Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Ecym_10091.6ON33633616890.0
SAKL0C00484g1.6ON33932014070.0
CAGL0B00352g1.6ON33733613790.0
KLLA0C00506g1.6ON33030913730.0
NCAS0B091001.6ON32731913710.0
NDAI0A001501.6ON31731713670.0
Kpol_2002.91.6ON33832113680.0
Kwal_33.130111.6ON33431113550.0
Smik_3.151.6ON31631213280.0
KLTH0F00506g1.6ON33233513290.0
YCL059C (KRR1)1.6ON31631213260.0
TPHA0E040001.6ON31631413260.0
AFR744W1.6ON34330913250.0
KNAG0C002301.6ON34931013240.0
Suva_3.1531.6ON31631213080.0
Skud_3.41.6ON31631613070.0
TDEL0C069601.6ON35031412831e-178
ZYRO0F18458g1.6ON31431312781e-178
TBLA0A049401.6ON31631412631e-176
KAFR0D001501.6ON34430712341e-171
SAKL0G03740g5.482ON2661561094e-05
ZYRO0D11440g5.482ON2691561084e-05
Suva_8.1975.482ON2741481085e-05
TDEL0A034605.482ON2721471085e-05
Kpol_543.135.482ON2681471076e-05
Ecym_45525.482ON2711461077e-05
Kwal_47.188645.482ON2711551067e-05
KLTH0G02574g5.482ON2711551068e-05
CAGL0K09460g5.482ON2611561059e-05
NCAS0A119605.482ON2701561041e-04
YOR145C (PNO1)5.482ON2741571032e-04
Skud_15.3105.482ON2761571032e-04
TPHA0J028205.482ON2681471023e-04
Smik_15.3265.482ON2741571013e-04
KAFR0E036005.482ON2761551013e-04
KLLA0C06446g5.482ON2741471014e-04
NDAI0A043105.482ON2741561005e-04
KNAG0C046105.482ON277168970.001
TBLA0D018905.482ON271147930.003
AAR002W1.420ON178172840.030
ZYRO0E04356g1.420ON186104701.7
TBLA0H018305.375ON40664712.1
KLTH0E14014g8.798ON48699703.1
AGL183C8.309ON50724703.6
KAFR0B030308.309ON46724693.7
KLLA0D02398g1.290ON120583686.6
KNAG0G023508.309ON49724677.5
SAKL0D08822g1.420ON18361649.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Ecym_1009
         (336 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Ecym_1009 Chr1 complement(16963..17973) [1011 bp, 336 aa] {ON} s...   655   0.0  
SAKL0C00484g Chr3 complement(45059..46078) [1020 bp, 339 aa] {ON...   546   0.0  
CAGL0B00352g Chr2 complement(22171..23184) [1014 bp, 337 aa] {ON...   535   0.0  
KLLA0C00506g Chr3 complement(38584..39576) [993 bp, 330 aa] {ON}...   533   0.0  
NCAS0B09100 Chr2 (1745144..1746127) [984 bp, 327 aa] {ON} Anc_1....   532   0.0  
NDAI0A00150 Chr1 complement(12040..12993) [954 bp, 317 aa] {ON} ...   531   0.0  
Kpol_2002.9 s2002 complement(17681..18697) [1017 bp, 338 aa] {ON...   531   0.0  
Kwal_33.13011 s33 complement(39946..40950) [1005 bp, 334 aa] {ON...   526   0.0  
Smik_3.15 Chr3 complement(23880..24830) [951 bp, 316 aa] {ON} YC...   516   0.0  
KLTH0F00506g Chr6 complement(40222..41220) [999 bp, 332 aa] {ON}...   516   0.0  
YCL059C Chr3 complement(22429..23379) [951 bp, 316 aa] {ON}  KRR...   515   0.0  
TPHA0E04000 Chr5 (838446..839396) [951 bp, 316 aa] {ON} Anc_1.6 ...   515   0.0  
AFR744W Chr6 (1801815..1802846) [1032 bp, 343 aa] {ON} Syntenic ...   514   0.0  
KNAG0C00230 Chr3 complement(36795..37844) [1050 bp, 349 aa] {ON}...   514   0.0  
Suva_3.153 Chr3 complement(232200..233150) [951 bp, 316 aa] {ON}...   508   0.0  
Skud_3.4 Chr3 complement(10422..11372) [951 bp, 316 aa] {ON} YCL...   508   0.0  
TDEL0C06960 Chr3 (1262869..1263921) [1053 bp, 350 aa] {ON} Anc_1...   498   e-178
ZYRO0F18458g Chr6 (1522841..1523785) [945 bp, 314 aa] {ON} highl...   496   e-178
TBLA0A04940 Chr1 complement(1218143..1219093) [951 bp, 316 aa] {...   491   e-176
KAFR0D00150 Chr4 complement(16573..17607) [1035 bp, 344 aa] {ON}...   479   e-171
SAKL0G03740g Chr7 complement(309922..310722) [801 bp, 266 aa] {O...    47   4e-05
ZYRO0D11440g Chr4 complement(964606..965415) [810 bp, 269 aa] {O...    46   4e-05
Suva_8.197 Chr8 complement(354586..355410) [825 bp, 274 aa] {ON}...    46   5e-05
TDEL0A03460 Chr1 complement(617779..618597) [819 bp, 272 aa] {ON...    46   5e-05
Kpol_543.13 s543 complement(30976..31782) [807 bp, 268 aa] {ON} ...    46   6e-05
Ecym_4552 Chr4 (1087732..1088547) [816 bp, 271 aa] {ON} similar ...    46   7e-05
Kwal_47.18864 s47 (1004428..1005243) [816 bp, 271 aa] {ON} YOR14...    45   7e-05
KLTH0G02574g Chr7 complement(201390..202205) [816 bp, 271 aa] {O...    45   8e-05
CAGL0K09460g Chr11 complement(935326..936111) [786 bp, 261 aa] {...    45   9e-05
NCAS0A11960 Chr1 complement(2371549..2372361) [813 bp, 270 aa] {...    45   1e-04
YOR145C Chr15 complement(605347..606171) [825 bp, 274 aa] {ON}  ...    44   2e-04
Skud_15.310 Chr15 complement(554002..554832) [831 bp, 276 aa] {O...    44   2e-04
TPHA0J02820 Chr10 complement(627383..628189) [807 bp, 268 aa] {O...    44   3e-04
Smik_15.326 Chr15 complement(561176..562000) [825 bp, 274 aa] {O...    44   3e-04
KAFR0E03600 Chr5 (724338..725168) [831 bp, 276 aa] {ON} Anc_5.48...    44   3e-04
KLLA0C06446g Chr3 complement(566371..567195) [825 bp, 274 aa] {O...    44   4e-04
NDAI0A04310 Chr1 (970952..971776) [825 bp, 274 aa] {ON} Anc_5.48...    43   5e-04
KNAG0C04610 Chr3 (905301..906134) [834 bp, 277 aa] {ON} Anc_5.48...    42   0.001
TBLA0D01890 Chr4 (461527..462342) [816 bp, 271 aa] {ON} Anc_5.48...    40   0.003
AAR002W Chr1 (341790..342326) [537 bp, 178 aa] {ON} Syntenic hom...    37   0.030
ZYRO0E04356g Chr5 complement(332059..332619) [561 bp, 186 aa] {O...    32   1.7  
TBLA0H01830 Chr8 complement(433992..435212) [1221 bp, 406 aa] {O...    32   2.1  
KLTH0E14014g Chr5 (1239444..1240904) [1461 bp, 486 aa] {ON} simi...    32   3.1  
AGL183C Chr7 complement(352996..354519) [1524 bp, 507 aa] {ON} S...    32   3.6  
KAFR0B03030 Chr2 (632585..633988) [1404 bp, 467 aa] {ON} Anc_8.3...    31   3.7  
KLLA0D02398g Chr4 complement(202446..206063) [3618 bp, 1205 aa] ...    31   6.6  
KNAG0G02350 Chr7 (542717..544210) [1494 bp, 497 aa] {ON} Anc_8.3...    30   7.5  
SAKL0D08822g Chr4 complement(734328..734879) [552 bp, 183 aa] {O...    29   9.6  

>Ecym_1009 Chr1 complement(16963..17973) [1011 bp, 336 aa] {ON}
           similar to Ashbya gossypii AFR744W
          Length = 336

 Score =  655 bits (1689), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 319/336 (94%), Positives = 319/336 (94%)

Query: 1   MVSTHNKDKPWDTPDIDKWKIEEFKPEDNASGLPFAEESSFMTLFPKYREAYLKSTWNDV 60
           MVSTHNKDKPWDTPDIDKWKIEEFKPEDNASGLPFAEESSFMTLFPKYREAYLKSTWNDV
Sbjct: 1   MVSTHNKDKPWDTPDIDKWKIEEFKPEDNASGLPFAEESSFMTLFPKYREAYLKSTWNDV 60

Query: 61  TRALDKHHLACELNLVEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPFPQAVKILEDD 120
           TRALDKHHLACELNLVEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPFPQAVKILEDD
Sbjct: 61  TRALDKHHLACELNLVEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPFPQAVKILEDD 120

Query: 121 VACDVIKIGNFSSNKDRFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPYKGL 180
           VACDVIKIGNFSSNKDRFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPYKGL
Sbjct: 121 VACDVIKIGNFSSNKDRFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPYKGL 180

Query: 181 KEVRRVVEDCMKNVHPIYHIKELMIKRELAKKPELADQDWSRFLPMFXXXXXXXXXXXXX 240
           KEVRRVVEDCMKNVHPIYHIKELMIKRELAKKPELADQDWSRFLPMF             
Sbjct: 181 KEVRRVVEDCMKNVHPIYHIKELMIKRELAKKPELADQDWSRFLPMFKKRNIARKKPKKI 240

Query: 241 XXXXVYTPFPPAQLPRKVDLEIETGEYFLSKNEKKMKKLEEHRNRQTEKQLEKAKERAED 300
               VYTPFPPAQLPRKVDLEIETGEYFLSKNEKKMKKLEEHRNRQTEKQLEKAKERAED
Sbjct: 241 KEKKVYTPFPPAQLPRKVDLEIETGEYFLSKNEKKMKKLEEHRNRQTEKQLEKAKERAED 300

Query: 301 YIAPDEKEYKNALNSQKRYGEDQPSEGPQKRKKSKH 336
           YIAPDEKEYKNALNSQKRYGEDQPSEGPQKRKKSKH
Sbjct: 301 YIAPDEKEYKNALNSQKRYGEDQPSEGPQKRKKSKH 336

>SAKL0C00484g Chr3 complement(45059..46078) [1020 bp, 339 aa] {ON}
           highly similar to uniprot|P25586 Saccharomyces
           cerevisiae YCL059C KRR1 Essential nucleolar protein
           required for the synthesis of 18S rRNA and for the
           assembly of 40S ribosomal subunit
          Length = 339

 Score =  546 bits (1407), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 264/320 (82%), Positives = 285/320 (89%), Gaps = 2/320 (0%)

Query: 1   MVSTHNKDKPWDTPDIDKWKIEEFKPEDNASGLPFAEESSFMTLFPKYREAYLKSTWNDV 60
           M STHNKDKPWDTP+IDKWKIEEFKPEDNASGLPFAEESSFMTLFPKYREAYLKS WNDV
Sbjct: 1   MPSTHNKDKPWDTPEIDKWKIEEFKPEDNASGLPFAEESSFMTLFPKYREAYLKSVWNDV 60

Query: 61  TRALDKHHLACELNLVEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPFPQAVKILEDD 120
           TRALDKHH+AC L+LVEGSM+VKTTRKTYDPAIILKARDLIKLLARSVPFPQAVKILEDD
Sbjct: 61  TRALDKHHIACTLDLVEGSMSVKTTRKTYDPAIILKARDLIKLLARSVPFPQAVKILEDD 120

Query: 121 VACDVIKIGNFSSNKDRFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPYKGL 180
           VACDVIKIGNF SNK+RFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGP+KGL
Sbjct: 121 VACDVIKIGNFVSNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPFKGL 180

Query: 181 KEVRRVVEDCMKNVHPIYHIKELMIKRELAKKPELADQDWSRFLPMFXXXXX--XXXXXX 238
           KEVRRVVEDCMKNVHPIYHIKELMIKRELAK+PELA++DWSRFLPMF             
Sbjct: 181 KEVRRVVEDCMKNVHPIYHIKELMIKRELAKRPELAEEDWSRFLPMFKKRNVARKKPKKA 240

Query: 239 XXXXXXVYTPFPPAQLPRKVDLEIETGEYFLSKNEKKMKKLEEHRNRQTEKQLEKAKERA 298
                 VYTPFPPAQLPRKVDLEIE+GEYFLSK EK++KKL+E R  Q EKQ +K +ERA
Sbjct: 241 KAKEKKVYTPFPPAQLPRKVDLEIESGEYFLSKKEKEVKKLQERRQEQAEKQAQKEEERA 300

Query: 299 EDYIAPDEKEYKNALNSQKR 318
           +DY+AP+E EYK+ L  + +
Sbjct: 301 KDYVAPEEAEYKSTLKKRSK 320

>CAGL0B00352g Chr2 complement(22171..23184) [1014 bp, 337 aa] {ON}
           highly similar to uniprot|P25586 Saccharomyces
           cerevisiae YCL059c KRR1
          Length = 337

 Score =  535 bits (1379), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 262/336 (77%), Positives = 288/336 (85%), Gaps = 3/336 (0%)

Query: 1   MVSTHNKDKPWDTPDIDKWKIEEFKPEDNASGLPFAEESSFMTLFPKYREAYLKSTWNDV 60
           MVST+NKDKPWDT DIDKWKIEEFKPEDN SG PFAEESSFMTLFPKYREAYLKS WNDV
Sbjct: 1   MVSTYNKDKPWDTEDIDKWKIEEFKPEDNKSGQPFAEESSFMTLFPKYREAYLKSIWNDV 60

Query: 61  TRALDKHHLACELNLVEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPFPQAVKILEDD 120
           TRALDKHH+ C L+LVEGSMTVKTTRKT+DPAIILKARDLIKLLARSVPFPQAVKIL+DD
Sbjct: 61  TRALDKHHIGCTLDLVEGSMTVKTTRKTFDPAIILKARDLIKLLARSVPFPQAVKILQDD 120

Query: 121 VACDVIKIGNFSSNKDRFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPYKGL 180
           +ACDVIKIGN  +NKDRFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPYKGL
Sbjct: 121 IACDVIKIGNTVANKDRFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPYKGL 180

Query: 181 KEVRRVVEDCMKNVHPIYHIKELMIKRELAKKPELADQDWSRFLPMFXXXXXXXXX-XXX 239
           KE+RRVV DCMKNVHPIYHIKELMIKRELAK+PELA++DWSRFLPMF             
Sbjct: 181 KEIRRVVLDCMKNVHPIYHIKELMIKRELAKRPELANEDWSRFLPMFKKRNVARKKPSKV 240

Query: 240 XXXXXVYTPFPPAQLPRKVDLEIETGEYFLSKNEKKMKKLEEHRNRQTEKQLEKAKERAE 299
                VYTPFPPAQLPRKVDL+IE+GEYFLSK EK++KKL E R +Q EKQ+ K +ER +
Sbjct: 241 KAEKKVYTPFPPAQLPRKVDLQIESGEYFLSKKEKEIKKLHEQREKQAEKQILKDEERRK 300

Query: 300 DYIAPDEKEYKNALNSQKR--YGEDQPSEGPQKRKK 333
           DYIAP E EYK++  S K+    ED+  +  +KRK+
Sbjct: 301 DYIAPKEDEYKSSHKSTKKRTSNEDKGDKDSKKRKR 336

>KLLA0C00506g Chr3 complement(38584..39576) [993 bp, 330 aa] {ON}
           highly similar to uniprot|P25586 Saccharomyces
           cerevisiae YCL059C KRR1 Essential nucleolar protein
           required for the synthesis of 18S rRNA and for the
           assembly of 40S ribosomal subunit
          Length = 330

 Score =  533 bits (1373), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 256/309 (82%), Positives = 272/309 (88%)

Query: 1   MVSTHNKDKPWDTPDIDKWKIEEFKPEDNASGLPFAEESSFMTLFPKYREAYLKSTWNDV 60
           MVSTHNKDKPWDT ++DKW IEEFKPEDN SGLPFAEESSFMTLFPKYREAYLKS W DV
Sbjct: 1   MVSTHNKDKPWDTDEVDKWNIEEFKPEDNKSGLPFAEESSFMTLFPKYREAYLKSVWKDV 60

Query: 61  TRALDKHHLACELNLVEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPFPQAVKILEDD 120
           TR+LD HH+ACELNLVEGSMTVKTTRKTYDPA+ILKARDLIKLLARSVPFPQAVKILEDD
Sbjct: 61  TRSLDAHHIACELNLVEGSMTVKTTRKTYDPAVILKARDLIKLLARSVPFPQAVKILEDD 120

Query: 121 VACDVIKIGNFSSNKDRFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPYKGL 180
           VACDVIKIGNF SNK+RFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVS MGPYKGL
Sbjct: 121 VACDVIKIGNFVSNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSVMGPYKGL 180

Query: 181 KEVRRVVEDCMKNVHPIYHIKELMIKRELAKKPELADQDWSRFLPMFXXXXXXXXXXXXX 240
           KEVRRVVEDCMKNVHPIYHIKELMIKRELAKKPELA++DWSRFLPMF             
Sbjct: 181 KEVRRVVEDCMKNVHPIYHIKELMIKRELAKKPELAEEDWSRFLPMFKKRNVARKKPKKI 240

Query: 241 XXXXVYTPFPPAQLPRKVDLEIETGEYFLSKNEKKMKKLEEHRNRQTEKQLEKAKERAED 300
               +YTPFPPAQLPRKVDLEIE+GEYFLSK EK++KKL E R +Q  K  EK  ERA+D
Sbjct: 241 KEKKIYTPFPPAQLPRKVDLEIESGEYFLSKREKEVKKLHERREQQAAKHAEKESERAKD 300

Query: 301 YIAPDEKEY 309
           +IAP E +Y
Sbjct: 301 FIAPKETDY 309

>NCAS0B09100 Chr2 (1745144..1746127) [984 bp, 327 aa] {ON} Anc_1.6
           YCL059C
          Length = 327

 Score =  532 bits (1371), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 255/319 (79%), Positives = 281/319 (88%), Gaps = 1/319 (0%)

Query: 1   MVSTHNKDKPWDTPDIDKWKIEEFKPEDNASGLPFAEESSFMTLFPKYREAYLKSTWNDV 60
           MVSTHN+DKPWDTPD+DKW IEEFKPEDNASGLPFAEESSFMTLFPKYRE YLKS WNDV
Sbjct: 1   MVSTHNRDKPWDTPDVDKWHIEEFKPEDNASGLPFAEESSFMTLFPKYRETYLKSVWNDV 60

Query: 61  TRALDKHHLACELNLVEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPFPQAVKILEDD 120
           TRAL+KH+L C L+LVEGSMTVKTTRKT+DPAIILKARDLIKLLARSVPFPQAVKIL+DD
Sbjct: 61  TRALNKHNLGCVLDLVEGSMTVKTTRKTFDPAIILKARDLIKLLARSVPFPQAVKILQDD 120

Query: 121 VACDVIKIGNFSSNKDRFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPYKGL 180
           +ACDVIKIGNF +NK+RFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVS MGP++GL
Sbjct: 121 MACDVIKIGNFVTNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSVMGPFQGL 180

Query: 181 KEVRRVVEDCMKNVHPIYHIKELMIKRELAKKPELADQDWSRFLPMFXXXXXXX-XXXXX 239
           KEVRRVVEDCMKNVHPIYHIKELMIKRELAKKPELA++DWSRFLPMF             
Sbjct: 181 KEVRRVVEDCMKNVHPIYHIKELMIKRELAKKPELANEDWSRFLPMFKKRNVARKKPKKV 240

Query: 240 XXXXXVYTPFPPAQLPRKVDLEIETGEYFLSKNEKKMKKLEEHRNRQTEKQLEKAKERAE 299
                +YTPFPPAQLPRKVDLEIE+GEYFLSK EK+MKKL E R +Q EKQ EK  ER +
Sbjct: 241 RKEKKIYTPFPPAQLPRKVDLEIESGEYFLSKREKEMKKLHERREQQAEKQAEKEVERNK 300

Query: 300 DYIAPDEKEYKNALNSQKR 318
           +YIAP+E+ YK++L  + +
Sbjct: 301 NYIAPEEETYKSSLKKEHK 319

>NDAI0A00150 Chr1 complement(12040..12993) [954 bp, 317 aa] {ON}
           Anc_1.6 YCL059C
          Length = 317

 Score =  531 bits (1367), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 256/317 (80%), Positives = 279/317 (88%), Gaps = 1/317 (0%)

Query: 1   MVSTHNKDKPWDTPDIDKWKIEEFKPEDNASGLPFAEESSFMTLFPKYREAYLKSTWNDV 60
           MVSTHN+DKPWDT +I+KWKIEEFKPEDNASGLPFAEESSFMTLFPKYRE YLKS WNDV
Sbjct: 1   MVSTHNRDKPWDTEEINKWKIEEFKPEDNASGLPFAEESSFMTLFPKYRETYLKSVWNDV 60

Query: 61  TRALDKHHLACELNLVEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPFPQAVKILEDD 120
           TRAL+ H+LAC L+LVEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPFPQAVKILEDD
Sbjct: 61  TRALNTHNLACVLDLVEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPFPQAVKILEDD 120

Query: 121 VACDVIKIGNFSSNKDRFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPYKGL 180
           +ACDVIKIGNF +NK+RFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVS MGP+KGL
Sbjct: 121 MACDVIKIGNFVTNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSVMGPFKGL 180

Query: 181 KEVRRVVEDCMKNVHPIYHIKELMIKRELAKKPELADQDWSRFLPMFXXXXXXX-XXXXX 239
           KEVRRVVEDCMKN+HPIYHIKELMIKRELAKKPELA++DWSRFLPMF             
Sbjct: 181 KEVRRVVEDCMKNIHPIYHIKELMIKRELAKKPELANEDWSRFLPMFKKRNVARKKPKKV 240

Query: 240 XXXXXVYTPFPPAQLPRKVDLEIETGEYFLSKNEKKMKKLEEHRNRQTEKQLEKAKERAE 299
                +YTPFPPAQLPRKVDLEIE+GEYFLSK EK+MKKL E R +Q EKQ+EK  ER +
Sbjct: 241 KKEKKIYTPFPPAQLPRKVDLEIESGEYFLSKREKEMKKLNERREQQAEKQVEKETERNK 300

