Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Ecym_10071.4ON46246224290.0
SAKL0C00440g1.4ON4624881901e-14
Smik_3.131.4ON4251581018e-04
YCL063W (VAC17)1.4ON4231591018e-04
TDEL0C069801.4ON426154990.001
TBLA0A075801.4ON513170970.003
KLLA0C00462g1.4ON460502960.003
Skud_3.21.4ON426158960.004
NDAI0A001301.4ON478165800.33
Kpol_1018.1642.450ON84577751.2
KLTH0F00462g1.4ON451122741.4
NCAS0B091201.4ON433132704.5
NOTE: 9 genes in the same pillar as Ecym_1007 were not hit in these BLAST results
LIST: Kpol_2002.7 ZYRO0F18502g KAFR0D00120 Suva_3.151 AFR746C Kwal_33.13003 KNAG0C00190 TPHA0E04020 CAGL0B00308g

BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Ecym_1007
         (462 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Ecym_1007 Chr1 (11741..13129) [1389 bp, 462 aa] {ON} similar to ...   940   0.0  
SAKL0C00440g Chr3 (39662..41050) [1389 bp, 462 aa] {ON} weakly s...    78   1e-14
Smik_3.13 Chr3 (18714..19991) [1278 bp, 425 aa] {ON} YCL063W (REAL)    44   8e-04
YCL063W Chr3 (17290..18561) [1272 bp, 423 aa] {ON}  VAC17Phospho...    44   8e-04
TDEL0C06980 Chr3 complement(1267077..1268357) [1281 bp, 426 aa] ...    43   0.001
TBLA0A07580 Chr1 complement(1878594..1880135) [1542 bp, 513 aa] ...    42   0.003
KLLA0C00462g Chr3 (33948..35330) [1383 bp, 460 aa] {ON} weakly s...    42   0.003
Skud_3.2 Chr3 (5324..6604) [1281 bp, 426 aa] {ON} YCL063W (REAL)       42   0.004
NDAI0A00130 Chr1 (6694..8130) [1437 bp, 478 aa] {ON} Anc_1.4 YCL...    35   0.33 
Kpol_1018.164 s1018 (420666..423203) [2538 bp, 845 aa] {ON} (420...    33   1.2  
KLTH0F00462g Chr6 (35640..36995) [1356 bp, 451 aa] {ON} weakly s...    33   1.4  
NCAS0B09120 Chr2 complement(1749531..1750832) [1302 bp, 433 aa] ...    32   4.5  

>Ecym_1007 Chr1 (11741..13129) [1389 bp, 462 aa] {ON} similar to
           XP_452214  K. lactis KLLA0C00462g
          Length = 462

 Score =  940 bits (2429), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 451/462 (97%), Positives = 451/462 (97%)

Query: 1   MLVSEYEIHRLLTRCQESLVDLNLHIQMSWSLFELAQDCGGSECNGHNCDICRYTCRSAV 60
           MLVSEYEIHRLLTRCQESLVDLNLHIQMSWSLFELAQDCGGSECNGHNCDICRYTCRSAV
Sbjct: 1   MLVSEYEIHRLLTRCQESLVDLNLHIQMSWSLFELAQDCGGSECNGHNCDICRYTCRSAV 60

Query: 61  QQSCGDQRTEQMRRYQSSMAHLMSLSIRAQFLIDKFHKGGSGYQIDLDTVKKLGSEFEDI 120
           QQSCGDQRTEQMRRYQSSMAHLMSLSIRAQFLIDKFHKGGSGYQIDLDTVKKLGSEFEDI
Sbjct: 61  QQSCGDQRTEQMRRYQSSMAHLMSLSIRAQFLIDKFHKGGSGYQIDLDTVKKLGSEFEDI 120

Query: 121 SHNLCFLEPNKVFDKNHTRFRSSEYPAPFQLRPLKLLQRIRNPSENESKDNLRIYEGSAP 180
           SHNLCFLEPNKVFDKNHTRFRSSEYPAPFQLRPLKLLQRIRNPSENESKDNLRIYEGSAP
Sbjct: 121 SHNLCFLEPNKVFDKNHTRFRSSEYPAPFQLRPLKLLQRIRNPSENESKDNLRIYEGSAP 180

