Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Ecym_10081.5ON1118111851210.0
SAKL0C00462g1.5ON11773986612e-70
Smik_3.141.5ON11133726263e-66
KLLA0C00484g1.5ON9253455868e-62
YCL061C (MRC1)1.5ON10963845811e-60
AFR745W1.5ON10184125764e-60
Suva_3.1521.5ON11404005686e-59
Skud_3.31.5ON11523785614e-58
KAFR0D001401.5ON10413605533e-57
Kpol_2002.81.5ON9853735504e-57
NDAI0A001401.5ON10913705482e-56
KLTH0F00484g1.5ON9933705462e-56
TPHA0E040101.5ON9653735442e-56
CAGL0B00330g1.5ON11363435364e-55
NCAS0B091101.5ON10203425283e-54
KNAG0C002201.5ON11613695232e-53
Kwal_33.130051.5ON9703645088e-52
TBLA0A075701.5ON12523674973e-50
ZYRO0F18480g1.5ON9603504741e-47
TDEL0C069701.5ON9413534462e-44
Smik_27.11singletonON828134800.86
KAFR0F042401.103ON48375791.1
ACR074W5.237ON41056744.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Ecym_1008
         (1118 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Ecym_1008 Chr1 complement(13340..16696) [3357 bp, 1118 aa] {ON} ...  1977   0.0  
SAKL0C00462g Chr3 complement(41257..44790) [3534 bp, 1177 aa] {O...   259   2e-70
Smik_3.14 Chr3 complement(20226..23567) [3342 bp, 1113 aa] {ON} ...   245   3e-66
KLLA0C00484g Chr3 complement(35397..38174) [2778 bp, 925 aa] {ON...   230   8e-62
YCL061C Chr3 complement(18816..22106) [3291 bp, 1096 aa] {ON}  M...   228   1e-60
AFR745W Chr6 (1803046..1806102) [3057 bp, 1018 aa] {ON} Syntenic...   226   4e-60
Suva_3.152 Chr3 complement(228665..232087) [3423 bp, 1140 aa] {O...   223   6e-59
Skud_3.3 Chr3 complement(6855..10313) [3459 bp, 1152 aa] {ON} YC...   220   4e-58
KAFR0D00140 Chr4 complement(13233..16358) [3126 bp, 1041 aa] {ON...   217   3e-57
Kpol_2002.8 s2002 complement(11914..14871) [2958 bp, 985 aa] {ON...   216   4e-57
NDAI0A00140 Chr1 complement(8373..11648) [3276 bp, 1091 aa] {ON}...   215   2e-56
KLTH0F00484g Chr6 complement(37017..39998) [2982 bp, 993 aa] {ON...   214   2e-56
TPHA0E04010 Chr5 (839903..842800) [2898 bp, 965 aa] {ON} Anc_1.5...   214   2e-56
CAGL0B00330g Chr2 complement(18031..21441) [3411 bp, 1136 aa] {O...   211   4e-55
NCAS0B09110 Chr2 (1746358..1749420) [3063 bp, 1020 aa] {ON} Anc_...   207   3e-54
KNAG0C00220 Chr3 complement(33011..36496) [3486 bp, 1161 aa] {ON...   206   2e-53
Kwal_33.13005 s33 complement(36797..39709) [2913 bp, 970 aa] {ON...   200   8e-52
TBLA0A07570 Chr1 (1874419..1878177) [3759 bp, 1252 aa] {ON} Anc_...   196   3e-50
ZYRO0F18480g Chr6 (1524051..1526933) [2883 bp, 960 aa] {ON} weak...   187   1e-47
TDEL0C06970 Chr3 (1264155..1266980) [2826 bp, 941 aa] {ON} Anc_1...   176   2e-44
Smik_27.11 Chr27 (6612..9095) [2484 bp, 828 aa] {ON} YBL017C (REAL)    35   0.86 
KAFR0F04240 Chr6 complement(831101..832552) [1452 bp, 483 aa] {O...    35   1.1  
ACR074W Chr3 (496156..497388) [1233 bp, 410 aa] {ON} Syntenic ho...    33   4.5  

>Ecym_1008 Chr1 complement(13340..16696) [3357 bp, 1118 aa] {ON}
            similar to Ashbya gossypii AFR745W
          Length = 1118

 Score = 1977 bits (5121), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 987/1118 (88%), Positives = 987/1118 (88%)

Query: 1    MDLLNLLPGKARRKTTYKIEHEKLSQEAGYIIIKPSNAENVFANAIVDKVRNRLEGTISS 60
            MDLLNLLPGKARRKTTYKIEHEKLSQEAGYIIIKPSNAENVFANAIVDKVRNRLEGTISS
Sbjct: 1    MDLLNLLPGKARRKTTYKIEHEKLSQEAGYIIIKPSNAENVFANAIVDKVRNRLEGTISS 60

Query: 61   PDRLDTLSSKLSETVGNLYDGEALEEDFDPNIDNSFKGMVNSYNVNFEHIKSKGTMDHNR 120
            PDRLDTLSSKLSETVGNLYDGEALEEDFDPNIDNSFKGMVNSYNVNFEHIKSKGTMDHNR
Sbjct: 61   PDRLDTLSSKLSETVGNLYDGEALEEDFDPNIDNSFKGMVNSYNVNFEHIKSKGTMDHNR 120

Query: 121  TIDAIPLPVKLDNGGIFASESNNHSLRDSKTDTISCNSLTSNHTQHARSSSGIHTAQLQE 180
            TIDAIPLPVKLDNGGIFASESNNHSLRDSKTDTISCNSLTSNHTQHARSSSGIHTAQLQE
Sbjct: 121  TIDAIPLPVKLDNGGIFASESNNHSLRDSKTDTISCNSLTSNHTQHARSSSGIHTAQLQE 180

Query: 181  TQKVITDVKSALFTXXXXXXXXXLQKVKATRISAPNFNTNEDRGYTQTQIIKNIQFDEGK 240
            TQKVITDVKSALFT         LQKVKATRISAPNFNTNEDRGYTQTQIIKNIQFDEGK
Sbjct: 181  TQKVITDVKSALFTSSSISSNSNLQKVKATRISAPNFNTNEDRGYTQTQIIKNIQFDEGK 240

Query: 241  YSETQLIPEITDDDDCRSLHNAQGPDSQTLSTLADTLESKLSEKLRATVPNQVISQSNKK 300
            YSETQLIPEITDDDDCRSLHNAQGPDSQTLSTLADTLESKLSEKLRATVPNQVISQSNKK
Sbjct: 241  YSETQLIPEITDDDDCRSLHNAQGPDSQTLSTLADTLESKLSEKLRATVPNQVISQSNKK 300

Query: 301  KEELAIHKFQRDLGEAEDENNKVTEHILPSYVALQNHIFTKEAFLDDFELSGQEVDYSST 360
            KEELAIHKFQRDLGEAEDENNKVTEHILPSYVALQNHIFTKEAFLDDFELSGQEVDYSST
Sbjct: 301  KEELAIHKFQRDLGEAEDENNKVTEHILPSYVALQNHIFTKEAFLDDFELSGQEVDYSST 360

Query: 361  ATRVKEXXXXXXXXXXXXXXNAVYDNLTDNFGTITRDAYAEEAKPPLLPLQSMKNTVGQD 420
            ATRVKE              NAVYDNLTDNFGTITRDAYAEEAKPPLLPLQSMKNTVGQD
Sbjct: 361  ATRVKETVSNDISSDVSSNTNAVYDNLTDNFGTITRDAYAEEAKPPLLPLQSMKNTVGQD 420

Query: 421  IILDSSSDEEHASNQFATSTMVKAALLNIKAKISKNMNLSKNAEQSINSPTLKQLFISLK 480
            IILDSSSDEEHASNQFATSTMVKAALLNIKAKISKNMNLSKNAEQSINSPTLKQLFISLK
Sbjct: 421  IILDSSSDEEHASNQFATSTMVKAALLNIKAKISKNMNLSKNAEQSINSPTLKQLFISLK 480

Query: 481  KANKKQILDHRREITEKRGISLEQLEQEREKVEDLLEQKIKRNRRIRLREKKKENELRLR 540
            KANKKQILDHRREITEKRGISLEQLEQEREKVEDLLEQKIKRNRRIRLREKKKENELRLR
Sbjct: 481  KANKKQILDHRREITEKRGISLEQLEQEREKVEDLLEQKIKRNRRIRLREKKKENELRLR 540

Query: 541  YEDINNCSTGSSDGDANXXXXXXXXXXXXXXXXXXXXNLLAXXXXXXXXXXXXXQNSCNK 600
            YEDINNCSTGSSDGDAN                    NLLA             QNSCNK
Sbjct: 541  YEDINNCSTGSSDGDANSEIPESDTSEESDDIEVDETNLLADDDEYSDIDVSDIQNSCNK 600

Query: 601  NIEWTANNKKQEIANEVTXXXXXXXXXXXXXXXXDKIIVNRHYHHKFRLAENRFHTSKAP 660
            NIEWTANNKKQEIANEVT                DKIIVNRHYHHKFRLAENRFHTSKAP
Sbjct: 601  NIEWTANNKKQEIANEVTEEEEEEEEEEEEEEEEDKIIVNRHYHHKFRLAENRFHTSKAP 660

Query: 661  KNTIXXXXXXXXXXXXXXXXXXXXEYLTYRIKKFEGLSPSKSATTELDVKSDLAAESSIL 720
            KNTI                    EYLTYRIKKFEGLSPSKSATTELDVKSDLAAESSIL
Sbjct: 661  KNTIDLGAYGDNLNLGNAGLPNNDEYLTYRIKKFEGLSPSKSATTELDVKSDLAAESSIL 720

Query: 721  ETIKDGNWRLXXXXXXXXXXXXXXXXXXXXXXXXXXXXLMLKLRLQEKIKRQKQKEMRKL 780
            ETIKDGNWRL                            LMLKLRLQEKIKRQKQKEMRKL
Sbjct: 721  ETIKDGNWRLKKSGEIETGEEEEPKEEGEEEKRKIVKELMLKLRLQEKIKRQKQKEMRKL 780

Query: 781  GVNKMVELEADESEDEWHGVGGVDYEASDEYDSDLDKMIDDYNKNEFDPVEIRKILASED 840
            GVNKMVELEADESEDEWHGVGGVDYEASDEYDSDLDKMIDDYNKNEFDPVEIRKILASED
Sbjct: 781  GVNKMVELEADESEDEWHGVGGVDYEASDEYDSDLDKMIDDYNKNEFDPVEIRKILASED 840

Query: 841  LQHDKNMVNKILHDIKTGGFRKRGRGXXXXXXXXXXXGILQSYRAKRWNEQKQKMLDSEH 900
            LQHDKNMVNKILHDIKTGGFRKRGRG           GILQSYRAKRWNEQKQKMLDSEH
Sbjct: 841  LQHDKNMVNKILHDIKTGGFRKRGRGELDLELSEDEDGILQSYRAKRWNEQKQKMLDSEH 900

Query: 901  NTSVKSNPKSLPFFESMVDEFTIPVERALGTPDSPPAQSTNVLELKQNTKQKIVISEHFV 960
            NTSVKSNPKSLPFFESMVDEFTIPVERALGTPDSPPAQSTNVLELKQNTKQKIVISEHFV
Sbjct: 901  NTSVKSNPKSLPFFESMVDEFTIPVERALGTPDSPPAQSTNVLELKQNTKQKIVISEHFV 960

Query: 961  KQTLSFLTSDENMTNMRSEINVEKPNNDNDIYSSEVEDLYTLKETSTIKVLNTYSGKPIV 1020
            KQTLSFLTSDENMTNMRSEINVEKPNNDNDIYSSEVEDLYTLKETSTIKVLNTYSGKPIV
Sbjct: 961  KQTLSFLTSDENMTNMRSEINVEKPNNDNDIYSSEVEDLYTLKETSTIKVLNTYSGKPIV 1020

Query: 1021 NEDEDGAEFGFKAPSVMQTFGSRNDVNDKFKDGFKSVKISNKYKTLGSSRAAITFLGKKR 1080
            NEDEDGAEFGFKAPSVMQTFGSRNDVNDKFKDGFKSVKISNKYKTLGSSRAAITFLGKKR
Sbjct: 1021 NEDEDGAEFGFKAPSVMQTFGSRNDVNDKFKDGFKSVKISNKYKTLGSSRAAITFLGKKR 1080

Query: 1081 KLIIPKRSSKSPRDSAHRSIKNRLKHQAFLENTDTFEA 1118
            KLIIPKRSSKSPRDSAHRSIKNRLKHQAFLENTDTFEA
Sbjct: 1081 KLIIPKRSSKSPRDSAHRSIKNRLKHQAFLENTDTFEA 1118

>SAKL0C00462g Chr3 complement(41257..44790) [3534 bp, 1177 aa] {ON}
            some similarities with uniprot|P25588 Saccharomyces
            cerevisiae YCL061C MRC1 S-phase checkpoint protein found
            at replication forks required for DNA replication also
            required for Rad53p activation during DNA replication
            stress where it forms a replication-pausing complex with
            Tof1p and is phosphorylated by Mec1p protein involved in
            replication checkpoint
          Length = 1177

 Score =  259 bits (661), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 174/398 (43%), Positives = 241/398 (60%), Gaps = 50/398 (12%)