Query: 300 DYIAPDEKEYKNALNSQ 316
           DY+AP E  YK++  S+
Sbjct: 301 DYVAPSEPTYKSSNKSK 317

>Kpol_2002.9 s2002 complement(17681..18697) [1017 bp, 338 aa] {ON}
           complement(17681..18697) [1017 nt, 339 aa]
          Length = 338

 Score =  531 bits (1368), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 255/321 (79%), Positives = 284/321 (88%), Gaps = 3/321 (0%)

Query: 1   MVSTHNKDKPWDTPDIDKWKIEEFKPEDNASGLPFAEESSFMTLFPKYREAYLKSTWNDV 60
           MVSTHNKDKPWDT DIDKWK+EEFKPEDNASGLPFAEESSFMTLFPKYRE YLKS WNDV
Sbjct: 1   MVSTHNKDKPWDTEDIDKWKVEEFKPEDNASGLPFAEESSFMTLFPKYREIYLKSVWNDV 60

Query: 61  TRALDKHHLACELNLVEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPFPQAVKILEDD 120
           T+ALDK H+AC L+LVEGSMTVKTTRKT+DP  ILKARDLIKLLARSVPFPQA+KILEDD
Sbjct: 61  TKALDKRHIACTLDLVEGSMTVKTTRKTFDPYAILKARDLIKLLARSVPFPQAIKILEDD 120

Query: 121 VACDVIKIGNFSSNKDRFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPYKGL 180
           +ACDVIKIGNF +NK+RFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVS MGP+KGL
Sbjct: 121 MACDVIKIGNFVTNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSCMGPFKGL 180

Query: 181 KEVRRVVEDCMKNVHPIYHIKELMIKRELAKKPELADQDWSRFLPMFXXX-XXXXXXXXX 239
           KE+RRVVEDCMKNVHPIYHIKELMIKRELAK+PELAD+DWSRFLPMF             
Sbjct: 181 KEIRRVVEDCMKNVHPIYHIKELMIKRELAKRPELADEDWSRFLPMFKKRNVARKKAAKP 240

Query: 240 XXXXXVYTPFPPAQLPRKVDLEIETGEYFLSKNEKKMKKLEEHRNRQTEKQLEKAKERAE 299
                VYTPFPPAQ PRKVDLEIE+GEYFLSK EK++K+L+E R  Q++KQ+EK KER++
Sbjct: 241 KKEKKVYTPFPPAQQPRKVDLEIESGEYFLSKKEKEVKRLQERREEQSQKQIEKEKERSK 300

Query: 300 DYIAPDEKEYKNAL--NSQKR 318
           DY+AP E+EYK+ +  +S+KR
Sbjct: 301 DYVAPMEEEYKSTITKSSKKR 321

>Kwal_33.13011 s33 complement(39946..40950) [1005 bp, 334 aa] {ON}
           YCL059C (KRR1) - involved in cell division and spore
           germination [contig 123] FULL
          Length = 334

 Score =  526 bits (1355), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 252/311 (81%), Positives = 274/311 (88%), Gaps = 2/311 (0%)

Query: 1   MVSTHNKDKPWDTPDIDKWKIEEFKPEDNASGLPFAEESSFMTLFPKYREAYLKSTWNDV 60
           M STHNKDKPWDTPDIDKWKIEEFKPEDN SGLPF+EESSFMTLFPKYRE YLKS W DV
Sbjct: 1   MPSTHNKDKPWDTPDIDKWKIEEFKPEDNTSGLPFSEESSFMTLFPKYREVYLKSVWKDV 60

Query: 61  TRALDKHHLACELNLVEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPFPQAVKILEDD 120
           TRAL+KH ++C L+LVEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPFPQAVKIL+DD
Sbjct: 61  TRALEKHSISCVLDLVEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPFPQAVKILQDD 120

Query: 121 VACDVIKIGNFSSNKDRFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPYKGL 180
           +ACDVIKIGNF SNK+RFVKRRQRLVGPNGNTLKALELL+KCYILVQGNTVSAMGP+KGL
Sbjct: 121 MACDVIKIGNFVSNKERFVKRRQRLVGPNGNTLKALELLSKCYILVQGNTVSAMGPFKGL 180

Query: 181 KEVRRVVEDCMKNVHPIYHIKELMIKRELAKKPELADQDWSRFLPMFXXXXXXXX--XXX 238
           KEVRRVVEDCMKNVHPIYHIKELMIKRELAK+P+LA++DWSRFLPMF             
Sbjct: 181 KEVRRVVEDCMKNVHPIYHIKELMIKRELAKRPDLAEEDWSRFLPMFKKRNVARKKPKNI 240

Query: 239 XXXXXXVYTPFPPAQLPRKVDLEIETGEYFLSKNEKKMKKLEEHRNRQTEKQLEKAKERA 298
                 VYTPFPP Q PRKVDL+IE+GEYFLSK EK+ KKL+E +  Q EKQ+EK KERA
Sbjct: 241 KSKEAKVYTPFPPVQQPRKVDLQIESGEYFLSKKEKEAKKLDERKKEQAEKQIEKDKERA 300

Query: 299 EDYIAPDEKEY 309
           +DY+AP EKEY
Sbjct: 301 KDYVAPSEKEY 311

>Smik_3.15 Chr3 complement(23880..24830) [951 bp, 316 aa] {ON}
           YCL059C (REAL)
          Length = 316

 Score =  516 bits (1328), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 253/312 (81%), Positives = 280/312 (89%), Gaps = 2/312 (0%)

Query: 1   MVSTHNKDKPWDTPDIDKWKIEEFKPEDNASGLPFAEESSFMTLFPKYREAYLKSTWNDV 60
           MVSTHN+DKPWDT DIDKWKIEEFK EDNASG PFAEESSFMTLFPKYRE+YLK+ WNDV
Sbjct: 1   MVSTHNRDKPWDTDDIDKWKIEEFKEEDNASGQPFAEESSFMTLFPKYRESYLKTIWNDV 60

Query: 61  TRALDKHHLACELNLVEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPFPQAVKILEDD 120
           TRALDKH++AC L+LVEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPFPQAVKIL+DD
Sbjct: 61  TRALDKHNIACVLDLVEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPFPQAVKILQDD 120

Query: 121 VACDVIKIGNFSSNKDRFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPYKGL 180
           +ACDVIKIGNF +NK+RFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGP+KGL
Sbjct: 121 MACDVIKIGNFVTNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPFKGL 180

Query: 181 KEVRRVVEDCMKNVHPIYHIKELMIKRELAKKPELADQDWSRFLPMFXXXXXXXX--XXX 238
           KEVRRVVEDCMKNVHPIYHIKELMIKRELAK+PELA++DWSRFLPMF             
Sbjct: 181 KEVRRVVEDCMKNVHPIYHIKELMIKRELAKRPELANEDWSRFLPMFKKRNVARKKPKKI 240

Query: 239 XXXXXXVYTPFPPAQLPRKVDLEIETGEYFLSKNEKKMKKLEEHRNRQTEKQLEKAKERA 298
                 VYTPFPPAQLPRKVDLEIE+GEYFLSK EK+MKKL E + +Q E+++E+ +ERA
Sbjct: 241 RNIEKKVYTPFPPAQLPRKVDLEIESGEYFLSKREKQMKKLSEQKEKQMEREIERQEERA 300

Query: 299 EDYIAPDEKEYK 310
           +D+IAP+E+ YK
Sbjct: 301 KDFIAPEEETYK 312

>KLTH0F00506g Chr6 complement(40222..41220) [999 bp, 332 aa] {ON}
           highly similar to uniprot|P25586 Saccharomyces
           cerevisiae YCL059C KRR1 Essential nucleolar protein
           required for the synthesis of 18S rRNA and for the
           assembly of 40S ribosomal subunit
          Length = 332

 Score =  516 bits (1329), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 262/335 (78%), Positives = 290/335 (86%), Gaps = 6/335 (1%)

Query: 1   MVSTHNKDKPWDTPDIDKWKIEEFKPEDNASGLPFAEESSFMTLFPKYREAYLKSTWNDV 60
           M STHNKDKPWDTPDIDKWKIEEFKPEDN SG+PFAEESSFMTLFPKYREAYLKS WNDV
Sbjct: 1   MPSTHNKDKPWDTPDIDKWKIEEFKPEDNVSGMPFAEESSFMTLFPKYREAYLKSVWNDV 60

Query: 61  TRALDKHHLACELNLVEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPFPQAVKILEDD 120
           TRALDKH++AC L+LVEGSMTVKTTR+TYDPAIILKARDLIKLLARSVPFPQAVKIL+DD
Sbjct: 61  TRALDKHNIACVLDLVEGSMTVKTTRRTYDPAIILKARDLIKLLARSVPFPQAVKILQDD 120

Query: 121 VACDVIKIGNFSSNKDRFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPYKGL 180
            ACDVIKIGNF SNK+RFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGP+KGL
Sbjct: 121 TACDVIKIGNFVSNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPFKGL 180

Query: 181 KEVRRVVEDCMKNVHPIYHIKELMIKRELAKKPELADQDWSRFLPMFXXXXXXXX--XXX 238
           KEVRRVVEDCM+N+HPIYHIKELMIKRELAK+P+LA++DWSRFLPMF             
Sbjct: 181 KEVRRVVEDCMRNIHPIYHIKELMIKRELAKRPDLAEEDWSRFLPMFKKRNVARKKPKNI 240

Query: 239 XXXXXXVYTPFPPAQLPRKVDLEIETGEYFLSKNEKKMKKLEEHRNRQTEKQLEKAKERA 298
                 VYTPFPPAQ PRK+DL+IE+GEYFL+K EK+ KKLEE +  Q EKQ+EK KERA
Sbjct: 241 KPKENKVYTPFPPAQQPRKIDLQIESGEYFLTKKEKEAKKLEERKREQAEKQVEKNKERA 300

Query: 299 EDYIAPDEKEYKNALNSQKRYGEDQPSEGPQKRKK 333
           +DY+AP EK Y+ +  S+KR  E Q  E P+K+ K
Sbjct: 301 KDYVAPIEKGYEGS--SKKRRHEVQ--ESPKKKTK 331

>YCL059C Chr3 complement(22429..23379) [951 bp, 316 aa] {ON}
           KRR1Essential nucleolar protein required for the
           synthesis of 18S rRNA and for the assembly of 40S
           ribosomal subunit
          Length = 316

 Score =  515 bits (1326), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 252/312 (80%), Positives = 280/312 (89%), Gaps = 2/312 (0%)

Query: 1   MVSTHNKDKPWDTPDIDKWKIEEFKPEDNASGLPFAEESSFMTLFPKYREAYLKSTWNDV 60
           MVSTHN+DKPWDT DIDKWKIEEFK EDNASG PFAEESSFMTLFPKYRE+YLK+ WNDV
Sbjct: 1   MVSTHNRDKPWDTDDIDKWKIEEFKEEDNASGQPFAEESSFMTLFPKYRESYLKTIWNDV 60

Query: 61  TRALDKHHLACELNLVEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPFPQAVKILEDD 120
           TRALDKH++AC L+LVEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPFPQAVKIL+DD
Sbjct: 61  TRALDKHNIACVLDLVEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPFPQAVKILQDD 120

Query: 121 VACDVIKIGNFSSNKDRFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPYKGL 180
           +ACDVIKIGNF +NK+RFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGP+KGL
Sbjct: 121 MACDVIKIGNFVTNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPFKGL 180