Query: 181 QRDNPSFDXXXXXXXXXXXVVGADFSVIRQGLMNWNSFEMHIPNVDALMPQNLNFQEKSE 240
           QRDNPSFD           VVGADFSVIRQGLMNWNSFEMHIPNVDALMPQNLNFQEKSE
Sbjct: 181 QRDNPSFDLNSSLSSLHGLVVGADFSVIRQGLMNWNSFEMHIPNVDALMPQNLNFQEKSE 240

Query: 241 FSTPFFDSLECNSDDETVMSISRLDLDTCSFVSASSQSKRFSISDYDRIACRHGSTIEVL 300
           FSTPFFDSLECNSDDETVMSISRLDLDTCSFVSASSQSKRFSISDYDRIACRHGSTIEVL
Sbjct: 241 FSTPFFDSLECNSDDETVMSISRLDLDTCSFVSASSQSKRFSISDYDRIACRHGSTIEVL 300

Query: 301 GTPPFFNLNHNIQELARTAIVGSSYVCSFSTRYKMNHFKKAVTSRDLLTKFVEPVTTTKP 360
           GTPPFFNLNHNIQELARTAIVGSSYVCSFSTRYKMNHFKKAVTSRDLLTKFVEPVTTTKP
Sbjct: 301 GTPPFFNLNHNIQELARTAIVGSSYVCSFSTRYKMNHFKKAVTSRDLLTKFVEPVTTTKP 360

Query: 361 LPAAKENHLHWWPIINLSGILTKCKIRNHGNPVTSESCPHEETSETANQILKHTGKSTLE 420
           LPAAKENHLHWWPIINLSGILTKCKIRNHGNPVTSESCPHEETSETANQILKHTGKSTLE
Sbjct: 361 LPAAKENHLHWWPIINLSGILTKCKIRNHGNPVTSESCPHEETSETANQILKHTGKSTLE 420

Query: 421 NQAHIRSEVSQCSLFLEPNGSKFVHQFGGEQVVCSEISYSSL 462
           NQAHIRSEVSQCSLFLEPNGSKFVHQFGGEQVVCSEISYSSL
Sbjct: 421 NQAHIRSEVSQCSLFLEPNGSKFVHQFGGEQVVCSEISYSSL 462

>SAKL0C00440g Chr3 (39662..41050) [1389 bp, 462 aa] {ON} weakly
           similar to uniprot|P25591 Saccharomyces cerevisiae
           YCL063W VAC17 vacuole inheritance
          Length = 462

 Score = 77.8 bits (190), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 116/488 (23%), Positives = 205/488 (42%), Gaps = 78/488 (15%)

Query: 9   HRLLTRCQESLVDLNLHIQMSWSLFELAQDCGGSECNGHNCDICRYTCRSAVQQSCGDQR 68
            +LL R QE+++ L+L+IQ    L+E   +      NG                      
Sbjct: 9   QKLLVRSQEAILQLDLYIQRQQRLYEY--ETLDQPDNG---------------------L 45

Query: 69  TEQMRRYQSSMAHLMSLSIRAQFLIDKFHKGGSGYQIDLDTVKKLGSEFEDISHNLCFLE 128
             +++ YQ+ +A L SL IR++ L D+          D D++  L +EF+ I+  L  L 
Sbjct: 46  LTKLQEYQTCLAQLNSLHIRSEHLRDRIASTDHRASQDGDSIGHLVTEFQKITTKLNELA 105

Query: 129 PNKVFDKNHTRFRSSEYPAPFQLRPLKLLQRIR-----NPSENESKDNLRIYEGSAPQRD 183
             +         +S++  + F+ +PLK+L+R +     +P++  +    +I    AP R 
Sbjct: 106 ATQDRAYQSPGSQSTKSVSSFEPKPLKILERTKLQHPTSPTKRVATPPKKI----APLRK 161

Query: 184 NPSFDXXXXXX--XXXXXVVGADFSVIRQGL-MNWNSFEMHIPNVDALMPQN-------- 232
           NP FD             + G+        + +    F  H  + DA + +         
Sbjct: 162 NPPFDKKVMFSGHSKSTSLPGSPSMAASSPVSIQQERFPRHAKSCDAGLNKQQRRRQDSD 221

Query: 233 --LNF-QEKSEFSTPFFDS-LECNSDDETVMSISRLDLDTCSFVSASSQSKRFSISDYDR 288
             LNF +E    S  FFD  ++ +SD++TV+S+S    +T SF       K F  ++  R
Sbjct: 222 NRLNFFKENQRLSISFFDDEIDYSSDEDTVISVS--PPETTSF-------KGFPKAEPLR 272