Query: 759  LMLKLRLQEKIKRQKQKEMRKLGVNKMVELEADESEDEWHGVGGVDYEASDEYDSDLDKM 818
            ++ + R QE   RQK+KEM++ GV+KM E+EA+ESEDEWHGVGG D E SDEYDS+L+KM
Sbjct: 792  VLARKREQEHKIRQKRKEMKRKGVSKMFEMEAEESEDEWHGVGGADGELSDEYDSELEKM 851

Query: 819  IDDYNKNEFDPVEIRKILASEDLQHDKNMVNKILHDIKTGGFRKRGRGXXXXXXXXXXXG 878
            +DDY K  FDP EIR++LA+ED ++D+ +VNKILHDIK GGFR+RG+G            
Sbjct: 852  VDDYTKTTFDPAEIRQMLAAEDKEYDEKIVNKILHDIKNGGFRRRGKGALDIELSDDEDD 911

Query: 879  ILQSYRAKRWNEQKQKMLDSEHNTSVKSNPKSLPFFESMVDE-------FTI-----PVE 926
             LQ Y AKR    +QK+L++   + + SNPKS  FFESMV++       F+I     P  
Sbjct: 912  ELQRYHAKRRELLRQKVLENGEASKLVSNPKSHAFFESMVEDLVESKNPFSIGETADPDS 971

Query: 927  RALGTPD----------SPPAQSTNVLELKQNTKQKIVISEHFVKQTLSFLTSDENMTNM 976
             A+   D           P A    V    +  +++I IS+ FV+++LSFL S + + N 
Sbjct: 972  GAISENDKVDNASEHGTQPDAGGQPV----RTERKRIKISQEFVQRSLSFLNSKDELDN- 1026

Query: 977  RSEINVEKP---------NNDNDIYSSEVEDLYTLKETSTIKVLNT--YSGKPIVNEDED 1025
              E  +++           +DND    ++EDL+TLK+ S IK L+T   +    V+ + D
Sbjct: 1027 --EFELDRRLAKHQHSTLGDDND----DLEDLFTLKQNSCIKTLHTPARTSSRTVDLEVD 1080

Query: 1026 G--AEFGFKAPSVMQTFGSRNDVNDKFKDGFKSVKISNKYKTLGSSRAAITFLGKKRKLI 1083
            G     GFK PSV+ +F SR D+N+KFK+G K+VK+S  YKT+G SRA+IT+LGK RKL 
Sbjct: 1081 GNSPANGFKLPSVISSFSSRIDINEKFKEGTKTVKVSKSYKTIGGSRASITYLGKVRKLN 1140

Query: 1084 IPKR--SSKSPRDSAHRSIKNRLKHQA-FLENTDTFEA 1118
             PKR  S + P    HR  +   K    F +N D+FEA
Sbjct: 1141 APKRKESGRKPV-FGHRHPEAAPKRAGLFADNDDSFEA 1177

 Score =  142 bits (358), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 126/366 (34%), Positives = 187/366 (51%), Gaps = 57/366 (15%)

Query: 225 YTQTQIIKNIQFDEGKYS--ETQLIPEITDDDDCRSLHNAQGPDSQTLS-------TLAD 275
           Y  TQII + Q+   +    ETQ   E  + D  + +  A   D  TLS       T+AD
Sbjct: 188 YGLTQIIPSPQYKNSQQMQLETQEAGETQEVDKTQRILEATARDP-TLSEEDFVAATVAD 246

Query: 276 TLESKLSE------------KLRATVPNQVISQSNKKKEELAIHKFQRDLGEAEDENNKV 323
             E+  ++             ++ T P+Q    +++  + L IH+ ++DL   E+   ++
Sbjct: 247 GSEAVTTQLDTCVPDTSALGDVQPTAPDQ---SAHRNSQRLLIHEIEKDLDAEEEREKRI 303

Query: 324 TEHILPSYVALQNHIFTKEAFLDDFELSGQEVDYSSTATRVKEXXXXXXXXXXXXXX-NA 382
           TE      V +    F KEAFL++F+ S  E +      + ++                +
Sbjct: 304 TEAKPHDVVLVVKKKFDKEAFLNNFDCSSSEGEEQEQEEQEEQTHLESEPASKRRKLFTS 363

Query: 383 VYDNLTD----------NF--------GTIT---RDAYAEEAKPPLLPLQSMKNTVG--- 418
           V  N  D          NF        GT T   R    ++ +   +PL S KN +    
Sbjct: 364 VPGNPLDSKDSEAGGSGNFASAIAATIGTTTDEGRSTRKDKEEAGWVPLNSYKNQLKARL 423

Query: 419 ---QDIILDSSSDEEHASNQFATSTMVKAALLNIKAKISKNMNLSKNAEQ--SINSPTLK 473
              + I LDSSSDE+   N    S M KAA+L IKA+ SK   + K  +Q  +  +P+LK
Sbjct: 424 DSKEHIDLDSSSDEDE--NSVPASKMSKAAVLEIKARTSKRQGIKKTRQQPSTPRAPSLK 481

Query: 474 QLFISLKKANKKQILDHRREITEKRGISLEQLEQEREKVEDLLEQKIKRNRRIRLREKKK 533
           +LF SLKKANKKQILDHRREITEKRG++LE +E+E+++VE+LLEQ+I+RNR+IRLREK++
Sbjct: 482 ELFSSLKKANKKQILDHRREITEKRGLNLEDIEREKKEVENLLEQEIERNRKIRLREKQR 541

Query: 534 ENELRL 539
           E +  L
Sbjct: 542 EKKKEL 547

 Score = 39.3 bits (90), Expect = 0.064,   Method: Compositional matrix adjust.
 Identities = 35/96 (36%), Positives = 51/96 (53%), Gaps = 10/96 (10%)

Query: 1  MDLLNLLPGKARRKTTY--KIEHEKLSQEAGYIIIKP--SNAENVFANA-IVDKVRNRLE 55
          +D L  L    ++KTTY   IE     +E      +P  S+A  +F N+ IVDKV++RL 
Sbjct: 4  LDALGDLKHPKKKKTTYVKDIEVYATQEENDEEKKQPQLSSASFLFGNSTIVDKVKSRLN 63

Query: 56 GTI---SSPDRLDTLSSKLSETVGNLYDGEALEEDF 88
          G     +  +R D L    ++ + N YDGE LE+DF
Sbjct: 64 GVSNEETDGERGDALPQ--TQVIPNYYDGEDLEQDF 97

>Smik_3.14 Chr3 complement(20226..23567) [3342 bp, 1113 aa] {ON}
            YCL061C (REAL)
          Length = 1113

 Score =  245 bits (626), Expect = 3e-66,   Method: Compositional matrix adjust.
 Identities = 153/372 (41%), Positives = 220/372 (59%), Gaps = 47/372 (12%)

Query: 761  LKLRLQEKIKRQKQKEMRKLGVNKMVELEADESEDEWHGVGGVDYEASDEYDSDLDKMID 820
            L+LR +E  K  K KE++  GV    E+EA+ES+DEWHG+GG D E SDEYDSD++KMID
Sbjct: 717  LQLRQKELEKAIKLKELKHKGVTNFFEMEAEESDDEWHGIGGADGEGSDEYDSDVEKMID 776

Query: 821  DYNKNEFDPVEIRKILASEDLQHDKNMVNKILHDIKTGGFR-KRGRGXXXXXXXXXXXGI 879
            DY+KN F+  EIR++LA+E+ + D  M+NKIL+DIK GGFR KR +             +
Sbjct: 777  DYSKNNFNSHEIREMLAAENKEMDVKMINKILYDIKNGGFRNKRAKNSLELELSDDEDDV 836

Query: 880  LQSYRAKRWNEQKQKMLDSEHNTSVKSNPKSLPFFESMVD---EFTIP----------VE 926
            LQ YR KR    +++ L+    T +  NPKS  FFESMV+   E+  P          + 
Sbjct: 837  LQQYRLKRRELMRKRRLEIGDGTKLVKNPKSKAFFESMVEDIMEYKNPFRAEEESNQDIT 896

Query: 927  RALGTPDSPPAQSTNVLELKQNTK--------QKIVISEHFVKQTLSFLTSDE-NMTNMR 977
                  D+    S NV +  +N +        +KI+ISE FV+++LSFL S+  N   M 
Sbjct: 897  STATDLDTLDNNSLNVRDSTRNNEKGPVDDKSKKIIISEDFVQKSLSFLKSNNYNEFEMD 956

Query: 978  SEINVEKPNNDNDIYSSEVEDLYTLKETSTIKVL-----NTYSGKPIV--------NEDE 1024
             E+   +  ND++     +EDL+TLK+ S+IK       ++++ + +          EDE
Sbjct: 957  KELAKMQHGNDDE----PIEDLFTLKQHSSIKSFTNSQTDSFTSRTVTTMIDLEKRTEDE 1012

Query: 1025 DGAE-------FGFKAPSVMQTFGSRNDVNDKFKDGFKSVKISNKYKTLGSSRAAITFLG 1077
            D  E        GFK PS++++F SR D+NDKFK+G K+VKIS  YK +GSS+A+IT++G
Sbjct: 1013 DEMENGDSSLVSGFKHPSIVKSFASRTDINDKFKEGNKTVKISKSYKMVGSSKASITYMG 1072

Query: 1078 KKRKLIIPKRSS 1089
            K RKL+ PKR +
Sbjct: 1073 KTRKLMAPKRKA 1084

 Score = 80.1 bits (196), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 44/101 (43%), Positives = 73/101 (72%), Gaps = 2/101 (1%)

Query: 436 FATSTMVKAALLNIKAKISK-NMNLSKNAEQSINSPT-LKQLFISLKKANKKQILDHRRE 493
              S + KA +LN+KA++SK N ++S+   +  ++     +LF +L+KA++KQILDH+RE
Sbjct: 447 LPISQLSKATILNLKARLSKQNQDISQRPLEGRDARLDHNKLFNTLRKASRKQILDHQRE 506

Query: 494 ITEKRGISLEQLEQEREKVEDLLEQKIKRNRRIRLREKKKE 534
           + E +G  LE + +E+E VE+LLEQ+I RN++IR +EK++E
Sbjct: 507 VIETKGFKLEDMVKEKELVENLLEQEIIRNKKIRQKEKRRE 547

 Score = 32.7 bits (73), Expect = 7.2,   Method: Compositional matrix adjust.
 Identities = 26/67 (38%), Positives = 39/67 (58%), Gaps = 14/67 (20%)

Query: 31  IIIKPSNAEN--VFANAIVDKVRNRLEGTISSP--------DRLDTLSSKLSETVGNLYD 80
           I+  P+   N  +FANA +++V+NRLEG   +P        D  + +SS  S+ + NLY+
Sbjct: 43  IVAPPALTGNGFLFANATLNRVKNRLEGG-KAPEQEHDNKDDEDEDVSS--SQLIANLYE 99

Query: 81  -GEALEE 86
            GE LEE
Sbjct: 100 GGEDLEE 106

>KLLA0C00484g Chr3 complement(35397..38174) [2778 bp, 925 aa] {ON}
            weakly similar to uniprot|P25588 Saccharomyces cerevisiae
            YCL061C MRC1 S-phase checkpoint protein found at
            replication forks required for DNA replication also
            required for Rad53p activation during DNA replication
            stress where it forms a replication-pausing complex with
            Tof1p and is phosphorylated by Mec1p protein involved in
            replication checkpoint
          Length = 925

 Score =  230 bits (586), Expect = 8e-62,   Method: Compositional matrix adjust.
 Identities = 151/345 (43%), Positives = 208/345 (60%), Gaps = 40/345 (11%)

Query: 764  RLQEKIKRQKQKE----------MRKLGVNKMVELEADESEDEWHGVGGVDYEASDEYDS 813
            RLQE+ K +++ E          ++  G+NK++E+EA+ESEDEWHGVGG D E SD+YDS
Sbjct: 587  RLQERAKMRRRMEIEAAKKRKQVLKSTGLNKILEMEAEESEDEWHGVGGADGENSDDYDS 646

Query: 814  DLDKMIDDYNKNEFDPVEIRKILASEDLQHDKNMVNKILHDIKTGGFRKRGRGXXXXXXX 873
            DLD MIDD++K++FD   IR+ LA E+ + D+ M+NKILHDI TGGFRKRGRG       
Sbjct: 647  DLDTMIDDFSKSKFDTASIRERLALENKEMDERMINKILHDINTGGFRKRGRGALDLELS 706

Query: 874  XXXXGILQSYRAKRWNEQKQKMLDSEHNTSVKSNPKSLPFFESMVDEFTIPVERALGTPD 933
                 +L+ +R KR    KQK+L  E+   V +N KS  FF+SMV++          T  
Sbjct: 707  DDEDELLRQFREKRREIMKQKLL--ENVDGVVNNSKSKAFFDSMVEDI---------TRK 755

Query: 934  SPPAQSTNVLELKQNTKQKIVISEHFVKQTLSFLTSDENMTNMRSEINVEKPNNDNDIYS 993
            S PA ++      +  K+KIVISE FV+ +LSFL++ ++  N   E  V +  +D     
Sbjct: 756  SIPAVTSFSNTRDEMGKKKIVISEEFVQSSLSFLSAKDDDIN---EFEVTEAAHD----- 807

Query: 994  SEVEDLYTLKETSTIKVLNTYSGKPIVN------EDEDGAEFGFKAPSVMQTFGSRNDVN 1047
               EDL +LK+ S IK L++    P  N      +D DG    FK PS++++F S +DVN
Sbjct: 808  -ATEDLESLKQRSNIKSLDS----PQRNRNSAFFDDVDGTSLDFKLPSIVKSFSSNSDVN 862