Query: 181 KEVRRVVEDCMKNVHPIYHIKELMIKRELAKKPELADQDWSRFLPMFXXXXXXXX--XXX 238
           KEVRRVVEDCMKN+HPIYHIKELMIKRELAK+PELA++DWSRFLPMF             
Sbjct: 181 KEVRRVVEDCMKNIHPIYHIKELMIKRELAKRPELANEDWSRFLPMFKKRNVARKKPKKI 240

Query: 239 XXXXXXVYTPFPPAQLPRKVDLEIETGEYFLSKNEKKMKKLEEHRNRQTEKQLEKAKERA 298
                 VYTPFPPAQLPRKVDLEIE+GEYFLSK EK+MKKL E + +Q E+++E+ +ERA
Sbjct: 241 RNVEKKVYTPFPPAQLPRKVDLEIESGEYFLSKREKQMKKLNEQKEKQMEREIERQEERA 300

Query: 299 EDYIAPDEKEYK 310
           +D+IAP+E+ YK
Sbjct: 301 KDFIAPEEEAYK 312

>TPHA0E04000 Chr5 (838446..839396) [951 bp, 316 aa] {ON} Anc_1.6
           YCL059C
          Length = 316

 Score =  515 bits (1326), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 245/314 (78%), Positives = 277/314 (88%), Gaps = 1/314 (0%)

Query: 1   MVSTHNKDKPWDTPDIDKWKIEEFKPEDNASGLPFAEESSFMTLFPKYREAYLKSTWNDV 60
           MVSTHNK+KPWDT DIDKWK+E+FKPEDNASG+PF+EESSFMTLFPKYRE YLKS W DV
Sbjct: 1   MVSTHNKEKPWDTEDIDKWKLEDFKPEDNASGMPFSEESSFMTLFPKYREVYLKSVWKDV 60

Query: 61  TRALDKHHLACELNLVEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPFPQAVKILEDD 120
           T+ALDKHH+AC LNLV+GSMTV TTRKTYDP IILKARDLIKLLARSVPFPQAVKIL+DD
Sbjct: 61  TKALDKHHVACTLNLVDGSMTVSTTRKTYDPYIILKARDLIKLLARSVPFPQAVKILDDD 120

Query: 121 VACDVIKIGNFSSNKDRFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPYKGL 180
           +ACDVIKIGNF +NK+RFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVS MGP+KGL
Sbjct: 121 MACDVIKIGNFVTNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSVMGPFKGL 180

Query: 181 KEVRRVVEDCMKNVHPIYHIKELMIKRELAKKPELADQDWSRFLPMFXXXXXXX-XXXXX 239
           KE+RRVVED M+NVHPIYHIKELMIKRELAKKPELA++DWSRFLPMF             
Sbjct: 181 KEIRRVVEDAMRNVHPIYHIKELMIKRELAKKPELANEDWSRFLPMFKKRNVARKKSKKP 240

Query: 240 XXXXXVYTPFPPAQLPRKVDLEIETGEYFLSKNEKKMKKLEEHRNRQTEKQLEKAKERAE 299
                VYTPFPP+QLPRKVDLEIE+GEYFLSK EK++K+L E R++Q EKQ EK  ER++
Sbjct: 241 KREKKVYTPFPPSQLPRKVDLEIESGEYFLSKKEKEVKRLHERRDQQAEKQAEKDIERSK 300

Query: 300 DYIAPDEKEYKNAL 313
           +YIAP E++Y +++
Sbjct: 301 NYIAPKEEKYVSSI 314

>AFR744W Chr6 (1801815..1802846) [1032 bp, 343 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YCL059C (KRR1)
          Length = 343

 Score =  514 bits (1325), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 253/309 (81%), Positives = 273/309 (88%)

Query: 1   MVSTHNKDKPWDTPDIDKWKIEEFKPEDNASGLPFAEESSFMTLFPKYREAYLKSTWNDV 60
           MVST NKDKPWDTPD+DKW IEEF PED+ASGLPFAEESSFMTLFPKYRE YLKS W +V
Sbjct: 1   MVSTPNKDKPWDTPDVDKWAIEEFNPEDSASGLPFAEESSFMTLFPKYRETYLKSIWKEV 60

Query: 61  TRALDKHHLACELNLVEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPFPQAVKILEDD 120
           TRAL+KHH+ACELNLVEGSM+VKTTRKTYDPAIILKARDLIKLLARSVP PQA+KIL+DD
Sbjct: 61  TRALEKHHIACELNLVEGSMSVKTTRKTYDPAIILKARDLIKLLARSVPLPQAIKILQDD 120

Query: 121 VACDVIKIGNFSSNKDRFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPYKGL 180
           +ACDVIKIGN  ++K+RFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPYKGL
Sbjct: 121 IACDVIKIGNIVASKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPYKGL 180

Query: 181 KEVRRVVEDCMKNVHPIYHIKELMIKRELAKKPELADQDWSRFLPMFXXXXXXXXXXXXX 240
           KEVRRVVEDCM+N+HPIYHIKELMIKRELAK+PELA++DWSRFLPMF             
Sbjct: 181 KEVRRVVEDCMRNIHPIYHIKELMIKRELAKRPELAEEDWSRFLPMFKKRNVARKKPKKI 240

Query: 241 XXXXVYTPFPPAQLPRKVDLEIETGEYFLSKNEKKMKKLEEHRNRQTEKQLEKAKERAED 300
               VYTPFPPAQLPRKVDLEIETGEYFLSK EK+ KKLE  R +Q EKQ EK KERA+D
Sbjct: 241 KEKKVYTPFPPAQLPRKVDLEIETGEYFLSKKEKEAKKLEARRAQQAEKQSEKEKERAKD 300

Query: 301 YIAPDEKEY 309
           YIAP E EY
Sbjct: 301 YIAPAEPEY 309

>KNAG0C00230 Chr3 complement(36795..37844) [1050 bp, 349 aa] {ON}
           Anc_1.6 YCL059C
          Length = 349

 Score =  514 bits (1324), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 250/310 (80%), Positives = 267/310 (86%), Gaps = 1/310 (0%)

Query: 1   MVSTHNKDKPWDTPDIDKWKIEEFKPEDNASGLPFAEESSFMTLFPKYREAYLKSTWNDV 60
           MVSTHNKDKPWDT DIDKW IEEFKPEDNASG PFAEESSFMTLFPKYRE YLKS W DV
Sbjct: 1   MVSTHNKDKPWDTDDIDKWHIEEFKPEDNASGQPFAEESSFMTLFPKYRETYLKSVWKDV 60

Query: 61  TRALDKHHLACELNLVEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPFPQAVKILEDD 120
           T+ALD HH+AC L+LVEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPFPQAVKIL++D
Sbjct: 61  TKALDSHHIACTLDLVEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPFPQAVKILQED 120

Query: 121 VACDVIKIGNFSSNKDRFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPYKGL 180
            ACDVIKIGN  +NK+RFVKRRQRLVGP+GNTLKALELLTKCYILVQGNTVSAMGPYKGL
Sbjct: 121 TACDVIKIGNIVTNKERFVKRRQRLVGPDGNTLKALELLTKCYILVQGNTVSAMGPYKGL 180

Query: 181 KEVRRVVEDCMKNVHPIYHIKELMIKRELAKKPELADQDWSRFLPMFXXXXXXX-XXXXX 239
           KE+RRVVEDCM NVHPIYHIKELMIKRELAKKPELA++DWSRFLPMF             
Sbjct: 181 KELRRVVEDCMHNVHPIYHIKELMIKRELAKKPELANEDWSRFLPMFKKRNVARKKPKKI 240

Query: 240 XXXXXVYTPFPPAQLPRKVDLEIETGEYFLSKNEKKMKKLEEHRNRQTEKQLEKAKERAE 299
                VYTPFPPAQLPRKVDLEIE+GEYFL+K EK+ KKLEE +  Q EKQ  K +ER +
Sbjct: 241 KKEKKVYTPFPPAQLPRKVDLEIESGEYFLNKKEKQFKKLEERKEIQAEKQRVKDEERRK 300

Query: 300 DYIAPDEKEY 309
           DY AP EK Y
Sbjct: 301 DYTAPKEKAY 310

>Suva_3.153 Chr3 complement(232200..233150) [951 bp, 316 aa] {ON}
           YCL059C (REAL)
          Length = 316

 Score =  508 bits (1308), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 248/312 (79%), Positives = 277/312 (88%), Gaps = 2/312 (0%)

Query: 1   MVSTHNKDKPWDTPDIDKWKIEEFKPEDNASGLPFAEESSFMTLFPKYREAYLKSTWNDV 60
           MVSTHN+DKPWDT D+DKW IEEFK EDNASG PFAEESSFMTLFPKYRE YLK+ WNDV
Sbjct: 1   MVSTHNRDKPWDTDDVDKWTIEEFKEEDNASGQPFAEESSFMTLFPKYRENYLKTIWNDV 60

Query: 61  TRALDKHHLACELNLVEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPFPQAVKILEDD 120
           TRALDKH+++C L+LVEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPFPQAVKIL+DD
Sbjct: 61  TRALDKHNISCVLDLVEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPFPQAVKILQDD 120

Query: 121 VACDVIKIGNFSSNKDRFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPYKGL 180
           +ACDVIKIGNF +NK+RFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGP+KGL
Sbjct: 121 MACDVIKIGNFVTNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPFKGL 180

Query: 181 KEVRRVVEDCMKNVHPIYHIKELMIKRELAKKPELADQDWSRFLPMFXXXXXXXX--XXX 238
           KEVRRVVEDCMKNVHPIYHIKELMIKRELAK+PELA++DWSRFLPMF             
Sbjct: 181 KEVRRVVEDCMKNVHPIYHIKELMIKRELAKRPELANEDWSRFLPMFKKRNVARKKPKKI 240

Query: 239 XXXXXXVYTPFPPAQLPRKVDLEIETGEYFLSKNEKKMKKLEEHRNRQTEKQLEKAKERA 298
                 VYTPFPPAQLPRKVDLEIE+GEYFLSK EK+MKKL E + +Q E+++E+ +ERA
Sbjct: 241 RNIEKKVYTPFPPAQLPRKVDLEIESGEYFLSKREKQMKKLNEQKEKQMEREVERQEERA 300

Query: 299 EDYIAPDEKEYK 310
           ++++AP E+ YK
Sbjct: 301 KNFVAPQEEAYK 312

>Skud_3.4 Chr3 complement(10422..11372) [951 bp, 316 aa] {ON}
           YCL059C (REAL)
          Length = 316

 Score =  508 bits (1307), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 249/316 (78%), Positives = 279/316 (88%), Gaps = 2/316 (0%)

Query: 1   MVSTHNKDKPWDTPDIDKWKIEEFKPEDNASGLPFAEESSFMTLFPKYREAYLKSTWNDV 60
           MVSTHN++KPWDT DIDKWKIEEFK EDN SG PFAEESSFMTLFPKYRE YLK+ WNDV
Sbjct: 1   MVSTHNREKPWDTDDIDKWKIEEFKEEDNGSGQPFAEESSFMTLFPKYREGYLKTIWNDV 60

Query: 61  TRALDKHHLACELNLVEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPFPQAVKILEDD 120
           TRALDKH++AC L+LVEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPFPQAVKIL+DD
Sbjct: 61  TRALDKHNIACVLDLVEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPFPQAVKILQDD 120

Query: 121 VACDVIKIGNFSSNKDRFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPYKGL 180
           +ACDVIKIGNF +NK+RFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGP+KGL
Sbjct: 121 MACDVIKIGNFVTNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPFKGL 180

