Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Ecym_10061.3ON36436417520.0
AFR747W1.3ON4263489191e-121
SAKL0C00418g1.3ON3643418641e-114
NDAI0A001201.3ON3773678591e-113
KAFR0D001101.3ON3653428411e-110
NCAS0B091301.3ON3673388411e-110
ZYRO0F15774gsingletonON4103378321e-108
Skud_3.11.3ON3603398231e-108
Smik_3.121.3ON3603458131e-106
Suva_3.1501.3ON3613398121e-106
TPHA0E040401.3ON3573478091e-106
YCL064C (CHA1)1.3ON3603388031e-104
KAFR0I00130singletonON3443387871e-102
KAFR0F04430singletonON3433477861e-102
KLTH0F00440g1.3ON3413387811e-101
KNAG0C001801.3ON3593517821e-101
CAGL0B00286g1.3ON3603577781e-101
NDAI0K02950singletonON3343417731e-100
Kpol_2002.61.3ON3503587621e-98
TBLA0A049201.3ON3603447603e-98
NCAS0A15330singletonON3473377384e-95
KLLA0C00440g1.3ON3773387328e-94
ZYRO0F18524g1.3ON3353347288e-94
SAKL0C13904gsingletonON3393377227e-93
KNAG0D05380singletonON3343436966e-89
Smik_9.2na 1ON3383366941e-88
TDEL0D06540singletonON3373386896e-88
KLLA0E01805gsingletonON3223386879e-88
Scer_YGOB_SDL1 (SDL1)na 1ON3373336689e-85
Skud_9.2na 1ON3393426522e-82
YIL167W (SDL1)singletonOFF2101894543e-54
KNAG0A01150singletonON2312204441e-52
YIL168WsingletonOFF1271282275e-22
SAKL0F11858g7.367ON5622632022e-16
KAFR0K017007.367ON5792821906e-15
TDEL0C018007.367ON5692871899e-15
KLLA0E19779g7.367ON5672821826e-14
Ecym_47087.367ON5702871801e-13
NCAS0A142307.367ON5692871782e-13
ZYRO0B02772g7.367ON5692631693e-12
YER086W (ILV1)7.367ON5762641675e-12
CAGL0I05126g7.367ON5712871666e-12
Smik_5.2257.367ON5762861666e-12
Skud_5.2057.367ON5762641667e-12
ACR232C7.367ON5602631658e-12
Suva_5.1997.367ON5762641659e-12
Kpol_530.167.367ON5662821632e-11
TPHA0F031307.367ON5682861622e-11
NDAI0A018107.367ON5702871603e-11
TBLA0C050707.367ON5752891551e-10
KNAG0C036907.367ON5772781533e-10
KLTH0B04884g7.367ON5732631382e-08
Kwal_33.148227.367ON5622631274e-07
SAKL0A10626gsingletonON3202951211e-06
YKL218C (SRY1)na 2ON3263011061e-04
Smik_11.3na 2ON269240693.2
YNL290W (RFC3)3.69ON34045678.2
TPHA0J028705.488ON94674679.7
ACL176W3.241ON290150669.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Ecym_1006
         (364 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Ecym_1006 Chr1 complement(9635..10729) [1095 bp, 364 aa] {ON} si...   679   0.0  
AFR747W Chr6 (1808016..1809296) [1281 bp, 426 aa] {ON} Syntenic ...   358   e-121
SAKL0C00418g Chr3 complement(37529..38623) [1095 bp, 364 aa] {ON...   337   e-114
NDAI0A00120 Chr1 complement(4652..5785) [1134 bp, 377 aa] {ON} A...   335   e-113
KAFR0D00110 Chr4 complement(7211..8308) [1098 bp, 365 aa] {ON} A...   328   e-110
NCAS0B09130 Chr2 (1751219..1752322) [1104 bp, 367 aa] {ON} Anc_1.3    328   e-110
ZYRO0F15774g Chr6 (1300486..1301718) [1233 bp, 410 aa] {ON} simi...   325   e-108
Skud_3.1 Chr3 complement(3828..4910) [1083 bp, 360 aa] {ON} YCL0...   321   e-108
Smik_3.12 Chr3 complement(17223..18305) [1083 bp, 360 aa] {ON} Y...   317   e-106
Suva_3.150 Chr3 complement(225656..226741) [1086 bp, 361 aa] {ON...   317   e-106
TPHA0E04040 Chr5 (846219..847292) [1074 bp, 357 aa] {ON} Anc_1.3...   316   e-106
YCL064C Chr3 complement(15798..16880) [1083 bp, 360 aa] {ON}  CH...   313   e-104
KAFR0I00130 Chr9 complement(26703..27737) [1035 bp, 344 aa] {ON}...   307   e-102
KAFR0F04430 Chr6 (868691..869722) [1032 bp, 343 aa] {ON}              307   e-102
KLTH0F00440g Chr6 complement(34215..35240) [1026 bp, 341 aa] {ON...   305   e-101
KNAG0C00180 Chr3 complement(27151..28230) [1080 bp, 359 aa] {ON}...   305   e-101
CAGL0B00286g Chr2 complement(12803..13885) [1083 bp, 360 aa] {ON...   304   e-101
NDAI0K02950 Chr11 (671102..672106) [1005 bp, 334 aa] {ON}             302   e-100
Kpol_2002.6 s2002 complement(7840..8892) [1053 bp, 350 aa] {ON} ...   298   1e-98
TBLA0A04920 Chr1 complement(1214344..1215426) [1083 bp, 360 aa] ...   297   3e-98
NCAS0A15330 Chr1 (3015596..3016639) [1044 bp, 347 aa] {ON}            288   4e-95
KLLA0C00440g Chr3 complement(32008..33141) [1134 bp, 377 aa] {ON...   286   8e-94
ZYRO0F18524g Chr6 (1528741..1529748) [1008 bp, 335 aa] {ON} simi...   285   8e-94
SAKL0C13904g Chr3 (1223973..1224992) [1020 bp, 339 aa] {ON} simi...   282   7e-93
KNAG0D05380 Chr4 complement(986308..987312) [1005 bp, 334 aa] {O...   272   6e-89
Smik_9.2 Chr9 (6779..7795) [1017 bp, 338 aa] {ON} YCL064C (REAL)      271   1e-88
TDEL0D06540 Chr4 (1175562..1176575) [1014 bp, 337 aa] {ON}            270   6e-88
KLLA0E01805g Chr5 complement(173125..174093) [969 bp, 322 aa] {O...   269   9e-88
Scer_YGOB_SDL1 Chr9 (29032..29411,29415..30048) [1014 bp, 337 aa...   261   9e-85
Skud_9.2 Chr9 (5919..6938) [1020 bp, 339 aa] {ON} YCL064C (REAL)      255   2e-82
YIL167W Chr9 (29416..30048) [633 bp, 210 aa] {OFF}  SDL1Open rea...   179   3e-54
KNAG0A01150 Chr1 (6346..7041) [696 bp, 231 aa] {ON}                   175   1e-52
YIL168W Chr9 (29032..29415) [384 bp, 127 aa] {OFF} Open reading ...    92   5e-22
SAKL0F11858g Chr6 (920767..922455) [1689 bp, 562 aa] {ON} highly...    82   2e-16
KAFR0K01700 Chr11 (352943..354682) [1740 bp, 579 aa] {ON} Anc_7....    78   6e-15
TDEL0C01800 Chr3 complement(313699..315408) [1710 bp, 569 aa] {O...    77   9e-15
KLLA0E19779g Chr5 complement(1760800..1762503) [1704 bp, 567 aa]...    75   6e-14
Ecym_4708 Chr4 (1386138..1387850) [1713 bp, 570 aa] {ON} similar...    74   1e-13
NCAS0A14230 Chr1 (2801647..2803356) [1710 bp, 569 aa] {ON} Anc_7...    73   2e-13
ZYRO0B02772g Chr2 (224426..226135) [1710 bp, 569 aa] {ON} highly...    70   3e-12
YER086W Chr5 (328477..330207) [1731 bp, 576 aa] {ON}  ILV1Threon...    69   5e-12
CAGL0I05126g Chr9 complement(481145..482860) [1716 bp, 571 aa] {...    69   6e-12
Smik_5.225 Chr5 (337064..338794) [1731 bp, 576 aa] {ON} YER086W ...    69   6e-12
Skud_5.205 Chr5 (322688..324418) [1731 bp, 576 aa] {ON} YER086W ...    69   7e-12
ACR232C Chr3 complement(767330..769012) [1683 bp, 560 aa] {ON} S...    68   8e-12
Suva_5.199 Chr5 (303073..304803) [1731 bp, 576 aa] {ON} YER086W ...    68   9e-12
Kpol_530.16 s530 complement(41170..42870) [1701 bp, 566 aa] {ON}...    67   2e-11
TPHA0F03130 Chr6 complement(685292..686998) [1707 bp, 568 aa] {O...    67   2e-11
NDAI0A01810 Chr1 complement(400890..402602) [1713 bp, 570 aa] {O...    66   3e-11
TBLA0C05070 Chr3 (1230732..1232459) [1728 bp, 575 aa] {ON} Anc_7...    64   1e-10
KNAG0C03690 Chr3 complement(722238..723971) [1734 bp, 577 aa] {O...    64   3e-10
KLTH0B04884g Chr2 (400193..401914) [1722 bp, 573 aa] {ON} highly...    58   2e-08
Kwal_33.14822 s33 complement(830029..831717) [1689 bp, 562 aa] {...    54   4e-07
SAKL0A10626g Chr1 complement(932879..933841) [963 bp, 320 aa] {O...    51   1e-06
YKL218C Chr11 complement(17359..18339) [981 bp, 326 aa] {ON}  SR...    45   1e-04
Smik_11.3 Chr11 complement(1725..2534) [810 bp, 269 aa] {ON} YKL...    31   3.2  
YNL290W Chr14 (86218..87240) [1023 bp, 340 aa] {ON}  RFC3Subunit...    30   8.2  
TPHA0J02870 Chr10 (635718..638558) [2841 bp, 946 aa] {ON} Anc_5....    30   9.7  
ACL176W Chr3 (52435..53307) [873 bp, 290 aa] {ON} Syntenic homol...    30   9.7  

>Ecym_1006 Chr1 complement(9635..10729) [1095 bp, 364 aa] {ON}
           similar to Ashbya gossypii AFR747W
          Length = 364

 Score =  679 bits (1752), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 335/364 (92%), Positives = 335/364 (92%)

Query: 1   MSSLYVKTPLLRRAFGKPNIQISKVPQFLVKYEFFQPSGSFKSRGIGNLIYNKVSEIRRD 60
           MSSLYVKTPLLRRAFGKPNIQISKVPQFLVKYEFFQPSGSFKSRGIGNLIYNKVSEIRRD
Sbjct: 1   MSSLYVKTPLLRRAFGKPNIQISKVPQFLVKYEFFQPSGSFKSRGIGNLIYNKVSEIRRD 60

Query: 61  PAKQPHVFXXXXXXXXXXXXXXXQRMGIPCTVVVPTSTRQRIIEKIMATGATIICRGDYF 120
           PAKQPHVF               QRMGIPCTVVVPTSTRQRIIEKIMATGATIICRGDYF
Sbjct: 61  PAKQPHVFSSSGGNAGLAAATASQRMGIPCTVVVPTSTRQRIIEKIMATGATIICRGDYF 120

Query: 121 AEADSYLKDLMQEAANKNTRDKKNVPIYVHPFNHPLIWHGHSYIVEEILESLRNENIPYS 180
           AEADSYLKDLMQEAANKNTRDKKNVPIYVHPFNHPLIWHGHSYIVEEILESLRNENIPYS
Sbjct: 121 AEADSYLKDLMQEAANKNTRDKKNVPIYVHPFNHPLIWHGHSYIVEEILESLRNENIPYS 180

Query: 181 RVKGIVCSVXXXXXXXXXXXXXXRHSLANTIPIIGVETEGCEVLHKSLIAGKLITFKKAL 240
           RVKGIVCSV              RHSLANTIPIIGVETEGCEVLHKSLIAGKLITFKKAL
Sbjct: 181 RVKGIVCSVGGGGLYNGIIEGLERHSLANTIPIIGVETEGCEVLHKSLIAGKLITFKKAL 240

Query: 241 SVATSLSVPTITKETLRYAQKYKTKSLVLGEGEVLDTCLRFTDESNIVTEPACGATLHLG 300
           SVATSLSVPTITKETLRYAQKYKTKSLVLGEGEVLDTCLRFTDESNIVTEPACGATLHLG
Sbjct: 241 SVATSLSVPTITKETLRYAQKYKTKSLVLGEGEVLDTCLRFTDESNIVTEPACGATLHLG 300

Query: 301 YHPAILHKELGPLSSEDIVILIACGGSATTLADLRELKLKYNPVTLDDSPVEIPGLITEQ 360
           YHPAILHKELGPLSSEDIVILIACGGSATTLADLRELKLKYNPVTLDDSPVEIPGLITEQ
Sbjct: 301 YHPAILHKELGPLSSEDIVILIACGGSATTLADLRELKLKYNPVTLDDSPVEIPGLITEQ 360

Query: 361 VLTA 364
           VLTA
Sbjct: 361 VLTA 364

>AFR747W Chr6 (1808016..1809296) [1281 bp, 426 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YCL064C (CHA1)
          Length = 426

 Score =  358 bits (919), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 172/348 (49%), Positives = 237/348 (68%), Gaps = 7/348 (2%)

Query: 1   MSSLYVKTPLLRRAFGKPNIQISKVPQFLVKYEFFQPSGSFKSRGIGNLIYNKVSEIRRD 60
           M+S Y KTPL+R  F + N++ +  P+ ++KYEFFQPSGSFKSRGIGNLI+ ++ +IR++
Sbjct: 69  MASFYCKTPLMRHVFARQNVRYTANPEIMLKYEFFQPSGSFKSRGIGNLIWKEMQKIRQN 128

Query: 61  PAKQPHVFXXXXXXXXXXXXXXXQRMGIPCTVVVPTSTRQRIIEKIMATGATIICRGDYF 120
            + QPHVF               +++G+PCTVVVP +TR+R++E+I +TGA +I  G   
Sbjct: 129 SSLQPHVFASSGGNAGLAAATASRQLGLPCTVVVPETTRRRMVERIRSTGADVISMGSVL 188

Query: 121 AEADSYLK-DLMQEAANKNTRDKKNVPIYVHPFNHPLIWHGHSYIVEEILESLRNENIPY 179
            E+D YL+ +LM      N   +K  PIY HPF++PLIW GH+ +V+E++E+L  + +  
Sbjct: 189 KESDDYLRSELM-----GNVNLEKVAPIYAHPFDNPLIWEGHATMVDEVVEALHLQGVQL 243

Query: 180 SRVKGIVCSVXXXXXXXXXXXXXXRHSLANTIPIIGVETEGCEVLHKSLIAGKLITFKKA 239
             VKGIVCSV              +H LA++IP++ VETEGCEVLH+SL+ G+ ++    
Sbjct: 244 ESVKGIVCSVGGGGLYNGIVYGLEKHGLADSIPVVAVETEGCEVLHRSLLLGRNVSMNPK 303

Query: 240 LSVATSLSVPTITKETLRYAQKYKTKSLVLGEGEVLDTCLRFTDESNIVTEPACGATLHL 299
            SVATSL    +T  TL YAQKY+TKS+VL +  V+ TCL F +ESNIVTEPACGA LHL
Sbjct: 304 -SVATSLCTSFVTDLTLSYAQKYRTKSVVLDQLAVVQTCLNFAEESNIVTEPACGAALHL 362

Query: 300 GYHPAILHKELGPLSSEDIVILIACGGSATTLADLRELKLKYNPVTLD 347
           GYHP IL +ELGPL+ +D+VI+IACGGS   LADL+E + +  P   D
Sbjct: 363 GYHPEILERELGPLTPQDVVIVIACGGSTMNLADLKESEDQLQPKIKD 410

>SAKL0C00418g Chr3 complement(37529..38623) [1095 bp, 364 aa] {ON}
           similar to uniprot|P25379 Saccharomyces cerevisiae
           YCL064C CHA1 catabolism of hydroxy amino acids catabolic
           serine (threonine) dehydratase
          Length = 364

 Score =  337 bits (864), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 172/341 (50%), Positives = 223/341 (65%), Gaps = 7/341 (2%)

Query: 1   MSSLYVKTPLLRRAFGKPNIQISKVPQFLVKYEFFQPSGSFKSRGIGNLIYNKVSEIRRD 60
           M+S Y KTPLLRR F  P+  +S  PQFLVKYE FQPSGSFKSRGIG+LI    + I  +
Sbjct: 1   MTSFYSKTPLLRRIF--PSSVLSATPQFLVKYEVFQPSGSFKSRGIGHLITQSAARIESE 58

Query: 61  PAKQPHVFXXXXXXXXXXXXXXXQRMGIPCTVVVPTSTRQRIIEKIMATGATIICRGDYF 120
             K  HVF               +   +PCTVVVPT+T  R++ KI  TGA +I  G+++
Sbjct: 59  GNKTAHVFASSGGNAGLAAATACRAFSLPCTVVVPTTTNLRMVAKIRQTGADVIVHGNHW 118

Query: 121 AEADSYLKDLMQEAANKNTRDKKNVPIYVHPFNHPLIWHGHSYIVEEILESLRNENIPYS 180
            +AD YL   +    +      K  P+Y HPF++P+IW GHS IV+EI+ESL  + IP S
Sbjct: 119 GDADQYLHRSVMPCIDTT----KFEPVYAHPFDNPVIWEGHSTIVDEIVESLERQRIPAS 174

Query: 181 RVKGIVCSVXXXXXXXXXXXXXXRHSLANTIPIIGVETEGCEVLHKSLIAGKLITFKKAL 240
           +VKGIVCS+              +H LA TIPIIGVET+GCEV H+SL AGK + F K  
Sbjct: 175 QVKGIVCSIGGGGLYNGIIEGLEKHDLATTIPIIGVETKGCEVFHQSLKAGKPLVFDKIT 234

Query: 241 SVATSLSVPTITKETLRYAQKYKTKSLVLGEGEVLDTCLRFTDESNIVTEPACGATLHLG 300
           SVATSL   TI K+TL  A KY TKS+VL + +V+ TCL F D++NIV EPACGA+LH G
Sbjct: 235 SVATSLGTATICKKTLENALKYNTKSVVLSDADVVRTCLDFADDTNIVPEPACGASLHFG 294

Query: 301 YHPAILHKEL-GPLSSEDIVILIACGGSATTLADLRELKLK 340
           Y+P +L   L G L  EDI+I+IACGGS+TT+ DL++++++
Sbjct: 295 YNPHLLEDTLGGSLGPEDIIIVIACGGSSTTVQDLQQMQVR 335

>NDAI0A00120 Chr1 complement(4652..5785) [1134 bp, 377 aa] {ON}
           Anc_1.3
          Length = 377

 Score =  335 bits (859), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 171/367 (46%), Positives = 230/367 (62%), Gaps = 14/367 (3%)