Query: 1048 DKFKDGFKSVKISNKYKTLGSSRAAITFLGKKRKLIIPKRSSKSP 1092
            DKFK G K+V IS  Y+    SR+AITFLGKKRKL  P+    +P
Sbjct: 863  DKFKTGIKTVTISKSYRVASGSRSAITFLGKKRKLKAPQGRKSTP 907

 Score = 89.7 bits (221), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 58/121 (47%), Positives = 78/121 (64%), Gaps = 4/121 (3%)

Query: 412 SMKNTVGQDIILDSSSDEEHASNQFATSTMVKAALLNIKAKISKNMNLSKNAEQSINSPT 471
           +MKN+    I L+SSS+ E        S   KAALL IKAK S+N              +
Sbjct: 313 TMKNSPQNVIELNSSSESEDD----YKSQSSKAALLLIKAKRSRNKATKAKNMHVSTVDS 368

Query: 472 LKQLFISLKKANKKQILDHRREITEKRGISLEQLEQEREKVEDLLEQKIKRNRRIRLREK 531
           LK+LF SLK  N+ QIL+ RREI+ K+GISLE +E E+ +VE LLEQ+++RNRR++LREK
Sbjct: 369 LKELFTSLKTKNRDQILEFRREISGKKGISLEAIEDEKIQVEKLLEQELERNRRVKLREK 428

Query: 532 K 532
           +
Sbjct: 429 R 429

>YCL061C Chr3 complement(18816..22106) [3291 bp, 1096 aa] {ON}
            MRC1S-phase checkpoint protein required for DNA
            replication; interacts with and stabilizes Pol2p at
            stalled replication forks during stress, where it forms a
            pausing complex with Tof1p and is phosphorylated by
            Mec1p; protects uncapped telomeres
          Length = 1096

 Score =  228 bits (581), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 159/384 (41%), Positives = 224/384 (58%), Gaps = 58/384 (15%)

Query: 761  LKLRLQEKIKRQKQKEMRKLGVNKMVELEADESEDEWHGVGGVDYEASDEYDSDLDKMID 820
            L+L+ +EK    K KE++K GV    E+EA+ESEDEWHG+GG D E SD+YDSDL+KMID
Sbjct: 694  LQLKQKEKEHEAKIKELKKRGVTNFFEMEAEESEDEWHGIGGADGEGSDDYDSDLEKMID 753

Query: 821  DYNKNEFDPVEIRKILASEDLQHDKNMVNKILHDIKTGGFR-KRGRG-XXXXXXXXXXXG 878
            DY+KN F+P EIR++LA+E+ + D  M+NKIL+DIK GGFR KR +              
Sbjct: 754  DYSKNNFNPHEIREMLAAENKEMDIKMINKILYDIKNGGFRNKRAKNSLELELSDDDEDD 813

Query: 879  ILQSYRAKRWNEQKQKMLDSEHNTSVKSNPKSLPFFESMV-------------DEFTIPV 925
            +LQ YR KR    +++ L+   +  +  NPKS  FFESMV             +E+ + +
Sbjct: 814  VLQQYRLKRRELMRKRRLEIGDDAKLVKNPKSSAFFESMVEDIIEYKNPFGAEEEYNLDI 873

Query: 926  ERA---LGTPDSPPAQSTNVLELKQNTKQ--------KIVISEHFVKQTLSFLTSDENMT 974
                  L T D+    S NV +   N +Q        K++ISE FV+++LSFL S+ N  
Sbjct: 874  TSTATDLDTQDN----SINVGDNTGNNEQKPVDQKNKKVIISEDFVQKSLSFLKSN-NYE 928

Query: 975  NMRSEINVEKPNNDNDIYSSEVEDLYTLKETSTI-------------KVLNTYSGKPIVN 1021
            +  ++  + +  + ND     +EDLYTLK+ S+I             K +NT        
Sbjct: 929  DFETDKELSRIQHGND---EAIEDLYTLKQNSSIKSFTNSQTDSTTSKTVNTIIDLEKRP 985

Query: 1022 EDEDGAEFG-------FKAPSVMQTFGSRNDVNDKFKDGFKSVKISNKYKTLGSSRAAIT 1074
            EDED  E G       FK PS++++F SR D+NDKFK+G K+VKI   YKT+GSS+A+IT
Sbjct: 986  EDEDEVENGDTSLVGVFKHPSIIKSFASRTDINDKFKEGNKTVKILKSYKTVGSSKASIT 1045

Query: 1075 FLGKKRKLIIPKRSSKSPRDSAHR 1098
            ++GK RKLI PKR +    + +HR
Sbjct: 1046 YMGKTRKLIAPKRKT----EGSHR 1065

 Score = 82.0 bits (201), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 46/102 (45%), Positives = 72/102 (70%), Gaps = 4/102 (3%)

Query: 436 FATSTMVKAALLNIKAKISK-NMNLSKNAEQSINSPTLKQ--LFISLKKANKKQILDHRR 492
              S + KA +LN+KA++SK N  LS+   +S   P +    L  +L+KA++KQILDH++
Sbjct: 431 LPISQLSKATILNLKARLSKQNQKLSQRPNKS-KDPKVDHNVLLNTLRKASRKQILDHQK 489

Query: 493 EITEKRGISLEQLEQEREKVEDLLEQKIKRNRRIRLREKKKE 534
           E+ E +G+ LE + +E+E VE+LLEQ+I RN+RIR +EK++E
Sbjct: 490 EVIETKGLKLEDMAKEKEIVENLLEQEILRNKRIRQKEKRRE 531

>AFR745W Chr6 (1803046..1806102) [3057 bp, 1018 aa] {ON} Syntenic
            homolog of Saccharomyces cerevisiae YCL061C (MRC1)
          Length = 1018

 Score =  226 bits (576), Expect = 4e-60,   Method: Compositional matrix adjust.
 Identities = 157/412 (38%), Positives = 238/412 (57%), Gaps = 22/412 (5%)

Query: 686  YLTYRIKKFEGLSPSKSATTE----LDVKSDLAAESSILETIKDGNWRLXXXXXXXXXXX 741
            YLT RIKK++ LSP K+ T+      D +++L  ES    ++ + N +            
Sbjct: 587  YLTSRIKKYDDLSPVKTTTSTPKGLTDGRAELDHESPDGHSL-NTNLQQGLSKSESSSTK 645

Query: 742  XXXXXXXXXXXXXXXXXLMLKLRLQEKIKRQKQKEMRKLGVNKMVELEADESEDEWHGVG 801
                             L+ + R + +  + +++EM+K G+ KM+E+EA+ESEDEWHG+G
Sbjct: 646  VSEDELDQETRRKILSDLLARNRKRAERNKLRRREMKKKGITKMLEMEAEESEDEWHGIG 705

Query: 802  GVDYEASDEYDSDLDKMIDDYNKNEFDPVEIRKILASEDLQHDKNMVNKILHDIKTGGFR 861
            G D E S++YDS+++KMIDDY+ +  +   +R ILA  + QHD+N+VNKILHDI TGGFR
Sbjct: 706  GSDNELSEDYDSEVEKMIDDYSVHSSNADHLRAILAKNERQHDENIVNKILHDISTGGFR 765

Query: 862  KRGRGXXXXXXXXXXXGILQSYRAKRWNEQKQKMLDSEHNTSVKSNPKSLPFFESMVDEF 921
            +RG+G             LQ +R KR    KQK+L++   + + SNPKS  FF++MVD+ 
Sbjct: 766  RRGKGALDLEMSENEDQELQQFRQKRRELLKQKILENGDTSKLVSNPKSYAFFQTMVDDV 825

Query: 922  TIPVERALG-TPDSPPAQSTNVLELKQNTKQKIVISEHFVKQTLSFLTSDENMTNMRSEI 980
            T   E + G T D+   + T+         +KIVISE FVK+TLSFL+S    + + +E 
Sbjct: 826  T---EASFGNTFDANIDEKTD----PSAAGRKIVISEQFVKETLSFLSSKSGDSEIPAET 878

Query: 981  NVEKPNNDNDIYSSEVEDLYTLKETSTIKVLNTYSGKPIVNED---EDGAEFGF---KAP 1034
               K  + + +   E++DL+TLK+ S IK L      P    +    D  ++GF   +  
Sbjct: 879  ---KSISSSTVEREEIQDLHTLKQNSNIKHLKGSLELPAQMAELSSGDEGDYGFSLDRFR 935

Query: 1035 SVMQTFGSRNDVNDKFKDGFKSVKISNKYKTLGSSRAAITFLGKKRKLIIPK 1086
            S  ++F +  +V+DKFK G K+V+I    KT+G S+AAITF+G+KR+LI PK
Sbjct: 936  SAAKSFNNGTNVDDKFKSGTKAVRILKANKTIGGSKAAITFIGRKRRLIPPK 987

 Score =  111 bits (278), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 161/565 (28%), Positives = 257/565 (45%), Gaps = 102/565 (18%)

Query: 1   MDLLNLLPGKARRKTTYKIEHEKLSQEAGYIIIKPSN--AENVFANAIVDKVRNRL---E 55
           M+LL+ L   AR+KTTYK     +++++     +PS+     VF ++++D+VR RL   +
Sbjct: 1   MELLDGLCVSARKKTTYKKVRLGIAEQSKD---EPSSNKPAAVFRSSLLDRVRTRLNVED 57

Query: 56  GTISSPDRLDTLSSKLSETVGNLYDGEALEEDFDPNIDNSFKGMVNSYNVNFEHIKSKGT 115
           G   S D L+   S L++ V   YDGE LE  FD   D     +    +   E I+    
Sbjct: 58  GHAPSSDALEP-ESGLTDDV---YDGENLEVSFDVG-DAEDDCLPTQADGKPEQIEVNVG 112

Query: 116 MDHNRTIDAIPLPVKLDNGGIFASESNNHSLRDSKTDTISCNSLTSNHTQHARSSSGIHT 175
                    I +P+KL +GGIF+  +          D ++                    
Sbjct: 113 TAPEEPFSRIKIPLKLSDGGIFSPSTQVD-------DEMAM------------------- 146

Query: 176 AQLQETQKVITDVKSALFTXXXXXXXXXLQKVKAT--RISAPNFNTNEDRGYTQTQIIKN 233
            QLQ TQK+  +  +             L+   A   RIS            +QTQ+I  
Sbjct: 147 -QLQPTQKLPPESPALQAVDTHTELQDELETGVAVDGRIS-----------LSQTQVI-- 192

Query: 234 IQFDEGKYSETQLIPEITDDDDCRSLHNAQG-PDSQTLSTLADTLESKLSEKLRATVPNQ 292
                   S T   P   DD+   +  ++ G  D+Q   T   TL+  L++  +AT+P+ 
Sbjct: 193 -------VSGTNYGPTRVDDEVVATQQDSMGTADAQCWDT--QTLDCALADDFQATIPD- 242

Query: 293 VISQSNKKKEELAIHKFQRDLG-EAEDENNKVTEHILPSYVALQNHIFTKEAFLDDF--- 348
             + +  + E+L IH+ + ++  + + E   +T+     Y+  Q  +FTK+ FLD F   
Sbjct: 243 AQTLATARHEKLFIHQIEEEIATKTQKELPMMTQAKEAPYIPKQKLVFTKDNFLDSFDDD 302

Query: 349 ---ELSG------QEVDYSSTATRVKEXXXXXXXXXXXXXXNAVYDNLTDNFGTITRDAY 399
              E+ G      ++V Y+                        +Y  L     +IT  +Y
Sbjct: 303 SETEIHGGLDGSDRQVSYNDREHTETGPQSSQPATGEGQDTQVLYPALQSL--SITSKSY 360

Query: 400 AEEAKPPLLPLQSMKNTVGQDIILDSSSDEEHASNQFATSTMVKAALLNIKAKISKNMNL 459
            E                 + IILD SS+++   N   +S + KAA+L IKA+ SK +  
Sbjct: 361 QE----------------ARQIILDESSEDDTDVN--LSSAVSKAAVLAIKARNSKFITP 402

Query: 460 SKNAEQSINSPTLKQLFISLKKANKKQILDHRREITEKRGISLEQLEQEREKVEDLLEQK 519
            K  E    S    +LF  L+KAN++Q+L+ RR   E+RGI+++ LEQERE++ +LLEQ+
Sbjct: 403 QKIDE--TKSSKSNELFAKLRKANREQLLEQRRNAIERRGINMQNLEQEREQLGNLLEQE 460

Query: 520 IKRNRRIRLREKKKENELRLRYEDI 544
           ++RNRRIR+REKK E E RL  E++
Sbjct: 461 LERNRRIRIREKKIERE-RLENENV 484

>Suva_3.152 Chr3 complement(228665..232087) [3423 bp, 1140 aa] {ON}
            YCL061C (REAL)
          Length = 1140

 Score =  223 bits (568), Expect = 6e-59,   Method: Compositional matrix adjust.
 Identities = 157/400 (39%), Positives = 230/400 (57%), Gaps = 50/400 (12%)

Query: 764  RLQEKIKRQKQKEMRKLGVNKMVELEADESEDEWHGVGGVDYEASDEYDSDLDKMIDDYN 823
            R +EK +  K KE++  GV    E+EA+ESEDEWHGVGG D E SDEYDS+++KMIDDY+
Sbjct: 746  RQKEKEQATKLKELKSKGVTNFFEMEAEESEDEWHGVGGADGEGSDEYDSEVEKMIDDYS 805