Query: 289 IACRHGSTI---EVL-----GTPPFFNL----NHNIQELARTAIVGSSYVCSFSTRYKMN 336
               H S +   EVL         +F+L    N+  + +A +  +    V S +   + +
Sbjct: 273 RYNSHESVLSRKEVLPAALPARAGWFSLWAGRNNKPKPMAESVSINDKPVYSTAALLR-S 331

Query: 337 HFKKAVTSRDLLTKFVEPVTTTKPLPAAKENHLHWWPIIN--LSGILTKCKIRNHGNPVT 394
           H K   TS+DLL +FV         P  K+    W+         I +  K+ N+   VT
Sbjct: 332 HSKTTETSKDLLAQFVSAA------PKQKKQTTSWFGPAEEPKRSIFSGWKLFNNSVLVT 385

Query: 395 SESCPHEETSETANQILKHTGKSTLENQAHIRSEVSQCSLFLEPNGSKFVHQFGGEQVVC 454
           SE+   +  S+ + + +     +        ++ +   SL + PNGS+FV     E V+ 
Sbjct: 386 SETGLQDSNSKPSAKRIGAAAPAKRVPLGRRKTHLPSSSLIMGPNGSRFVSP-PNEPVLN 444

Query: 455 SEISYSSL 462
           +++SY +L
Sbjct: 445 NKVSYDAL 452

>Smik_3.13 Chr3 (18714..19991) [1278 bp, 425 aa] {ON} YCL063W (REAL)
          Length = 425

 Score = 43.5 bits (101), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 44/158 (27%), Positives = 70/158 (44%), Gaps = 31/158 (19%)

Query: 10  RLLTRCQESLVDLNLHIQMSWSLFELAQDCGGSECNGHNCDICRYTCRSAVQQSCGDQRT 69
           RLL R QE+++ L+L IQ                       +C+ T      Q   D+ +
Sbjct: 12  RLLIRSQEAILQLDLWIQ-----------------RQQRSSVCQTT-----DQELLDKVS 49

Query: 70  EQMRRYQSSMAHLMSLSIRAQFLIDKFHKGGSGYQIDLDT----VKKLGSEFEDISHNLC 125
           +Q  +Y   M+ L SL +R++ + DK  K      I  D     ++ L  EF+DI+  L 
Sbjct: 50  KQYNQY---MSQLNSLYVRSESVRDKLSKEQQRRLITEDNEHQRIEDLVREFQDITLRLN 106

Query: 126 FL--EPNKVFDKNHTRFRSSEYPAPFQLRPLKLLQRIR 161
            L   PN+V + +     +      FQ RPLK+++R R
Sbjct: 107 ELATAPNEVANDSPQSQSTRSSLESFQPRPLKIIERQR 144

>YCL063W Chr3 (17290..18561) [1272 bp, 423 aa] {ON}
           VAC17Phosphoprotein involved in vacuole inheritance;
           degraded in late M phase of the cell cycle; acts as a
           vacuole-specific receptor for myosin Myo2p
          Length = 423

 Score = 43.5 bits (101), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 44/159 (27%), Positives = 69/159 (43%), Gaps = 31/159 (19%)

Query: 9   HRLLTRCQESLVDLNLHIQMSWSLFELAQDCGGSECNGHNCDICRYTCRSAVQQSCGDQR 68
            RLL R QE+++ L+L IQ                       IC+ T      Q   D+ 
Sbjct: 11  ERLLIRSQEAILQLDLWIQRQ-----------------QRSSICQTT-----DQESLDKL 48

Query: 69  TEQMRRYQSSMAHLMSLSIRAQFLIDKFHKGGSGYQIDLDT----VKKLGSEFEDISHNL 124
           ++Q  +Y   M+ L SL +R++ + DK  K      I  D     ++ L  EF+DI+  L
Sbjct: 49  SQQYNQY---MSQLNSLYVRSESVRDKLSKEQQRRLITEDNEHQRIEDLVREFQDITLRL 105

Query: 125 CFLE--PNKVFDKNHTRFRSSEYPAPFQLRPLKLLQRIR 161
             L   PN+  + +     +      FQ RPLK+++R R
Sbjct: 106 NELATVPNEAPNDSPQSQSTRSSLGSFQPRPLKIIERQR 144