Query: 1   MSSLYVKTPLLRRAF------GKPNIQISKVPQFLVKYEFFQPSGSFKSRGIGNLIYNKV 54
           MS +Y KTPLLR+ F            ++  PQF VKYE  QPSGSFKSRGIGNLI    
Sbjct: 1   MSVVYNKTPLLRQFFQNSVAKSSATASVTATPQFFVKYECLQPSGSFKSRGIGNLILKSA 60

Query: 55  SEIRRDPAKQPHVFXXXXXXXXXXXXXXXQRMGIPCTVVVPTSTRQRIIEKIMATGATII 114
             I +   K P VF               QR+ +PCTVVVPT+T+QR++EKI +TGA +I
Sbjct: 61  MNINKIGQKTPQVFASSGGNAGFAAATACQRLSLPCTVVVPTATKQRMVEKIKSTGANVI 120

Query: 115 CRGDYFAEADSYLKDLMQEAANKNTRDKKNVPIYVHPFNHPLIWHGHSYIVEEILESLRN 174
             G ++ EAD +LK+ +    + N  +    PIYVHPF++PLIW GH+ +V+EI++SL +
Sbjct: 121 INGAHWKEADMFLKNSIMNKIDTNHIE----PIYVHPFDNPLIWEGHATMVDEIMDSLND 176

Query: 175 ENIPYSRVKGIVCSVXXXXXXXXXXXXXXRHSLANTIPIIGVETEGCEVLHKSLIAGKLI 234
           +NIP ++VKGIVCSV              +++LA+ IPI+GVET+GC V + SL   K I
Sbjct: 177 QNIPINKVKGIVCSVGGGGLYNGIIQGLQKYNLADKIPIVGVETKGCHVFNTSLKLNKQI 236

Query: 235 TFKKALSVATSLSVPTITKETLRYAQKYKTKSLVLGEGEVLDTCLRFTDESNIVTEPACG 294
            F K  S+ATSL    I+K+T  YAQKYKT+S+V+ +  V++TCL++T + N+V EPACG
Sbjct: 237 EFSKITSIATSLGTANISKKTFEYAQKYKTRSVVIEDKNVIETCLKYTQDYNMVVEPACG 296

Query: 295 ATLHLGYHPAILHKELG-PLSSEDIVILIACGGSATTLADLRELKLKYNP---VTLDDSP 350
           A++HL YH  IL K LG  L+S+DI+++IACGGS+ T  DL  L L         LD S 
Sbjct: 297 ASIHLAYHTDILEKSLGHKLNSDDIILVIACGGSSNTTHDLESLLLNMKADEKQNLDSSS 356

Query: 351 VEIPGLI 357
             IP  I
Sbjct: 357 STIPNFI 363

>KAFR0D00110 Chr4 complement(7211..8308) [1098 bp, 365 aa] {ON}
           Anc_1.3 YCL064C
          Length = 365

 Score =  328 bits (841), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 163/342 (47%), Positives = 225/342 (65%), Gaps = 6/342 (1%)

Query: 1   MSSLYVKTPLLRRAF-GKPNIQISKVPQFLVKYEFFQPSGSFKSRGIGNLIYNKVSEIRR 59
           MS +Y KTPLLR+ F G  + + + +PQF +KYE  QPSGSFKSRGIGNLI  +  +I +
Sbjct: 1   MSVVYNKTPLLRQFFPGTKSRKSNSLPQFFLKYECLQPSGSFKSRGIGNLILKQAMQIHK 60

Query: 60  DPAKQPHVFXXXXXXXXXXXXXXXQRMGIPCTVVVPTSTRQRIIEKIMATGATIICRGDY 119
              K+P VF               QR+ +PCTVVVPT+T+QR+IEKI  TGA +I  G +
Sbjct: 61  KGTKRPEVFASSGGNAGYAAAVACQRLSLPCTVVVPTATKQRMIEKIKDTGANVIIDGAF 120

Query: 120 FAEADSYLKDLMQEAANKNTRDKKNVPIYVHPFNHPLIWHGHSYIVEEILESLRNENIPY 179
           + EAD YLK  +    NKN  D    PIYVHPF++PLIW GHS IV+EI+++LR + +  
Sbjct: 121 WKEADQYLKKSVMNKINKNEID----PIYVHPFDNPLIWEGHSSIVDEIMDTLREQKVQP 176

Query: 180 SRVKGIVCSVXXXXXXXXXXXXXXRHSLANTIPIIGVETEGCEVLHKSLIAGKLITFKKA 239
           S +KGIVCSV              RH L + IP++GVETEGC V + SL  GK + F+K 
Sbjct: 177 SNIKGIVCSVGGGGLYNGIIQGLERHKLVDKIPVVGVETEGCHVFNTSLKLGKQVEFEKI 236

Query: 240 LSVATSLSVPTITKETLRYAQKYKTKSLVLGEGEVLDTCLRFTDESNIVTEPACGATLHL 299
            S+ATSL+  +I+ +T   A KY T+S+++ + +V++TCL++T + N+VTEPACGA++HL
Sbjct: 237 TSIATSLATASISAKTFENALKYGTRSVIVKDADVIETCLKYTKDYNMVTEPACGASIHL 296

Query: 300 GYHPAILHKELG-PLSSEDIVILIACGGSATTLADLRELKLK 340
            Y+  IL   LG  L+ +D V++IACGGS+ TL D+ E  L+
Sbjct: 297 AYNIDILENALGTKLTKDDTVVVIACGGSSNTLQDMEETLLR 338

>NCAS0B09130 Chr2 (1751219..1752322) [1104 bp, 367 aa] {ON} Anc_1.3
          Length = 367

 Score =  328 bits (841), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 163/338 (48%), Positives = 225/338 (66%), Gaps = 6/338 (1%)

Query: 1   MSSLYVKTPLLRRAFGKPNIQIS-KVPQFLVKYEFFQPSGSFKSRGIGNLIYNKVSEIRR 59
           MS +Y KTPLLR+ F   + + S  +PQF +KYE  QPSGSFKSRGIGNLI      I++
Sbjct: 1   MSIVYNKTPLLRQFFPAVSTKPSTSIPQFFLKYECLQPSGSFKSRGIGNLIMKNAIRIKK 60

Query: 60  DPAKQPHVFXXXXXXXXXXXXXXXQRMGIPCTVVVPTSTRQRIIEKIMATGATIICRGDY 119
              K P VF               QR+ +PCTVVVPT+T+QR++EKI ATGA +I  G +
Sbjct: 61  SGNKSPQVFSSSGGNAGFAAATASQRLSLPCTVVVPTATKQRMVEKIRATGANVIINGAH 120

Query: 120 FAEADSYLKDLMQEAANKNTRDKKNVPIYVHPFNHPLIWHGHSYIVEEILESLRNENIPY 179
           + EAD+YLK  +  + + NT +    PIYVHPF++P IW GHS +V+EI+++L  +NI  
Sbjct: 121 WKEADTYLKSSVMNSIDLNTTE----PIYVHPFDNPDIWEGHSTMVDEIVDTLNEQNIAL 176

Query: 180 SRVKGIVCSVXXXXXXXXXXXXXXRHSLANTIPIIGVETEGCEVLHKSLIAGKLITFKKA 239
           +++KGIVCSV              +H LA+ IPI+GVET+GC V + SL  GK I F K 
Sbjct: 177 NKIKGIVCSVGGGGLYNGIIQGLEKHKLADKIPIVGVETKGCHVFNTSLKLGKQIEFSKI 236

Query: 240 LSVATSLSVPTITKETLRYAQKYKTKSLVLGEGEVLDTCLRFTDESNIVTEPACGATLHL 299
            S+ATSL   +I+ +T  YA+KY T+S+V+ + +V++TCL++T + N+V EPACGA+LHL
Sbjct: 237 TSIATSLGTASISSQTFEYAKKYHTRSVVVEDTDVIETCLKYTQDFNMVAEPACGASLHL 296

Query: 300 GYHPAILHKELG-PLSSEDIVILIACGGSATTLADLRE 336
            Y+  IL   LG  LSS+DI+++IACGGS+ T+ DL E
Sbjct: 297 AYNTNILENALGHKLSSDDIILVIACGGSSNTVQDLEE 334

>ZYRO0F15774g Chr6 (1300486..1301718) [1233 bp, 410 aa] {ON} similar
           to uniprot|P25379 Saccharomyces cerevisiae YCL064C CHA1
           catabolism of hydroxy amino acids catabolic serine
           (threonine) dehydratase
          Length = 410

 Score =  325 bits (832), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 159/337 (47%), Positives = 220/337 (65%), Gaps = 10/337 (2%)

Query: 1   MSSLYVKTPLLRRAFGKPNIQISKVPQFLVKYEFFQPSGSFKSRGIGNLIYNKVSEIRRD 60
           M S+Y KTPLL++ F       +   Q  VKYE  QPSGSFKSRGIG+LI  +  +I+ D
Sbjct: 47  MPSIYNKTPLLKQIFNH-----ATSAQVFVKYECLQPSGSFKSRGIGHLISKRAKDIQGD 101

Query: 61  PAKQPHVFXXXXXXXXXXXXXXXQRMGIPCTVVVPTSTRQRIIEKIMATGATIICRGDYF 120
             K PHVF               Q++ +PCTVV+PT+T+QR+ +KI   GA ++ +G ++
Sbjct: 102 GRKSPHVFSSSGGNAGYAAAVAAQKLNLPCTVVIPTTTKQRMADKIRGCGANVVVQGSHW 161

Query: 121 AEADSYLKDLMQEAANKNTRDKKNVPIYVHPFNHPLIWHGHSYIVEEILESLRNENIPYS 180
            EADS+LK+++Q   N    +    PIYVHPF++P IW GH+ IV+EI+ SL+NEN   +
Sbjct: 162 KEADSHLKNILQNQVNMAILE----PIYVHPFDNPTIWEGHASIVDEIISSLKNENTALN 217

Query: 181 RVKGIVCSVXXXXXXXXXXXXXXRHSLANTIPIIGVETEGCEVLHKSLIAGKLITFKKAL 240
           RVKGIVCSV              +++LAN IP++ VET+GC VL+ SL  G+ + F K  
Sbjct: 218 RVKGIVCSVGGGGLYNGIIQGLEKYNLANKIPLLAVETKGCHVLNTSLQVGQCVEFNKMN 277

Query: 241 SVATSLSVPTITKETLRYAQKYKTKSLVLGEGEVLDTCLRFTDESNIVTEPACGATLHLG 300
           SVATSL    I+  TL Y QKY +KS+VL + EVL TCL++ +  N++TEPACGA+LHLG
Sbjct: 278 SVATSLCTSQISSRTLDYVQKYGSKSIVLEDKEVLQTCLKYAENFNMITEPACGASLHLG 337

Query: 301 YHPAILHKELGP-LSSEDIVILIACGGSATTLADLRE 336
           YHP ++ + LG  L  +D++I+IACGGS+ T+ DL E
Sbjct: 338 YHPQLIERALGKNLDKDDVIIVIACGGSSNTILDLEE 374

>Skud_3.1 Chr3 complement(3828..4910) [1083 bp, 360 aa] {ON} YCL064C
           (REAL)
          Length = 360

 Score =  321 bits (823), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 167/339 (49%), Positives = 221/339 (65%), Gaps = 14/339 (4%)

Query: 1   MSSLYVKTPLLRRAFGKPNIQISKVP-QFLVKYEFFQPSGSFKSRGIGNLIYNKVSEIRR 59
           MS +Y KTPLLR+ F       SK P QF +KYE  QPSGSFKSRGIGNLI      I++
Sbjct: 1   MSIVYNKTPLLRQFFP------SKSPAQFFLKYECLQPSGSFKSRGIGNLILKNAIRIQK 54

Query: 60  DPAKQPHVFXXXXXXXXXXXXXXXQRMGIPCTVVVPTSTRQRIIEKIMATGATIICRGDY 119
           D  + P VF               QR+ +PCTVVVPT+T++R++EKI  TGA +I  G Y
Sbjct: 55  DGRRSPQVFASSGGNAGLAAATTCQRLSLPCTVVVPTATKKRMVEKIRNTGAQVIVNGAY 114

Query: 120 FAEADSYLKDLMQEAANKNTRDKKNV-PIYVHPFNHPLIWHGHSYIVEEILESLRNENIP 178
           + EAD++LK     A   N  D + V PIYVHPF++P IW GHS +V+EI++ L+++ I 
Sbjct: 115 WKEADTFLK-----ANIMNQIDSQVVEPIYVHPFDNPDIWEGHSSMVDEIVQDLKSQRIS 169

Query: 179 YSRVKGIVCSVXXXXXXXXXXXXXXRHSLANTIPIIGVETEGCEVLHKSLIAGKLITFKK 238
            ++VKGIVCSV              R+ LA+ IPI+GVET GC V + SL  G+ + FKK
Sbjct: 170 MNKVKGIVCSVGGGGLYNGIIQGLERYHLADKIPIVGVETNGCHVFNTSLRIGQPVQFKK 229

Query: 239 ALSVATSLSVPTITKETLRYAQKYKTKSLVLGEGEVLDTCLRFTDESNIVTEPACGATLH 298
             S+ATSL    I+ +T  YA KY TKS+V+ + +V++TCL++T + N+V EPACGA LH
Sbjct: 230 ITSIATSLGTAVISNQTFEYAHKYNTKSVVIEDKDVIETCLKYTHQCNMVAEPACGAALH 289

Query: 299 LGYHPAILHKELGP-LSSEDIVILIACGGSATTLADLRE 336
           LGYH  IL K LG  L+++DIVI+IACGGS+ T+ DL E
Sbjct: 290 LGYHTEILEKALGSKLAADDIVIIIACGGSSNTVQDLEE 328

>Smik_3.12 Chr3 complement(17223..18305) [1083 bp, 360 aa] {ON}
           YCL064C (REAL)
          Length = 360

 Score =  317 bits (813), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 163/345 (47%), Positives = 222/345 (64%), Gaps = 14/345 (4%)

Query: 1   MSSLYVKTPLLRRAFGKPNIQISKVP-QFLVKYEFFQPSGSFKSRGIGNLIYNKVSEIRR 59
           MS +Y KTPLLR+ F        K P QF +KYE  QPSGSFKSRGIGNLI      I++
Sbjct: 1   MSIVYNKTPLLRQFFP------GKSPAQFFLKYECLQPSGSFKSRGIGNLIMKSAIRIQK 54

Query: 60  DPAKQPHVFXXXXXXXXXXXXXXXQRMGIPCTVVVPTSTRQRIIEKIMATGATIICRGDY 119
           D  K P +F               QR+ +PCTVVVPT+T++R++EKI  TGA +I  G Y
Sbjct: 55  DGKKSPQIFASSGGNAGFAAATACQRLSLPCTVVVPTATKKRMVEKIRNTGAQVIVSGAY 114

Query: 120 FAEADSYLK-DLMQEAANKNTRDKKNVPIYVHPFNHPLIWHGHSYIVEEILESLRNENIP 178
           + EAD++LK D+MQ+   +        PIYVHPF++P IW GHS +V+E+++ L  + I 
Sbjct: 115 WKEADTFLKADVMQKIDTQVVE-----PIYVHPFDNPDIWEGHSSMVDEMVQDLEFQRIS 169

Query: 179 YSRVKGIVCSVXXXXXXXXXXXXXXRHSLANTIPIIGVETEGCEVLHKSLIAGKLITFKK 238
            ++VKGIVCSV              R+ LA+ IPI+GVET GC V + SL  G+ + FKK
Sbjct: 170 MNKVKGIVCSVGGGGLYNGIVQGLERYGLADKIPIVGVETNGCHVFNTSLRIGQPVQFKK 229

Query: 239 ALSVATSLSVPTITKETLRYAQKYKTKSLVLGEGEVLDTCLRFTDESNIVTEPACGATLH 298
             S+ATSL    I+ +T  YA+KY T+S+V+ + +V+DTCL++T + N+V EPACGA LH
Sbjct: 230 ITSIATSLGTAVISNQTFDYARKYNTRSVVIEDKDVIDTCLKYTHQFNMVVEPACGAALH 289

Query: 299 LGYHPAILHKELGP-LSSEDIVILIACGGSATTLADLRELKLKYN 342
           LGY+  IL + LG  L+++DIVI+IACGGS+ T+ DL E    +N
Sbjct: 290 LGYNTEILERALGSKLAADDIVIIIACGGSSNTIQDLEEALDHFN 334

>Suva_3.150 Chr3 complement(225656..226741) [1086 bp, 361 aa] {ON}
           YCL064C (REAL)
          Length = 361

 Score =  317 bits (812), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 162/339 (47%), Positives = 222/339 (65%), Gaps = 14/339 (4%)

Query: 1   MSSLYVKTPLLRRAF-GKPNIQISKVPQFLVKYEFFQPSGSFKSRGIGNLIYNKVSEIRR 59
           MS +Y KTPLLR+ F GK       + QF +KYE  QPSGSFKSRGIGNLI      I++
Sbjct: 1   MSIVYNKTPLLRQFFPGK------SLAQFYLKYECLQPSGSFKSRGIGNLILKNAIRIQK 54

Query: 60  DPAKQPHVFXXXXXXXXXXXXXXXQRMGIPCTVVVPTSTRQRIIEKIMATGATIICRGDY 119
           +  + P VF               QR+ +PCTVVVPT+T++R++EKI  TGA +I  G +
Sbjct: 55  NGKRSPQVFASSGGNAGFAAATACQRLSLPCTVVVPTATKERMVEKIRNTGAQVIVNGAF 114

Query: 120 FAEADSYLKDLMQEAANKNTRDKKNV-PIYVHPFNHPLIWHGHSYIVEEILESLRNENIP 178
           + EAD+YLK  +      N  D + V PIYVHPF++P IW GHS +V+EI++ L+++ +P
Sbjct: 115 WKEADTYLKTNVM-----NLIDHQAVEPIYVHPFDNPDIWEGHSSMVDEIVQDLKSQRVP 169

Query: 179 YSRVKGIVCSVXXXXXXXXXXXXXXRHSLANTIPIIGVETEGCEVLHKSLIAGKLITFKK 238
             +VKGIVCSV              RH LA+ IPI+GVET+GC V + SL  G+ + FKK
Sbjct: 170 MEKVKGIVCSVGGGGLYNGIIQGLERHGLADKIPIVGVETKGCHVFNTSLRIGQPVQFKK 229

Query: 239 ALSVATSLSVPTITKETLRYAQKYKTKSLVLGEGEVLDTCLRFTDESNIVTEPACGATLH 298
             S+ATSL    I+ +T  YA+KY TKS+V+ + +V++TCL+++ + N+VTEPACGA LH
Sbjct: 230 ITSIATSLGTANISNQTFEYARKYNTKSVVVEDKDVIETCLKYSHQFNMVTEPACGAALH 289

Query: 299 LGYHPAILHKELG-PLSSEDIVILIACGGSATTLADLRE 336
           LGYH  IL   L   L+++DIV++IACGGS+ T+ DL E
Sbjct: 290 LGYHTDILETALDTKLAADDIVLIIACGGSSNTVQDLEE 328

>TPHA0E04040 Chr5 (846219..847292) [1074 bp, 357 aa] {ON} Anc_1.3
           YCL064C
          Length = 357