Query: 824  KNEFDPVEIRKILASEDLQHDKNMVNKILHDIKTGGFR-KRGRGXXXXXXXXXXXGILQS 882
            KN+F+  EIR++LA+E+ + D  M+NKIL+DIK GGFR KR +             +LQ 
Sbjct: 806  KNKFNSHEIREMLAAENKEMDVKMINKILYDIKNGGFRNKRAKNSLELELSDDEDDVLQQ 865

Query: 883  YRAKRWNEQKQKMLDSEHNTSVKSNPKSLPFFESMVD---EFTIP-------------VE 926
            YR KR    +++ L+   +T +  NPKS  FFESMV+   EF  P               
Sbjct: 866  YRLKRRELMRKRRLEIGDDTKLVKNPKSKAFFESMVEDIMEFKNPFGAEKESDQDVTSTA 925

Query: 927  RALGTPD---SPPAQSTNVLELKQNT---KQKIVISEHFVKQTLSFLTSD--ENMTNMRS 978
              L T D   + P  +T+  E  ++     +K++ISE FV+++LSFL S+  +     R 
Sbjct: 926  TDLDTQDNDNTKPGDNTSNNEHNKHVGDKSKKLIISEDFVQKSLSFLKSNNYDEFEMDRE 985

Query: 979  EINVEKPNNDNDIYSSEVEDLYTLKETSTIK--------VLNTYSGKPIVN--------- 1021
               ++  N + D+      DL+TLK+ S+IK         L++ +   ++N         
Sbjct: 986  LARIQHGNGEGDVV-----DLFTLKQHSSIKSFTNSQTNSLSSRTMNTVINLEEHTEGND 1040

Query: 1022 EDEDGAE---FGFKAPSVMQTFGSRNDVNDKFKDGFKSVKISNKYKTLGSSRAAITFLGK 1078
            E E+G +    GFK PSV+++F SR D+NDKFK+G K+VKIS  YKT+GSS+A+IT++GK
Sbjct: 1041 EGENGDQSLIGGFKHPSVIKSFASRTDINDKFKEGNKTVKISKSYKTVGSSKASITYMGK 1100

Query: 1079 KRKLIIPKRSSKSPRDSAHRSIKNRLKHQAFLENTDTFEA 1118
             RKL+ PKR ++      H       K + F    D+F++
Sbjct: 1101 TRKLMAPKRKTEENHHPNHIKKSKTQKSKLFENGQDSFDS 1140

 Score = 70.1 bits (170), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 77/249 (30%), Positives = 126/249 (50%), Gaps = 46/249 (18%)

Query: 304 LAIHKFQRDLGEAEDENNKVTEHILPSYVALQNHI-----FTKEAFLDDFELSGQEVD-- 356
           L IH+ Q +L   ED N K  ++    Y  LQ  I     F+KE+FL DF+ S  + D  
Sbjct: 318 LKIHELQSELA-LEDFNRKKAQNT--EYRKLQKTIPIVKRFSKESFLADFDNSSSDEDTN 374

Query: 357 YSSTATRVKEXXXXXXXXXXXXXXNAVYDNLTDNFGTITRDAYAEEAKPPLLPLQS-MKN 415
           +   +++ K+                 Y+ + D   +  + A  E  K   +PL S   N
Sbjct: 375 FKLESSQPKQQQNG-------------YE-MIDISQSNPQPAEKENKKDKKVPLLSTYAN 420

Query: 416 TVGQDII--------LDSSSDEEHASNQ-----------FATSTMVKAALLNIKAKISK- 455
            + ++I         LDS SD+++ ++               S + KA + N+KA++SK 
Sbjct: 421 NLKREIDSSKCITLDLDSGSDKDNDNHMDTDKLNEDESALPISQLSKATIFNLKARLSKQ 480

Query: 456 NMNLSKNAEQSINSPT-LKQLFISLKKANKKQILDHRREITEKRGISLEQLEQEREKVED 514
           N  L++ + ++ +  +   +L  +L+KA++KQILDH+REI E +G  LE + +E+E VED
Sbjct: 481 NQKLAQGSNKNKDFKSDHNKLINTLRKASRKQILDHQREIVETKGFKLEDMVKEKEIVED 540

Query: 515 LLEQKIKRN 523
           LLEQ+I RN
Sbjct: 541 LLEQEILRN 549

>Skud_3.3 Chr3 complement(6855..10313) [3459 bp, 1152 aa] {ON} YCL061C
            (REAL)
          Length = 1152

 Score =  220 bits (561), Expect = 4e-58,   Method: Compositional matrix adjust.
 Identities = 152/378 (40%), Positives = 223/378 (58%), Gaps = 47/378 (12%)

Query: 762  KLRLQEKIKRQKQKEMRKLGVNKMVELEADESEDEWHGVGGVDYEASDEYDSDLDKMIDD 821
            +LR +EK    + KE +  G+    E+EA+ESEDEWHGVGG D E S+EYDS+++KMIDD
Sbjct: 756  QLRQKEKKHVAELKEFKSKGITNFFEMEAEESEDEWHGVGGADGEGSEEYDSEVEKMIDD 815

Query: 822  YNKNEFDPVEIRKILASEDLQHDKNMVNKILHDIKTGGFR-KRGRGXXXXXXXXXXXGIL 880
            Y+KN F+  EIR++LA+E+ + D  M+N+IL+DIK GGFR KR +             +L
Sbjct: 816  YSKNSFNSHEIREMLAAENKEMDVKMINRILYDIKNGGFRNKRAKNSLELELSDDEDDVL 875

Query: 881  QSYRAKRWNEQKQKMLDSEHNTSVKSNPKSLPFFESMVD---EFTIPV-------ERALG 930
            Q YR KR    +++ L+   +T +  NPKS  FFESMV+   EF  P        +    
Sbjct: 876  QQYRLKRRELMRKRRLEIGDDTKLVKNPKSKAFFESMVEDIMEFKNPFKAEEESHQDLTS 935

Query: 931  TPDSPPAQSTNVLELKQNTK-----------QKIVISEHFVKQTLSFLTSDENMTNMRSE 979
            T      Q  + +++  +T+           +K +ISE FV+++LSFL S+ N      E
Sbjct: 936  TATDLDTQDNDSIQIGDSTRNNEHRRVDDRSKKTIISEDFVQKSLSFLRSN-NYDEF--E 992

Query: 980  INVEKPNNDNDIYSSEVEDLYTLKETSTIKVL-----NTYSGKPIVN------------- 1021
            ++ E+    +DI    VEDL+TLK+ S+IK       ++ S K + +             
Sbjct: 993  MDKERARIQHDIGDEGVEDLFTLKQHSSIKSFTNSPTDSLSSKRVNSMIDLEQPTEDNNE 1052

Query: 1022 -EDEDGAEF-GFKAPSVMQTFGSRNDVNDKFKDGFKSVKISNKYKTLGSSRAAITFLGKK 1079
             E+ED +   GFK PS++++F SR D+NDKFK+G K+VKIS  YKT+GSS+A+IT++GK 
Sbjct: 1053 VENEDPSLIGGFKHPSIIKSFASRTDINDKFKEGNKTVKISKTYKTVGSSKASITYMGKT 1112

Query: 1080 RKLIIPKRSSKSPRDSAH 1097
            RKL+ PK+  K+ RD  H
Sbjct: 1113 RKLMAPKK--KADRDHHH 1128

 Score = 77.8 bits (190), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 44/91 (48%), Positives = 67/91 (73%), Gaps = 2/91 (2%)

Query: 439 STMVKAALLNIKAKISK-NMNLSKNAEQSINSPT-LKQLFISLKKANKKQILDHRREITE 496
           S + KAA+LN+KA++SK + NL++   ++  +     +LF  L+KA++KQILDH+RE+ E
Sbjct: 492 SRLSKAAILNLKARLSKQSQNLTQMPNKNKGAKVDHNKLFNILRKASRKQILDHQREVIE 551

Query: 497 KRGISLEQLEQEREKVEDLLEQKIKRNRRIR 527
            +G  LE + +E+E VE+LLEQ+I RNRRIR
Sbjct: 552 TKGFKLEDMAKEKEIVENLLEQEILRNRRIR 582

 Score = 34.7 bits (78), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 23/55 (41%), Positives = 33/55 (60%), Gaps = 12/55 (21%)

Query: 41  VFANAIVDKVRNRLEGT-ISSPDRL-------DTLSSKLSETVGNLYD-GEALEE 86
           +F NA +++V+NRLEG  +   DR        D +S++L   + NLYD GE LEE
Sbjct: 110 LFGNATLNRVKNRLEGIDVPEDDRQIKDNENEDAVSTQL---IANLYDGGEDLEE 161

>KAFR0D00140 Chr4 complement(13233..16358) [3126 bp, 1041 aa] {ON}
            Anc_1.5 YCL061C
          Length = 1041

 Score =  217 bits (553), Expect = 3e-57,   Method: Compositional matrix adjust.
 Identities = 144/360 (40%), Positives = 211/360 (58%), Gaps = 43/360 (11%)

Query: 760  MLKLRLQEKIKRQ-----KQKEMRKLGVNKMVELEADESEDEWHGVGGVDYEASDEYDSD 814
            +++ + Q +++RQ     K+KEM+  G+   +E EA+ESEDEWHG+GG+D E SDEYDS+
Sbjct: 663  LIEEKKQHELERQRKQMKKRKEMKAKGITNFLEEEAEESEDEWHGIGGIDGEMSDEYDSE 722

Query: 815  LDKMIDDYNKNEFDPVEIRKILASEDLQHDKNMVNKILHDIKTGGFRKRGRGXXXXXXXX 874
            ++KMIDDY+K  F+P EIR++LA E+ + D  MV KIL+DIK GGFRKR +G        
Sbjct: 723  VEKMIDDYSKANFNPDEIRQMLADENKETDIKMVEKILYDIKNGGFRKRRKGAMDLELSD 782

Query: 875  XXXGILQSYRAKRWNEQKQKMLDSEHNTSVKSNPKSLPFFESMVDE-------FTI--PV 925
                 L+ YR KR    +QK L+     ++  NPKS  FFESMVD+       F +  P 
Sbjct: 783  EEDDELKQYRLKRRELMRQKRLEVGEAETLVKNPKSKAFFESMVDDIVEVKNPFAVFEPQ 842

Query: 926  ERALGTPDSPPAQSTNVLE--LKQNTKQKIVISEHFVKQTLSFLTSDENM------TNMR 977
                 T D    ++ N  E    QN  +K+++SE FV++TLSFL S ++M       +MR
Sbjct: 843  RSGTITTDDGTQENANSNEGAASQNPSKKVMLSEEFVQRTLSFLNSSKDMDQFAPARSMR 902

Query: 978  SEINVEKPNNDNDIYSSEVEDLYTLKETSTIKVLNT----YSGKPIVNEDEDGAEFG--- 1030
            +E N E            +EDL  LK+ S+IK   T     S +P   + E+   F    
Sbjct: 903  AEANDEL-----------IEDLTALKKQSSIKSFKTTRASVSQEPTDFDKENDDSFDDLL 951

Query: 1031 ---FKAPSVMQTFGSRNDVNDKFKDGFKSVKISNKYKTLGSSRAAITFLGKKRKLIIPKR 1087
                   S+M+TF +  D+NDKF++G K+VK+S  YK++ SS+A+IT++GK RKL+ P++
Sbjct: 952  NSRVGTSSIMKTFSATVDINDKFQEGVKTVKVSKAYKSVSSSKASITYMGKMRKLVAPQK 1011

 Score = 92.0 bits (227), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 91/319 (28%), Positives = 156/319 (48%), Gaps = 37/319 (11%)

Query: 243 ETQLIPEITDDDDCRSLHNAQGPDSQTLSTLADTLESKLSEKLRATVPNQVISQSNKKKE 302
           +TQ+IP   DDD   +L   +G  +Q  ++    L++++      T  +  +S +     
Sbjct: 243 DTQIIPREFDDD-ASTLPIPEGDKTQKDTSAV--LKTQIDSTTEGTSYSATVSDT----- 294

Query: 303 ELAIHKFQRDLGEAEDENN--KVTEHI-LPSYVALQNHIFTKEAFLDDFELSGQEVDYSS 359
            L IH+ QR+L E++      +  +H+  P  V     +FTKE++ D+F       D   
Sbjct: 295 -LKIHEIQRELEESQKTKTIPEYKQHVRTPKNVI----VFTKESYFDEF-------DSDD 342

Query: 360 TATRVKEXXXXXXXXXXXXXXNAVYDNLTDNFGTITRDAYAEEAKPPL-------LPLQS 412
                                 +  D   D      +   +   KP L       L L+ 
Sbjct: 343 EEKEENLESEGDSQKVQLLKNTSPSDKSNDGKRLPDKTRTSPSFKPKLHGLNNYELKLKR 402

Query: 413 MKNTVGQDIILDSSSDEEHASNQFA----TSTMVKAALLNIKAKISKNMNLSKNAEQSIN 468
             N+  Q I L+  SD+E   ++       S M KA + +IKA++SK   + K +  S  
Sbjct: 403 QLNS-DQQIDLNLDSDDEDGIDRMGEKGPISQMSKATVFDIKARLSKKRPIVKISNDS-- 459