Query: 181 KEVRRVVEDCMKNVHPIYHIKELMIKRELAKKPELADQDWSRFLPMFXXXXXXXX--XXX 238
           KEVRRVVEDCMKN+HPIYHIKELMIKRELAK+PELA++DWSRFLPMF             
Sbjct: 181 KEVRRVVEDCMKNIHPIYHIKELMIKRELAKRPELANEDWSRFLPMFKKRNVARKKPKKI 240

Query: 239 XXXXXXVYTPFPPAQLPRKVDLEIETGEYFLSKNEKKMKKLEEHRNRQTEKQLEKAKERA 298
                 VYTPFPPAQLPRKVDLEIE+GEYFLSK +K++KKL E + +Q E++LE+ +ERA
Sbjct: 241 RNVEKKVYTPFPPAQLPRKVDLEIESGEYFLSKRDKQVKKLNEQKEKQMERELERQEERA 300

Query: 299 EDYIAPDEKEYKNALN 314
           +D+ AP+E+ YK + N
Sbjct: 301 KDFTAPEEESYKPSKN 316

>TDEL0C06960 Chr3 (1262869..1263921) [1053 bp, 350 aa] {ON} Anc_1.6
           YCL059C
          Length = 350

 Score =  498 bits (1283), Expect = e-178,   Method: Compositional matrix adjust.
 Identities = 246/314 (78%), Positives = 273/314 (86%), Gaps = 1/314 (0%)

Query: 1   MVSTHNKDKPWDTPDIDKWKIEEFKPEDNASGLPFAEESSFMTLFPKYREAYLKSTWNDV 60
           MVSTHN+DKPWDT DIDKW++EEFKPEDNASGLPFAEESSFMTLFPKYRE YLKS WNDV
Sbjct: 1   MVSTHNRDKPWDTEDIDKWQVEEFKPEDNASGLPFAEESSFMTLFPKYREPYLKSIWNDV 60

Query: 61  TRALDKHHLACELNLVEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPFPQAVKILEDD 120
           TRAL+ HH+AC L+L+EGSMTVKTTRKT+DPAIIL+ARDLIKLLARSVPF QAVKILE+D
Sbjct: 61  TRALNAHHIACVLDLMEGSMTVKTTRKTFDPAIILRARDLIKLLARSVPFAQAVKILEED 120

Query: 121 VACDVIKIGNFSSNKDRFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPYKGL 180
           VACDVIKIGN  +NK+RFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVS MGPYKGL
Sbjct: 121 VACDVIKIGNVVANKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSVMGPYKGL 180

Query: 181 KEVRRVVEDCMKNVHPIYHIKELMIKRELAKKPELADQDWSRFLPMFXXXXXXXXX-XXX 239
           KEVRRVVED M+NVHPIY IKELMIKRELAK+PELA++DWSRFLPMF             
Sbjct: 181 KEVRRVVEDTMRNVHPIYQIKELMIKRELAKRPELAEEDWSRFLPMFKKRNVARKKPKKI 240

Query: 240 XXXXXVYTPFPPAQLPRKVDLEIETGEYFLSKNEKKMKKLEEHRNRQTEKQLEKAKERAE 299
                VYTPFPPAQ PRK+DLEIE+GEYFLSK EK++ KL+E R +Q EKQ EK + R++
Sbjct: 241 RAEKKVYTPFPPAQQPRKIDLEIESGEYFLSKKEKEINKLKERREKQAEKQEEKEEARSK 300

Query: 300 DYIAPDEKEYKNAL 313
           DYIAP E  YK++L
Sbjct: 301 DYIAPKEDVYKSSL 314

>ZYRO0F18458g Chr6 (1522841..1523785) [945 bp, 314 aa] {ON} highly
           similar to uniprot|P25586 Saccharomyces cerevisiae
           YCL059C KRR1 Essential nucleolar protein required for
           the synthesis of 18S rRNA and for the assembly of 40S
           ribosomal subunit
          Length = 314

 Score =  496 bits (1278), Expect = e-178,   Method: Compositional matrix adjust.
 Identities = 243/313 (77%), Positives = 269/313 (85%), Gaps = 1/313 (0%)

Query: 1   MVSTHNKDKPWDTPDIDKWKIEEFKPEDNASGLPFAEESSFMTLFPKYREAYLKSTWNDV 60
           MVSTHNKDKPWDT +IDKW  +EFK EDNASGLPFAEESSFMTLFPKYREAYLKS WNDV
Sbjct: 1   MVSTHNKDKPWDTGEIDKWHQDEFKEEDNASGLPFAEESSFMTLFPKYREAYLKSIWNDV 60

Query: 61  TRALDKHHLACELNLVEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPFPQAVKILEDD 120
           T+AL+K+H+AC L+LVEGSMTVKTTRKT DPAIILKARDLIKLLARSVPFPQAVKILED+
Sbjct: 61  TKALNKYHVACVLDLVEGSMTVKTTRKTCDPAIILKARDLIKLLARSVPFPQAVKILEDN 120

Query: 121 VACDVIKIGNFSSNKDRFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPYKGL 180
            ACDVIKIGN  +NK+RF KRRQRLVGPNGNTLKALELLTKCYILVQGNTV+AMG YKGL
Sbjct: 121 TACDVIKIGNTVANKERFQKRRQRLVGPNGNTLKALELLTKCYILVQGNTVAAMGNYKGL 180

Query: 181 KEVRRVVEDCMKNVHPIYHIKELMIKRELAKKPELADQDWSRFLPMFXXXXXXXXX-XXX 239
           KEVRRVVED MKN+HPIYHIKELMIKRELAK+PELA++DWSRFLP F             
Sbjct: 181 KEVRRVVEDTMKNIHPIYHIKELMIKRELAKRPELANEDWSRFLPNFKKRNVARKKPMKI 240

Query: 240 XXXXXVYTPFPPAQLPRKVDLEIETGEYFLSKNEKKMKKLEEHRNRQTEKQLEKAKERAE 299
                VYTPFPPAQ PRKVDLEIE+GEYFL+K EK+ KKLEE R +Q EKQ E+ KER +
Sbjct: 241 RKEKKVYTPFPPAQTPRKVDLEIESGEYFLNKREKEAKKLEERREKQAEKQEERQKERRK 300

Query: 300 DYIAPDEKEYKNA 312
           D++ P E++YK +
Sbjct: 301 DFLPPKEEDYKKS 313

>TBLA0A04940 Chr1 complement(1218143..1219093) [951 bp, 316 aa] {ON}
           Anc_1.6 YCL059C
          Length = 316

 Score =  491 bits (1263), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 248/314 (78%), Positives = 281/314 (89%), Gaps = 1/314 (0%)

Query: 1   MVSTHNKDKPWDTPDIDKWKIEEFKPEDNASGLPFAEESSFMTLFPKYREAYLKSTWNDV 60
           MVSTHN+DKPWDTPDI+KW+I+EFKPEDNASGLPF EESSFMTLFPKYRE YL+  W DV
Sbjct: 1   MVSTHNRDKPWDTPDINKWEIQEFKPEDNASGLPFTEESSFMTLFPKYRETYLREVWGDV 60

Query: 61  TRALDKHHLACELNLVEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPFPQAVKILEDD 120
           T++LDK+H+AC L+L+EGSMTVKTTRKTYDPAIILKARDLIKLLARSVP+PQA++IL+DD
Sbjct: 61  TKSLDKYHVACTLDLIEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPYPQAIRILQDD 120

Query: 121 VACDVIKIGNFSSNKDRFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPYKGL 180
           +ACDVIKIGN  +NK+RFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGP+KGL
Sbjct: 121 IACDVIKIGNVVNNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPFKGL 180

Query: 181 KEVRRVVEDCMKNVHPIYHIKELMIKRELAKKPELADQDWSRFLPMFXXX-XXXXXXXXX 239
           KEVRRVVEDCMKNVHPIYHIKELMIKREL+K+PELA++DWSRFLPMF             
Sbjct: 181 KEVRRVVEDCMKNVHPIYHIKELMIKRELSKRPELANEDWSRFLPMFKKRNVARKKSKKP 240

Query: 240 XXXXXVYTPFPPAQLPRKVDLEIETGEYFLSKNEKKMKKLEEHRNRQTEKQLEKAKERAE 299
                VYTPFPPAQLPRKVDLEIE+GEYFLSK EK++KKL+E R +Q EKQ+EK KER +
Sbjct: 241 KKEKKVYTPFPPAQLPRKVDLEIESGEYFLSKKEKEIKKLKERREKQEEKQVEKEKERRK 300

Query: 300 DYIAPDEKEYKNAL 313
           D+IAP EKEYK++L
Sbjct: 301 DFIAPSEKEYKSSL 314

>KAFR0D00150 Chr4 complement(16573..17607) [1035 bp, 344 aa] {ON}
           Anc_1.6 YCL059C
          Length = 344

 Score =  479 bits (1234), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 250/307 (81%), Positives = 272/307 (88%), Gaps = 1/307 (0%)

Query: 1   MVSTHNKDKPWDTPDIDKWKIEEFKPEDNASGLPFAEESSFMTLFPKYREAYLKSTWNDV 60
           MVST+NK+KPWDT DIDKW+ EEFKPEDNASGLPFAEESSFMTLFPKYRE+YLKS W DV
Sbjct: 1   MVSTYNKEKPWDTEDIDKWQTEEFKPEDNASGLPFAEESSFMTLFPKYRESYLKSVWKDV 60

Query: 61  TRALDKHHLACELNLVEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPFPQAVKILEDD 120
           T+AL+KHH+AC L+LVEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPFPQA+KILED+
Sbjct: 61  TKALEKHHIACILDLVEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPFPQAIKILEDN 120

Query: 121 VACDVIKIGNFSSNKDRFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPYKGL 180
           +ACDVIKIGNF SNK+RFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGP+KGL
Sbjct: 121 MACDVIKIGNFVSNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPFKGL 180

Query: 181 KEVRRVVEDCMKNVHPIYHIKELMIKRELAKKPELADQDWSRFLPMFXX-XXXXXXXXXX 239
           KEVRRVVEDCM NVHPIYHIKELMIKRELAKKPELA++DWSRFLPMF             
Sbjct: 181 KEVRRVVEDCMLNVHPIYHIKELMIKRELAKKPELANEDWSRFLPMFKKRNVARKKPKKI 240

Query: 240 XXXXXVYTPFPPAQLPRKVDLEIETGEYFLSKNEKKMKKLEEHRNRQTEKQLEKAKERAE 299
                VYTPFPP QLPRKVDLEIE+GEYFLSK EK++KKLEE +  Q +KQ EK KER +
Sbjct: 241 RKEKKVYTPFPPTQLPRKVDLEIESGEYFLSKKEKEVKKLEERKEEQAKKQEEKEKERKK 300

Query: 300 DYIAPDE 306
           +YIAP E
Sbjct: 301 NYIAPKE 307

>SAKL0G03740g Chr7 complement(309922..310722) [801 bp, 266 aa] {ON}
           similar to uniprot|Q7LHP7 Saccharomyces cerevisiae
           YOR145C PNO1 Partner of Nob1 Protein required for cell
           viability
          Length = 266

 Score = 46.6 bits (109), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 37/156 (23%), Positives = 68/156 (43%), Gaps = 4/156 (2%)