 Score =  316 bits (809), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 162/347 (46%), Positives = 225/347 (64%), Gaps = 14/347 (4%)

Query: 1   MSSLYVKTPLLRRAFGKPNIQISKVPQFLVKYEFFQPSGSFKSRGIGNLIYNKVSEIRRD 60
           MS +Y KTPLLR  F   N+     PQ  +KYE FQPSGSFKSRGIGNLI +   EI+++
Sbjct: 1   MSQVYNKTPLLRHLFPGKNL-----PQVFLKYECFQPSGSFKSRGIGNLIQSTSLEIQKN 55

Query: 61  PAKQPHVFXXXXXXXXXXXXXXXQRMGIPCTVVVPTSTRQRIIEKIMATGATIICRGDYF 120
             K P VF               + + +PCTVVVPT+T+ R++EKI ATGA +I +G+++
Sbjct: 56  SKKSPEVFSSSGGNAGLAAATASKMLSLPCTVVVPTATKLRMVEKIKATGANVIVKGNHW 115

Query: 121 AEADSYLKDLMQEAANKNTRDKKNVPIYVHPFNHPLIWHGHSYIVEEILESLRNENIPYS 180
            EAD+YLK  +    +K   +    PIYVHPF++  IW GH+ +++EI+E+   ++IP  
Sbjct: 116 KEADTYLKTNVLSNIDKKLIE----PIYVHPFDNKKIWEGHATMIDEIVETFGQQHIPIE 171

Query: 181 RVKGIVCSVXXXXXXXXXXXXXXRHSLANTIPIIGVETEGCEVLHKSLIAGKLITFKKAL 240
           +VK IVCSV              +H LA  IP++GVET GC V + SL  GK+I F+K  
Sbjct: 172 KVKAIVCSVGGGGLYNGIIQGLEKHDLATKIPVVGVETLGCHVFNTSLKMGKVIQFEKIN 231

Query: 241 SVATSLSVPTITKETLRYAQKYKTKSLVLGEGEVLDTCLRFTDESNIVTEPACGATLHLG 300
           ++ATSL    I+ +T  YA+KY TKS+V+ + +V++TCL+FT +SN+V EPACGA LH+G
Sbjct: 232 TIATSLGTANISNQTFEYAKKYNTKSIVVDDLKVVETCLKFTRDSNMVAEPACGAALHMG 291

Query: 301 YHPAILHKELG-PLSSEDIVILIACGGSATTL----ADLRELKLKYN 342
           Y+  IL K LG  L+++DIV++IACGGS+ T+    A L ELK K N
Sbjct: 292 YNMDILEKSLGKKLATDDIVLIIACGGSSNTVQELEASLTELKNKSN 338

>YCL064C Chr3 complement(15798..16880) [1083 bp, 360 aa] {ON}
           CHA1Catabolic L-serine (L-threonine) deaminase,
           catalyzes the degradation of both L-serine and
           L-threonine; required to use serine or threonine as the
           sole nitrogen source, transcriptionally induced by
           serine and threonine
          Length = 360

 Score =  313 bits (803), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 157/338 (46%), Positives = 220/338 (65%), Gaps = 12/338 (3%)

Query: 1   MSSLYVKTPLLRRAF-GKPNIQISKVPQFLVKYEFFQPSGSFKSRGIGNLIYNKVSEIRR 59
           MS +Y KTPLLR+ F GK +       QF +KYE  QPSGSFKSRGIGNLI      I++
Sbjct: 1   MSIVYNKTPLLRQFFPGKAS------AQFFLKYECLQPSGSFKSRGIGNLIMKSAIRIQK 54

Query: 60  DPAKQPHVFXXXXXXXXXXXXXXXQRMGIPCTVVVPTSTRQRIIEKIMATGATIICRGDY 119
           D  + P VF               QR+ +PCTVVVPT+T++R+++KI  TGA +I  G Y
Sbjct: 55  DGKRSPQVFASSGGNAGFAAATACQRLSLPCTVVVPTATKKRMVDKIRNTGAQVIVSGAY 114

Query: 120 FAEADSYLKDLMQEAANKNTRDKKNVPIYVHPFNHPLIWHGHSYIVEEILESLRNENIPY 179
           + EAD++LK  +    +    +    PIYVHPF++P IW GHS +++EI++ L++++I  
Sbjct: 115 WKEADTFLKTNVMNKIDSQVIE----PIYVHPFDNPDIWEGHSSMIDEIVQDLKSQHISV 170

Query: 180 SRVKGIVCSVXXXXXXXXXXXXXXRHSLANTIPIIGVETEGCEVLHKSLIAGKLITFKKA 239
           ++VKGIVCSV              R+ LA+ IPI+GVET GC V + SL  G+ + FKK 
Sbjct: 171 NKVKGIVCSVGGGGLYNGIIQGLERYGLADRIPIVGVETNGCHVFNTSLKIGQPVQFKKI 230

Query: 240 LSVATSLSVPTITKETLRYAQKYKTKSLVLGEGEVLDTCLRFTDESNIVTEPACGATLHL 299
            S+ATSL    I+ +T  YA+KY T+S+V+ + +V++TCL++T + N+V EPACGA LHL
Sbjct: 231 TSIATSLGTAVISNQTFEYARKYNTRSVVIEDKDVIETCLKYTHQFNMVIEPACGAALHL 290

Query: 300 GYHPAILHKELGP-LSSEDIVILIACGGSATTLADLRE 336
           GY+  IL   LG  L+++DIVI+IACGGS+ T+ DL E
Sbjct: 291 GYNTKILENALGSKLAADDIVIIIACGGSSNTIKDLEE 328

>KAFR0I00130 Chr9 complement(26703..27737) [1035 bp, 344 aa] {ON}
           Anc_1.3 YCL064C
          Length = 344

 Score =  307 bits (787), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 156/338 (46%), Positives = 219/338 (64%), Gaps = 6/338 (1%)

Query: 1   MSSLYVKTPLLRRAFGKPNIQISK-VPQFLVKYEFFQPSGSFKSRGIGNLIYNKVSEIRR 59
           M  +Y KTPL+ ++F    I+ S  +PQ L+KYE+ QPSGSFKSRGIGNL+Y K  +I++
Sbjct: 1   MPIVYNKTPLVPQSFPGTEIRSSDSLPQVLIKYEYLQPSGSFKSRGIGNLVYQKALQIQK 60

Query: 60  DPAKQPHVFXXXXXXXXXXXXXXXQRMGIPCTVVVPTSTRQRIIEKIMATGATIICRGDY 119
           +  K P VF               Q++ +PCTVVVP +T+QR+IEKI +TGA +   G +
Sbjct: 61  NSTKNPEVFSSSGGNAGYAAAVVAQKLSLPCTVVVPAATKQRMIEKIRSTGAKVTIHGTF 120

Query: 120 FAEADSYLKDLMQEAANKNTRDKKNVPIYVHPFNHPLIWHGHSYIVEEILESLRNENIPY 179
           +  AD Y+K+ +    N     +K  PIYVHP + PLIW G+S IV+E++ESL+ + I  
Sbjct: 121 WKGADKYMKNSVLNEINT----EKVEPIYVHPSDDPLIWEGNSMIVDELMESLQEQKIDP 176

Query: 180 SRVKGIVCSVXXXXXXXXXXXXXXRHSLANTIPIIGVETEGCEVLHKSLIAGKLITFKKA 239
           S+VK IVCSV              R+ LA+ IPI+GVET+G  V +  L +GK I F+K 
Sbjct: 177 SKVKAIVCSVGGGGLYNGLMQGLERYKLADKIPIVGVETDGSHVFNTCLKSGKHIEFEKI 236

Query: 240 LSVATSLSVPTITKETLRYAQKYKTKSLVLGEGEVLDTCLRFTDESNIVTEPACGATLHL 299
            +VATSL   +ITK+T  YA KY+ + +++ + EVL+TCLR+T + N++TEPACGA +HL
Sbjct: 237 STVATSLGSASITKKTFEYAMKYRPRGVIVKDIEVLETCLRYTQDYNMITEPACGAAIHL 296

Query: 300 GYHPAILHKELGP-LSSEDIVILIACGGSATTLADLRE 336
            YH  IL K L   L  +D+VI+IACGGS+ +L D+ E
Sbjct: 297 AYHVDILEKALDTRLDGDDVVIIIACGGSSNSLHDMEE 334

>KAFR0F04430 Chr6 (868691..869722) [1032 bp, 343 aa] {ON} 
          Length = 343

 Score =  307 bits (786), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 160/347 (46%), Positives = 223/347 (64%), Gaps = 12/347 (3%)

Query: 1   MSSLYVKTPLLRRAFGKPNIQISKV-PQFLVKYEFFQPSGSFKSRGIGNLIYNKVSEIRR 59
           M ++Y KTPLLR  F + N   S   PQ   KYE FQP  SFKSRGIGNLI     ++  
Sbjct: 1   MPTVYNKTPLLRPYFLEANRGTSDSSPQVFFKYESFQPGCSFKSRGIGNLILKNAKKVEE 60

Query: 60  DPAKQPHVFXXXXXXXXXXXXXXXQRMGIPCTVVVPTSTRQRIIEKIMATGATIICRGDY 119
           +  K   VF               + + IPCTVVVP+ST+ R++EKI +TGA +I  G++
Sbjct: 61  EGIKTLEVFSSSGGNAGYAAAVACRELSIPCTVVVPSSTKVRMVEKIRSTGAQVIVSGNF 120

Query: 120 FAEADSYLKDLMQEAANKNTRDKKNV-PIYVHPFNHPLIWHGHSYIVEEILESLRNENIP 178
           + EAD YL++ +      N  D   V P+YVHPF+ PLIW GHS I++EI+ESL +EN+ 
Sbjct: 121 WKEADEYLRNSVI-----NKVDSSKVEPLYVHPFDDPLIWEGHSTIIDEIVESLNDENVH 175

Query: 179 YSRVKGIVCSVXXXXXXXXXXXXXXRHSLANTIPIIGVETEGCEVLHKSLIAGKLITFKK 238
            S+VKG+VCS+              RH+LA+ IP+I VETEGC V +  L  GK + F+K
Sbjct: 176 TSKVKGVVCSIGGGGLYNGIIEGLERHALADKIPVIAVETEGCHVFNTCLELGKHVEFEK 235

Query: 239 ALSVATSLSVPTITKETLRYAQKYKTKSLVLGEGEVLDTCLRFTDESNIVTEPACGATLH 298
             S+ATSL  P+I+ +T  YAQKY +K +VL + +VL+TCLR++++SN++ EPAC A++H
Sbjct: 236 ISSIATSLGSPSISTKTFEYAQKYHSKGVVLQDIDVLETCLRYSEDSNMIIEPACAASVH 295

Query: 299 LGYHPAILHKELG-PLSSEDIVILIACGGSATTLADLRE----LKLK 340
           L Y+  IL + L   LS +D++I+IACGGSATTL D+++    LK+K
Sbjct: 296 LAYNVDILEEALNKKLSKDDVIIIIACGGSATTLQDIKDSLAKLKIK 342

>KLTH0F00440g Chr6 complement(34215..35240) [1026 bp, 341 aa] {ON}
           similar to uniprot|P25379 Saccharomyces cerevisiae
           YCL064C CHA1 catabolism of hydroxy amino acids catabolic
           serine (threonine) dehydratase
          Length = 341

 Score =  305 bits (781), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 155/338 (45%), Positives = 210/338 (62%), Gaps = 5/338 (1%)

Query: 1   MSSLYVKTPLLRRAFGKPNIQISKVPQFLVKYEFFQPSGSFKSRGIGNLIYNKVSEIRRD 60
           M S +VKTPLL   F   + ++   PQF++K EF QPSGSFKSRGIG +I  +  +IR +
Sbjct: 1   MKSAFVKTPLLAHYFAASSNRLPNQPQFMLKCEFLQPSGSFKSRGIGYMITKQAIKIRSE 60

Query: 61  PAKQPHVFXXXXXXXXXXXXXXXQRMGIPCTVVVPTSTRQRIIEKIMATGATIICRGDYF 120
             K PHVF               + + IPC+VVVP ST  R+++KI   GA +   G  +
Sbjct: 61  GNKLPHVFASSGGNAGLAAATTSRALSIPCSVVVPESTSNRMVQKIWNLGAEVHVYGRNW 120

Query: 121 AEADSYLKDLMQEAANKNTRDKKNVPIYVHPFNHPLIWHGHSYIVEEILESLRNENIPYS 180
            EAD +LK+ +    N +    +   IY HPF+HPLIW GHS IV+EI++SL+ + I   
Sbjct: 121 KEADKFLKESIISGHNPS----RTQVIYAHPFDHPLIWEGHSSIVDEIIDSLKEQKIDLK 176

Query: 181 RVKGIVCSVXXXXXXXXXXXXXXRHSLANTIPIIGVETEGCEVLHKSLIAGKLITFKKAL 240
            +K IVCSV              RH L + IPIIGVE++GCEV + SL  GKL  F+   
Sbjct: 177 NIKAIVCSVGGGGLYNGIIEGLSRHKLVHKIPIIGVESKGCEVFNSSLKLGKLTEFEDIT 236

Query: 241 SVATSLSVPTITKETLRYAQKYKTKSLVLGEGEVLDTCLRFTDESNIVTEPACGATLHLG 300
           S+ATS+   +I+K+TL  A +Y TKS+VL + E++ TCLRF DE+NI+ EPACGA LHLG
Sbjct: 237 SIATSIGTNSISKKTLENALRYHTKSVVLTDQEIISTCLRFADETNIIPEPACGAALHLG 296

Query: 301 YHPAILHKELGP-LSSEDIVILIACGGSATTLADLREL 337
           Y+P IL++ L    + ED++I+I CGGSAT+  DL  L
Sbjct: 297 YYPDILYQALNSDFTPEDVIIMIGCGGSATSYNDLASL 334

>KNAG0C00180 Chr3 complement(27151..28230) [1080 bp, 359 aa] {ON}
           Anc_1.3 YCL064C
          Length = 359

 Score =  305 bits (782), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 157/351 (44%), Positives = 218/351 (62%), Gaps = 10/351 (2%)

Query: 1   MSSLYVKTPLLRRAFGKPNIQISKVPQFLVKYEFFQPSGSFKSRGIGNLIYNKVSEIRRD 60
           MS +Y KTPLLR+ F   N+     PQ  +KYE  QPSGSFKSRGIGNLI      I++ 
Sbjct: 1   MSLVYNKTPLLRQFFPGKNL-----PQLFLKYECLQPSGSFKSRGIGNLILKNAMRIQKI 55

Query: 61  PAKQPHVFXXXXXXXXXXXXXXXQRMGIPCTVVVPTSTRQRIIEKIMATGATIICRGDYF 120
             ++ HVF               QR+ +PCTVVVPT+T+ R++EKI  TGA +I  G ++
Sbjct: 56  GERRAHVFASSGGNAGFAAATACQRLSLPCTVVVPTATKTRMVEKIRNTGAKVIVNGAHW 115

Query: 121 AEADSYLKDLMQEAANKNTRDKKNVPIYVHPFNHPLIWHGHSYIVEEILESLRNENIPYS 180
            EAD +LK  +    +  T +    PIYVHPF++P IW GH+ +V+EI+E+L ++ I   
Sbjct: 116 KEADQHLKKTVMSQIDLKTTE----PIYVHPFDNPDIWEGHATLVDEIMETLNSQKIQTE 171

Query: 181 RVKGIVCSVXXXXXXXXXXXXXXRHSLANTIPIIGVETEGCEVLHKSLIAGKLITFKKAL 240
            VKGIVCSV              +H LA  IPI+GVET GC VL+ SL   K I F+K  
Sbjct: 172 NVKGIVCSVGGGGLYNGIMQGLEKHGLAEKIPIVGVETRGCHVLNTSLNLNKQIEFEKIT 231

Query: 241 SVATSLSVPTITKETLRYAQKYKTKSLVLGEGEVLDTCLRFTDESNIVTEPACGATLHLG 300
           S+ATSL   +I+K+T   A+KY T+S+V+ + +V++TCL++T + N+V EPACGA LHL 
Sbjct: 232 SIATSLGTASISKQTFELAKKYNTRSVVVDDSKVIETCLKYTRDFNMVAEPACGAALHLA 291

Query: 301 YHPAILHKELG-PLSSEDIVILIACGGSATTLADLRELKLKYNPVTLDDSP 350
           Y+  IL K LG  L+  D++++IACGGS+ TL DL +  +  N  ++   P
Sbjct: 292 YNVDILEKALGHSLTPNDVILVIACGGSSNTLKDLEDTLVTLNSKSIPSPP 342

>CAGL0B00286g Chr2 complement(12803..13885) [1083 bp, 360 aa] {ON}
           highly similar to uniprot|P25379 Saccharomyces
           cerevisiae YCL064c CHA1 L-serine/L-threonine deaminase
          Length = 360

 Score =  304 bits (778), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 158/357 (44%), Positives = 234/357 (65%), Gaps = 16/357 (4%)

Query: 3   SLYVKTPLLRRAFGKPNIQISKVPQFLVKYEFFQPSGSFKSRGIGNLIYNKVSEIRRDP- 61
           S+Y KTPL+R+ F  P+I     PQ  +K+E FQPSGSFKSRGIG+LI  +   I  +  
Sbjct: 2   SVYNKTPLIRQIF--PSI-----PQMYLKHECFQPSGSFKSRGIGHLISKQSQRILGNGL 54

Query: 62  AKQPHVFXXXXXXXXXXXXXXXQRMGIPCTVVVPTSTRQRIIEKIMATGATIICRGDYFA 121
            K+P VF               + + +PCTVV+PT+T+QR+ +KI ATGA +I  G+++ 
Sbjct: 55  GKKPMVFASSGGNAGLAAATAAKFLNLPCTVVIPTATKQRMADKIRATGANVIVSGNFWK 114

Query: 122 EADSYLKDLMQEAANKNTRDKKNV-PIYVHPFNHPLIWHGHSYIVEEILESLRNENIPYS 180
           EAD+YLKD      +K     KNV PIYVHPF++P IW GH+ +V+EI+E  +N+ IP +
Sbjct: 115 EADNYLKD---NILSKLEELHKNVEPIYVHPFDNPDIWEGHASMVDEIVEDFKNKMIPLN 171

Query: 181 RVKGIVCSVXXXXXXXXXXXXXXRHSLANTIPIIGVETEGCEVLHKSLIAGKLITFKKAL 240
           ++K IVCSV              +++LA+ IPI+GVET+GC V + SL   K+++FKK  
Sbjct: 172 KIKAIVCSVGGGGLYNGIIQGLEKYNLADKIPIVGVETKGCHVFNTSLRMNKVVSFKKIT 231

Query: 241 SVATSLSVPTITKETLRYAQKYKTKSLVLGEGEVLDTCLRFTDESNIVTEPACGATLHLG 300
           S+ATSL    I+ E  +YA++Y TKS+VL + +V+ TCLR+T + N+V EPACGA +HL 
Sbjct: 232 SIATSLGTADISTEAFKYAKRYGTKSVVLSDQDVVKTCLRYTHDFNMVIEPACGAAVHLA 291