Query: 469 SPTLKQLFISLKKANKKQILDHRREITEKRGISLEQLEQEREKVEDLLEQKIKRNRRIRL 528
             TL  LF  L+KA+++QI++H++E+ EK+G++LE +E+E++ VE+LLEQ+I RN++IR 
Sbjct: 460 KTTLHTLFNKLQKASRQQIIEHQKEVIEKKGLNLEDIEKEKKIVENLLEQEINRNKKIRQ 519

Query: 529 REKKKENELRLRYEDINNC 547
           REK++E +L    +D N+ 
Sbjct: 520 REKEREKQLADAQDDENDL 538

>Kpol_2002.8 s2002 complement(11914..14871) [2958 bp, 985 aa] {ON}
            complement(11914..14871) [2958 nt, 986 aa]
          Length = 985

 Score =  216 bits (550), Expect = 4e-57,   Method: Compositional matrix adjust.
 Identities = 151/373 (40%), Positives = 221/373 (59%), Gaps = 30/373 (8%)

Query: 764  RLQEKIKRQKQKEMRKLGVNKMVELEADESEDEWHGVGGVDYEASDEYDSDLDKMIDDYN 823
            R QE+ +RQK +E++  G+  M E+EA+ESEDEWHG+GGVD E SDEYDS+++KMIDDY+
Sbjct: 623  RDQERKQRQKLRELKDKGITDMFEVEAEESEDEWHGIGGVDGELSDEYDSEVEKMIDDYS 682

Query: 824  KNEFDPVEIRKILASEDLQHDKNMVNKILHDIKTGGFRKRGRGXXXXXXXXXXXGILQSY 883
            K  F+  EIR+ LA+E+   D  MVN+IL+DIK GGFRKR R              L++Y
Sbjct: 683  KENFNAGEIREKLAAENKDMDLKMVNRILNDIKNGGFRKR-RNALEIELSDDEDDDLKAY 741

Query: 884  RAKRWNEQKQKMLDSEHNTSVKSNPKSLPFFESMVDEFTIPVERAL---------GTPDS 934
            RAKR    K+K L+++HN  + +N KS  F ESMVD+  + V+             TP++
Sbjct: 742  RAKRRQLMKEKRLETDHNKKLMTNKKSHAFLESMVDDI-VEVKNPFDERDDNIMDDTPET 800

Query: 935  PPAQSTNVLELKQNTKQKIVISEHFVKQTLSFLTSDENMTNMRSEINVEKPNNDNDIYSS 994
                  N  EL  N K+K ++SE FV+++LSFL+S  N+       N+ K       +S 
Sbjct: 801  DAEGDVNSNEL-LNKKKKFILSEAFVQKSLSFLSSSRNLEEFEMNNNLAKEQ-----HSH 854

Query: 995  EVEDLYTLKETSTIKVLNTYSGK---------PIVNEDEDGAEF-GFKAPSVMQTFGSRN 1044
               D++ LK   +IK L +  G           +++E+     F G K  SV+++F S  
Sbjct: 855  AATDMFALKSHCSIKSLESLPGSHNNSISSKLDLLHEEIVSTPFSGLKQTSVIKSFSSSI 914

Query: 1045 DVNDKFKDGFKSVKISNKYKTLGSSRAAITFLGKKRKLIIPKRSSKSPRDSAHRSIKNRL 1104
            D++ KFKDG K+VK+S  Y+T+GS++A+IT+LGK RKL+ PK+    P   +H+S K   
Sbjct: 915  DIDSKFKDGNKTVKVSKSYRTVGSAKASITYLGKARKLVPPKKKEHKPH--SHKS-KTAS 971

Query: 1105 KHQAFLENTDTFE 1117
              + F E  ++FE
Sbjct: 972  ASRLFDEQDNSFE 984

 Score = 79.7 bits (195), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 64/153 (41%), Positives = 100/153 (65%), Gaps = 12/153 (7%)

Query: 399 YAEEAKPPLLPLQSMKNTVGQDI----ILDSSSDEEHASNQFATSTMVKAALLNIKAKIS 454
           +++E+K   + L + +N + +DI     ++ S  E+        S   KA +L+IKA +S
Sbjct: 317 FSKESK--FIGLSNYENILKKDINKQNCIEFSDSEDETEVTSKVSRASKATILSIKANLS 374

Query: 455 KNMNLSKNAEQSINSP-TLKQLFISLKKANKKQILDHRREITEKRGISLEQLEQEREKVE 513
           ++    K A+ SIN+   L  LF  LKKA K QILDH++EI E++G  +E++E+E+E VE
Sbjct: 375 RH----KPAQSSINNKNALGNLFSDLKKATKAQILDHKKEIMEQKGYKMEEIEKEKEIVE 430

Query: 514 DLLEQKIKRNRRIRLREKKKENELRLRYEDINN 546
           +LLEQ+I+RNR+IR+REK+KE EL+ R + I N
Sbjct: 431 NLLEQEIERNRKIRIREKQKE-ELKKRKQRIEN 462

>NDAI0A00140 Chr1 complement(8373..11648) [3276 bp, 1091 aa] {ON}
            Anc_1.5 YCL061C
          Length = 1091

 Score =  215 bits (548), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 149/370 (40%), Positives = 212/370 (57%), Gaps = 53/370 (14%)

Query: 762  KLRLQEKIKRQKQKEMRKLGVNKMVELEADESEDEWHGVGGVDYEASDEYDSDLDKMIDD 821
            K+++Q++  R K+KEM K GV K  E+EA+ESEDEWHG+GG+D E SDEYDSD++KMIDD
Sbjct: 705  KIKMQQEKMRHKEKEMMKKGVTKFFEMEAEESEDEWHGIGGIDGEMSDEYDSDVEKMIDD 764

Query: 822  YNKNEFDPVEIRKILASEDLQHDKNMVNKILHDIKTGGFRKRGRGX-XXXXXXXXXXGIL 880
            Y+K  FDP EIR++LA+E+ + D NM+NKIL+DIK GGFRKR RG              L
Sbjct: 765  YSKANFDPNEIREMLAAENKEMDLNMINKILYDIKNGGFRKRKRGGLELELSEDEDDDAL 824

Query: 881  QSYRAKRWNEQKQKMLD-SEHNTSVKSNPKSLPFFESMVDEFTIPV----ERALGTPDSP 935
            + Y  KR    +++ L+  +    +  NPKS  FFESMV++ T       +  LG   + 
Sbjct: 825  REYHLKRKELMRKRRLELGDDEKKLVKNPKSKAFFESMVEDITDDKNAFNDEPLGETSTQ 884

Query: 936  PAQST-------NVLELKQN------TKQKIVISEHFVKQTLSFLTSDENMTNMRSEINV 982
               +T       +   +K+N       K+K +ISE FV++TLSFL S           N+
Sbjct: 885  EINNTQDDMKEEDAAVVKENGDSKRIKKKKTIISEEFVQRTLSFLKSSREDEEFAMNENL 944

Query: 983  EKPNNDNDIYSSEVEDLYTLKETSTIKVLNTYSG--------------------KPIVNE 1022
             K       + ++VE+L +LK+ S+IKV  + S                      PI   
Sbjct: 945  AKEQ-----HGTKVENLLSLKQQSSIKVFQSPSNNSSKVIKLDDINNDDDDDEDSPIA-- 997

Query: 1023 DEDGAEFGFKAPSVMQTFGSRNDVNDKFKDGFKSVKISNKYKTLGSSRAAITFLGKKRKL 1082
                    FK PS++++FGS+ D+N+KF+DG K+V IS  Y+T+GSS+A+IT+LGK RKL
Sbjct: 998  -------LFKVPSILKSFGSKTDINEKFQDGNKTVTISKSYRTVGSSKASITYLGKSRKL 1050

Query: 1083 IIPKRSSKSP 1092
            + P  S   P
Sbjct: 1051 MAPTHSKMKP 1060

 Score = 95.1 bits (235), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 172/600 (28%), Positives = 267/600 (44%), Gaps = 122/600 (20%)

Query: 1   MDLL--NLLPGKARRKTTY---KIEHEKLSQEAGYIIIKPSNAENV----------FANA 45
           MD L  +L P    RKTTY    ++     QE   I+   ++  NV          F N+
Sbjct: 1   MDSLIDDLKPVTKVRKTTYNKKSLDPSIEEQEEDGILTDVTSGGNVTPTILGTGFLFKNS 60

Query: 46  IVDKVRNRLEGTISSPDRLDTLSSKLSET--VGNLY-DGEALEEDFDPNIDNS-FKGMVN 101
            +DKVR RL G          L+S   ET  + NLY +GE LE+D   +I  S  + + N
Sbjct: 61  TIDKVRARLSGKNYIEQEKTPLASSEQETQIITNLYTNGEDLEKDLIKHIPVSQTQPITN 120

Query: 102 SYNVNFEHIKSKGTMDHNRTIDAIPLPVKLDNGGIFASESNNHSLRDSKTDTISCNSLTS 161
           +        + K T+D+    D+  +P ++    I ++E ++ +   ++   ++      
Sbjct: 121 TGERTQLEQEIKVTIDN----DSNEMPTQV----IGSTERDDETAERTQIGEVA------ 166

Query: 162 NHTQHARSSSGIHTAQLQETQKVITDVKSALFTXXXXXXXXXLQKVKATRI---SAPNFN 218
             TQ     +   T+ +Q+TQ+                     Q +K  RI   S  N N
Sbjct: 167 --TQLIPGDTYDRTSTMQKTQE---------------------QLLKTQRIPQNSRDNHN 203

Query: 219 ----TNEDRG---YTQTQIIKNIQ---------FDEGKYSETQLIPEITDDDDCRSLHNA 262
                NE  G   +T TQ IKN +         F  G  S+T LI   T+ D+ R+ +  
Sbjct: 204 QTNIINESFGSVPFTFTQKIKNFETNITNENDDFTNGSKSQTVLIS--TNVDNVRAEYVD 261

Query: 263 QGPDSQTLSTLADTL--ESKLSEKLRATVPNQVISQSNKKKEELAIHKFQRDLGEAED-- 318
                   + +A T+  +   S  L  TV +  +S  +     LAIHKFQ++L E E   
Sbjct: 262 ASSSLLQATAIAATVRDDGPSSTALVGTVADDKLSSGSN----LAIHKFQKELEEEEQLA 317

Query: 319 ENNKVTEHILPSYVALQNHI-FTKEAFLDDFE--------LSGQEVDYSSTATRVKEXXX 369
            N+K  E+   S   L N + FTK++FL  F+          G +V    T    KE   
Sbjct: 318 NNSKYKEYKGISKPILTNIVKFTKDSFLQGFDNSSSSSSEEEGDKV--KETKRNGKENTS 375

Query: 370 XXXXXXXXXXXNAVYDNLT-----------DNFGTITRDAYAEEAKPPLLPLQSMKNTVG 418
                       A  D  T               T++R  Y  + K  L     ++  +G
Sbjct: 376 SNSYSTKNNNSTASSDGTTIKPKIKSPKKFSKLNTLSR--YENKLKTVLNSKNQLQ--LG 431

Query: 419 QDIILDSSSDEEHASNQFATSTMVKAALLNIKAKISKN---MNLSKNAEQSINSPTLKQL 475
            D   D SSD+    N    S   KA +L IKA++SK     N+ K+   + N   L +L
Sbjct: 432 SD---DESSDD--TENSLPVSRTSKATILTIKARLSKQKSKKNVQKDGTVNTN---LNKL 483

Query: 476 FISLKKANKKQILDHRREITEKRGISLEQLEQEREKVEDLLEQKIKRNRRIRLREKKKEN 535
           F +LKK+++KQIL+++RE+ E +G++ E +E E+E VE+LLEQ+IKRN++IR REK++E+
Sbjct: 484 FENLKKSSRKQILENQRELIENKGLNFEDIEMEKELVENLLEQEIKRNQKIRQREKERED 543

>KLTH0F00484g Chr6 complement(37017..39998) [2982 bp, 993 aa] {ON}
            weakly similar to uniprot|P25588 Saccharomyces cerevisiae
            YCL061C MRC1 S-phase checkpoint protein found at
            replication forks required for DNA replication also
            required for Rad53p activation during DNA replication
            stress where it forms a replication-pausing complex with
            Tof1p and is phosphorylated by Mec1p protein involved in
            replication checkpoint
          Length = 993

 Score =  214 bits (546), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 140/370 (37%), Positives = 213/370 (57%), Gaps = 14/370 (3%)

Query: 759  LMLKLRLQEKIKRQKQKEMRKLGVNKMVELEADESEDEWHGVGGVDYEASDEYDSDLDKM 818
            L+ K + +E ++  K +++ +   +++++ EA+ES+DEWHG+GGVD E  D++DSDL+KM
Sbjct: 628  LIEKHKRKELLREAKLEKLHQSKASRIIDYEAEESDDEWHGIGGVDGERFDDHDSDLEKM 687

Query: 819  IDDYNKNEFDPVEIRKILASEDLQHDKNMVNKILHDIKTGGFRKRGRGXXXXXXXXXXXG 878
            IDDY+ + FD  E+RK    E++  DK+MVNKILHDI+TGGFRKRGR             
Sbjct: 688  IDDYSNSRFDSSEVRKRQIEEEISEDKSMVNKILHDIETGGFRKRGRNALDLELSDDDDE 747

Query: 879  ILQSYRAKRWNEQKQKMLDSEHNTSVKSNPKSLPFFESMVDEFTIPVERALGTPDSPPAQ 938
             L  Y ++R    +QK+        +  NPKS  FFE++V++  I  + AL     PP +
Sbjct: 748  ELLKYHSRRKELLRQKVSAQGEAKLLAENPKSKAFFETIVED--IRSKGALEDEGPPPVR 805