Query: 45  FPKYREAYLKSTWNDVTRALDKH-HLACELNLVEGSMTVKTTRK-TYDPAIILKARDLIK 102
            P +R   L++ W  +   L  H  L   +NL   S+ ++T  K T DP  + K  D IK
Sbjct: 93  VPPHRMTPLRNNWTKIYPPLVDHLKLQVRMNLKTKSVELRTHPKHTTDPGALQKGADFIK 152

Query: 103 LLARSVPFPQAVKILE-DDVACDVIKIGNFSS-NKDRFVKRRQRLVGPNGNTLKALELLT 160
             A       A+ +L  DD+  +  ++ +  +   D   +   R+ G +G T  A+E  T
Sbjct: 153 AFALGFDLDDAIALLRLDDLYIETFEVKDVKTLTGDHLSRAIGRIAGKDGKTKFAIENAT 212

Query: 161 KCYILVQGNTVSAMGPYKGLKEVRRVVEDCMKNVHP 196
           +  I++  + +  +G +  ++  R  V   +    P
Sbjct: 213 RTRIVLADSKIHILGGFTHIRMAREAVVSLILGSPP 248

>ZYRO0D11440g Chr4 complement(964606..965415) [810 bp, 269 aa] {ON}
           highly similar to uniprot|Q7LHP7 Saccharomyces
           cerevisiae YOR145C PNO1 Partner of Nob1 Protein required
           for cell viability
          Length = 269

 Score = 46.2 bits (108), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 35/156 (22%), Positives = 69/156 (44%), Gaps = 4/156 (2%)

Query: 45  FPKYREAYLKSTWNDVTRALDKH-HLACELNLVEGSMTVKT-TRKTYDPAIILKARDLIK 102
            P +R   L++ W  +   L +H  L   +NL   S+ +++  R+T DP  + K  D IK
Sbjct: 96  VPPHRMTPLRNNWTKIYPPLVEHLKLQVRMNLKTKSVELRSHPRQTTDPGALQKGADFIK 155

Query: 103 LLARSVPFPQAVKILE-DDVACDVIKIGNFSS-NKDRFVKRRQRLVGPNGNTLKALELLT 160
                     ++ +L  DD+  +  ++ +  + N D   +   R+ G +G T  A+E  T
Sbjct: 156 AFTLGFDLDDSIALLRLDDLYIETFEVKDVKTLNGDHLSRAIGRIAGKDGKTKFAIENAT 215

Query: 161 KCYILVQGNTVSAMGPYKGLKEVRRVVEDCMKNVHP 196
           +  I++    +  +G +  ++  R  V   +    P
Sbjct: 216 RTRIVLADAKIHILGGFTHIRMAREAVVSLILGSPP 251

>Suva_8.197 Chr8 complement(354586..355410) [825 bp, 274 aa] {ON}
           YOR145C (REAL)
          Length = 274

 Score = 46.2 bits (108), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 35/148 (23%), Positives = 69/148 (46%), Gaps = 4/148 (2%)

Query: 44  LFPKYREAYLKSTWNDVTRALDKH-HLACELNLVEGSMTVKTTRK-TYDPAIILKARDLI 101
           + P +R   L+++W  +   L +H  L   +NL   S+ ++T  K T DP  + K  D I
Sbjct: 100 MVPPHRLTPLRNSWTKIYPPLVEHLKLQVRMNLKTKSVELRTNPKFTTDPGALQKGADFI 159

Query: 102 KLLARSVPFPQAVKILE-DDVACDVIKIGNFSS-NKDRFVKRRQRLVGPNGNTLKALELL 159
           K  A       ++ +L  DD+  +  ++ +  +   D   +   R+ G +G T  A+E  
Sbjct: 160 KAFALGFDLDDSIALLRLDDLYIETFEVKDVKTLTGDHLSRAIGRIAGKDGKTKFAIENA 219

Query: 160 TKCYILVQGNTVSAMGPYKGLKEVRRVV 187
           T+  I++  + +  +G +  ++  R  V
Sbjct: 220 TRTRIVLADSKIHILGGFTHIRMAREFV 247

>TDEL0A03460 Chr1 complement(617779..618597) [819 bp, 272 aa] {ON}
           Anc_5.482 YOR145C
          Length = 272

 Score = 46.2 bits (108), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 36/147 (24%), Positives = 67/147 (45%), Gaps = 4/147 (2%)

Query: 45  FPKYREAYLKSTWNDVTRALDKH-HLACELNLVEGSMTVKTTRK-TYDPAIILKARDLIK 102
            P +R   L++ W  +   L +H  L   +NL   S+ ++T  K T DP  + K  D IK
Sbjct: 99  VPPHRMTPLRNNWTKIYPPLVEHLKLQVRMNLKTKSVELRTNPKHTTDPGALQKGADFIK 158

Query: 103 LLARSVPFPQAVKILE-DDVACDVIKIGNFSS-NKDRFVKRRQRLVGPNGNTLKALELLT 160
                     ++ +L  DD+  +  +I +  + N D   +   R+ G +G T  A+E  T
Sbjct: 159 AFTLGFDLDDSIALLRLDDLYIETFEIKDVKTLNGDHLSRAIGRIAGKDGKTKFAIENAT 218

Query: 161 KCYILVQGNTVSAMGPYKGLKEVRRVV 187
           +  I++  + +  +G +  ++  R  V
Sbjct: 219 RTRIVLADSKIHILGGFTHIRMAREAV 245

>Kpol_543.13 s543 complement(30976..31782) [807 bp, 268 aa] {ON}
           complement(30976..31782) [807 nt, 269 aa]
          Length = 268

 Score = 45.8 bits (107), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 36/147 (24%), Positives = 66/147 (44%), Gaps = 4/147 (2%)

Query: 45  FPKYREAYLKSTWNDVTRALDKH-HLACELNLVEGSMTVKTTRK-TYDPAIILKARDLIK 102
            P +R   L++ W  +   L  H  L   +NL   S+ ++T  K T DP  + K  D IK
Sbjct: 95  VPPHRMTPLRNNWTKIYPPLVDHLKLQVRMNLKTKSVELRTNPKHTTDPGALQKGADFIK 154

Query: 103 LLARSVPFPQAVKILE-DDVACDVIKIGNFSS-NKDRFVKRRQRLVGPNGNTLKALELLT 160
                     ++ +L  DD+  +  +I +  + N D   +   R+ G +G T  A+E  T
Sbjct: 155 AFTLGFDLDDSIALLRLDDLYIETFEIKDVKTLNGDHLSRAIGRIAGKDGKTKFAIENAT 214

Query: 161 KCYILVQGNTVSAMGPYKGLKEVRRVV 187
           +  I++  + +  +G +  ++  R  V
Sbjct: 215 RTRIVLADSKIHILGGFTHIRMAREAV 241

>Ecym_4552 Chr4 (1087732..1088547) [816 bp, 271 aa] {ON} similar to
           Ashbya gossypii AFR390C
          Length = 271

 Score = 45.8 bits (107), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 35/146 (23%), Positives = 66/146 (45%), Gaps = 4/146 (2%)

Query: 46  PKYREAYLKSTWNDVTRALDKH-HLACELNLVEGSMTVKTTRK-TYDPAIILKARDLIKL 103
           P +R   L++ W  +   L  H  L   +NL   S+ ++T  K T DP  + K  D IK 
Sbjct: 99  PPHRMTPLRNNWTKIYPPLVDHLKLQVRMNLKTKSVELRTHPKHTVDPGALQKGADFIKT 158

Query: 104 LARSVPFPQAVKILE-DDVACDVIKIGNFSS-NKDRFVKRRQRLVGPNGNTLKALELLTK 161
                    ++ +L  DD+  +  +I +  + N D   +   R+ G +G T  A+E  T+
Sbjct: 159 FTLGFDLDDSIALLRLDDLYIETFEIKDVKTLNGDHLSRAIGRIAGKDGKTKFAIENATR 218

Query: 162 CYILVQGNTVSAMGPYKGLKEVRRVV 187
             I++  + +  +G +  ++  R  +
Sbjct: 219 TRIVLADSKIHILGGFTHIRMARETI 244

>Kwal_47.18864 s47 (1004428..1005243) [816 bp, 271 aa] {ON} YOR145C
           - Protein required for cell viability [contig 189] FULL
          Length = 271

 Score = 45.4 bits (106), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 37/155 (23%), Positives = 68/155 (43%), Gaps = 4/155 (2%)

Query: 46  PKYREAYLKSTWNDVTRALDKH-HLACELNLVEGSMTVKTTRK-TYDPAIILKARDLIKL 103
           P +R   L++ W  +   L  H  L   +NL   ++ ++T  K T DP  + K  D IK 
Sbjct: 99  PPHRLTPLRNNWTKIYPPLVDHLKLQVRMNLKTKTVELRTHPKHTTDPGALQKGADFIKA 158

Query: 104 LARSVPFPQAVKILE-DDVACDVIKIGNFSS-NKDRFVKRRQRLVGPNGNTLKALELLTK 161
                    A+ +L  DD+  +  +I +  + N D   +   R+ G +G T  A+E  T+
Sbjct: 159 FTLGFDLDDAIALLRLDDLYIETFEIKDVKTLNGDHLSRAIGRIAGKDGKTKFAIENATR 218

Query: 162 CYILVQGNTVSAMGPYKGLKEVRRVVEDCMKNVHP 196
             I++  + +  +G +  ++  R  V   +    P
Sbjct: 219 TRIVLADSKIHILGGFTHIRMARESVVSLILGSPP 253

>KLTH0G02574g Chr7 complement(201390..202205) [816 bp, 271 aa] {ON}
           similar to uniprot|Q7LHP7 Saccharomyces cerevisiae
           YOR145C PNO1 Partner of Nob1 Protein required for cell
           viability
          Length = 271

 Score = 45.4 bits (106), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 37/155 (23%), Positives = 68/155 (43%), Gaps = 4/155 (2%)

Query: 46  PKYREAYLKSTWNDVTRALDKH-HLACELNLVEGSMTVKTTRK-TYDPAIILKARDLIKL 103
           P +R   L++ W  +   L  H  L   +NL   ++ ++T  K T DP  + K  D IK 
Sbjct: 99  PPHRMTPLRNNWTKIYPPLVDHLKLQVRMNLKTKTVELRTHPKHTTDPGALQKGADFIKA 158

Query: 104 LARSVPFPQAVKILE-DDVACDVIKIGNFSS-NKDRFVKRRQRLVGPNGNTLKALELLTK 161
                    A+ +L  DD+  +  +I +  + N D   +   R+ G +G T  A+E  T+
Sbjct: 159 FTLGFDLDDAIALLRLDDLYIETFEIKDVKTLNGDHLSRAIGRIAGKDGKTKFAIENATR 218

Query: 162 CYILVQGNTVSAMGPYKGLKEVRRVVEDCMKNVHP 196
             I++  + +  +G +  ++  R  V   +    P
Sbjct: 219 TRIVLADSKIHILGGFTHIRMARESVVSLILGSPP 253

>CAGL0K09460g Chr11 complement(935326..936111) [786 bp, 261 aa] {ON}
           highly similar to uniprot|Q99216 Saccharomyces
           cerevisiae YOR145c
          Length = 261

 Score = 45.1 bits (105), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 35/156 (22%), Positives = 69/156 (44%), Gaps = 4/156 (2%)

Query: 45  FPKYREAYLKSTWNDVTRALDKH-HLACELNLVEGSMTVKTTRK-TYDPAIILKARDLIK 102
            P +R   L+++WN +   L  H  L   +NL   ++ ++T  K T DP  + K  D IK
Sbjct: 88  VPPHRMTPLRNSWNKIYPPLVDHLKLQVRMNLKTRTVELRTHPKHTTDPGALQKGADFIK 147