Query: 301 YHPAILHKELG-PLSSEDIVILIACGGSATTLADLRELKLKYNPVTLDDSPVEIPGL 356
           YH  IL KELG  L+++DIV+++ACGGS+ T+ D+  +  +   ++ +++ + IP +
Sbjct: 292 YHTEILEKELGTKLNADDIVLVVACGGSSNTVEDMESILQR---LSTEENNINIPNV 345

>NDAI0K02950 Chr11 (671102..672106) [1005 bp, 334 aa] {ON} 
          Length = 334

 Score =  302 bits (773), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 150/341 (43%), Positives = 214/341 (62%), Gaps = 10/341 (2%)

Query: 1   MSSLYVKTPLLRRAFGKPNIQISKVPQFLVKYEFFQPSGSFKSRGIGNLIYNKVSEIRRD 60
           MS +Y KTPLLR+ F    I     P+  +KYE  QPSGSFKSRGIG LI   ++++++D
Sbjct: 1   MSFIYNKTPLLRQTFDSAKIG----PRIFLKYENLQPSGSFKSRGIGCLILQHINKLKQD 56

Query: 61  PAKQPHVFXXXXXXXXXXXXXXXQRMGIPCTVVVPTSTRQRIIEKIMATGATIICRGDYF 120
             K  HVF               + + +PCTVVVP ST++R++ KI  TGA+++ +GD++
Sbjct: 57  GNKTAHVFSSSGGNAGLAAATASRSLQVPCTVVVPKSTKERMVNKIRKTGASVLIKGDHW 116

Query: 121 AEADSYLKDLMQEAANKNTRDKKNVPIYVHPFNHPLIWHGHSYIVEEILESLRNENIPYS 180
            EAD +L+  M+E  N   +     PIYVHPF+ P+IW GHS I++EI+++L+ E I   
Sbjct: 117 KEADDFLRKSMKEMDNTQEQ-----PIYVHPFDDPVIWEGHSTIIDEIVQTLQTEKISIE 171

Query: 181 RVKGIVCSVXXXXXXXXXXXXXXRHSLANTIPIIGVETEGCEVLHKSLIAGKLITFKKAL 240
           +VKGI+CSV              RH+LA +IP+I VET+GC+VL+KSL  G  +   K  
Sbjct: 172 KVKGIICSVGGGGLFNGIIKGLERHNLAQSIPVIAVETKGCDVLNKSLKNGTPVQLPKIT 231

Query: 241 SVATSLSVPTITKETLRYAQKYKTKSLVLGEGEVLDTCLRFTDESNIVTEPACGATLHLG 300
           SVATSL    I+      A KY ++S+ L + +VL+TCL++ D+ ++  EPACGA++HL 
Sbjct: 232 SVATSLGSTYISSTAFENAMKYNSRSITLNDKDVLETCLKYNDDFSMTLEPACGASVHLA 291

Query: 301 YHPAILHKELG-PLSSEDIVILIACGGSATTLADLRELKLK 340
           Y+P I+   LG  LS+ DIVI++ CGGS+ TL DL  L  K
Sbjct: 292 YNPGIVESALGTALSNHDIVIVVLCGGSSCTLHDLESLNSK 332

>Kpol_2002.6 s2002 complement(7840..8892) [1053 bp, 350 aa] {ON}
           complement(7840..8892) [1053 nt, 351 aa]
          Length = 350

 Score =  298 bits (762), Expect = 1e-98,   Method: Compositional matrix adjust.
 Identities = 155/358 (43%), Positives = 224/358 (62%), Gaps = 11/358 (3%)

Query: 1   MSSLYVKTPLLRRAFGKPNIQISKVPQFLVKYEFFQPSGSFKSRGIGNLIYNKVSEIRRD 60
           MS +Y KTPLL+  F   N+     PQF +KYE  QPSGSFKSRGIGNLI      I++ 
Sbjct: 1   MSLVYNKTPLLKHFFPGKNL-----PQFYLKYESLQPSGSFKSRGIGNLILKNAIRIKKI 55

Query: 61  PAKQPHVFXXXXXXXXXXXXXXXQRMGIPCTVVVPTSTRQRIIEKIMATGATIICRGDYF 120
             K+P+VF               QR+ +PCTVVVPT+T++R+++KI ATGA +I +G+++
Sbjct: 56  NVKKPYVFSSSGGNAGLAAATASQRLSLPCTVVVPTATKERMVQKIRATGANVIIKGNHW 115

Query: 121 AEADSYLKDLMQEAANKNTRDKKNVPIYVHPFNHPLIWHGHSYIVEEILESLRNENIPYS 180
            EAD++LK  +    NK+  +    PIYVHPF++PLIW GHS +V+EI+E+   +     
Sbjct: 116 KEADNFLKQNIMNEINKDKIE----PIYVHPFDNPLIWEGHSTMVDEIMETFSQQKFNIK 171

Query: 181 RVKGIVCSVXXXXXXXXXXXXXXRHSLANTIPIIGVETEGCEVLHKSLIAGKLITFKKAL 240
            +K IVCSV              +++LA+ IP++GVET+GC V + SL   K + F K  
Sbjct: 172 NLKAIVCSVGGGGLYNGIIQGLEKYNLADKIPVVGVETQGCHVFNTSLKLNKPVEFTKIS 231

Query: 241 SVATSLSVPTITKETLRYAQKYKTKSLVLGEGEVLDTCLRFTDESNIVTEPACGATLHLG 300
           ++ATSL    I+ +   YA+KY TKS+V+ + +V++TCL+FT + N+V EPACGA +HLG
Sbjct: 232 TIATSLGTANISNQMFDYAKKYNTKSVVVEDKDVVETCLKFTHDHNMVIEPACGAAIHLG 291

Query: 301 YHPAILHKELG-PLSSEDIVILIACGGSATTLADLRELKLKYNPVTLDDSPVEIPGLI 357
           YH  +L   LG  L+ +D V+++ACGGS+ T+ +L    L+ N  +   SP  IP  I
Sbjct: 292 YHTDLLETALGTKLTCDDAVLIVACGGSSNTVKELETALLELNLKSQKASPT-IPSFI 348

>TBLA0A04920 Chr1 complement(1214344..1215426) [1083 bp, 360 aa]
           {ON} Anc_1.3 YCL064C
          Length = 360

 Score =  297 bits (760), Expect = 3e-98,   Method: Compositional matrix adjust.
 Identities = 157/344 (45%), Positives = 216/344 (62%), Gaps = 13/344 (3%)

Query: 1   MSSLYVKTPLLRRAF-GKPNIQISKVPQFLVKYEFFQPSGSFKSRGIGNLIYNKVSEIRR 59
           MS +Y KTPLLR+ F G P      +PQF +KYE  QPSGSFKSRGIGNLI   + +I  
Sbjct: 1   MSIVYNKTPLLRQFFRGSP------IPQFFLKYECMQPSGSFKSRGIGNLILKSIDKINS 54

Query: 60  -DPAKQPHVFXXXXXXXXXXXXXXXQRMGIPCTVVVPTSTRQRIIEKIMATGATIICRGD 118
            +  K+P VF               +R+ IPCTVVVPT+T++R++ KI  TGA +I  G 
Sbjct: 55  SNLNKRPQVFSSSGGNAGLAAATASRRLSIPCTVVVPTATKERMVNKIKDTGAKVIVNGG 114

Query: 119 YFAEADSYLKDLMQEAANKNTRDKKNVPIYVHPFNHPLIWHGHSYIVEEILESLRNENIP 178
           +++EAD YL++ +    + N  +    PIYVHPF++PLIW GHS +++EI+ESL  +NI 
Sbjct: 115 HWSEADDYLQNHVINKIDLNEIE----PIYVHPFDNPLIWEGHSTMIDEIIESLNEQNID 170

Query: 179 YSRVKGIVCSVXXXXXXXXXXXXXXRHSLANTIPIIGVETEGCEVLHKSLIAGKLITFKK 238
              VK I CS+              +++LA+ IPIIGVET GC+V + SL   KL+ F K
Sbjct: 171 IRNVKAITCSIGGGGLYNGLIRGLEKYNLASKIPIIGVETNGCQVFNTSLKLKKLVKFPK 230

Query: 239 ALSVATSLSVPTITKETLRYAQKYKTKSLVLGEGEVLDTCLRFTDESNIVTEPACGATLH 298
             ++ATSL   TI+ +T   A KY TKS+V+   +V+ TCLR+T + N V EPACGA LH
Sbjct: 231 INTIATSLGTSTISAKTFENALKYNTKSVVVDNIDVIKTCLRYTYDFNQVAEPACGAALH 290

Query: 299 LGYHPAILHKELG-PLSSEDIVILIACGGSATTLADLRELKLKY 341
           L Y+  ++   L   L+ +DI+I+IACGGS+ T+ +L E  LKY
Sbjct: 291 LAYNTGLIENALDTTLTKDDIIIVIACGGSSNTVQELEEALLKY 334

>NCAS0A15330 Chr1 (3015596..3016639) [1044 bp, 347 aa] {ON} 
          Length = 347

 Score =  288 bits (738), Expect = 4e-95,   Method: Compositional matrix adjust.
 Identities = 142/337 (42%), Positives = 210/337 (62%), Gaps = 7/337 (2%)

Query: 1   MSSLYVKTPLLRRAFGKPNIQISKVPQFLVKYEFFQPSGSFKSRGIGNLIYNKVSEIRRD 60
           MS +Y KTPLLRR F    +++   PQ  VKYE  QPSGSFKSRGIG+LI      +++ 
Sbjct: 1   MSLVYNKTPLLRRVF-PTGLKVPSAPQLYVKYESLQPSGSFKSRGIGHLIMKNALRVQQL 59

Query: 61  PAKQPHVFXXXXXXXXXXXXXXXQRMGIPCTVVVPTSTRQRIIEKIMATGATIICRGDYF 120
             K  HVF               Q + +PCTVVVPTST+ R++EKI   G  +I +G ++
Sbjct: 60  GGKSLHVFSSSGGNAGLAAATASQSLKLPCTVVVPTSTKSRMVEKIRNVGTEVIVKGSHW 119

Query: 121 AEADSYLKDLMQEAANKNTRDKKNVPIYVHPFNHPLIWHGHSYIVEEILESLRNENIPYS 180
            EADS+LK+ +  +      D+   PIYVHPF+HP +W GHS +V+EI+++ R++N+  +
Sbjct: 120 KEADSFLKNSVIPSV-----DRIEEPIYVHPFDHPDVWEGHSTMVDEIVDTFRSQNVSLN 174

Query: 181 RVKGIVCSVXXXXXXXXXXXXXXRHSLANTIPIIGVETEGCEVLHKSLIAGKLITFKKAL 240
           +VK IVCSV              ++ LA+ IP+I +ET+GC   +  L A K +   K  
Sbjct: 175 KVKAIVCSVGGGGLYNGIIHGLEKYHLADKIPVIAMETDGCNSFNACLKAKKQVELPKIT 234

Query: 241 SVATSLSVPTITKETLRYAQKYKTKSLVLGEGEVLDTCLRFTDESNIVTEPACGATLHLG 300
           SVATSL    +  +     Q+Y++ S+VL + +V++TCL++ ++ NI+TEPACGA+LH+ 
Sbjct: 235 SVATSLGATGVATKAFENGQRYQSPSVVLQDIDVVNTCLKYANDFNIITEPACGASLHMA 294

Query: 301 YHPAILHKELG-PLSSEDIVILIACGGSATTLADLRE 336
           Y+  ++ K LG  L S+DI+++IACGGSA T+ DL+ 
Sbjct: 295 YNTKLIEKALGKKLDSDDIIVIIACGGSANTMEDLQN 331

>KLLA0C00440g Chr3 complement(32008..33141) [1134 bp, 377 aa] {ON}
           similar to uniprot|P25379 Saccharomyces cerevisiae
           YCL064C CHA1 catabolism of hydroxy amino acids catabolic
           serine (threonine) dehydratase
          Length = 377

 Score =  286 bits (732), Expect = 8e-94,   Method: Compositional matrix adjust.
 Identities = 151/338 (44%), Positives = 212/338 (62%), Gaps = 11/338 (3%)

Query: 2   SSLYVKTPLLRRAFGKPNIQISKVPQFLVKYEFFQPSGSFKSRGIGNLIYNKVSEIRRD- 60
           + L+ KTPLL+  F +     SK PQ L+KYEF QPSGSFKSRGIG+LI  KV EI++  
Sbjct: 22  AQLFSKTPLLKHQFKR-----SKGPQVLLKYEFLQPSGSFKSRGIGHLISTKVEEIKKSS 76

Query: 61  PAKQPHVFXXXXXXXXXXXXXXXQRMGIPCTVVVPTSTRQRIIEKIMATGATIICRGDYF 120
           P K  HVF                 + +PCTVVV  +TR RIIEKI + GA ++  G+++
Sbjct: 77  PEKIGHVFASSGGNAGLAAAVASLELNVPCTVVVSNATRPRIIEKIRSYGADVVVHGNHW 136

Query: 121 AEADSYLKDLMQEAANKNTRDKKNVPIYVHPFNHPLIWHGHSYIVEEILESLRNENIPYS 180
            EADS++K+ +     K     K  PIY HPF++PLIW GHS++V+EI++ L +  IP +
Sbjct: 137 KEADSFMKEHLM----KKLDSFKYEPIYSHPFDNPLIWEGHSFMVDEIMDVLASSKIPIT 192

Query: 181 RVKGIVCSVXXXXXXXXXXXXXXRHSLANTIPIIGVETEGCEVLHKSLIAGKLITFKKAL 240
           ++KGIVCS               R++LA+ IPI+ VET+G +VL  SL  G  + F+K  
Sbjct: 193 KIKGIVCSFGGGGLYNGLILGLQRYNLADKIPIVCVETKGTDVLSASLRVGAPVEFEKIS 252

Query: 241 SVATSLSVPTITKETLRYAQKYKTKSLVLGEGEVLDTCLRFTDESNIVTEPACGATLHLG 300
           S ATSL   TI+    +  +++ +KS V+ + EV+ TCL+F++++NIV EP CGATL+ G
Sbjct: 253 SCATSLGTATISTTAYQNVKRHGSKSAVISDTEVISTCLQFSNDTNIVAEPGCGATLYFG 312

Query: 301 YHPAILHKELGP-LSSEDIVILIACGGSATTLADLREL 337
           Y+   L   LG  +  +D VILI CGGS+T+L DL+EL
Sbjct: 313 YNIDKLQNILGSDIKDDDYVILIGCGGSSTSLEDLKEL 350

>ZYRO0F18524g Chr6 (1528741..1529748) [1008 bp, 335 aa] {ON} similar
           to uniprot|P25379 Saccharomyces cerevisiae YCL064C CHA1
           catabolism of hydroxy amino acids catabolic serine
           (threonine) dehydratase
          Length = 335

 Score =  285 bits (728), Expect = 8e-94,   Method: Compositional matrix adjust.
 Identities = 146/334 (43%), Positives = 200/334 (59%), Gaps = 9/334 (2%)

Query: 1   MSSLYVKTPLLRRAFGKPNIQISKVPQFLVKYEFFQPSGSFKSRGIGNLIYNKVSEIRRD 60
           M++ Y KTPLLR+         +++PQ  +KYE  QP GSFKSRGIGNLI  K      +
Sbjct: 1   MNNWYYKTPLLRQILNWKTT--TELPQIFIKYENLQPGGSFKSRGIGNLISLK----SEN 54

Query: 61  PAKQPHVFXXXXXXXXXXXXXXXQRMGIPCTVVVPTSTRQRIIEKIMATGATIICRGDYF 120
              + HV                ++M +PCTVVVPTST+QR+++KI  +GA +I RG ++
Sbjct: 55  GLVKSHVLSSSGGNAGLAAAIASKQMELPCTVVVPTSTKQRMVQKIKNSGAEVIIRGSHW 114

Query: 121 AEADSYLKDLMQEAANKNTRDKKNVPIYVHPFNHPLIWHGHSYIVEEILESLRNENIPYS 180
            EAD+YL+   Q        D  + P+YVHPF+ P +W GHS +V EI+++LR +NI   
Sbjct: 115 KEADNYLQ---QNYIQSFRNDGTSKPLYVHPFDDPKVWEGHSTMVHEIIDNLREQNISVE 171

Query: 181 RVKGIVCSVXXXXXXXXXXXXXXRHSLANTIPIIGVETEGCEVLHKSLIAGKLITFKKAL 240
            V+GIVCSV               H LA+ IP+I VET GC VL+ SL AG+ +   K  
Sbjct: 172 NVRGIVCSVGGGGLFNGIIKGLEDHGLADKIPVIAVETYGCNVLNASLNAGRPVMLDKIT 231

Query: 241 SVATSLSVPTITKETLRYAQKYKTKSLVLGEGEVLDTCLRFTDESNIVTEPACGATLHLG 300
           S+ATSL    I +     A +Y  KSLVL + +V++TCLR+  +   + EPACGA+LH+G
Sbjct: 232 SLATSLGSTYIPQGVFENAVRYGAKSLVLEDKDVIETCLRYVSDFGQIVEPACGASLHIG 291

Query: 301 YHPAILHKELGPLSSEDIVILIACGGSATTLADL 334
           YHP +L   LG  S +DI+++IACGGS TT  DL
Sbjct: 292 YHPELLENFLGGFSKDDIIVIIACGGSTTTFKDL 325

>SAKL0C13904g Chr3 (1223973..1224992) [1020 bp, 339 aa] {ON} similar
           to uniprot|P25379 Saccharomyces cerevisiae YCL064C CHA1
           catabolism of hydroxy amino acids catabolic serine
           (threonine) dehydratase
          Length = 339

 Score =  282 bits (722), Expect = 7e-93,   Method: Compositional matrix adjust.
 Identities = 142/337 (42%), Positives = 208/337 (61%), Gaps = 9/337 (2%)

Query: 3   SLYVKTPLLRRAFGKPNIQISKVPQFLVKYEFFQPSGSFKSRGIGNLIYNKVSEIRRDPA 62
           S Y KTPLL R     +      P+F +KYEF QP GSFKSRGIG L+     + RRD  
Sbjct: 6   SFYNKTPLLPRVLTTTD----GAPRFFLKYEFLQPGGSFKSRGIGYLVKKSYEKARRDGG 61

Query: 63  KQPHVFXXXXXXXXXXXXXXXQRMGIPCTVVVPTSTRQRIIEKIMATGATIICRGDYFAE 122
           K   VF               Q   I CTVVVP +T+ R++EKI  TGA ++  G ++  
Sbjct: 62  KSLAVFSSSGGNAGLAAAIAAQTFSINCTVVVPRTTKSRMVEKIRKTGAEVLVYGKHWGM 121

Query: 123 ADSYLKDLMQEAANKNTRDKKNVPIYVHPFNHPLIWHGHSYIVEEILESLRNENIPYSRV 182
           AD YL++++ +  + +    K VP+YVHPF++P+IW GHS IV+E++  L+ EN+   +V
Sbjct: 122 ADEYLREVVMKEVDVS----KVVPLYVHPFDNPIIWQGHSTIVDEVVAQLKEENVSIDKV 177