Query: 939  ---STNVLELKQNTK----QKIVISEHFVKQTLSFLTSDENMTNMRSEINVEK-PNNDND 990
               S N  E K +      +K V+SE FV+QTLSFLTS E       E N+   P +   
Sbjct: 806  GFSSVNAPEEKNSDSDKKGKKTVLSEAFVQQTLSFLTSGEVGEEKGPENNLGSLPTHVPS 865

Query: 991  IYSSEVEDLYTLKETSTIKVLN--TYSGKPIVNEDEDGAEFGFKAPSVMQTFGSRNDVND 1048
              + E +D++ LK+ S+IK L+  T +   ++ +D++      +A S    F  R D N+
Sbjct: 866  FNTEETQDIFALKQNSSIKSLSAPTRNSSNMLIDDQEDLLSRKRACSFFARFTKRVDANE 925

Query: 1049 KFKDGFKSVKISNKYKTLGSSRAAITFLGKKRKLIIPKRSSKSPRDSAHRSIKNRLKHQA 1108
            KF++G K+V+  N YK  GSS+A+IT+LGK RKL  PK+ +   + S  R  K       
Sbjct: 926  KFEEGKKTVRSLNSYKVAGSSKASITYLGKARKLNAPKKVAH--QQSRKRGHKPAAGFGI 983

Query: 1109 FLENTDTFEA 1118
            F  N+++FE+
Sbjct: 984  FASNSESFES 993

 Score = 72.4 bits (176), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 39/96 (40%), Positives = 68/96 (70%), Gaps = 2/96 (2%)

Query: 443 KAALLNIKAKISKNMN--LSKNAEQSINSPTLKQLFISLKKANKKQILDHRREITEKRGI 500
           KAA+L++KA++SK     L   ++ + N  + + LF SL+KANK QILD+R+E  + +GI
Sbjct: 360 KAAILDLKARLSKKSQSLLIPRSKVTSNFSSHQILFASLRKANKSQILDYRKEKYQSKGI 419

Query: 501 SLEQLEQEREKVEDLLEQKIKRNRRIRLREKKKENE 536
             +++ +E+  +E LLE+++ RN++IRLRE ++E +
Sbjct: 420 DYDKITEEKNSIESLLERELARNKKIRLREIEQERQ 455

>TPHA0E04010 Chr5 (839903..842800) [2898 bp, 965 aa] {ON} Anc_1.5
            YCL061C
          Length = 965

 Score =  214 bits (544), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 151/373 (40%), Positives = 219/373 (58%), Gaps = 39/373 (10%)

Query: 765  LQEKIKRQKQ---------KEMRKLGVNKMVELEADESEDEWHGVGGVDYEASDEYDSDL 815
            + E I++QK+         KEM+  GV+KM E+EA+ESEDEWHG+GGVD + SD YDS++
Sbjct: 590  ISEGIRKQKELEKREAKRLKEMKTSGVSKMFEVEAEESEDEWHGIGGVDSDFSDAYDSEV 649

Query: 816  DKMIDDYNKNEFDPVEIRKILASEDLQHDKNMVNKILHDIKTGGFRKRGRGXXXXXXXXX 875
            +KMIDDY++  F+P EIR++LA E+ + D  +VNKIL+DIK GGFR R R          
Sbjct: 650  EKMIDDYSRQNFNPSEIREMLAKENKETDLALVNKILYDIKNGGFRTRKRRDRDLEFSDD 709

Query: 876  XXGILQSYRAKRWNEQKQKMLDSEHNTSVKSNPKSLPFFESMV----------DEFTIPV 925
                L++YRAKR    ++K LD E +  +  NPKS  FFES+V          D+    +
Sbjct: 710  DDDDLKAYRAKRRALMREKRLDIEGDKKIVKNPKSKAFFESIVDDIIETKNPFDDMNTSI 769

Query: 926  ERALGTPDSPPAQSTNVLELKQNT---KQKIVISEHFVKQTLSFLTSDENMTNMRSEINV 982
            E+ +   ++P     N  +L  N    K+KIVISE FV+++LSFL    N    + E  +
Sbjct: 770  EQIV-EKETPTVDIDNDEKLATNVTKKKKKIVISEEFVQRSLSFL----NSCREQDEFEI 824

Query: 983  EKPNNDNDIYSSEVEDLYTLKETSTIKVLNTYSGKPI------VNE---DEDGAEFG-FK 1032
               +N  +  +S   DLYTLK  S+IK L + +          +NE      G+ F   +
Sbjct: 825  NNQHNGGEKATS-TADLYTLKRYSSIKTLQSVTSSRSSSIASNLNEQPSQSSGSLFNDLR 883

Query: 1033 APSVMQTFGSRNDVNDKFKDGFKSVKISNKYKTLGSSRAAITFLGKKRKLIIPKRSSKSP 1092
              SV+ +F S  D+N KFK+G KSVK+SN YKT+GS+RA+IT++G  R+L+ PK+S  + 
Sbjct: 884  KTSVLNSFSSDVDINSKFKEGTKSVKVSNAYKTVGSARASITYMGTSRRLVAPKKSRLTT 943

Query: 1093 RDSAH-RSIKNRL 1104
               A+ R+  +RL
Sbjct: 944  SSKANSRTTPSRL 956

 Score = 68.9 bits (167), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 53/117 (45%), Positives = 84/117 (71%), Gaps = 6/117 (5%)

Query: 419 QDIILDSSSDEEHASNQFATSTMVKAALLNIKAKISKNM-NLSKNAEQSINSPTLKQLFI 477
           + II  S SDE+  +N  + S   KA +LNI+A  SK    +S+ ++Q+    TL  L+ 
Sbjct: 337 EQIIEFSESDEDSDTN-ISPSYASKAVILNIRANKSKQQPKVSQKSDQT----TLLMLYN 391

Query: 478 SLKKANKKQILDHRREITEKRGISLEQLEQEREKVEDLLEQKIKRNRRIRLREKKKE 534
           +LK+A+K+QI+ +++E+ EK+GI+LE+LE+E E VE+LLEQ+I RN++IR REK+K+
Sbjct: 392 NLKRASKEQIVSYQKELMEKKGINLEELEKENEIVENLLEQEIARNQKIRQREKQKQ 448

>CAGL0B00330g Chr2 complement(18031..21441) [3411 bp, 1136 aa] {ON}
            similar to uniprot|P25588 Saccharomyces cerevisiae
            YCL061c
          Length = 1136

 Score =  211 bits (536), Expect = 4e-55,   Method: Compositional matrix adjust.
 Identities = 138/343 (40%), Positives = 201/343 (58%), Gaps = 29/343 (8%)

Query: 765  LQEKIKRQKQKEMR---KL------GVNKMVELEADESEDEWHGVGGVDYEASDEYDSDL 815
            +++++KRQ+++E++   KL      GVN+  E EA+ES+DEW G+GGVD +   EYDS++
Sbjct: 777  IKQQVKRQQEREVKERKKLQELANKGVNQYFEEEAEESDDEWRGIGGVDGDDFGEYDSEV 836

Query: 816  DKMIDDYNKNEFDPVEIRKILASEDLQHDKNMVNKILHDIKTGGFRKRGRGXXXXXXXXX 875
            +KMIDDY+K E D   +R+ +  E+ + D  +VNKIL+DIK GGFRKRGR          
Sbjct: 837  EKMIDDYSKTEVDLTSLRQKIMDENKEMDLKLVNKILYDIKNGGFRKRGRNDMELEFSDD 896

Query: 876  XXGILQSYRAKRWNEQKQKMLDSEHNTSVKSNPKSLPFFESMVDEFTIPVERALGTPDSP 935
                LQ +R KR    KQ+ML++E    +  NPKS  FFESM+ +            D  
Sbjct: 897  EDAELQEFRRKRRELMKQRMLENEDTDKLTKNPKSKAFFESMIVDLVEDKNNFDDLSDQI 956

Query: 936  PAQSTNVL---------ELKQNTKQKIVISEHFVKQTLSFLTSDENMTNMRSEINVEKPN 986
              +  N+          E K N + KI ISE FV++TLSFL +DE+    +    + K  
Sbjct: 957  ELKEENITQEDNEKEYNEAKSNKRGKIRISEDFVQKTLSFLHNDESTQEFQPSFIMSKEK 1016

Query: 987  NDNDIYSSEVEDLYTLKETSTIKVLNTYS-GKPIVNEDEDG-AEF-GFKAPSVMQTFGSR 1043
                     + D+  LK  S++   +  S  + I+N++ED   EF  FK PS++Q+F S+
Sbjct: 1017 G--------IGDMNALKSNSSLSFCSKLSTSRKIINDEEDVIEEFESFKRPSIIQSFSSK 1068

Query: 1044 NDVNDKFKDGFKSVKISNKYKTLGSSRAAITFLGKKRKLIIPK 1086
              ++DKFKDG KSVK+S  YKT+G S+A+IT+LGK RKL+ PK
Sbjct: 1069 FTIDDKFKDGNKSVKVSTSYKTVGGSKASITYLGKTRKLVPPK 1111

 Score = 77.4 bits (189), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 48/111 (43%), Positives = 73/111 (65%), Gaps = 7/111 (6%)

Query: 436 FATSTMVKAALLNIKAKISKNMNLSK--NAEQSINSPTLKQLFISLKKANKKQILDHRRE 493
           +  S   KA LLN+K ++SK   + K  N + S N      LF +L+KA K+QI+ HR+E
Sbjct: 530 YKLSNKSKATLLNLKVRLSKKKPVKKVHNEKDSTN-----LLFNNLRKATKQQIMLHRKE 584

Query: 494 ITEKRGISLEQLEQEREKVEDLLEQKIKRNRRIRLREKKKENELRLRYEDI 544
           + E RG++ E LE+++  VEDLLE++I+RN +IR REK+KE+   L  ++I
Sbjct: 585 LMESRGLNFEDLEKQKVMVEDLLEKEIERNLKIREREKRKESNEPLAEQEI 635

>NCAS0B09110 Chr2 (1746358..1749420) [3063 bp, 1020 aa] {ON} Anc_1.5
            YCL061C
          Length = 1020

 Score =  207 bits (528), Expect = 3e-54,   Method: Compositional matrix adjust.
 Identities = 148/342 (43%), Positives = 210/342 (61%), Gaps = 22/342 (6%)

Query: 762  KLRLQEKIKRQKQKEMRKLGVNKMVELEADESEDEWHGVGGVDYEASDEYDSDLDKMIDD 821
            +++L EK    + KEM+K GVNK+ E+EA+ESEDEWHG+GG D E SDEYDS+++KMIDD
Sbjct: 656  RIQLIEKKNAARTKEMKKKGVNKLFEMEAEESEDEWHGIGGADGEVSDEYDSEVEKMIDD 715

Query: 822  YNKNEFDPVEIRKILASEDLQHDKNMVNKILHDIK--TGGFRKRGRGXXXXXXXXXXXGI 879
            Y+K+ F+P EIR++LA E+ + D NM+ KIL+DIK      R+RG               
Sbjct: 716  YSKSNFNPDEIRQMLALENKEMDLNMITKILYDIKNGGFRKRRRGGLDLELSDDDEDDEE 775

Query: 880  LQSYRAKRWNEQKQKMLDSEHNTSVKSNPKSLPFFESMVDEFTIPVERALGTPDSPPAQS 939
            L+ Y  ++    K++ML+   +  +  NPKS  FFESMV++  +  + A G  +S    S
Sbjct: 776  LREYHKRKRELMKKRMLEIGDDKKLIKNPKSKAFFESMVEDI-VDEKNAFGDIESIEKSS 834

Query: 940  TNV---LELKQNT-----KQKIVISEHFVKQTLSFLTSDENMTNMRSEINVEKPNNDNDI 991
            T +    E +Q+      K+K VISE FV++TLSFL S  ++     E ++ K     + 
Sbjct: 835  TELDTQEEKEQDVTPGVDKKKNVISEEFVQKTLSFLRSGRDLEEFNIEEDLAK-----EQ 889

Query: 992  YSSEVEDLYTLKETSTIKVL------NTYSGKPIVNEDEDGAEFGFKAPSVMQTFGSRND 1045
            +   VEDL++LK+ STIK        NT      V   E     GFK PSV+++F SR D
Sbjct: 890  HGENVEDLFSLKQRSTIKEFRNPSQTNTIDLINNVENVESSPLGGFKPPSVIKSFSSRTD 949

Query: 1046 VNDKFKDGFKSVKISNKYKTLGSSRAAITFLGKKRKLIIPKR 1087
            +N+KFKDG K+V IS  YKT+GSS+A+IT+LGK RKL+ PK+
Sbjct: 950  INEKFKDGNKTVTISKVYKTVGSSKASITYLGKSRKLMPPKK 991

 Score = 97.1 bits (240), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 54/103 (52%), Positives = 77/103 (74%), Gaps = 3/103 (2%)

Query: 435 QFATSTMVKAALLNIKAKISKNMNLSKNAEQSINSPTLKQLFISLKKANKKQILDHRREI 494
           +F  S   KA LLN+KA++SK   +  N  +S N+ +L  LF +LK+A++KQILDH+RE+
Sbjct: 394 RFPISRTSKATLLNLKARLSKKKPVKSN--KSTNT-SLDVLFQNLKQASRKQILDHQREL 450