>TDEL0C06980 Chr3 complement(1267077..1268357) [1281 bp, 426 aa]
           {ON} Anc_1.4 YCL063W
          Length = 426

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 42/154 (27%), Positives = 61/154 (39%), Gaps = 31/154 (20%)

Query: 9   HRLLTRCQESLVDLNLHIQMSWSLFELAQDCGGSECNGHNCDICRYTCRSAVQQSCGDQR 68
            RLLTR QE+++ L L IQ    L EL         N +N  I                 
Sbjct: 8   ERLLTRSQEAILQLELWIQRQQHLRELEDSSIDKLGNQYNVYI----------------- 50

Query: 69  TEQMRRYQSSMAHLMSLSIRAQFLIDKFHKGGSGYQI---DLDTVKKLGSEFEDISHNLC 125
                      A L SL +R++++ DK +K          D   ++ L  EF+DI+  L 
Sbjct: 51  -----------AQLNSLCVRSEYVRDKLNKERERRMSIINDRKYIEDLVFEFQDITVKLN 99

Query: 126 FLEPNKVFDKNHTRFRSSEYPAPFQLRPLKLLQR 159
            L  ++  D   +   +      FQ RPLKL +R
Sbjct: 100 ELAQSQSIDSTPSSKSTRSSLGSFQPRPLKLTER 133

>TBLA0A07580 Chr1 complement(1878594..1880135) [1542 bp, 513 aa]
           {ON} Anc_1.4 YCL063W
          Length = 513

 Score = 42.0 bits (97), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 45/170 (26%), Positives = 71/170 (41%), Gaps = 42/170 (24%)

Query: 10  RLLTRCQESLVDLNLHIQMSWSLFELAQDCGGSECNGHNCDICRYTCRSAVQQSCGDQRT 69
           RLLT+ QE+++ L+L I+          D  G            +  R  ++ S  +   
Sbjct: 10  RLLTKAQEAVLQLDLWIK----------DQQG------------FQNRDGLRASTSESLE 47

Query: 70  EQMRRYQSSMAHLMSLSIRAQFLIDKFHKGGSGYQIDLDT----------VKKLGSEFED 119
           +  R Y   M  L SL +RAQ++ DK  K  +    D D           V++L +EF  
Sbjct: 48  QAERDYNRYMFQLNSLYLRAQYIRDKIEKQNAYNLADSDVAGNDTNSHAYVQQLVTEFYS 107

Query: 120 IS---HNLCFLEPNKV-------FDKNHTRFRSSEYPAPFQLRPLKLLQR 159
           +S   + L  ++ N            +H+    S+    FQ RPLK+LQR
Sbjct: 108 LSIKMNELSAIQENVTNGSSPLSNKSSHSNDSLSKITDGFQPRPLKILQR 157

>KLLA0C00462g Chr3 (33948..35330) [1383 bp, 460 aa] {ON} weakly
           similar to uniprot|P25591 Saccharomyces cerevisiae
           YCL063W VAC17 vacuole inheritance
          Length = 460

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 119/502 (23%), Positives = 201/502 (40%), Gaps = 102/502 (20%)

Query: 6   YEIHRLLTRCQESLVDLNLHIQMSWSLFELAQDCGGSECNGHNCDICRYTCRSAVQQSCG 65
           Y   RL+ RC E+++ L L IQ     F+          N  +C I              
Sbjct: 6   YVAERLVIRCNEAVMQLELSIQRKMCEFD---------PNNSHCFI-------------- 42

Query: 66  DQRTEQMRRYQSSMAHLMSLSIRAQFLIDKFH---KGGSGYQIDLDTVKKLGSEFEDISH 122
                Q++ Y S +A L SL +RA+ + +      K  +   I+ +T++KL  EF+DI+ 
Sbjct: 43  -----QVQEYYSFLARLSSLKLRAEHVQESLRHQRKDPNDVCIEYETLEKLIYEFQDITM 97

Query: 123 NL-----CFLEPNKVFDKNHTRFRSSEYPAPFQLRPLKLLQRIRN-----PSENESKDNL 172
           +L      +  P K       R  SS+  +   L+ LK+++R R+         +S   L
Sbjct: 98  SLNEVARAYQSPTK-----SARSGSSKESSVIPLKTLKIIERNRDSLIGTSPMKKSLSQL 152