Query: 103 LLARSVPFPQAVKILE-DDVACDVIKIGNFSS-NKDRFVKRRQRLVGPNGNTLKALELLT 160
                     ++ +L  DD+  +  ++ +  +   D   +   R+ G +G T  A+E  T
Sbjct: 148 AFTLGFDLDDSIALLRLDDLYIETFEVKDVKTLTGDHLSRAIGRIAGKDGKTKFAIENAT 207

Query: 161 KCYILVQGNTVSAMGPYKGLKEVRRVVEDCMKNVHP 196
           +  I++  + +  +G +  ++  R  V   +    P
Sbjct: 208 RTRIVLADSKIHILGGFTHIRMAREAVVSLILGSPP 243

>NCAS0A11960 Chr1 complement(2371549..2372361) [813 bp, 270 aa] {ON}
           Anc_5.482 YOR145C
          Length = 270

 Score = 44.7 bits (104), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 36/156 (23%), Positives = 67/156 (42%), Gaps = 4/156 (2%)

Query: 45  FPKYREAYLKSTWNDVTRALDKH-HLACELNLVEGSMTVKTTRK-TYDPAIILKARDLIK 102
            P +R   L+++W  +   L  H  L   +NL   S+ ++T  K T DP  + K  D IK
Sbjct: 97  VPPHRMTPLRNSWTKIYPPLVDHLKLQVRMNLKTKSVELRTHPKHTTDPGALQKGADFIK 156

Query: 103 LLARSVPFPQAVKILE-DDVACDVIKIGNFSS-NKDRFVKRRQRLVGPNGNTLKALELLT 160
                     ++ +L  DD+  +  +I +  +   D   +   R+ G +G T  A+E  T
Sbjct: 157 AFTLGFDLDDSIALLRLDDLYIETFEIKDVKTLTGDHLSRAIGRIAGKDGKTKFAIENAT 216

Query: 161 KCYILVQGNTVSAMGPYKGLKEVRRVVEDCMKNVHP 196
           +  I++    +  +G +  ++  R  V   +    P
Sbjct: 217 RTRIVLADTKIHILGGFTHIRMAREAVVSLILGSPP 252

>YOR145C Chr15 complement(605347..606171) [825 bp, 274 aa] {ON}
           PNO1Essential nucleolar protein required for pre-18S
           rRNA processing, interacts with Dim1p, an 18S rRNA
           dimethyltransferase, and also with Nob1p, which is
           involved in proteasome biogenesis; contains a KH domain
          Length = 274

 Score = 44.3 bits (103), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 35/157 (22%), Positives = 70/157 (44%), Gaps = 4/157 (2%)

Query: 44  LFPKYREAYLKSTWNDVTRALDKH-HLACELNLVEGSMTVKTTRK-TYDPAIILKARDLI 101
           + P +R   L+++W  +   L +H  L   +NL   S+ ++T  K T DP  + K  D I
Sbjct: 100 MVPPHRMTPLRNSWTKIYPPLVEHLKLQVRMNLKTKSVELRTNPKFTTDPGALQKGADFI 159

Query: 102 KLLARSVPFPQAVKILE-DDVACDVIKIGNFSS-NKDRFVKRRQRLVGPNGNTLKALELL 159
           K          ++ +L  DD+  +  ++ +  +   D   +   R+ G +G T  A+E  
Sbjct: 160 KAFTLGFDLDDSIALLRLDDLYIETFEVKDVKTLTGDHLSRAIGRIAGKDGKTKFAIENA 219

Query: 160 TKCYILVQGNTVSAMGPYKGLKEVRRVVEDCMKNVHP 196
           T+  I++  + +  +G +  ++  R  V   +    P
Sbjct: 220 TRTRIVLADSKIHILGGFTHIRMARESVVSLILGSPP 256

>Skud_15.310 Chr15 complement(554002..554832) [831 bp, 276 aa] {ON}
           YOR145C (REAL)
          Length = 276

 Score = 44.3 bits (103), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 35/157 (22%), Positives = 70/157 (44%), Gaps = 4/157 (2%)

Query: 44  LFPKYREAYLKSTWNDVTRALDKH-HLACELNLVEGSMTVKTTRK-TYDPAIILKARDLI 101
           + P +R   L+++W  +   L +H  L   +NL   S+ ++T  K T DP  + K  D I
Sbjct: 102 MVPPHRMTPLRNSWTKIYPPLVEHLKLQVRMNLKTKSVELRTNPKFTTDPGALQKGADFI 161

Query: 102 KLLARSVPFPQAVKILE-DDVACDVIKIGNFSS-NKDRFVKRRQRLVGPNGNTLKALELL 159
           K          ++ +L  DD+  +  ++ +  +   D   +   R+ G +G T  A+E  
Sbjct: 162 KAFTLGFDLDDSIALLRLDDLYIETFEVKDVKTLTGDHLSRAIGRIAGKDGKTKFAIENA 221

Query: 160 TKCYILVQGNTVSAMGPYKGLKEVRRVVEDCMKNVHP 196
           T+  I++  + +  +G +  ++  R  V   +    P
Sbjct: 222 TRTRIVLADSKIHILGGFTHIRMARESVVSLILGSPP 258

>TPHA0J02820 Chr10 complement(627383..628189) [807 bp, 268 aa] {ON}
           Anc_5.482 YOR145C
          Length = 268

 Score = 43.9 bits (102), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 35/147 (23%), Positives = 67/147 (45%), Gaps = 4/147 (2%)

Query: 45  FPKYREAYLKSTWNDVTRALDKH-HLACELNLVEGSMTVKTTRK-TYDPAIILKARDLIK 102
            P +R   L+++W+ +   L  H  L   +NL   S+ ++T  K T DP  + K  D IK
Sbjct: 95  VPPHRMTPLRNSWSKIYPPLVDHLKLQVRMNLKSKSVELRTHPKHTTDPGALQKGADFIK 154

Query: 103 LLARSVPFPQAVKILE-DDVACDVIKIGNFSS-NKDRFVKRRQRLVGPNGNTLKALELLT 160
                     ++ +L  DD+  +  +I +  + + D   +   R+ G +G T  A+E  T
Sbjct: 155 AFTLGFDLDDSIALLRLDDLYIETFEIKDVKTLHGDHLSRAIGRIAGKDGKTKFAIENAT 214

Query: 161 KCYILVQGNTVSAMGPYKGLKEVRRVV 187
           +  I++    +  +G +  ++  R  V
Sbjct: 215 RTRIVLADTKIHILGGFTHIRMAREAV 241

>Smik_15.326 Chr15 complement(561176..562000) [825 bp, 274 aa] {ON}
           YOR145C (REAL)
          Length = 274

 Score = 43.5 bits (101), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 35/157 (22%), Positives = 70/157 (44%), Gaps = 4/157 (2%)

Query: 44  LFPKYREAYLKSTWNDVTRALDKH-HLACELNLVEGSMTVKTTRK-TYDPAIILKARDLI 101
           + P +R   L+++W  +   L +H  L   +NL   S+ ++T  K T DP  + K  D I
Sbjct: 100 MVPPHRMTPLRNSWTKIYPPLVEHLKLQVRMNLKTKSVELRTNPKFTTDPGALQKGADFI 159

Query: 102 KLLARSVPFPQAVKILE-DDVACDVIKIGNFSS-NKDRFVKRRQRLVGPNGNTLKALELL 159
           K          ++ +L  DD+  +  ++ +  +   D   +   R+ G +G T  A+E  
Sbjct: 160 KAFTLGFDLDDSIALLRLDDLYIETFEVKDVKTLTGDHLSRAIGRIAGKDGKTKFAIENA 219

Query: 160 TKCYILVQGNTVSAMGPYKGLKEVRRVVEDCMKNVHP 196
           T+  I++  + +  +G +  ++  R  V   +    P
Sbjct: 220 TRTRIVLADSKIHILGGFTHIRMARESVVSLILGSPP 256

>KAFR0E03600 Chr5 (724338..725168) [831 bp, 276 aa] {ON} Anc_5.482
           YOR145C
          Length = 276

 Score = 43.5 bits (101), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 35/155 (22%), Positives = 68/155 (43%), Gaps = 4/155 (2%)

Query: 46  PKYREAYLKSTWNDVTRALDKH-HLACELNLVEGSMTVKTTRK-TYDPAIILKARDLIKL 103
           P +R   L++ W  +   L +H  L   +NL   S+ ++T  K T DP  + K  D IK 
Sbjct: 104 PPHRMTPLRNNWTKIYPPLVEHLKLQVRMNLKTKSVELRTHPKHTTDPGALQKGADFIKA 163

Query: 104 LARSVPFPQAVKILE-DDVACDVIKIGNFSS-NKDRFVKRRQRLVGPNGNTLKALELLTK 161
                    ++ +L  DD+  +  ++ +  +   D   +   R+ G +G T  A+E  T+
Sbjct: 164 FTLGFDLDDSIALLRLDDLYIETFEVKDVKTLTGDHLSRAIGRIAGKDGKTKFAIENATR 223

Query: 162 CYILVQGNTVSAMGPYKGLKEVRRVVEDCMKNVHP 196
             I++  + +  +G +  ++  R  V   +    P
Sbjct: 224 TRIVLADSKIHILGGFTHIRMAREAVVSLILGSPP 258

>KLLA0C06446g Chr3 complement(566371..567195) [825 bp, 274 aa] {ON}
           highly similar to uniprot|Q7LHP7 Saccharomyces
           cerevisiae YOR145C PNO1 Partner of Nob1 Protein required
           for cell viability,
          Length = 274

 Score = 43.5 bits (101), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 36/147 (24%), Positives = 66/147 (44%), Gaps = 4/147 (2%)

Query: 45  FPKYREAYLKSTWNDVTRALDKH-HLACELNLVEGSMTVKTTRK-TYDPAIILKARDLIK 102
            P +R   LK+ W+ +   L  H  L   +NL   S+ ++T  K T DP  + K  D IK
Sbjct: 101 VPPHRMTPLKNNWSKIYPPLVDHLKLQVRMNLKTKSVELRTHPKHTTDPGALQKGADFIK 160

Query: 103 LLARSVPFPQAVKILE-DDVACDVIKIGNFSS-NKDRFVKRRQRLVGPNGNTLKALELLT 160
                     ++ +L  DD+  +  +I +  +   D   +   R+ G +G T  A+E  T
Sbjct: 161 AFTLGFDLDDSIALLRLDDLYIETFEIKDVKTLQGDHLSRAIGRIAGKDGKTKFAIENAT 220

Query: 161 KCYILVQGNTVSAMGPYKGLKEVRRVV 187
           +  I++  + +  +G +  ++  R  V
Sbjct: 221 RTRIVLADSKIHILGGFTHIRMARESV 247

>NDAI0A04310 Chr1 (970952..971776) [825 bp, 274 aa] {ON} Anc_5.482
           YOR145C
          Length = 274

 Score = 43.1 bits (100), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 36/156 (23%), Positives = 67/156 (42%), Gaps = 4/156 (2%)

Query: 45  FPKYREAYLKSTWNDVTRALDKH-HLACELNLVEGSMTVKTTRK-TYDPAIILKARDLIK 102
            P +R   L+++W  +   L  H  L   +NL   S+ ++T  K T DP  + K  D IK
Sbjct: 101 VPPHRMTPLRNSWTKIYPPLVDHLKLQVRMNLKTKSVELRTHPKHTTDPGALQKGADFIK 160