Query: 183 KGIVCSVXXXXXXXXXXXXXXRHSLANTIPIIGVETEGCEVLHKSLIAGKLITFKKALSV 242
           K IVCSV               H LA+ IPI+ +ET+GC+VL+KSL +G  +  +   SV
Sbjct: 178 KAIVCSVGGGGLYNGIVKGLETHQLADRIPILAIETKGCDVLNKSLNSGNPVVLESLTSV 237

Query: 243 ATSLSVPTITKETLRYAQKYKTKSLVLGEGEVLDTCLRFTDESNIVTEPACGATLHLGYH 302
           A+SL+ P I+++    A+KY++KS++L + +V++TCL F D++ IV EPACGA+L+  YH
Sbjct: 238 ASSLASPYISEKAFENARKYESKSILLKDSQVIETCLNFADDAGIVVEPACGASLYSCYH 297

Query: 303 PAILHKELGP-LSSEDIVILIACGGSATTLADLRELK 338
           P +L   +G  L+ +D++++IACGGSA T  DL  +K
Sbjct: 298 PELLPLYIGKELTEDDVIVVIACGGSAVTYKDLEYMK 334

>KNAG0D05380 Chr4 complement(986308..987312) [1005 bp, 334 aa] {ON} 
          Length = 334

 Score =  272 bits (696), Expect = 6e-89,   Method: Compositional matrix adjust.
 Identities = 147/343 (42%), Positives = 198/343 (57%), Gaps = 12/343 (3%)

Query: 1   MSSLYVKTPLLRRAFGKPNIQISKVPQFLVKYEFFQPSGSFKSRGIGNLIYNKVSEIRRD 60
           M +LY KTPLL +     N+     P FL KYE  QP GSFK RG+ +LI  +V +I+ +
Sbjct: 1   MPALYNKTPLLPK-----NLSGGDGPTFLFKYENMQPGGSFKIRGVSHLIEKRVEQIKSE 55

Query: 61  PAKQPHVFXXXXXXXXXXXXXXXQRMGIPCTVVVPTSTRQRIIEKIMATGATIICRGDYF 120
             K PHVF                 + IPCTVVVPT T+ R++EKI    A +I +G  +
Sbjct: 56  GKKPPHVFSSSGGNAGLAAATACHILSIPCTVVVPTLTKPRMVEKIRKANAEVIVKGSNW 115

Query: 121 AEADSYLKDLMQEAANKNTRDKKNVPIYVHPFNHPLIWHGHSYIVEEILESLRNENIPYS 180
            EAD YL+  +  + N         PIYV+PF+ PL+W GHS +++EIL +L  ENI   
Sbjct: 116 KEADDYLRGTVIASNNAVQ------PIYVNPFDDPLLWEGHSTMIDEILNALNQENIKLD 169

Query: 181 RVKGIVCSVXXXXXXXXXXXXXXRHSLANTIPIIGVETEGCEVLHKSLIAGKLITFKKAL 240
            VKGIVCSV               H LA TIP++ VET+GC+VL  SL A K +   K  
Sbjct: 170 AVKGIVCSVGGGGLFNGIVHGLENHQLACTIPVVAVETKGCDVLGLSLAAEKPVRLNKID 229

Query: 241 SVATSLSVPTITKETLRYAQKYKTKSLVLGEGEVLDTCLRFTDESNIVTEPACGATLHLG 300
           S+ATSL    ++ +    A K+K++S+VL + +VL+TC R+ D+ N + EPACGAT+H  
Sbjct: 230 SIATSLGSSYVSCQAFDNAVKFKSRSVVLHDSDVLNTCYRYLDDFNAIVEPACGATIHTA 289

Query: 301 YHPAILHKELG-PLSSEDIVILIACGGSATTLADLRELKLKYN 342
           YH  IL K LG  L+  DI+I+I CGGS  T+ DL   K K +
Sbjct: 290 YHYKILEKALGQKLTPSDIIIIIVCGGSCVTIQDLENAKRKLD 332

>Smik_9.2 Chr9 (6779..7795) [1017 bp, 338 aa] {ON} YCL064C (REAL)
          Length = 338

 Score =  271 bits (694), Expect = 1e-88,   Method: Compositional matrix adjust.
 Identities = 148/336 (44%), Positives = 200/336 (59%), Gaps = 15/336 (4%)

Query: 3   SLYVKTPLLRRAF--GKPNIQISKVPQFLVKYEFFQPSGSFKSRGIGNLIYNKVSEIRRD 60
           S Y KTPL+R+ F  GK N      P F +K++  QP GSFKSRGIG+LI  K  E   +
Sbjct: 4   SHYEKTPLIRQVFDNGKTN------PLFYIKHDMLQPGGSFKSRGIGHLIRKKNKEALAE 57

Query: 61  PAKQPHVFXXXXXXXXXXXXXXXQRMGIPCTVVVPTSTRQRIIEKIMATGATIICRGDYF 120
            + +  VF               + M + CTVVVP +T+ R+++KI + GA +I  GD++
Sbjct: 58  GSGKLVVFSSSGGNAGLAAATSCRLMALNCTVVVPKTTKSRMVKKIQSAGAKVIIHGDHW 117

Query: 121 AEADSYLK-DLMQEAANKNTRDKKNVPIYVHPFNHPLIWHGHSYIVEEILESLRNENIPY 179
            EAD YLK ++M +     ++      +YVHPF+  +IW GHS IV+EIL+ L+ ++I  
Sbjct: 118 GEADEYLKQEVMAQEGQHGSK-----TLYVHPFDDEIIWEGHSTIVDEILQQLQEKDISP 172

Query: 180 SRVKGIVCSVXXXXXXXXXXXXXXRHSLANTIPIIGVETEGCEVLHKSLIAGKLITFKKA 239
            +VKG+VCSV              R+ LA  IPI+ VET GC+VL+KSL  G  +  ++ 
Sbjct: 173 LQVKGLVCSVGGGGLFSGIIKGLERNRLAGKIPIVAVETAGCDVLNKSLKNGSPVALERL 232

Query: 240 LSVATSLSVPTITKETLRYAQKYKTKSLVLGEGEVLDTCLRFTDESNIVTEPACGATLHL 299
            SVATSL  P I          Y  KS+VL + +VLDTCLR+ D+ N + EPACGA+LHL
Sbjct: 233 TSVATSLGSPYIAPFAFESFITYGCKSVVLSDQDVLDTCLRYADDYNFIVEPACGASLHL 292

Query: 300 GYHPAILHKELG-PLSSEDIVILIACGGSATTLADL 334
            YHP IL K LG  LS +D+VI+IACGGS  T  DL
Sbjct: 293 CYHPEILEKALGQKLSEDDVVIIIACGGSCMTYEDL 328

>TDEL0D06540 Chr4 (1175562..1176575) [1014 bp, 337 aa] {ON} 
          Length = 337

 Score =  270 bits (689), Expect = 6e-88,   Method: Compositional matrix adjust.
 Identities = 143/338 (42%), Positives = 199/338 (58%), Gaps = 9/338 (2%)

Query: 7   KTPLLRRAFGKPNIQISKVPQFLVKYEFFQPSGSFKSRGIGNLIYNKVSEIRRDPAKQPH 66
           K+PLL R F +        PQF +KYE  QPSGSFKSRGIG LI +K  E R       H
Sbjct: 6   KSPLLNRRFKESE---KDGPQFFLKYETLQPSGSFKSRGIGYLINSKAKEARSRDGSDVH 62

Query: 67  VFXXXXXXXXXXXXXXXQRMGIPCTVVVPTSTRQRIIEKIMATGATIICRGDYFAEADSY 126
           VF               + + + CTVVVP +T++ +I++I   G+ +I  G ++  AD+Y
Sbjct: 63  VFSSSGGNAGLAAANASKLLNLNCTVVVPVTTKRHMIDRIQNAGSQVIVHGTHWGMADTY 122

Query: 127 LKDLMQEAANKNTRDKKNVPIYVHPFNHPLIWHGHSYIVEEILESLRNENIPYSRVKGIV 186
           LK+++ +    N       P+YVHPF+ PL+W GHS++++EI+E L+ +      VKGI+
Sbjct: 123 LKEVVMKKVPSNVE-----PLYVHPFDDPLVWEGHSFMIDEIVEQLQEQGRSMRDVKGII 177

Query: 187 CSVXXXXXXXXXXXXXXRHSLANTIPIIGVETEGCEVLHKSLIAGKLITFKKALSVATSL 246
           CSV              RH  A  IPII VET G + L KSL AGK +   +  S+A+SL
Sbjct: 178 CSVGGGGLYNGIVGGLERHGYAGKIPIIAVETVGADALAKSLAAGKPVRLTEVTSIASSL 237

Query: 247 SVPTITKETLRYAQKYKTKSLVLGEGEVLDTCLRFTDESNIVTEPACGATLHLGYHPAIL 306
             P I +++   A +YKT+S V  + E + T LRF  E+NI+ EPAC A++ L YH   L
Sbjct: 238 GSPYIAQDSFEKAIRYKTRSFVQTDEEAVRTSLRFFQETNILVEPACAASVSLCYHVDEL 297

Query: 307 HKELG-PLSSEDIVILIACGGSATTLADLRELKLKYNP 343
           +K L   LSS+DIVI+I CGGSATT++DL  L+ +YNP
Sbjct: 298 NKLLSCKLSSKDIVIVIVCGGSATTISDLEMLQRRYNP 335

>KLLA0E01805g Chr5 complement(173125..174093) [969 bp, 322 aa] {ON}
           similar to uniprot|P25379 Saccharomyces cerevisiae
           YCL064C CHA1 catabolism of hydroxy amino acids catabolic
           serine (threonine) dehydratase
          Length = 322

 Score =  269 bits (687), Expect = 9e-88,   Method: Compositional matrix adjust.
 Identities = 143/338 (42%), Positives = 207/338 (61%), Gaps = 18/338 (5%)

Query: 1   MSSLYVKTPLLRRAFGKPNIQISKVPQFLVKYEFFQPSGSFKSRGIGNLIYNKVSEIRRD 60
           M  L +KTPLL   F +P   ++  P FL+KYE  QP GSFKSRGI +LI   +  I  D
Sbjct: 1   MDQLTIKTPLL--PFREP---LNGGPTFLLKYENLQPGGSFKSRGISHLIKTTMDSIS-D 54

Query: 61  PAKQPHVFXXXXXXXXXXXXXXXQRMGIPCTVVVPTSTRQRIIEKIMATGATIICRGDYF 120
           P  +  V+                 + +PCTV+VP ST+ R+I+KI + GA ++  GD++
Sbjct: 55  PENELAVYSSSGGNAGLAAARACATLKVPCTVIVPKSTKPRMIKKIESAGAKVVIFGDHW 114

Query: 121 AEADSYLKD-LMQEAANKNTRDKKNVPIYVHPFNHPLIWHGHSYIVEEILESLRNENIPY 179
            EAD+YL++ +M++++  NT       +YVHPF++P+IW GHS +++EI+E L   +   
Sbjct: 115 KEADTYLREYVMRQSSYSNT-------LYVHPFDNPIIWDGHSTMIDEIIEQLAESHTDI 167

Query: 180 SRVKGIVCSVXXXXXXXXXXXXXXRHSLANTIPIIGVETEGCEVLHKSLIAGKLITFKKA 239
           + VKGIVCSV              RH LA +IP+  +ET+GC+VL KSLIAG+ +   + 
Sbjct: 168 NDVKGIVCSVGGGGLYNGVVNGLERHGLAGSIPVFAMETDGCDVLSKSLIAGEPVVLDRI 227

Query: 240 LSVATSLSVPTITKETLRYAQKYKTKSLVLGEGEVLDTCLRFTDESNIVTEPACGATLHL 299
            S+ATSL    I  ++ + A K+ +KS+VL +  V+DTCLRF DE++I+ EPACGA+LH 
Sbjct: 228 SSIATSLGSTEICADSFQKAIKFSSKSIVLDDKNVVDTCLRFFDETSILVEPACGASLHT 287

Query: 300 GYHPAILHKELGPLSSEDIVILIACGGSATTLADLREL 337
            Y P +    LGPL  +DIV++I CGGS  T  DL+  
Sbjct: 288 CYRPEL----LGPLGPDDIVVVILCGGSCNTYDDLKSF 321

>Scer_YGOB_SDL1 Chr9 (29032..29411,29415..30048) [1014 bp, 337 aa]
           {ON} ANNOTATED BY YGOB - Skipping over stop codon in
           S288c
          Length = 337

 Score =  261 bits (668), Expect = 9e-85,   Method: Compositional matrix adjust.
 Identities = 142/333 (42%), Positives = 192/333 (57%), Gaps = 14/333 (4%)

Query: 5   YVKTPLLRRAF--GKPNIQISKVPQFLVKYEFFQPSGSFKSRGIGNLIYNKVSEIRRDPA 62
           Y KTPL+R+    GK N        F VK+E  QP GSFKSRGIG+LI     E   + +
Sbjct: 6   YEKTPLIRQFLNNGKTN------SWFYVKHEMLQPGGSFKSRGIGHLIRKSNEEALSEGS 59

Query: 63  KQPHVFXXXXXXXXXXXXXXXQRMGIPCTVVVPTSTRQRIIEKIMATGATIICRGDYFAE 122
            +  VF               + M + C+VVVP +T+ R+++KI + GA +I  GD++ E
Sbjct: 60  GKLAVFSSSGGNAGLAAATACRSMALNCSVVVPKTTKPRMVKKIQSAGAKVIIHGDHWGE 119

Query: 123 ADSYLKDLMQEAANKNTRDKKNVPIYVHPFNHPLIWHGHSYIVEEILESLRNENIPYSRV 182
           AD YL+  M + +   ++      +YVHPF++  IW GHS IV+EI+E L+  +I   RV
Sbjct: 120 ADEYLRHEMAQESQHGSK-----TLYVHPFDNETIWEGHSTIVDEIIEQLKENDISLPRV 174

Query: 183 KGIVCSVXXXXXXXXXXXXXXRHSLANTIPIIGVETEGCEVLHKSLIAGKLITFKKALSV 242
           K +VCSV              R+ LA  IP++ VET GC+VL+KSL  G  +T +K  SV
Sbjct: 175 KALVCSVGGGGLFSGIIKGLDRNQLAEKIPVVAVETAGCDVLNKSLKKGSPVTLEKLTSV 234

Query: 243 ATSLSVPTITKETLRYAQKYKTKSLVLGEGEVLDTCLRFTDESNIVTEPACGATLHLGYH 302
           ATSL+ P I         KY  KS+VL + +VL TCLR+ D+ N + EPACGA+LHL YH
Sbjct: 235 ATSLASPYIASFAFESFNKYGCKSVVLSDQDVLATCLRYADDYNFIVEPACGASLHLCYH 294

Query: 303 PAILHKEL-GPLSSEDIVILIACGGSATTLADL 334
           P IL   L   +  +DIVI+IACGGS  T  DL
Sbjct: 295 PEILEDILEQKIYEDDIVIIIACGGSCMTYEDL 327

>Skud_9.2 Chr9 (5919..6938) [1020 bp, 339 aa] {ON} YCL064C (REAL)
          Length = 339

 Score =  255 bits (652), Expect = 2e-82,   Method: Compositional matrix adjust.
 Identities = 141/342 (41%), Positives = 193/342 (56%), Gaps = 11/342 (3%)

Query: 5   YVKTPLLRRAFGKPNIQISKVPQFLVKYEFFQPSGSFKSRGIGNLIYNKVSEIRRDPAKQ 64
           Y +TPL+ + F          P+  VK+E  QP GSFKSRGIG+LI     E   D + +
Sbjct: 6   YERTPLIHQVFNNGQTG----PRLYVKHEMLQPGGSFKSRGIGHLINRSNEEALADGSGK 61

Query: 65  PHVFXXXXXXXXXXXXXXXQRMGIPCTVVVPTSTRQRIIEKIMATGATIICRGDYFAEAD 124
             VF                 M + CTVVVP +T+ R+I+KI   GA +I  G ++ EAD
Sbjct: 62  LAVFSSSGGNAGLAAATACSSMALDCTVVVPKTTKSRMIKKIQNAGAKVIIHGSHWGEAD 121

Query: 125 SYLK-DLMQEAANKNTRDKKNVPIYVHPFNHPLIWHGHSYIVEEILESLRNENIPYSRVK 183
            YL+ +LM + +   ++      +YVHPF+   IW GHS IV+E+L+ L+ +NI  +R+K
Sbjct: 122 EYLRQELMIQESQLGSK-----TLYVHPFDDERIWEGHSTIVDEVLQQLQEKNISLARIK 176

Query: 184 GIVCSVXXXXXXXXXXXXXXRHSLANTIPIIGVETEGCEVLHKSLIAGKLITFKKALSVA 243
            +VCSV              R++LA  I +I VET GC+VL+KSL+ G  IT ++  S+A
Sbjct: 177 AMVCSVGGGGLFSGIIKGLERNNLAGKIRVIAVETIGCDVLNKSLVNGSPITLERLSSIA 236

Query: 244 TSLSVPTITKETLRYAQKYKTKSLVLGEGEVLDTCLRFTDESNIVTEPACGATLHLGYHP 303
           TSL  P I          Y  KS+VL + +VL TCLR+ D+ N + EPACGA+LHL YH 
Sbjct: 237 TSLGSPYIAPFAFESFNAYGCKSVVLSDQDVLATCLRYADDYNSIVEPACGASLHLCYHQ 296

Query: 304 AILHKEL-GPLSSEDIVILIACGGSATTLADLRELKLKYNPV 344
            IL   L   LS +DIVI+IACGGS  T  DL E   + + V
Sbjct: 297 EILENALEQKLSDDDIVIIIACGGSCMTYEDLVETSRRISSV 338

>YIL167W Chr9 (29416..30048) [633 bp, 210 aa] {OFF}  SDL1Open
           reading frame, unlikely to produce a functional protein
           in S288C; in closely related species and other S.
           cerevisiae strain backgrounds YIL167W and adjacent
           ORF, YIL168W, constitute a single ORF encoding L-serine
           dehydratase
          Length = 210

 Score =  179 bits (454), Expect = 3e-54,   Method: Compositional matrix adjust.
 Identities = 92/189 (48%), Positives = 118/189 (62%), Gaps = 1/189 (0%)

Query: 147 IYVHPFNHPLIWHGHSYIVEEILESLRNENIPYSRVKGIVCSVXXXXXXXXXXXXXXRHS 206
           +YVHPF++  IW GHS IV+EI+E L+  +I   RVK +VCSV              R+ 
Sbjct: 12  LYVHPFDNETIWEGHSTIVDEIIEQLKENDISLPRVKALVCSVGGGGLFSGIIKGLDRNQ 71

Query: 207 LANTIPIIGVETEGCEVLHKSLIAGKLITFKKALSVATSLSVPTITKETLRYAQKYKTKS 266
           LA  IP++ VET GC+VL+KSL  G  +T +K  SVATSL+ P I         KY  KS
Sbjct: 72  LAEKIPVVAVETAGCDVLNKSLKKGSPVTLEKLTSVATSLASPYIASFAFESFNKYGCKS 131