Query: 173 RIYE--GSAPQRDNPSFDXXXX-------XXXXXXXVVGAD----------FSVIRQGLM 213
           +  E   S P + N  F                   + G+           FS   + L 
Sbjct: 153 KKEEHNQSLPAKRNVRFQEDDLDILHHLHSVKRANSLPGSPMPDTLLESQMFSREHKTLR 212

Query: 214 NWNSFEMHIPNVDALMPQNLNF-QEKSEFSTPFFDSLECN-SDDETVMSISRLDLDTCSF 271
              S+++ + N  A    +  F + K+  S   FD +  + SD+ETV+S+S  ++    +
Sbjct: 213 MAKSYDVGL-NGRAKKNADWEFFKNKNRLSLSVFDDVNTDASDEETVISVSPPNISY--Y 269

Query: 272 VS------ASSQSKRFSISDYDRIACRHGSTIEVLGTPPFFNLNHNIQEL-ARTAIVGSS 324
           +S       S Q +R   + ++ I  R    I    TP    +    Q +  + AIV   
Sbjct: 270 LSQNEDQYPSKQVRR--CNSHESILSRK---ILSPSTPANLIMRPTYQSVWQKKAIVTKP 324

Query: 325 YV-CSFSTRYKMNHFKKAVTSRDLLTKFVEPVTTTKPLPAAKENHLHWWPIINLSGILTK 383
            + CS S             S+D+L++FV     T P P+ K  +  W+   N +   + 
Sbjct: 325 TISCSTSNSTASPTIGSPHLSKDMLSQFV-----TAP-PSKK--YRGWFSSSNSTPFASS 376

Query: 384 C--KIRNHGNPVTSESCPHEETSETANQILKHTGKSTLEN-QAHIRSEVSQCSLFLEPNG 440
              K  N  + VT E    + +S +       +G+  +EN Q H  S     S+ + PNG
Sbjct: 377 IFQKWFNSDSLVTKEIGNPDNSSPS-------SGRPIVENRQRHSSSNSYSTSIVIGPNG 429

Query: 441 SKFVHQFGGEQVVCSEISYSSL 462
           +KF+       V C+ +SY+ L
Sbjct: 430 AKFIRGLNDPLVTCT-VSYNEL 450

>Skud_3.2 Chr3 (5324..6604) [1281 bp, 426 aa] {ON} YCL063W (REAL)
          Length = 426

 Score = 41.6 bits (96), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 43/158 (27%), Positives = 71/158 (44%), Gaps = 31/158 (19%)

Query: 10  RLLTRCQESLVDLNLHIQMSWSLFELAQDCGGSECNGHNCDICRYTCRSAVQQSCGDQRT 69
           RLL R QE+++ L+L IQ                            C+++ Q+S  D+ +
Sbjct: 12  RLLIRSQEAILQLDLWIQRQQR---------------------SSVCQTSDQESL-DKLS 49

Query: 70  EQMRRYQSSMAHLMSLSIRAQFLIDKFHKGGSGYQIDLDT----VKKLGSEFEDISHNLC 125
           +Q  +Y   M+ L SL +R++ + DK  K      I  D     ++ L  EF+DI+  L 
Sbjct: 50  QQYNQY---MSQLNSLYVRSESVRDKLSKEQQRRLITEDNEHQRIEDLVHEFQDITSRLN 106

Query: 126 FLE--PNKVFDKNHTRFRSSEYPAPFQLRPLKLLQRIR 161
            L   P+ V + +     +      FQ RPLK+++R R
Sbjct: 107 ELATVPHGVSNDSPQSQSTRSSSGSFQPRPLKIIERQR 144

>NDAI0A00130 Chr1 (6694..8130) [1437 bp, 478 aa] {ON} Anc_1.4
           YCL063W
          Length = 478

 Score = 35.4 bits (80), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 41/165 (24%), Positives = 66/165 (40%), Gaps = 38/165 (23%)

Query: 10  RLLTRCQESLVDLNLHIQMSWSLFELAQDCGGSECNGHNCDICRYTCRSAVQQSCGDQRT 69
           RLL R QE+++ L+L IQ      EL+     +     + D  +Y               
Sbjct: 11  RLLIRSQEAILQLDLWIQREKKQQELSTLNNSNNITYDHVDNQQYNVY------------ 58

Query: 70  EQMRRYQSSMAHLMSLSIRAQFLIDKF-HKGG--SGYQIDLDTVKKLGSEFEDISHNLCF 126
                    +A L SL +R Q++ DKF H        Q +   ++ L  EF+ I+     
Sbjct: 59  ---------LAQLNSLIVRVQYIRDKFLHNINQLDSTQDEQKYIENLVYEFKQIT----- 104