Query: 495 TEKRGISLEQLEQEREKVEDLLEQKIKRNRRIRLREKKKENEL 537
            E RG  LE +E+E+E VE+LLE++IKRN+RIR+REK+KE  L
Sbjct: 451 VENRGFKLEDIEKEKEIVENLLEEEIKRNKRIRMREKQKEKSL 493

 Score = 40.8 bits (94), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 28/80 (35%), Positives = 45/80 (56%), Gaps = 11/80 (13%)

Query: 7  LPGKARRKTTYKIEHEKLSQEAGYI-----IIKPSNAEN--VFANAIVDKVRNRLEGTIS 59
          LP K +RKTTYK  HE+ + +   +     ++ P    N  +F NA++DK+RNRL+G   
Sbjct: 10 LP-KKQRKTTYKKIHEEPNNDEEALTEAVDVMAPPVIGNGFIFGNALIDKIRNRLDG--- 65

Query: 60 SPDRLDTLSSKLSETVGNLY 79
            ++ DT     ++ + NLY
Sbjct: 66 KENKEDTPVPTQTQMIDNLY 85

>KNAG0C00220 Chr3 complement(33011..36496) [3486 bp, 1161 aa] {ON}
            Anc_1.5 YCL061C
          Length = 1161

 Score =  206 bits (523), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 140/369 (37%), Positives = 210/369 (56%), Gaps = 29/369 (7%)

Query: 761  LKLRLQEKIKRQKQKEMRKLGVNKMVELEADESEDEWHGVGGVDYEASDEYDSDLDKMID 820
            LK  ++EK    K+ E+++ GV+   E EA+ESEDEWHG+GG+D E SDEYDS+++KMID
Sbjct: 789  LKTIMKEKKLMLKRAELKEKGVSNFFEEEAEESEDEWHGIGGIDGEVSDEYDSEVEKMID 848

Query: 821  DYNKNEFDPVEIRKILASEDLQHDKNMVNKILHDIKTGGFRKRGRGXXXXXXXXXXXGIL 880
            DY++ + DP EIRK+L SE+ + D  MVNKIL DIK G FRKRGR              L
Sbjct: 849  DYSRADMDPEEIRKLLVSENKEMDVKMVNKILFDIKNGNFRKRGRDTLELELSDEEDDDL 908

Query: 881  QSYRAKRWNEQKQKMLDSEHNTSVKSNPKSLPFFESMVDEFTIPVERALGT--------- 931
            + YR KR    KQ++LD   +  +  N K+  FF+S+V++  + V+   G          
Sbjct: 909  RQYRQKRNELMKQRLLDLGDDKKLVKNVKTKAFFDSLVEDI-VEVKNPFGVMSDNETQDT 967

Query: 932  -----PDSPPAQSTNVLELK--QNTKQKIVISEHFVKQTLSFLTSDENMTNMRSEINVEK 984
                  D+   +S +  E K  Q   +K V+SE FV+++LSFL S+ N+T      ++ +
Sbjct: 968  DETTTIDTQTRESVSNKEEKPTQEKGKKTVLSEEFVQRSLSFLNSNRNLTEFEQNQDLAR 1027

Query: 985  PNNDNDIYSSEVEDLYTLKETSTIKVLNTYSGK-PIVNEDEDG------AEFGFKAPSVM 1037
              +D+D     V DLYTLK+ S++K   +   K  I+N D +       A   F+ PS++
Sbjct: 1028 LQHDDD-----VSDLYTLKKQSSVKSFKSVGSKNEIINVDANDNSGTAVATATFRPPSII 1082

Query: 1038 QTFGSRNDVNDKFKDGFKSVKISNKYKTLGSSRAAITFLGKKRKLIIPKRSSKSPRDSAH 1097
            ++F S+ +V+DKF++G K+VK    YK +G S+ ++T++ K RKL  PK   K       
Sbjct: 1083 KSFNSKLNVDDKFRNGKKTVKTFKSYKAVGGSKTSVTYMNKVRKLTAPKSLKKLHSTGGE 1142

Query: 1098 RSIKNRLKH 1106
            R I  +  H
Sbjct: 1143 RKISAQTSH 1151

 Score = 78.6 bits (192), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 86/265 (32%), Positives = 126/265 (47%), Gaps = 33/265 (12%)

Query: 270 LSTLADTLESKLSEKLRATVPNQVISQSNKKKEELAIHKFQRDLGEAEDEN--NKVTEHI 327
           ++T+ D LE+   ++ + TV + V S  N     L IH+ Q  + E E  N  N+  EH 
Sbjct: 389 IATMRDRLET---QEFQPTVADDVKSGGNT----LKIHEIQTQIDE-ETRNMLNRGVEHR 440

Query: 328 ----LPSYVALQNHIFTKEAFLDDFELSGQEVDYSSTATRVKEXXXXXXXXXXXXXXNAV 383
               +PS V ++   FTKE+F+ DFE S    D  S + ++ +               A 
Sbjct: 441 KSRGVPSRVEVR---FTKESFMADFEESDSASDMESDSDQINDTTPETGSSQNSDSNKAR 497

Query: 384 YDNLTDNFGTITRDAYAEEAKPPLLPLQSMKNTVGQDIILDSSSDEEHASNQ-----FAT 438
                     +T  +  E           ++N V  D  LD  SD+ ++S +        
Sbjct: 498 KPTEAPKTKRVTGLSSYETI---------LRNKVNDDECLDLGSDDTYSSEEEYDKESKV 548

Query: 439 STMVKAALLNIKAKISKNMNLSKNAEQSINSPTLKQLFISLKKANKKQILDHRREITEKR 498
           S   KAA+LNIKAK  K    +     + N  TL  LF  LKK N++QIL H+ EI   +
Sbjct: 549 SQASKAAVLNIKAKALKKK--AIVKAANTNKTTLDSLFSDLKKKNRQQILSHQAEIIGTK 606

Query: 499 GISLEQLEQEREKVEDLLEQKIKRN 523
           GI+ + LE+E+E VEDLLEQ+I RN
Sbjct: 607 GINHKDLEREKEIVEDLLEQEILRN 631

 Score = 33.9 bits (76), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 24/84 (28%), Positives = 39/84 (46%), Gaps = 12/84 (14%)

Query: 10 KARRKTTYK-IEHEKLSQEAGYIIIKPSNAEN---VFANAIVDKVRNRLEGT-------- 57
          K +R+TTYK ++     + AG     P++      +F NA VDK++NRL           
Sbjct: 12 KVKRRTTYKKVQQNSTDEAAGDDDCVPTSLAGNGFLFGNATVDKIKNRLNNEDHPNSSID 71

Query: 58 ISSPDRLDTLSSKLSETVGNLYDG 81
          ++     D +    S+ +  LYDG
Sbjct: 72 VTKSSSEDQIPVSQSQLLSTLYDG 95

>Kwal_33.13005 s33 complement(36797..39709) [2913 bp, 970 aa] {ON}
            YCL061C (MRC1) - protein involved in replication
            checkpoint [contig 123] FULL
          Length = 970

 Score =  200 bits (508), Expect = 8e-52,   Method: Compositional matrix adjust.
 Identities = 134/364 (36%), Positives = 198/364 (54%), Gaps = 11/364 (3%)

Query: 759  LMLKLRLQEKIKRQKQKEMRKLGVNKMVELEADESEDEWHGVGGVDYEASDEYDSDLDKM 818
            L+ K +L+E ++  K KE+ +   N M++ EA+ES+DEW GVGG D E SD YDS+LD+M
Sbjct: 612  LIEKRKLKEALREAKMKELNRSKANGMIDFEAEESDDEWFGVGGADGENSDGYDSELDRM 671

Query: 819  IDDYNKNEFDPVEIRKILASEDLQHDKNMVNKILHDIKTGGFRKRGRGXXXXXXXXXXXG 878
            IDDY+  + DP  +RK L  E+  HDK+MV++ILHDI+ GGFRKRGR             
Sbjct: 672  IDDYSNTKSDPEFLRKKLMEEEKLHDKDMVDRILHDIENGGFRKRGRYAMDLTLSDDEDD 731

Query: 879  ILQSYRAKRWNEQKQKMLDSEHNTSVKSNPKSLPFFESMVDE---FTIPVERALGTPDSP 935
             L  Y A+R     ++   ++  + + +NPKS  FF+S+ ++     I   +   +  SP
Sbjct: 732  DLLRYHARRKELLNERKSGNQEISVLATNPKSKAFFDSIFEDDLKGGIANLKEYQSHASP 791

Query: 936  PAQSTNVLELKQNTKQKIVISEHFVKQTLSFLTSDENMTNMRSEINVEKPNNDNDIYSSE 995
               + + +  K+ T+    ISE FV++TLSFL S E+       ++V      +    +E
Sbjct: 792  LKAAKDEISGKRETR----ISEQFVQKTLSFLKSKEDEQGDAEFVSVADTQESSSGDFAE 847

Query: 996  VEDLYTLKETSTIKVLNT--YSGKPIVNEDEDGAEFGFKAPSVMQTFGSRNDVNDKFKDG 1053
              D Y LK+ S IK  +    S   +   ++DG   G    ++++ F    D N+KF++G
Sbjct: 848  ATDFYRLKQLSGIKSFSAPLRSSIRLQVRNKDGVLSGKANTTLVERFVRSVDTNEKFEEG 907

Query: 1054 FKSVKISNKYKTLGSSRAAITFLGKKRKLIIPKRSSKSPRDSAHRSIKNRLKHQAFLENT 1113
             K+VK  N YK  GSSRA+ITFLGK R L   KR   +   SA    K    HQ F  + 
Sbjct: 908  RKTVKSLNSYKIAGSSRASITFLGKARSLKARKRGPHAR--SAPHGQKIMTSHQFFASDG 965

Query: 1114 DTFE 1117
             +FE
Sbjct: 966  QSFE 969

 Score = 68.9 bits (167), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 36/99 (36%), Positives = 68/99 (68%), Gaps = 2/99 (2%)

Query: 437 ATSTMVKAALLNIKAKISKNMN--LSKNAEQSINSPTLKQLFISLKKANKKQILDHRREI 494
           A S   KAA+L++KA++SK        ++++++ S +L+ LF SL+KAN+ Q+++HR  +
Sbjct: 333 ARSLSSKAAILDLKARMSKKKQSLAVTSSKETMPSASLRHLFSSLRKANRDQLVEHRNGL 392

Query: 495 TEKRGISLEQLEQEREKVEDLLEQKIKRNRRIRLREKKK 533
              RG+ L ++ +E+E VE LLE+++ RN++++  E +K
Sbjct: 393 LLLRGVDLAEIAKEKESVESLLERELARNKKVKQEEIQK 431

>TBLA0A07570 Chr1 (1874419..1878177) [3759 bp, 1252 aa] {ON} Anc_1.5
            YCL061C
          Length = 1252

 Score =  196 bits (497), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 128/367 (34%), Positives = 192/367 (52%), Gaps = 63/367 (17%)

Query: 775  KEMRKLGVNKMVELEADESEDEWHGVGGVDYEASDEYDSDLDKMIDDYNKNEFDPVEIRK 834
            +E++K+G +KM ++EA+ESEDEW G+GG D E SDEYDS+++K+IDDY++ +F+P EIR 
Sbjct: 866  RELKKVGASKMFDMEAEESEDEWFGIGGADGEVSDEYDSEVEKLIDDYSRQDFNPDEIRN 925

Query: 835  ILASEDLQHDKNMVNKILHDIKTGGFRKRGRGXXXXXXXXXXXGILQSYRAKRWNEQKQK 894
             L +E+ + D  MVN+IL+DIK GGFRKR R              L+ YR KR    K+K
Sbjct: 926  KLMNENKEMDIKMVNRILYDIKNGGFRKRNRNNIDLELSDDEDDELREYRIKRREIMKKK 985

Query: 895  MLDSEHNTSVKSNPKSLPFFESMVDE---------FTIPVERALGTPDSPPAQSTN---- 941
             L+  +   +    KS  FF SMVD+          T P +      +     + N    
Sbjct: 986  RLEVTNTDKILKTSKSKAFFMSMVDDIVETSNPFMITQPSDDDSDDNNMDSISNKNHKDA 1045

Query: 942  --------------VLELKQNTKQKIVISEHFVKQTLSFLTSDENMTNMRSEINVEKPNN 987
                             L Q++++K V+SE FV +TLSFLT  + +   +         +
Sbjct: 1046 NNAKKDKKDKRTDDHARLSQSSRKKFVMSEDFVHKTLSFLTKSKEVNEFQ---------H 1096

Query: 988  DNDIYSSE---VEDLYTLKETSTIKVLNTYS-----------------------GKPIVN 1021
             N+ Y S+   + D+ +LK+ S+IK ++  S                            N
Sbjct: 1097 VNEHYKSQIGTINDIQSLKQKSSIKTMHVLSMMSQDTNVDLDASDKDDDDMIHHAGSFDN 1156

Query: 1022 EDEDGAEFGFKAPSVMQTFGSRNDVNDKFKDGFKSVKISNKYKTLGSSRAAITFLGKKRK 1081
              +D      KAPS+++ FGS +D+NDKFKDG K+V ISN YKT+G  + +IT  G +RK
Sbjct: 1157 SFDDPLSSVSKAPSIIKIFGSTHDINDKFKDGNKTVTISNSYKTVGGMKTSITSFG-RRK 1215