Query: 267 LVLGEGEVLDTCLRFTDESNIVTEPACGATLHLGYHPAILHKEL-GPLSSEDIVILIACG 325
           +VL + +VL TCLR+ D+ N + EPACGA+LHL YHP IL   L   +  +DIVI+IACG
Sbjct: 132 VVLSDQDVLATCLRYADDYNFIVEPACGASLHLCYHPEILEDILEQKIYEDDIVIIIACG 191

Query: 326 GSATTLADL 334
           GS  T  DL
Sbjct: 192 GSCMTYEDL 200

>KNAG0A01150 Chr1 (6346..7041) [696 bp, 231 aa] {ON}
          Length = 231

 Score =  175 bits (444), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 89/220 (40%), Positives = 129/220 (58%), Gaps = 7/220 (3%)

Query: 122 EADSYLKDLMQEAANKNTRDKKNVPIYVHPFNHPLIWHGHSYIVEEILESLRNENIPYSR 181
           EAD YL++++ +        K   PIYV+PF+ PLIW GHS I++EIL +L  ENI    
Sbjct: 14  EADYYLQNVVIDLY------KDVQPIYVNPFDDPLIWEGHSTIIDEILNTLTQENIEVGS 67

Query: 182 VKGIVCSVXXXXXXXXXXXXXXRHSLANTIPIIGVETEGCEVLHKSLIAGKLITFKKALS 241
           VKGI+CS               ++ LA  IP++ VET+GC+VL+ SL A K +      S
Sbjct: 68  VKGIICSFSGGGLYNGIMQGLEKYDLAYNIPVVAVETKGCDVLNLSLAANKPVQLDSITS 127

Query: 242 VATSLSVPTITKETLRYAQKYKTKSLVLGEGEVLDTCLRFTDESNIVTEPACGATLHLGY 301
           +A SL    ++++      KY +KSLVL + + LDTC ++ D+   V EPACGA++H  Y
Sbjct: 128 IAKSLGSSVVSQKVFDNVIKYHSKSLVLNDSDALDTCFKYLDDFGTVLEPACGASVHTAY 187

Query: 302 HPAILHKELG-PLSSEDIVILIACGGSATTLADLRELKLK 340
           H  +L + L   L  +D++I+IACGGS  T  DL   K++
Sbjct: 188 HYNVLEEALDQKLRPDDVIIIIACGGSCATFQDLERAKVQ 227

>YIL168W Chr9 (29032..29415) [384 bp, 127 aa] {OFF} Open reading
           frame, unlikely to produce a functional protein in
           S288C; in closely related species and other S.
           cerevisiae strain backgrounds YIL168W and adjacent
           ORF, YIL167W, constitute a single ORF encoding L-serine
           dehydratase
          Length = 127

 Score = 92.0 bits (227), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 49/128 (38%), Positives = 70/128 (54%), Gaps = 8/128 (6%)

Query: 3   SLYVKTPLLRRAF--GKPNIQISKVPQFLVKYEFFQPSGSFKSRGIGNLIYNKVSEIRRD 60
           + Y KTPL+R+    GK N        F VK+E  QP GSFKSRGIG+LI     E   +
Sbjct: 4   TYYEKTPLIRQFLNNGKTN------SWFYVKHEMLQPGGSFKSRGIGHLIRKSNEEALSE 57

Query: 61  PAKQPHVFXXXXXXXXXXXXXXXQRMGIPCTVVVPTSTRQRIIEKIMATGATIICRGDYF 120
            + +  VF               + M + C+VVVP +T+ R+++KI + GA +I  GD++
Sbjct: 58  GSGKLAVFSSSGGNAGLAAATACRSMALNCSVVVPKTTKPRMVKKIQSAGAKVIIHGDHW 117

Query: 121 AEADSYLK 128
            EAD YL+
Sbjct: 118 GEADEYLR 125

>SAKL0F11858g Chr6 (920767..922455) [1689 bp, 562 aa] {ON} highly
           similar to uniprot|P00927 Saccharomyces cerevisiae
           YER086W ILV1 Threonine deaminase catalyzes the first
           step in isoleucine biosynthesis expression is under
           general amino acid control ILV1 locus exhibits highly
           positioned nucleosomes whose organization is independent
           of known ILV1 regulation
          Length = 562

 Score = 82.4 bits (202), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 71/263 (26%), Positives = 111/263 (42%), Gaps = 21/263 (7%)

Query: 30  VKYEFFQPSGSFKSRGIGNLIYNKVSEIRRDPAKQPHVFXXXXXXXXXXXXXXXQRMGIP 89
           +K E   P  SFK RG  N+I  K+ E +    K   V                + + IP
Sbjct: 83  LKREDLLPVFSFKLRGAYNMI-AKLDESQ----KTQGVIACSAGNHAQGVAYASKHLNIP 137

Query: 90  CTVVVPTSTRQRIIEKIMATGATIICRGDYFAEADSYLKDLMQEAANKNTRDKKNVPIYV 149
            T+V+P ST     + +   G+ ++  G+ F EA +    L +E      R   N+P   
Sbjct: 138 ATIVMPVSTPSIKYQNVSRLGSQVVLYGNDFDEAKAECTKLTEE------RGLTNIP--- 188

Query: 150 HPFNHPLIWHGHSYIVEEILESLRNENIPYSRVKGIVCSVXXXXXXXXXXXXXXRHSLAN 209
            PF+HP +  G   I  EIL  + N     S++K + C+V              R  +A 
Sbjct: 189 -PFDHPYVIAGQGTIAMEILRQVHNA----SKIKAVFCAVGGGGLITGVGAYLKR--IAP 241

Query: 210 TIPIIGVETEGCEVLHKSLIAGKLITFKKALSVATSLSVPTITKETLRYAQKYKTKSLVL 269
            I +IGVET     LH SL AGK +      + A   SV  I +ET R A+    + +++
Sbjct: 242 HIKVIGVETYDAATLHTSLKAGKRVPLPNVGTFADGTSVRMIGEETFRVAKDVVDEVVLV 301

Query: 270 GEGEVLDTCLRFTDESNIVTEPA 292
              E+        +++  + EP+
Sbjct: 302 NTDEICAAVKDIFEDTRSIVEPS 324

>KAFR0K01700 Chr11 (352943..354682) [1740 bp, 579 aa] {ON} Anc_7.367
           YER086W
          Length = 579

 Score = 77.8 bits (190), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 71/282 (25%), Positives = 120/282 (42%), Gaps = 22/282 (7%)

Query: 30  VKYEFFQPSGSFKSRGIGNLIYNKVSEIRRDPAKQPHVFXXXXXXXXXXXXXXXQRMGIP 89
           +K E   P  SFK RG     YN ++++  D  +   V                +++GIP
Sbjct: 100 LKREDLLPVFSFKLRGA----YNMIAKLD-DNVRNQGVIACSAGNHAQGVAYAAKKLGIP 154

Query: 90  CTVVVPTSTRQRIIEKIMATGATIICRGDYFAEADSYLKDLMQEAANKNTRDKKNVPIYV 149
            T+V+P ST     + +   G+ ++  G+ F EA +    L +E      R   N+P   
Sbjct: 155 ATIVMPVSTPSIKYQNVSRLGSQVVLYGNDFDEAKAECAKLSEE------RGLTNIP--- 205

Query: 150 HPFNHPLIWHGHSYIVEEILESLRNENIPYSRVKGIVCSVXXXXXXXXXXXXXXRHSLAN 209
            PF+HP +  G   +  EIL  + N N    ++  +   V              R  +A 
Sbjct: 206 -PFDHPYVIAGQGTVAMEILRQVHNAN----KINAVFVPVGGGGLIAGVGAYLKR--IAP 258

Query: 210 TIPIIGVETEGCEVLHKSLIAGKLITFKKALSVATSLSVPTITKETLRYAQKYKTKSLVL 269
            I +IGVET     LH SL  GK     K  + A   SV  I +ET R AQ+   + +++
Sbjct: 259 HIKVIGVETYDATTLHTSLQNGKRTELTKVGTFADGTSVRLIGEETFRVAQEVVDEIVLV 318

Query: 270 GEGEVLDTCLRFTDESNIVTEPACGATLH-LGYHPAILHKEL 310
              E+        +++  + EP+   ++  +  + ++LH E+
Sbjct: 319 NTDELCAAIKDVFEDTRSILEPSGALSVAGMKKYISVLHPEI 360

>TDEL0C01800 Chr3 complement(313699..315408) [1710 bp, 569 aa] {ON}
           Anc_7.367 YER086W
          Length = 569

 Score = 77.4 bits (189), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 76/287 (26%), Positives = 115/287 (40%), Gaps = 29/287 (10%)

Query: 30  VKYEFFQPSGSFKSRGIGNLIYNKVSEIRRDPAKQPHVFXXXXXXXXXXXXXXXQRMGIP 89
           +K E   P  SFK RG     YN ++++  D  K   V                + M IP
Sbjct: 90  LKREDLLPVFSFKLRGA----YNMIAKLD-DSQKNQGVIACSAGNHAQGVAFAAKHMSIP 144

Query: 90  CTVVVPTSTRQRIIEKIMATGATIICRGDYFAEADSYLKDLMQEAANKNTRDKKNVPIYV 149
            T+V+P ST     + +   G+ ++  G+ F EA +    L +E      R   N+P   
Sbjct: 145 ATIVMPVSTPSIKYQNVSRLGSQVVLYGNDFDEAKAECTRLSEE------RGLTNIP--- 195

Query: 150 HPFNHPLIWHGHSYIVEEILESLRNENIPYSRVKGIVCSVXXXXXXXXXXXXXXRHSLAN 209
            PF+HP +  G   +  EIL  +RN     +++  +                  R  +A 
Sbjct: 196 -PFDHPYVIAGQGTVAMEILRQVRNS----AKIGAVFVPCGGGGLVAGIGAYLKR--IAP 248

Query: 210 TIPIIGVETEGCEVLHKSLIAGKLITFKKALSVATSLSVPTITKETLRYAQKYKTKSLVL 269
            I IIGVET     LH SL  GK        + A   SV  I +ET R AQ    + +++
Sbjct: 249 HIKIIGVETFDSATLHTSLKNGKRTPLASVGTFADGTSVRMIGEETFRIAQDVVDEVVLV 308

Query: 270 GEGEVLDTCLRFTDESNIVTEPACGATLHLGY-------HPAILHKE 309
           G  E+        +++  + EP+ GA    G        HP I H +
Sbjct: 309 GTDEICAAIKDIFEDTRGIVEPS-GALAVAGMKKYVTQLHPEIEHSK 354

>KLLA0E19779g Chr5 complement(1760800..1762503) [1704 bp, 567 aa]
           {ON} highly similar to uniprot|P00927 Saccharomyces
           cerevisiae YER086W ILV1 Threonine deaminase catalyzes
           the first step in isoleucine biosynthesis expression is
           under general amino acid control ILV1 locus exhibits
           highly positioned nucleosomes whose organization is
           independent of known ILV1 regulation
          Length = 567

 Score = 74.7 bits (182), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 74/282 (26%), Positives = 113/282 (40%), Gaps = 22/282 (7%)

Query: 30  VKYEFFQPSGSFKSRGIGNLIYNKVSEIRRDPAKQPHVFXXXXXXXXXXXXXXXQRMGIP 89
           +K E   P  SFK RG  N+I  K+ E +++      V                  M IP
Sbjct: 88  LKREDLLPVFSFKLRGAYNMI-AKLDETQKNAG----VIACSAGNHAQGVAFSSNHMNIP 142

Query: 90  CTVVVPTSTRQRIIEKIMATGATIICRGDYFAEADSYLKDLMQEAANKNTRDKKNVPIYV 149
            T+V+P ST     + +   GA ++  GD F EA      L +E      R   ++P   
Sbjct: 143 ATIVMPVSTPSIKYQNVSRLGAQVVLYGDDFDEAKLECARLAEE------RGMTDIP--- 193

Query: 150 HPFNHPLIWHGHSYIVEEILESLRNENIPYSRVKGIVCSVXXXXXXXXXXXXXXRHSLAN 209
            PF+HP +  G   I  EIL  ++N     S +  + C+V              R  +A 
Sbjct: 194 -PFDHPYVIAGQGTIAMEILRQVQNG----SNIGAVFCAVGGGGLISGIGSYLKR--IAP 246

Query: 210 TIPIIGVETEGCEVLHKSLIAGKLITFKKALSVATSLSVPTITKETLRYAQKYKTKSLVL 269
            I +IGVET     L  SL  GK        + A   SV  I +ET R  Q    + +++
Sbjct: 247 HIKVIGVETYDAATLDVSLKNGKRTPLPSVGTFADGTSVRLIGEETFRVCQDVVDEVILV 306

Query: 270 GEGEVLDTCLRFTDESNIVTEPACG-ATLHLGYHPAILHKEL 310
              E+        +++  + EP+   A   L  + + LH E+
Sbjct: 307 NTDEICAAVKDVFEDTRSIVEPSGALAVAGLKKYVSQLHPEI 348

>Ecym_4708 Chr4 (1386138..1387850) [1713 bp, 570 aa] {ON} similar to
           Ashbya gossypii ACR232C
          Length = 570

 Score = 73.9 bits (180), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 75/287 (26%), Positives = 116/287 (40%), Gaps = 29/287 (10%)

Query: 30  VKYEFFQPSGSFKSRGIGNLIYNKVSEIRRDPAKQPHVFXXXXXXXXXXXXXXXQRMGIP 89
           +K E   P  SFK RG     YN +S +  D  K+  V                + +GIP
Sbjct: 91  LKREDLLPVFSFKLRGA----YNMISHLD-DVQKKCGVIACSAGNHAQGVAYSAKHLGIP 145

Query: 90  CTVVVPTSTRQRIIEKIMATGATIICRGDYFAEADSYLKDLMQEAANKNTRDKKNVPIYV 149
            T+V+P ST     + +   GA ++  GD F  A      L +E      +   ++P   
Sbjct: 146 ATIVMPVSTPSIKYQNVSRLGAEVVLYGDNFDAAKVECSRLSEE------KGLYDIP--- 196

Query: 150 HPFNHPLIWHGHSYIVEEILESLRNENIPYSRVKGIVCSVXXXXXXXXXXXXXXRHSLAN 209
            PF+HP +  G   I  EIL+ ++N     S++  + C+V              R   A 
Sbjct: 197 -PFDHPYVIAGQGTIAMEILKQIQNS----SKIGAVFCAVGGGGLIAGVGAYIKR--AAP 249

Query: 210 TIPIIGVETEGCEVLHKSLIAGKLITFKKALSVATSLSVPTITKETLRYAQKYKTKSLVL 269
            I +IGVET     LH S+      T  +    A   SV  I +E+ R A++   + +++
Sbjct: 250 HIKVIGVETYDAATLHTSMQNNARTTLSQVGGFADGTSVRLIGEESFRVAREVVDEVILV 309

Query: 270 GEGEVLDTCLRFTDESNIVTEPACGATLHLGY-------HPAILHKE 309
              E+        +++  V EP+ GA    G        HP I H E
Sbjct: 310 NTDEICAAIKDIFEDTRAVVEPS-GALAVAGMKKYVNEIHPEIDHSE 355

>NCAS0A14230 Chr1 (2801647..2803356) [1710 bp, 569 aa] {ON}
           Anc_7.367
          Length = 569

 Score = 73.2 bits (178), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 74/287 (25%), Positives = 116/287 (40%), Gaps = 29/287 (10%)

Query: 30  VKYEFFQPSGSFKSRGIGNLIYNKVSEIRRDPAKQPHVFXXXXXXXXXXXXXXXQRMGIP 89
           +K E   P  SFK RG  N+I  K+ + +R+      V                + +GIP
Sbjct: 90  LKREDLLPVFSFKLRGAYNMI-AKLDDSQRNQG----VIACSAGNHAQGVAYAAKHLGIP 144

Query: 90  CTVVVPTSTRQRIIEKIMATGATIICRGDYFAEADSYLKDLMQEAANKNTRDKKNVPIYV 149
            T+V+P ST     + +   G+ ++  G+ F EA +    L +E      R   N+P   
Sbjct: 145 ATIVMPVSTPSIKYQNVSRLGSQVVLYGNDFDEAKAECTKLAEE------RGLTNIP--- 195

Query: 150 HPFNHPLIWHGHSYIVEEILESLRNENIPYSRVKGIVCSVXXXXXXXXXXXXXXRHSLAN 209
            PF+HP +  G   +  EIL  + N N    ++  +   V              R  +A 
Sbjct: 196 -PFDHPYVIAGQGTVAMEILRQVHNAN----KIGAVFVPVGGGGFIAGVGAYLKR--IAP 248

Query: 210 TIPIIGVETEGCEVLHKSLIAGKLITFKKALSVATSLSVPTITKETLRYAQKYKTKSLVL 269
            I +IGVET     LH SL   K        + A   SV  I +ET R AQ+   + +++
Sbjct: 249 HIKVIGVETFDAATLHTSLKHNKRTPLPTVGTFADGTSVRVIGEETFRVAQQVVDEVVLV 308

Query: 270 GEGEVLDTCLRFTDESNIVTEPACGATLHLGY-------HPAILHKE 309
              E+        +++  + EP+ GA    G        HP I H +
Sbjct: 309 NTDEICAAVKDIFEDTRSIVEPS-GALAVAGMKKYITNLHPEIDHSK 354

>ZYRO0B02772g Chr2 (224426..226135) [1710 bp, 569 aa] {ON} highly
           similar to uniprot|P00927 Saccharomyces cerevisiae
           YER086W ILV1 Threonine deaminase catalyzes the first
           step in isoleucine biosynthesis expression is under
           general amino acid control ILV1 locus exhibits highly
           positioned nucleosomes whose organization is independent
           of known ILV1 regulation
          Length = 569

 Score = 69.7 bits (169), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 66/263 (25%), Positives = 107/263 (40%), Gaps = 21/263 (7%)

Query: 30  VKYEFFQPSGSFKSRGIGNLIYNKVSEIRRDPAKQPHVFXXXXXXXXXXXXXXXQRMGIP 89
           +K E   P  SFK RG  N+I  K+ E +++      V                + M IP
Sbjct: 90  LKREDLLPVFSFKLRGAYNMI-AKLDENQKNQG----VIACSAGNHAQGVAYAARHMNIP 144

Query: 90  CTVVVPTSTRQRIIEKIMATGATIICRGDYFAEADSYLKDLMQEAANKNTRDKKNVPIYV 149
            T+V+P ST     + +   G+ ++  G+ F EA +    L +E      R   N+P   
Sbjct: 145 ATIVMPVSTPSIKYQNVSRLGSQVVLYGNDFDEAKAECAKLAEE------RGLTNIP--- 195

Query: 150 HPFNHPLIWHGHSYIVEEILESLRNENIPYSRVKGIVCSVXXXXXXXXXXXXXXRHSLAN 209
            PF+HP +  G   +  EIL  + N      ++  +   V              R  +A 
Sbjct: 196 -PFDHPYVIAGQGTVAMEILRQVHNS----LKIGAVFVPVGGGGLIAGIGAYLKR--IAP 248