Query: 127 LEPNKVFDKNHTRFRSSEYPA---------PFQLRPLKLLQRIRN 162
           L+ N +  KN T   S               F+ +PLK+++R +N
Sbjct: 105 LKLNDLSKKNKTTSSSENSSKTASSKSSMESFEPKPLKIIKRTKN 149

>Kpol_1018.164 s1018 (420666..423203) [2538 bp, 845 aa] {ON}
           (420666..423203) [2538 nt, 846 aa]
          Length = 845

 Score = 33.5 bits (75), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 28/77 (36%), Positives = 41/77 (53%), Gaps = 11/77 (14%)

Query: 101 SGYQIDLDTVKKLGSEFEDISHNLCFLEPNKVFDKNHTRFRSSEYPAPFQLRPLKLLQRI 160
           SG  ID+D+     SE E+ S N  F+ P KV++K+  R  S EYPA  Q     L+ R+
Sbjct: 31  SGGSIDIDS----NSESENDSDN--FMHP-KVYEKSRNRRLSDEYPADIQ----PLMFRM 79

Query: 161 RNPSENESKDNLRIYEG 177
             P + ++ + L   EG
Sbjct: 80  TLPLDGQNNNTLAGQEG 96

>KLTH0F00462g Chr6 (35640..36995) [1356 bp, 451 aa] {ON} weakly
           similar to uniprot|P25591 Saccharomyces cerevisiae
           YCL063W VAC17 vacuole inheritance
          Length = 451

 Score = 33.1 bits (74), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 32/122 (26%), Positives = 51/122 (41%), Gaps = 20/122 (16%)

Query: 62  QSCGDQRTEQMRRYQSSMAHLMSLSIRAQFLIDK--FHKGGSGYQIDLDTVKKLGSEFED 119
           Q   D+ +  M +Y   +  L SL  +AQ L D        S   +    ++ L  EF++
Sbjct: 40  QCLSDKSSTNMAQYYEYIGQLYSLYTKAQKLSDTVILSDSKSLSSVQQRAIENLIQEFQE 99

Query: 120 ISHNLCFLEPNKVFDKNHTRFRSSEYP--------APFQLRPLKLLQRIRNPSENESKDN 171
           I+ N          D+N   +   E P          FQ +PLK+LQR +   E+ +K +
Sbjct: 100 IAKN----------DENFISYSMRESPNSMSVQSICSFQPKPLKILQRRQAQLESPTKRS 149

Query: 172 LR 173
            R
Sbjct: 150 FR 151

>NCAS0B09120 Chr2 complement(1749531..1750832) [1302 bp, 433 aa]
           {ON} Anc_1.4 YCL063W
          Length = 433

 Score = 31.6 bits (70), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 38/132 (28%), Positives = 59/132 (44%), Gaps = 27/132 (20%)

Query: 10  RLLTRCQESLVDLNLHIQMSWSLFELAQDCGGSEC---NGHNCDICRYTCRSAVQQSCGD 66
           RLL R QE+++ L++ IQ    L EL +     E       N DI R T    ++Q    
Sbjct: 10  RLLVRSQEAILQLDVWIQRQRRLQELMEGEEEQEQGGDTNTNMDI-RGTLPQFLEQ---- 64

Query: 67  QRTEQMRRYQSSMAHLMSLSIRAQF----LIDKFHKGGSGYQIDLDT-------VKKLGS 115
                   Y + MA L SL +R +F    L++K + G    Q++ +        ++ L  
Sbjct: 65  --------YNTYMAQLNSLQVRVEFIRDTLVNKKNTGIRNQQLESNNSVDEQKYIQDLVH 116

Query: 116 EFEDISHNLCFL 127
           EF+DI+  L  L
Sbjct: 117 EFQDITQKLSEL 128

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.319    0.132    0.398 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 48,416,257
Number of extensions: 2017155
Number of successful extensions: 5375
Number of sequences better than 10.0: 20
Number of HSP's gapped: 5494
Number of HSP's successfully gapped: 21
Length of query: 462
Length of database: 53,481,399
Length adjustment: 113
Effective length of query: 349
Effective length of database: 40,524,141
Effective search space: 14142925209
Effective search space used: 14142925209
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 67 (30.4 bits)