Query: 1082 LIIPKRS 1088
            L+ P ++
Sbjct: 1216 LVAPVKT 1222

 Score = 84.7 bits (208), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 57/139 (41%), Positives = 87/139 (62%), Gaps = 9/139 (6%)

Query: 403 AKPPL-LPLQSMKNTVGQDIILDSSSD-----EEHASNQFATSTMVKAALLNIKAKISKN 456
           AKP   + L   +N + ++++ ++S D     EE+  +    ST  KA +L+I+ K+SK 
Sbjct: 572 AKPKRKVILSQYENRLKENLLYNNSIDLYSDSEENTQSDILFSTASKAQILDIRHKLSKK 631

Query: 457 MNLSKNAEQSINSPTLKQLFISLKKANKKQILDHRREITEKRGISLEQLEQEREKVEDLL 516
               K      N   L QLF  LKKA+KKQI DH++   E +G+ LE L++E+E VE+LL
Sbjct: 632 KPQVKKKTIQTN---LDQLFNKLKKASKKQIFDHQKNAIESKGLKLEDLKKEKEIVENLL 688

Query: 517 EQKIKRNRRIRLREKKKEN 535
           EQ+I+RNR+IR +E+K+EN
Sbjct: 689 EQEIERNRKIRAKERKREN 707

>ZYRO0F18480g Chr6 (1524051..1526933) [2883 bp, 960 aa] {ON} weakly
            similar to uniprot|P25588 Saccharomyces cerevisiae
            YCL061C MRC1 S-phase checkpoint protein found at
            replication forks required for DNA replication also
            required for Rad53p activation during DNA replication
            stress where it forms a replication-pausing complex with
            Tof1p and is phosphorylated by Mec1p protein involved in
            replication checkpoint
          Length = 960

 Score =  187 bits (474), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 133/350 (38%), Positives = 206/350 (58%), Gaps = 26/350 (7%)

Query: 762  KLRLQEKIKRQKQKEMRKLGVNKMVELEADESEDEWHGVGGVDYEASDEYDSDLDKMIDD 821
            K+ +++K K Q+ K+M+  G+NKM+E+EA+ESEDEW GVGGVD + SDE+DSDL++MIDD
Sbjct: 605  KIEMRKKKKEQRLKDMKAKGLNKMLEMEAEESEDEWKGVGGVDGDLSDEHDSDLEEMIDD 664

Query: 822  YNKNEFDPVEIRKILASEDLQHDKNMVNKILHDIKTGGFRKRGRGXXXXXXXXXXXGILQ 881
            + K+  +  ++R++LA E+ + D+ MVNKIL+DIK GGFRKRGR              L+
Sbjct: 665  FTKSNENFDDVRQLLAKENKELDEKMVNKILYDIKNGGFRKRGRNALDLELSDDEDEDLR 724

Query: 882  SYRAKRWNEQKQKMLDSEHNTSVKSNPKSLPFFESMVDEFTIPVERALGTPDSPPAQSTN 941
            +YR KR    K+  ++ +       N KS  F ESMVD+     +   G P+     +T+
Sbjct: 725  NYRLKRRELMKKSRIEGKDKEKAFRNAKSKAFLESMVDDID-ESKNPFGDPEMDVEDNTD 783

Query: 942  VLELKQN----TKQKIVISEHFVKQTLSFLTSDENMTNMRSEINVEKPNNDNDIYSSEVE 997
            V + ++N     K+K  +S+ FV+++LSFL+++    N   E  +     +      E +
Sbjct: 784  V-DTQENDYPKNKEKNTLSQEFVQRSLSFLSNN----NSSREFEL----GEQITLGDEEQ 834

Query: 998  DLYTLKETSTIKVLNTYSGKPIV------NEDEDGAEF-GFKAPSVMQTFGSRNDVNDKF 1050
            D+ +LK  S+I  L+  S  PI       N+DED      FK PS++++     D N+KF
Sbjct: 835  DVSSLKRNSSIHALHN-SSSPIKEDLEKENQDEDFITLPNFKPPSLIKSLAGGFDPNNKF 893

Query: 1051 KDGFKSVKISNKYKTLGSSRAAITFLGKKRKLIIPKRS----SKSPRDSA 1096
            + G K+V +S  Y+ +G SR++IT+ GK RKL+ PK      SK PR ++
Sbjct: 894  QSGKKTVTVSKSYRAVGGSRSSITYFGKMRKLVGPKNRNSTLSKGPRPAS 943

 Score = 74.3 bits (181), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 77/262 (29%), Positives = 124/262 (47%), Gaps = 35/262 (13%)

Query: 304 LAIHKFQRDLGEAEDENN--KVTEHILPSYVALQNHIFTKEAFLDDFELSGQEVDYSSTA 361
           L +H  +++L E   E +  +  E+  P        +F+KEAFL +F+      + SS+ 
Sbjct: 238 LKMHDIEKELEEKRQERDHRRNIEYRAPEKPVNVKRVFSKEAFLKNFD------EESSSE 291

Query: 362 TRVKEXXXXXXXXXXXXXXNAVYDNLTDN------FGTITRDAYAEEAKPPLLPLQSMKN 415
             + E               +  +N T++      F         E        L S + 
Sbjct: 292 DELIELRSRDIEKKHTEKDKSTLENTTESSQRQRVFSVYEYKLKGE--------LDSKRC 343

Query: 416 TVGQDIILDSSSDEEHASNQFATSTMVKAALLNIKAKISKNMNLSKNAEQSINSPTLKQL 475
                I LD   DE     +   S + KA +L+IKA+ SK   LSK  ++     TL  L
Sbjct: 344 -----IQLDDDEDESDEDVEVPLSRVSKATVLDIKARRSKQEPLSKIKQKKT---TLNDL 395

Query: 476 FISLKKANKKQILDHRREITEKRGISLEQLEQEREKVEDLLEQKIKRNRRIRLREKKKEN 535
             +LKKA+KKQI DH+ E+ + RG  LE +E+++E++E+LLEQ+I RN+R+  RE +++N
Sbjct: 396 ICTLKKASKKQITDHQNELMKSRGYKLEDIEKQKEEIENLLEQEIARNKRLARRENEEDN 455

Query: 536 ELRLRYEDINNCSTGSSDGDAN 557
                  D+ + S GS +   N
Sbjct: 456 -----SNDLEDRSYGSGNESEN 472

>TDEL0C06970 Chr3 (1264155..1266980) [2826 bp, 941 aa] {ON} Anc_1.5
            YCL061C
          Length = 941

 Score =  176 bits (446), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 130/353 (36%), Positives = 204/353 (57%), Gaps = 32/353 (9%)

Query: 762  KLRLQEKIKRQKQKEMRKLGVNKMVELEADESEDEWHGVGGVDYEASDEYDSDLDKMIDD 821
            K+R QE+  +Q+ K+M++ GV  M ++EA+ES+DEW GVGGVD E  D+YDSDL+KMIDD
Sbjct: 589  KIRAQEE--KQRLKQMKESGVTNMFDMEAEESDDEWRGVGGVDGETIDDYDSDLEKMIDD 646

Query: 822  YNKNEFDPVEIRKILASEDLQHDKNMVNKILHDIKTGGFRKRGRGXXXXXXXXXXXGILQ 881
            ++    +  +IR++L +E+ + D   VNKILHDIK GGFRKR +              L 
Sbjct: 647  FSNTTSNADQIRQLLMAENKETDLKTVNKILHDIKNGGFRKRRQNNLQLELSDDEDDELL 706

Query: 882  SYRAKRWNEQKQKMLD-SEHNTSVKSNPKSLPFFESMVDEFTIPVERALGTPDSPPAQST 940
            +Y+ ++    +++ L     +  +  N +S  FFESMV++        L  P S  A+++
Sbjct: 707  NYKKRKLELMRKRRLQFGADDKKLLKNSRSKAFFESMVEDII-----DLKDPFSNQAETS 761

Query: 941  NVLE-----LKQNTKQKIVISEHFVKQTLSFLTSDENMTNMRSEINVEKPNNDNDIYSSE 995
               +     +  + KQK  IS  FV+Q+LSFL+S  +     SE  V + + + +  +  
Sbjct: 762  EKDKKSEGLVDASNKQKDTISHEFVQQSLSFLSSSRDF----SEFEVARVSQEGERNT-- 815

Query: 996  VEDLYTLKETSTIKVLNTYSGKPIVNEDE--DGAEFGFKA-------PSVMQTFGSRNDV 1046
              DL +LK+ ST+K L  Y+   I++E E  D  EF            SV+++FG   + 
Sbjct: 816  --DLNSLKQDSTVKTL--YAPSNIISESERADHEEFDNSVLPVESSYSSVVKSFGFDLNA 871

Query: 1047 NDKFKDGFKSVKISNKYKTLGSSRAAITFLGKKRKLIIPKRSSKSPRDSAHRS 1099
            NDK K+G K+V +S  Y+T+G ++A+IT+LGK RKL+ PK+S+   R ++  S
Sbjct: 872  NDKLKEGRKTVTVSKSYRTVGGNKASITYLGKMRKLVAPKKSNAEVRTTSKLS 924

 Score = 75.1 bits (183), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 52/143 (36%), Positives = 83/143 (58%), Gaps = 12/143 (8%)

Query: 421 IILDSSSDEEHASNQFATSTMVKAALLNIKAKISKNMNLSKNAEQSINSPTLKQLFISLK 480
           ++L  S DEE  +   +TS   KA +L +KA++SK        E      +L  L  +L+
Sbjct: 337 MLLSESDDEEDLA--VSTSHEAKATVLKLKARLSKR---RPPVESQHGKASLSALMKNLR 391

Query: 481 KANKKQILDHRREITEKRGISLEQLEQEREKVEDLLEQKIKRNRRIRLREKKKEN----- 535
            + K+QILD ++E  E++G+  E +E+E+E VE+LLEQ+I RN+RIR++EK+K       
Sbjct: 392 NSTKRQILDRQKEGIERQGLKFEDVEKEKEIVENLLEQEIARNKRIRMKEKEKAQMNDVP 451

Query: 536 --ELRLRYEDINNCSTGSSDGDA 556
              L  R E+ N+ +   SD D+
Sbjct: 452 SLALPNRVEEDNDSNYSVSDEDS 474

>Smik_27.11 Chr27 (6612..9095) [2484 bp, 828 aa] {ON} YBL017C (REAL)
          Length = 828

 Score = 35.4 bits (80), Expect = 0.86,   Method: Compositional matrix adjust.
 Identities = 36/134 (26%), Positives = 64/134 (47%), Gaps = 20/134 (14%)

Query: 959  FVKQTLSFLTSDENMTNMRSEINVEKPNNDNDIYSSEVEDLYTLKETSTIK--------- 1009
            FVK+TL+F T+D+   + R  + ++ P +  + Y++E+    T KE   +          
Sbjct: 144  FVKETLNFYTTDDQGKSWRL-LTIQNPEDSANFYNNEITTHPTKKEYIILHYNWVEKHSD 202

Query: 1010 VLNTYSGKPIVNEDEDGAEFGFKAPSVMQTFGSRNDVNDKFKDGFKSVKISNKYKTLGSS 1069
            +L + +G  + N   +G  F    PS  +  G  N ++  F      +K S+ Y  LGS+
Sbjct: 203  ILYSTTGFYVTN---NGVSFSRIKPSREKIDGYDNRIHCDF------IK-SSMYSNLGSN 252

Query: 1070 RAAITFLGKKRKLI 1083
             A+I  L + R+ I
Sbjct: 253  DASIICLFRNREYI 266

>KAFR0F04240 Chr6 complement(831101..832552) [1452 bp, 483 aa] {ON}
           Anc_1.103 YGR255C
          Length = 483

 Score = 35.0 bits (79), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 21/75 (28%), Positives = 41/75 (54%), Gaps = 1/75 (1%)

Query: 37  NAENVFANAIVDKVRNRLEG-TISSPDRLDTLSSKLSETVGNLYDGEALEEDFDPNIDNS 95
           NA  V ++A ++   N ++  T+ S + +D ++ +++ET  NL D   ++E F P + + 
Sbjct: 288 NAAFVLSDADLEYYFNAIKNNTMKSDELIDDINFRINETWDNLKDDSLIDEIFPPQVVDV 347

Query: 96  FKGMVNSYNVNFEHI 110
            KG V  +   F H+
Sbjct: 348 VKGSVARFPFKFSHV 362

>ACR074W Chr3 (496156..497388) [1233 bp, 410 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YJL036W (SNX4)
          Length = 410

 Score = 33.1 bits (74), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 25/56 (44%), Positives = 31/56 (55%), Gaps = 6/56 (10%)

Query: 65  DTLSSKLSETVGNLYDGEALEEDFDPNIDNSFKGMVNSYNVNFEHIKSK-GTMDHN 119
           D     L+ETVGNL + E L E     I N+FK  V+S +  F  IK K G +DHN
Sbjct: 134 DAYQKSLAETVGNLSNKEELTE----TIMNAFKS-VHSQSDEFVEIKEKSGKLDHN 184

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.310    0.128    0.347 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 109,126,309
Number of extensions: 4838068
Number of successful extensions: 23752
Number of sequences better than 10.0: 307
Number of HSP's gapped: 24786
Number of HSP's successfully gapped: 359
Length of query: 1118
Length of database: 53,481,399
Length adjustment: 120
Effective length of query: 998
Effective length of database: 39,721,479
Effective search space: 39642036042
Effective search space used: 39642036042
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.8 bits)
S2: 71 (32.0 bits)