Query: 103 LLARSVPFPQAVKILE-DDVACDVIKIGNFSS-NKDRFVKRRQRLVGPNGNTLKALELLT 160
                     ++ +L  DD+  +  +I +  +   D   +   R+ G +G T  A+E  T
Sbjct: 161 AFTLGFDLDDSIALLRLDDLYIETFEIKDVKTLTGDHLSRAIGRIAGKDGKTKFAIENAT 220

Query: 161 KCYILVQGNTVSAMGPYKGLKEVRRVVEDCMKNVHP 196
           +  I++    +  +G +  ++  R  V   +    P
Sbjct: 221 RTRIVLADTKIHILGGFTHIRMARESVVSLILGSPP 256

>KNAG0C04610 Chr3 (905301..906134) [834 bp, 277 aa] {ON} Anc_5.482
           YOR145C
          Length = 277

 Score = 42.0 bits (97), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 39/168 (23%), Positives = 74/168 (44%), Gaps = 5/168 (2%)

Query: 24  FKPEDNASGLPFAEESSFMTLFPKYREAYLKSTWNDVTRALDKH-HLACELNLVEGSMTV 82
           F   + AS      ES  + + P +R   L++ W  +   L  H  L   +NL   S+ +
Sbjct: 84  FSSANKASETKIKAESRKVAV-PPHRMTPLRNNWTKIYPPLVDHLKLQVRMNLKTKSVEL 142

Query: 83  KTTRK-TYDPAIILKARDLIKLLARSVPFPQAVKILE-DDVACDVIKIGNFSS-NKDRFV 139
           +T  K T DP  + K  D IK          ++ +L  DD+  +  ++ +  + + D   
Sbjct: 143 RTHPKHTTDPGALQKGADFIKAFTLGFDLDDSIALLRLDDLYIETFEVKDVKTLHGDHLS 202

Query: 140 KRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPYKGLKEVRRVV 187
           +   R+ G +G T  A+E  T+  I++  + +  +G +  ++  R  V
Sbjct: 203 RAIGRIAGKDGKTKFAIENATRTRIVLADSKIHILGGFTHIRMARESV 250

>TBLA0D01890 Chr4 (461527..462342) [816 bp, 271 aa] {ON} Anc_5.482
           YOR145C
          Length = 271

 Score = 40.4 bits (93), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 33/147 (22%), Positives = 65/147 (44%), Gaps = 4/147 (2%)

Query: 45  FPKYREAYLKSTWNDVTRALDKH-HLACELNLVEGSMTVKTTRK-TYDPAIILKARDLIK 102
            P +R   L++ W  +   L  H  L   +NL   S+ ++T  K T DP  + K  D IK
Sbjct: 98  VPPHRMTPLRNNWPKIYPPLVDHLKLQVRMNLRTKSVELRTHPKHTTDPGALQKGADFIK 157

Query: 103 LLARSVPFPQAVKILE-DDVACDVIKIGNFSS-NKDRFVKRRQRLVGPNGNTLKALELLT 160
                     ++ +L  DD+  +  ++ +  +   D   +   R+ G +G T  A+E  T
Sbjct: 158 AFTLGFDLDDSIALLRLDDLYIETFEVKDVKTLTGDHLSRAIGRIAGKDGKTKFAIENAT 217

Query: 161 KCYILVQGNTVSAMGPYKGLKEVRRVV 187
           +  I++  + +  +G +  ++  R  +
Sbjct: 218 RTRIVLADSKIHILGGFTHIRMARESI 244

>AAR002W Chr1 (341790..342326) [537 bp, 178 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YCR003W (MRPL32)
          Length = 178

 Score = 37.0 bits (84), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 47/172 (27%), Positives = 70/172 (40%), Gaps = 37/172 (21%)

Query: 54  KSTWNDVTRALDKHHLACELNLVEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPFPQA 113
           ++ W +V RAL +   A    L  GS +V            +  R L++LL R+    QA
Sbjct: 4   QAVWGNVGRALSECTAALFPRLELGSGSV------------IAPRTLLELLRRAGGSQQA 51

Query: 114 --VKILEDDVACDVIKIGNFSSNKDRFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTV 171
               +  D +   V K       K    KRRQ+L GP    L+ +  L KC         
Sbjct: 52  GTAAVGADGLVLAVPK------KKVSHQKRRQKLYGPGKKQLQMVHHLGKC--------- 96

Query: 172 SAMGPYKGLKEVRRVVEDCMKNVHPIYHIKELMIKRELAKKPELADQDWSRF 223
            + G YK L  +      CM  V  I HI ++  + + A+ P+  +QD S  
Sbjct: 97  PSCGHYKRLNTL------CMYCVGEIRHIWKVYTQTKPAEPPQ--EQDLSEL 140

>ZYRO0E04356g Chr5 complement(332059..332619) [561 bp, 186 aa] {ON}
           similar to uniprot|P25348 Saccharomyces cerevisiae
           YCR003W MRPL32 Mitochondrial ribosomal protein of the
           large subunit
          Length = 186

 Score = 31.6 bits (70), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 26/104 (25%), Positives = 47/104 (45%), Gaps = 12/104 (11%)

Query: 116 ILEDDVACDVIKIGNFSSNKDRFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMG 175
           I+E+D   +  ++      K    K+RQRL  P    LK +  L KC          + G
Sbjct: 57  IVEEDFFSNNGRLLAVPKKKVTHQKKRQRLYAPGKKQLKFIHELNKC---------PSCG 107

Query: 176 PYKGLKEVRRVVEDCMKNVHPIYHIKELMIKRELAKKPELADQD 219
            Y   K    +   C+++V  I+  + +  ++E +++ EL+D D
Sbjct: 108 HY---KRANCLCMHCVQHVRHIWKTQTVKERQEPSQEQELSDLD 148

>TBLA0H01830 Chr8 complement(433992..435212) [1221 bp, 406 aa] {ON}
           Anc_5.375 YDR331W
          Length = 406

 Score = 32.0 bits (71), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 20/64 (31%), Positives = 35/64 (54%), Gaps = 3/64 (4%)

Query: 79  SMTVKTTRKTYDPAIILKARDLIKLLAR-SVPFPQAVKILEDDVACDVIKI--GNFSSNK 135
           ++ V T+R  ++   +  A  + +   R  VP  Q + +L DDVAC+   +  G+  +NK
Sbjct: 30  AVIVSTSRFWFNYRHMANALSMYRTFKRLGVPDSQIILMLSDDVACNSRNLFPGSVFNNK 89

Query: 136 DRFV 139
           DRF+
Sbjct: 90  DRFL 93

>KLTH0E14014g Chr5 (1239444..1240904) [1461 bp, 486 aa] {ON} similar
           to uniprot|Q12096 Saccharomyces cerevisiae YOR320C GNT1
           N-acetylglucosaminyltransferase capable of modification
           of N-linked glycans in the Golgi apparatus
          Length = 486

 Score = 31.6 bits (70), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 26/99 (26%), Positives = 40/99 (40%), Gaps = 20/99 (20%)

Query: 137 RFV-KRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPYKGLKEVRRVVEDCMKNVH 195
           RF+ KRR RLVG  G  +  + L  KC +  Q N        + ++  R        N+H
Sbjct: 2   RFLFKRRLRLVGAIGAVVLLISLTAKCVVQFQLN--------REIEHYRTFFRKHKDNIH 53

Query: 196 PIYH-----------IKELMIKRELAKKPELADQDWSRF 223
            IY            I+ L   R+    P+ +  DW ++
Sbjct: 54  DIYDPLNIKQIPYETIESLYQLRKTGDVPKKSPIDWGKY 92

>AGL183C Chr7 complement(352996..354519) [1524 bp, 507 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR116W
           (MSL5)
          Length = 507

 Score = 31.6 bits (70), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 12/24 (50%), Positives = 18/24 (75%)

Query: 145 LVGPNGNTLKALELLTKCYILVQG 168
           L+GP GNTLK L+  + C I+++G
Sbjct: 169 LLGPRGNTLKQLQQQSGCKIVIRG 192

>KAFR0B03030 Chr2 (632585..633988) [1404 bp, 467 aa] {ON} Anc_8.309
           YLR116W
          Length = 467

 Score = 31.2 bits (69), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 12/24 (50%), Positives = 18/24 (75%)

Query: 145 LVGPNGNTLKALELLTKCYILVQG 168
           L+GP GNTL+ L+  +KC I ++G
Sbjct: 151 LLGPRGNTLRKLQEQSKCKIAIRG 174

>KLLA0D02398g Chr4 complement(202446..206063) [3618 bp, 1205 aa] {ON}
            similar to uniprot|P06105 Saccharomyces cerevisiae
            YJL080C SCP160 May be required during cell division for
            faithful partitioning of the ER-nuclear envelope
            membranes involved in control of mitotic chromsome
            transmission,
          Length = 1205

 Score = 30.8 bits (68), Expect = 6.6,   Method: Compositional matrix adjust.
 Identities = 22/83 (26%), Positives = 41/83 (49%), Gaps = 9/83 (10%)

Query: 112  QAVKILEDDVA-CDVIKIGNFSSNKDRFVKRRQRLVGPNGNTLKALELLTKCYILV---- 166
            +A K++ED +A   ++    F  +KD   K+   +VGPNG  ++ +   TK  I V    
Sbjct: 1120 KASKLIEDRIAEAKLVNTEGFVWSKD--AKKFNSIVGPNGRNIREIRNATKTVIHVPRKS 1177

Query: 167  --QGNTVSAMGPYKGLKEVRRVV 187
                N +  +G  +G+K+   ++
Sbjct: 1178 DKVNNVIYVLGSEEGVKKAAELI 1200

>KNAG0G02350 Chr7 (542717..544210) [1494 bp, 497 aa] {ON} Anc_8.309
           YLR116W
          Length = 497

 Score = 30.4 bits (67), Expect = 7.5,   Method: Compositional matrix adjust.
 Identities = 12/24 (50%), Positives = 17/24 (70%)

Query: 145 LVGPNGNTLKALELLTKCYILVQG 168
           L+GP GNTLK L+  + C I ++G
Sbjct: 148 LLGPRGNTLKQLQKQSNCKIAIRG 171

>SAKL0D08822g Chr4 complement(734328..734879) [552 bp, 183 aa] {ON}
           similar to uniprot|P25348 Saccharomyces cerevisiae
           YCR003W MRPL32 Mitochondrial ribosomal protein of the
           large subunit
          Length = 183

 Score = 29.3 bits (64), Expect = 9.6,   Method: Compositional matrix adjust.
 Identities = 21/61 (34%), Positives = 26/61 (42%), Gaps = 15/61 (24%)

Query: 140 KRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPYKGLKEVRRVVEDCMKNVHPIYH 199
           K+RQ+L GP    LK +  L KC          + G YK      R    CM  V+ I H
Sbjct: 78  KKRQKLYGPGKKQLKMIHHLNKC---------PSCGHYK------RANTLCMHCVNEIRH 122

Query: 200 I 200
           I
Sbjct: 123 I 123

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.315    0.133    0.390 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 36,332,821
Number of extensions: 1551224
Number of successful extensions: 10760
Number of sequences better than 10.0: 274
Number of HSP's gapped: 10714
Number of HSP's successfully gapped: 352
Length of query: 336
Length of database: 53,481,399
Length adjustment: 110
Effective length of query: 226
Effective length of database: 40,868,139
Effective search space: 9236199414
Effective search space used: 9236199414
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 66 (30.0 bits)