Query: 210 TIPIIGVETEGCEVLHKSLIAGKLITFKKALSVATSLSVPTITKETLRYAQKYKTKSLVL 269
            I I+GVET     L  S+  GK    K   S A   SV  I +ET R +Q+   + +++
Sbjct: 249 HIKIVGVETHDAPTLSASMKTGKRELLKTVGSFADGTSVRIIGEETFRVSQEVVDEIVLV 308

Query: 270 GEGEVLDTCLRFTDESNIVTEPA 292
              E+        +++  + EP+
Sbjct: 309 NTDEICAAVKDIFEDTRSIIEPS 331

>YER086W Chr5 (328477..330207) [1731 bp, 576 aa] {ON}  ILV1Threonine
           deaminase, catalyzes the first step in isoleucine
           biosynthesis; expression is under general amino acid
           control; ILV1 locus exhibits highly positioned
           nucleosomes whose organization is independent of known
           ILV1 regulation
          Length = 576

 Score = 68.9 bits (167), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 65/264 (24%), Positives = 107/264 (40%), Gaps = 21/264 (7%)

Query: 29  LVKYEFFQPSGSFKSRGIGNLIYNKVSEIRRDPAKQPHVFXXXXXXXXXXXXXXXQRMGI 88
           ++K E   P  SFK RG  N+I  K+ + +R+      V                + + I
Sbjct: 96  ILKREDLLPVFSFKLRGAYNMI-AKLDDSQRNQG----VIACSAGNHAQGVAFAAKHLKI 150

Query: 89  PCTVVVPTSTRQRIIEKIMATGATIICRGDYFAEADSYLKDLMQEAANKNTRDKKNVPIY 148
           P T+V+P  T     + +   G+ ++  G+ F EA +    L +E      R   N+P  
Sbjct: 151 PATIVMPVCTPSIKYQNVSRLGSQVVLYGNDFDEAKAECAKLAEE------RGLTNIP-- 202

Query: 149 VHPFNHPLIWHGHSYIVEEILESLRNENIPYSRVKGIVCSVXXXXXXXXXXXXXXRHSLA 208
             PF+HP +  G   +  EIL  +R  N    ++  +   V              R  +A
Sbjct: 203 --PFDHPYVIAGQGTVAMEILRQVRTAN----KIGAVFVPVGGGGLIAGIGAYLKR--VA 254

Query: 209 NTIPIIGVETEGCEVLHKSLIAGKLITFKKALSVATSLSVPTITKETLRYAQKYKTKSLV 268
             I IIGVET     LH SL   +        + A   SV  I +ET R AQ+   + ++
Sbjct: 255 PHIKIIGVETYDAATLHNSLQRNQRTPLPVVGTFADGTSVRMIGEETFRVAQQVVDEVVL 314

Query: 269 LGEGEVLDTCLRFTDESNIVTEPA 292
           +   E+        +++  + EP+
Sbjct: 315 VNTDEICAAVKDIFEDTRSIVEPS 338

>CAGL0I05126g Chr9 complement(481145..482860) [1716 bp, 571 aa] {ON}
           highly similar to uniprot|P00927 Saccharomyces
           cerevisiae YER086w ILV1 anabolic serine and threonine
           dehydratase precursor
          Length = 571

 Score = 68.6 bits (166), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 72/287 (25%), Positives = 114/287 (39%), Gaps = 29/287 (10%)

Query: 30  VKYEFFQPSGSFKSRGIGNLIYNKVSEIRRDPAKQPHVFXXXXXXXXXXXXXXXQRMGIP 89
           +K E   P  SFK RG  N+I  K+ + +R+      V                + + IP
Sbjct: 92  LKREDLLPVFSFKLRGAYNMI-AKLDDTQRNQG----VIACSAGNHAQGVAYAARHLDIP 146

Query: 90  CTVVVPTSTRQRIIEKIMATGATIICRGDYFAEADSYLKDLMQEAANKNTRDKKNVPIYV 149
            T+V+P ST     + +   G+ ++  G+ F EA +    L +E      R   N+P   
Sbjct: 147 ATIVMPVSTPSIKYQNVSRLGSQVVLYGNDFDEAKAECTKLAEE------RGLTNIP--- 197

Query: 150 HPFNHPLIWHGHSYIVEEILESLRNENIPYSRVKGIVCSVXXXXXXXXXXXXXXRHSLAN 209
            PF+HP +  G   +  EIL  + N N    ++  +   V              R  +  
Sbjct: 198 -PFDHPYVIAGQGTVAMEILRQVYNSN----KIGAVFVPVGGGGLIAGVGAYLKR--VTP 250

Query: 210 TIPIIGVETEGCEVLHKSLIAGKLITFKKALSVATSLSVPTITKETLRYAQKYKTKSLVL 269
            I IIGVET     LH SL   K        + A   SV  I +ET R A++   + +++
Sbjct: 251 HIKIIGVETHDAATLHTSLQRNKRTNLASVGTFADGTSVRIIGEETFRVAREVVDEIVLV 310

Query: 270 GEGEVLDTCLRFTDESNIVTEPACGATLHLGY-------HPAILHKE 309
              E+        +++  + EP+ GA    G        HP I H +
Sbjct: 311 NTDEICAAVKDVFEDTRSIVEPS-GALAVAGMKKYITQLHPEIDHSK 356

>Smik_5.225 Chr5 (337064..338794) [1731 bp, 576 aa] {ON} YER086W
           (REAL)
          Length = 576

 Score = 68.6 bits (166), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 71/286 (24%), Positives = 114/286 (39%), Gaps = 29/286 (10%)

Query: 29  LVKYEFFQPSGSFKSRGIGNLIYNKVSEIRRDPAKQPHVFXXXXXXXXXXXXXXXQRMGI 88
           ++K E   P  SFK RG  N+I  K+ + +R+      V                + + I
Sbjct: 96  ILKREDLLPVFSFKLRGAYNMI-AKLDDSQRNQG----VIACSAGNHAQGVAFAAKHLKI 150

Query: 89  PCTVVVPTSTRQRIIEKIMATGATIICRGDYFAEADSYLKDLMQEAANKNTRDKKNVPIY 148
           P T+V+P  T     + +   G+ ++  G+ F EA +    L +E      R   N+P  
Sbjct: 151 PATIVMPVCTPSIKYQNVSRLGSQVVLYGNDFDEAKAECAKLAEE------RGLTNIP-- 202

Query: 149 VHPFNHPLIWHGHSYIVEEILESLRNENIPYSRVKGIVCSVXXXXXXXXXXXXXXRHSLA 208
             PF+HP +  G   +  EIL  +R  N    ++  +   V              R  +A
Sbjct: 203 --PFDHPYVIAGQGTVAMEILRQVRTAN----KIGAVFVPVGGGGLIAGIGAYLKR--VA 254

Query: 209 NTIPIIGVETEGCEVLHKSLIAGKLITFKKALSVATSLSVPTITKETLRYAQKYKTKSLV 268
             I +IGVET     LH SL   +        + A   SV  I +ET R AQ+   + ++
Sbjct: 255 PHIKVIGVETYDAATLHNSLQRNQRTPLPVVGTFADGTSVRMIGEETFRVAQQVVDEVVL 314

Query: 269 LGEGEVLDTCLRFTDESNIVTEPACGATLHLGY-------HPAILH 307
           +   E+        +++  + EP+ GA    G        HP I H
Sbjct: 315 VNTDEICAAVKDIFEDTRSIVEPS-GALSVAGMKKYISTVHPEIDH 359

>Skud_5.205 Chr5 (322688..324418) [1731 bp, 576 aa] {ON} YER086W
           (REAL)
          Length = 576

 Score = 68.6 bits (166), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 65/264 (24%), Positives = 107/264 (40%), Gaps = 21/264 (7%)

Query: 29  LVKYEFFQPSGSFKSRGIGNLIYNKVSEIRRDPAKQPHVFXXXXXXXXXXXXXXXQRMGI 88
           ++K E   P  SFK RG  N+I  K+ + +R+      V                + + I
Sbjct: 96  ILKREDLLPVFSFKLRGAYNMI-AKLDDSQRNQG----VIACSAGNHAQGVAFAAKHLKI 150

Query: 89  PCTVVVPTSTRQRIIEKIMATGATIICRGDYFAEADSYLKDLMQEAANKNTRDKKNVPIY 148
           P T+V+P  T     + +   G+ ++  G+ F EA +    L +E      R   N+P  
Sbjct: 151 PATIVMPVCTPSIKYQNVSRLGSQVVLYGNDFDEAKAECAKLAEE------RGLTNIP-- 202

Query: 149 VHPFNHPLIWHGHSYIVEEILESLRNENIPYSRVKGIVCSVXXXXXXXXXXXXXXRHSLA 208
             PF+HP +  G   +  EIL  +R  N    ++  +   V              R  +A
Sbjct: 203 --PFDHPYVIAGQGTVAMEILRQVRTAN----KIGAVFVPVGGGGLIAGIGAYLKR--VA 254

Query: 209 NTIPIIGVETEGCEVLHKSLIAGKLITFKKALSVATSLSVPTITKETLRYAQKYKTKSLV 268
             I +IGVET     LH SL   +        S A   SV  I +ET R AQ+   + ++
Sbjct: 255 PHIKVIGVETFDAPTLHNSLQRNQRTPLPVVGSFADGTSVRMIGEETFRVAQQVVDEVVL 314

Query: 269 LGEGEVLDTCLRFTDESNIVTEPA 292
           +   E+        +++  + EP+
Sbjct: 315 VNTDEICAAVKDVFEDTRSIVEPS 338

>ACR232C Chr3 complement(767330..769012) [1683 bp, 560 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YER086W
           (ILV1)
          Length = 560

 Score = 68.2 bits (165), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 67/263 (25%), Positives = 103/263 (39%), Gaps = 21/263 (7%)

Query: 30  VKYEFFQPSGSFKSRGIGNLIYNKVSEIRRDPAKQPHVFXXXXXXXXXXXXXXXQRMGIP 89
           +K E   P  SFK RG  N+I N + E +    K   V                + +GI 
Sbjct: 82  LKREDLLPVFSFKLRGAYNMISN-LDEYQ----KSAGVIACSAGNHAQGVAFSARELGIR 136

Query: 90  CTVVVPTSTRQRIIEKIMATGATIICRGDYFAEADSYLKDLMQEAANKNTRDKKNVPIYV 149
             +V+PTST       + A GA ++  G  F EA +    L Q           ++P   
Sbjct: 137 AMIVMPTSTPSIKYNSVAAMGAEVVLYGKDFDEAKAECARLAQ------LHKLTDIP--- 187

Query: 150 HPFNHPLIWHGHSYIVEEILESLRNENIPYSRVKGIVCSVXXXXXXXXXXXXXXRHSLAN 209
            PF+HP +  G   I  EIL  + N     S++  + C V              R  +A 
Sbjct: 188 -PFDHPYVIAGQGTIATEILRQVHNA----SQIGAVFCGVGGGGLIAGIGSYLKR--IAP 240

Query: 210 TIPIIGVETEGCEVLHKSLIAGKLITFKKALSVATSLSVPTITKETLRYAQKYKTKSLVL 269
            I IIGVET     LH +L  G+          A   SV  + +ET R A+    + +++
Sbjct: 241 HIKIIGVETHDAPTLHTALKQGRRTMLPAVGCFADGTSVRMMGEETFRVARDVVDEVVLV 300

Query: 270 GEGEVLDTCLRFTDESNIVTEPA 292
              E+        +++  + EP+
Sbjct: 301 NTDELCAAIKDIFEDTRAIVEPS 323

>Suva_5.199 Chr5 (303073..304803) [1731 bp, 576 aa] {ON} YER086W
           (REAL)
          Length = 576

 Score = 68.2 bits (165), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 64/264 (24%), Positives = 107/264 (40%), Gaps = 21/264 (7%)

Query: 29  LVKYEFFQPSGSFKSRGIGNLIYNKVSEIRRDPAKQPHVFXXXXXXXXXXXXXXXQRMGI 88
           ++K E   P  SFK RG  N+I  K+ + +R+      V                + + I
Sbjct: 96  ILKREDLLPVFSFKLRGAYNMI-AKLDDSQRNQG----VIACSAGNHAQGVAFAAKHLKI 150

Query: 89  PCTVVVPTSTRQRIIEKIMATGATIICRGDYFAEADSYLKDLMQEAANKNTRDKKNVPIY 148
           P T+V+P  T     + +   G+ ++  G+ F EA +    L +E      R   N+P  
Sbjct: 151 PATIVMPVCTPSIKYQNVSRLGSQVVLFGNDFDEAKAECTKLAEE------RGLTNIP-- 202

Query: 149 VHPFNHPLIWHGHSYIVEEILESLRNENIPYSRVKGIVCSVXXXXXXXXXXXXXXRHSLA 208
             PF+HP +  G   +  EIL  +R  N    ++  +   V              R  +A
Sbjct: 203 --PFDHPYVIAGQGTVAMEILRQVRTVN----KIGAVFVPVGGGGLIAGIGAYLKR--IA 254

Query: 209 NTIPIIGVETEGCEVLHKSLIAGKLITFKKALSVATSLSVPTITKETLRYAQKYKTKSLV 268
             I +IGVET     LH SL   +        + A   SV  I +ET R AQ+   + ++
Sbjct: 255 PHIKVIGVETYDAATLHNSLQRNQRTPLPAVGTFADGTSVRMIGEETFRVAQQVVDEVVL 314

Query: 269 LGEGEVLDTCLRFTDESNIVTEPA 292
           +   E+        +++  + EP+
Sbjct: 315 VNTDEICAAVKDVFEDTRSIVEPS 338

>Kpol_530.16 s530 complement(41170..42870) [1701 bp, 566 aa] {ON}
           complement(41170..42870) [1701 nt, 567 aa]
          Length = 566

 Score = 67.4 bits (163), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 67/282 (23%), Positives = 116/282 (41%), Gaps = 22/282 (7%)

Query: 30  VKYEFFQPSGSFKSRGIGNLIYNKVSEIRRDPAKQPHVFXXXXXXXXXXXXXXXQRMGIP 89
           +K E   P  SFK RG     YN ++++  D  K   V                + + IP
Sbjct: 87  LKREDLLPVFSFKLRGA----YNMMAKLD-DSQKNQGVIACSAGNHAQGIAYAAKHLNIP 141

Query: 90  CTVVVPTSTRQRIIEKIMATGATIICRGDYFAEADSYLKDLMQEAANKNTRDKKNVPIYV 149
            T+V+P ST     + +   G+ ++  G+ F EA +    L +E      R   N+P   
Sbjct: 142 ATIVMPVSTPSIKYQNVSRLGSQVVLYGNDFDEAKAECARLAEE------RGLTNIP--- 192

Query: 150 HPFNHPLIWHGHSYIVEEILESLRNENIPYSRVKGIVCSVXXXXXXXXXXXXXXRHSLAN 209
            PF+HP +  G   +  EIL  +   N    ++  +   V              R  +A 
Sbjct: 193 -PFDHPYVIAGQGTVAMEILRQVHKAN----KIGAVFVPVGGGGLIAGVGAYLKR--IAP 245

Query: 210 TIPIIGVETEGCEVLHKSLIAGKLITFKKALSVATSLSVPTITKETLRYAQKYKTKSLVL 269
            I IIGVET     L+ SL +GK +      + A   +V  I +ET R  Q+   + +++
Sbjct: 246 HIKIIGVETFDANCLYTSLQSGKRVPLSSVGTFADGTAVRLIGEETFRVCQEVVDEVVLV 305

Query: 270 GEGEVLDTCLRFTDESNIVTEPACGATLH-LGYHPAILHKEL 310
              E+        +++  + EP+   ++  +  + + LH E+
Sbjct: 306 NTDEICAAVKDVFEDTRSIVEPSGALSVAGMKKYVSTLHPEI 347

>TPHA0F03130 Chr6 complement(685292..686998) [1707 bp, 568 aa] {ON}
           Anc_7.367 YER086W
          Length = 568

 Score = 67.0 bits (162), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 69/286 (24%), Positives = 117/286 (40%), Gaps = 27/286 (9%)

Query: 30  VKYEFFQPSGSFKSRGIGNLIYNKVSEIRRDPAKQPHVFXXXXXXXXXXXXXXXQRMGIP 89
           +K +   P  SFK RG     YN ++++  D  K   V                + + IP
Sbjct: 89  LKRDDLLPVFSFKLRGA----YNMMAKLD-DTQKNQGVIACSAGNHAQGVAYAAKHLKIP 143

Query: 90  CTVVVPTSTRQRIIEKIMATGATIICRGDYFAEADSYLKDLMQEAANKNTRDKKNVPIYV 149
            T+V+P ST     + +   G+ ++  G+ F EA +    L +E      R   N+P   
Sbjct: 144 ATIVMPVSTPSIKYQNVSRLGSQVVLYGNDFDEAKAECARLAEE------RGLTNIP--- 194

Query: 150 HPFNHPLIWHGHSYIVEEILESLRNENIPYSRVKGIVCSVXXXXXXXXXXXXXXRHSLAN 209
            PF+HP +  G   +  EIL  +       S++  +   V              R  +A 
Sbjct: 195 -PFDHPYVIAGQGTVAMEILRQVHMS----SKIGAVFVPVGGGGLIAGVGTYLKR--IAP 247

Query: 210 TIPIIGVETEGCEVLHKSLIAGKLITFKKALSVATSLSVPTITKETLRYAQKYKTKSLVL 269
            I IIGVET     L+ SL +GK    +   S A   +V  + +ET R AQ+   + +++
Sbjct: 248 HIKIIGVETYDACALYTSLQSGKRAALESVGSFADGTAVRLLGEETFRVAQEVVDEVVLV 307

Query: 270 GEGEVLDTCLRFTDESNIVTEPA-----CGATLHLGY-HPAILHKE 309
              E+        +++  + EP+      G   ++ + HP I H +
Sbjct: 308 NTDEICAGIKDIFEDTRSIVEPSGALAVAGMKKYVSHLHPEIEHSK 353

>NDAI0A01810 Chr1 complement(400890..402602) [1713 bp, 570 aa] {ON}
           Anc_7.367
          Length = 570

 Score = 66.2 bits (160), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 73/287 (25%), Positives = 114/287 (39%), Gaps = 29/287 (10%)

Query: 30  VKYEFFQPSGSFKSRGIGNLIYNKVSEIRRDPAKQPHVFXXXXXXXXXXXXXXXQRMGIP 89
           +K E   P  SFK RG  N+I  K+ + +R+      V                + + IP
Sbjct: 91  LKREDLLPVFSFKLRGAYNMI-AKLDDSQRNQG----VIACSAGNHAQGVAFAAKHLNIP 145

Query: 90  CTVVVPTSTRQRIIEKIMATGATIICRGDYFAEADSYLKDLMQEAANKNTRDKKNVPIYV 149
            T+V+P ST     + +   G+ ++  G+ F EA +    L +E      R   N+P   
Sbjct: 146 ATIVMPVSTPSIKYQNVSRLGSQVVLYGNDFDEAKAECTKLAEE------RGLTNIP--- 196

Query: 150 HPFNHPLIWHGHSYIVEEILESLRNENIPYSRVKGIVCSVXXXXXXXXXXXXXXRHSLAN 209
            PF+HP +  G   +  EIL  + N N    ++  +   V              R  +A 
Sbjct: 197 -PFDHPYVIAGQGTVAMEILRQVHNAN----KIGAVFVPVGGGGLVAGVGAYLKR--IAP 249

Query: 210 TIPIIGVETEGCEVLHKSLIAGKLITFKKALSVATSLSVPTITKETLRYAQKYKTKSLVL 269
            I IIGVET     L  SL  G+          A   SV  I +ET R AQ+   + +++
Sbjct: 250 HIKIIGVETHDAATLQTSLKHGRRTPLSVVGPFADGTSVRLIGEETFRVAQEVVDEVVLV 309

Query: 270 GEGEVLDTCLRFTDESNIVTEPACGATLHLGY-------HPAILHKE 309
              E+        +++  + EP+ GA    G        HP I H +
Sbjct: 310 NTDEICAAVKDVFEDTRSIVEPS-GALSVAGMKKYITTLHPEIDHSK 355

>TBLA0C05070 Chr3 (1230732..1232459) [1728 bp, 575 aa] {ON}
           Anc_7.367 YER086W
          Length = 575

 Score = 64.3 bits (155), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 70/289 (24%), Positives = 115/289 (39%), Gaps = 31/289 (10%)

Query: 27  QFLVKYEFFQPSGSFKSRGIGNLIYNKVSEIRRDPAKQPHVFXXXXXXXXXXXXXXXQRM 86
           Q  +K E   P  SFK RG     YN V+++     KQ  V                + +
Sbjct: 88  QIQLKREDLLPVFSFKMRGA----YNMVAKLDETQRKQG-VIACSAGNHAQGVAYAAKHL 142

Query: 87  GIPCTVVVPTSTRQRIIEKIMATGATIICRGDYFAEADSYLKDLMQEAANKNTRDKKNVP 146
           GIP T+V+P ST     E +   G+ ++  G+ F  +    + L +E      R   N+P
Sbjct: 143 GIPATIVMPVSTPSIKYENVSRLGSQVVLYGNDFDSSKGECERLCEE------RGLVNIP 196

Query: 147 IYVHPFNHPLIWHGHSYIVEEILESLRNENIPYSRVKGIVCSVXXXXXXXXXXXXXXRHS 206
               PF+HP +  G   +  EIL  ++N     +++  +   V              R  
Sbjct: 197 ----PFDHPYVIAGQGTVAMEILRQVKNS----AKIGAVFVPVGGGGLVAGIGAYLKR-- 246

Query: 207 LANTIPIIGVETEGCEVLHKSLIAGKLITFKKALSVATSLSVPTITKETLRYAQKYKTKS 266
           +A  I I+GVET     L  SL  GK        + A   +V  I +ET R ++    + 
Sbjct: 247 IAPHIKIVGVETYDAATLKTSLDNGKRTELNTVGTFADGTAVKMIGEETFRVSKDVVDEI 306

Query: 267 LVLGEGEVLDTCLRFTDESNIVTEPACGATL--------HLGYHPAILH 307
           +++   E+        +++  + EP+   ++        HL  HP I H
Sbjct: 307 VLVNTDELCAAVKDIFEDTRSIVEPSGALSVAGLKKYVQHL--HPEIDH 353

>KNAG0C03690 Chr3 complement(722238..723971) [1734 bp, 577 aa] {ON}
           Anc_7.367 YER086W
          Length = 577

 Score = 63.5 bits (153), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 69/278 (24%), Positives = 111/278 (39%), Gaps = 22/278 (7%)

Query: 30  VKYEFFQPSGSFKSRGIGNLIYNKVSEIRRDPAKQPHVFXXXXXXXXXXXXXXXQRMGIP 89
           +K E   P  SFK RG     YN ++++  D  K   V                + + IP
Sbjct: 98  LKREDLLPVFSFKLRGA----YNMMAKLD-DTQKNQGVIACSAGNHAQGVAFAAKHLDIP 152

Query: 90  CTVVVPTSTRQRIIEKIMATGATIICRGDYFAEADSYLKDLMQEAANKNTRDKKNVPIYV 149
            T+V+P ST     + +   G+ ++  G+ F EA +    L +E      R   N+P   
Sbjct: 153 ATIVMPVSTPSIKYQNVSRLGSQVVLYGNDFDEAKAECTKLSKE------RGLTNIP--- 203

Query: 150 HPFNHPLIWHGHSYIVEEILESLRNENIPYSRVKGIVCSVXXXXXXXXXXXXXXRHSLAN 209
            PF+HP +  G   +  EIL  +   N    ++  +   V              R  +A 
Sbjct: 204 -PFDHPYVIAGQGTVAMEILRQVHIAN----KIGAVFVPVGGGGLVAGVGAYLKR--IAP 256

Query: 210 TIPIIGVETEGCEVLHKSLIAGKLITFKKALSVATSLSVPTITKETLRYAQKYKTKSLVL 269
            I IIGVET     L+ SL  G+  +     + A   SV  I +ET R +Q    + +++
Sbjct: 257 HIKIIGVETFDASTLYTSLQRGRRTSLPSVGTFADGTSVKLIGEETFRISQDVVDEVVLV 316

Query: 270 GEGEVLDTCLRFTDESNIVTEPACGATLHLGYHPAILH 307
              E+        +++  + EP+ GA    G    I H
Sbjct: 317 NTDEICAAVKDIFEDTRSIVEPS-GALAVAGMKKYITH 353

>KLTH0B04884g Chr2 (400193..401914) [1722 bp, 573 aa] {ON} highly
           similar to uniprot|P00927 Saccharomyces cerevisiae
           YER086W ILV1 Threonine deaminase catalyzes the first
           step in isoleucine biosynthesis expression is under
           general amino acid control ILV1 locus exhibits highly
           positioned nucleosomes whose organization is independent
           of known ILV1 regulation
          Length = 573

 Score = 57.8 bits (138), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 62/263 (23%), Positives = 103/263 (39%), Gaps = 21/263 (7%)

Query: 30  VKYEFFQPSGSFKSRGIGNLIYNKVSEIRRDPAKQPHVFXXXXXXXXXXXXXXXQRMGIP 89
           +K E   P  SFK RG  N++  K+SE +++      V                + + IP
Sbjct: 94  LKREDLLPVFSFKLRGAYNMM-AKLSEAQKNQG----VIACSAGNHAQGVAFASRHLNIP 148

Query: 90  CTVVVPTSTRQRIIEKIMATGATIICRGDYFAEADSYLKDLMQEAANKNTRDKKNVPIYV 149
             +V+P +T     + +   G  ++  G+ F EA +    + +E      R   N+P   
Sbjct: 149 AIIVMPVNTPSIKYQNVSRLGGQVVLYGNDFDEAKTECTRISEE------RGLTNIP--- 199

Query: 150 HPFNHPLIWHGHSYIVEEILESLRNENIPYSRVKGIVCSVXXXXXXXXXXXXXXRHSLAN 209
            PF+HP +  G   +  EIL  + N     +++  +   V              R  +A 
Sbjct: 200 -PFDHPYVIAGQGTVAMEILRQVHNA----AKIGAVFVPVGGGGLVAGVAAYLKR--IAP 252

Query: 210 TIPIIGVETEGCEVLHKSLIAGKLITFKKALSVATSLSVPTITKETLRYAQKYKTKSLVL 269
            I IIGVET     L  SL AG         + A   SV  I +ET R  Q      +++
Sbjct: 253 HIKIIGVETYDSATLKTSLEAGTRTPLSTVGTFADGTSVRMIGEETFRICQDLVDDVILV 312

Query: 270 GEGEVLDTCLRFTDESNIVTEPA 292
              E+        +++  + EP+
Sbjct: 313 NTDEICAAVKDIFEDTRSIVEPS 335

>Kwal_33.14822 s33 complement(830029..831717) [1689 bp, 562 aa] {ON}
           YER086W (ILV1) - threonine deaminase [contig 101] FULL
          Length = 562

 Score = 53.5 bits (127), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 60/263 (22%), Positives = 103/263 (39%), Gaps = 21/263 (7%)

Query: 30  VKYEFFQPSGSFKSRGIGNLIYNKVSEIRRDPAKQPHVFXXXXXXXXXXXXXXXQRMGIP 89
           +K E   P  SFK RG  N++  K++E + +      V                + + IP
Sbjct: 83  LKREDLLPVFSFKLRGAYNMM-AKLAEGQGNKG----VIACSAGNHAQGVAFASRHLNIP 137

Query: 90  CTVVVPTSTRQRIIEKIMATGATIICRGDYFAEADSYLKDLMQEAANKNTRDKKNVPIYV 149
             +V+P +T     + +   G  ++  G+ F EA      + +E      R   N+P   
Sbjct: 138 AIIVMPVNTPSIKYQNVSRLGGQVVLYGNDFDEAKIECARISEE------RGLTNIP--- 188

Query: 150 HPFNHPLIWHGHSYIVEEILESLRNENIPYSRVKGIVCSVXXXXXXXXXXXXXXRHSLAN 209
            PF+HP +  G   +  EIL  + N     S++  +   V              R  +A 
Sbjct: 189 -PFDHPYVIAGQGTVAMEILRQVHNA----SKIGAVFVPVGGGGLVAGVAAYLKR--IAP 241

Query: 210 TIPIIGVETEGCEVLHKSLIAGKLITFKKALSVATSLSVPTITKETLRYAQKYKTKSLVL 269
            I I+GVET     L  SL AG         + A   SV  I +ET R  + +  + +++
Sbjct: 242 HIKIVGVETYDSATLKTSLDAGCRTPLTSVGTFADGTSVRMIGEETFRICEDFVDEVVLV 301

Query: 270 GEGEVLDTCLRFTDESNIVTEPA 292
              E+        +++  + EP+
Sbjct: 302 NTDEICAAVKDIFEDTRSIVEPS 324

>SAKL0A10626g Chr1 complement(932879..933841) [963 bp, 320 aa] {ON}
           similar to uniprot|P36007 Saccharomyces cerevisiae
           YKL218C SRY1 3-hydroxyaspartate dehydratase deaminates
           L- threo-3-hydroxyaspartate to form oxaloacetate and
           ammonia required for survival in the presence of
           hydroxyaspartate
          Length = 320

 Score = 51.2 bits (121), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 62/295 (21%), Positives = 109/295 (36%), Gaps = 30/295 (10%)

Query: 31  KYEFFQPSGSFKSRGIGNLIYNKVSEIRRDPAKQPHVFXXXXXXXXXXXXXXXQRMGIPC 90
           K E FQ  G+FK RG  N +     E R        V                + +G+P 
Sbjct: 42  KCENFQRIGAFKFRGAMNTLLKLTQEQR-----AAGVVAFSSGNHAQAIALSAKLLGVPA 96

Query: 91  TVVVPTSTRQRIIEKIMATGATIICRGDYFAEADSYLKDLMQEAANKNTRDKKNVPIYVH 150
           T+V+P       +      GA I+         D Y +D  +E   +   ++K + + V 
Sbjct: 97  TIVMPNDAPAAKVRATAGYGANIV-------RYDRYTED--REQIGRALAEEKGLTL-VP 146

Query: 151 PFNHPLIWHGHSYIVEEILESLRNENIPYSRVKGIVCSVXXXXXXXXXXXXXXRHSLANT 210
           P++HP +  G     +E++E +   ++ +         V                 L+  
Sbjct: 147 PYDHPDVIAGQGTAAKELIEEVGELDLLF---------VPLGGGGLLSGSALAAKRLSPR 197

Query: 211 IPIIGVETEGCEVLHKSLIAGKLITFKKALSVATSLSVPTITKETLRYAQKYKTKSLVLG 270
             IIGVE E      +SL +G ++      ++A       + + T           L   
Sbjct: 198 CEIIGVEPEAGNDGQQSLRSGSIVHIDTPETIADGAQTQHLGQYTFEVIHANVADILTAS 257

Query: 271 EGEVLDTCLRFTDESNIVTEPACGATLHLGYHPAILHKELGPLSSEDIVILIACG 325
           + E++D+   F +   IV EP    T  LG+  A   K    L+ + + I+++ G
Sbjct: 258 DAELVDSMRFFAERMKIVVEP----TGCLGFAAARAQK--AKLAGKRVGIIVSGG 306

>YKL218C Chr11 complement(17359..18339) [981 bp, 326 aa] {ON}
           SRY13-hydroxyaspartate dehydratase, deaminates
           L-threo-3-hydroxyaspartate to form oxaloacetate and
           ammonia; required in the presence of hydroxyaspartate;
           highly similar to mouse serine racemase (Srr) but has no
           serine racemase activity
          Length = 326

 Score = 45.4 bits (106), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 64/301 (21%), Positives = 112/301 (37%), Gaps = 34/301 (11%)

Query: 27  QFLVKYEFFQPSGSFKSRGIGNLIYNKVSEIRRDPAKQPHVFXXXXXXXXXXXXXXXQRM 86
           Q   K E FQ  G+FK RG  N + +K+S+ +R       V                + +
Sbjct: 38  QIYFKGENFQRVGAFKFRGAMNAV-SKLSDEKRSKG----VIAFSSGNHAQAIALSAKLL 92

Query: 87  GIPCTVVVPTSTRQRIIEKIMATGATIICRGDYFAEADSYLKDLMQEAANKNTRDKKNVP 146
            +P T+V+P       +      GA II    Y  + +   + L  E             
Sbjct: 93  NVPATIVMPEDAPALKVAATAGYGAHIIRYNRYTEDREQIGRQLAAEHGFA--------- 143

Query: 147 IYVHPFNHPLIWHGHSYIVEEILESLRNENIPYSRVKGIVCSVXXXXXXXXXXXXXXRHS 206
             + P++HP +  G     +E+LE +   +  +         V                S
Sbjct: 144 -LIPPYDHPDVIAGQGTSAKELLEEVGQLDALF---------VPLGGGGLLSGSALAARS 193

Query: 207 LANTIPIIGVETEGCEVLHKSLIAGKLITFKKALSVATSLSVPTITKETLRYAQKYKTKS 266
           L+    I GVE E      +S  +G ++      ++A       + + T    ++     
Sbjct: 194 LSPGCKIFGVEPEAGNDGQQSFRSGSIVHINTPKTIADGAQTQHLGEYTFAIIRENVDDI 253

Query: 267 LVLGEGEVLDTCLRFTDES-NIVTEP-ACGATLHLGYHPAILHKELGPLSSEDIVILIAC 324
           L + + E++  C+ F  E   +V EP AC     LG+  A+L KE   L  + + I+++ 
Sbjct: 254 LTVSDQELV-KCMHFLAERMKVVVEPTAC-----LGFAGALLKKE--ELVGKKVGIILSG 305

Query: 325 G 325
           G
Sbjct: 306 G 306

>Smik_11.3 Chr11 complement(1725..2534) [810 bp, 269 aa] {ON}
           YKL218C (REAL)
          Length = 269

 Score = 31.2 bits (69), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 47/240 (19%), Positives = 89/240 (37%), Gaps = 25/240 (10%)

Query: 86  MGIPCTVVVPTSTRQRIIEKIMATGATIICRGDYFAEADSYLKDLMQEAANKNTRDKKNV 145
           + +P T+V+P       +      GA I     Y  + D   + L            K+ 
Sbjct: 35  LNVPATIVMPEDASTLKVAATTGYGAHITKYNRYTEDRDKIGRQLAA----------KHG 84

Query: 146 PIYVHPFNHPLIWHGHSYIVEEILESLRNENIPYSRVKGIVCSVXXXXXXXXXXXXXXRH 205
              + P++HP +  G S   +++LE +   +  +         V                
Sbjct: 85  FALIPPYDHPDVIAGQSASAKKLLEEVGQLDALF---------VLLGGGGLLSGSTLASR 135

Query: 206 SLANTIPIIGVETEGCEVLHKSLIAGKLITFKKALSVATSLSVPTITKETLRYAQKYKTK 265
           SL+    I GVE E      +S  +G ++      ++A       + + T    ++    
Sbjct: 136 SLSPDCKIFGVEPEAGNDGQQSFRSGSVVHIDTPNTIAGEAQTQHLGEYTFAIIRENVDD 195

Query: 266 SLVLGEGEVLDTCLRFTDESNIVTEPACGATLHLGYHPAILHKELGPLSSEDIVILIACG 325
            L + +G++++ C+ F  E     +   G T  LG+  A+L K+   L  E I I ++ G
Sbjct: 196 ILTVTDGKLIE-CMHFLAER---MKLVVGPTACLGHAGAVLKKK--ELVGEKIGIRLSRG 249

>YNL290W Chr14 (86218..87240) [1023 bp, 340 aa] {ON}  RFC3Subunit of
           heteropentameric Replication factor C (RF-C), which is a
           DNA binding protein and ATPase that acts as a clamp
           loader of the proliferating cell nuclear antigen (PCNA)
           processivity factor for DNA polymerases delta and
           epsilon
          Length = 340

 Score = 30.4 bits (67), Expect = 8.2,   Method: Compositional matrix adjust.
 Identities = 16/45 (35%), Positives = 26/45 (57%), Gaps = 2/45 (4%)

Query: 245 SLSVPTITKETLRYAQKYKTKSL--VLGEGEVLDTCLRFTDESNI 287
           S S    +KE L + +KY+ ++L  V G+ EV+ T  +F DE  +
Sbjct: 2   STSTEKRSKENLPWVEKYRPETLDEVYGQNEVITTVRKFVDEGKL 46

>TPHA0J02870 Chr10 (635718..638558) [2841 bp, 946 aa] {ON} Anc_5.488
           YDR395W
          Length = 946

 Score = 30.4 bits (67), Expect = 9.7,   Method: Compositional matrix adjust.
 Identities = 24/74 (32%), Positives = 37/74 (50%), Gaps = 8/74 (10%)

Query: 224 LHKSLIAGKLITFKKALSVATSLSVPTITKETLRYAQKYKTKSLVLGEG------EVLDT 277
           +HK     K+IT K+ L       VPTI +E  +  +++ TKSL + E       + L+ 
Sbjct: 268 IHKFSRTTKVIT-KEFLDYVNKNLVPTILQEYFKIIEQWGTKSLWISESSLYYLIQFLEK 326

Query: 278 CLRFTDESNIVTEP 291
           C+  TDE   + EP
Sbjct: 327 CVN-TDELYPLVEP 339

>ACL176W Chr3 (52435..53307) [873 bp, 290 aa] {ON} Syntenic homolog
           of Saccharomyces cerevisiae YBR039W (ATP3)
          Length = 290

 Score = 30.0 bits (66), Expect = 9.7,   Method: Compositional matrix adjust.
 Identities = 35/150 (23%), Positives = 58/150 (38%), Gaps = 20/150 (13%)

Query: 222 EVLHKSLIAGKLITFKKALSVATSLSVPTITKETLRY-----AQKYKTKSLVLGEGEVLD 276
           E+  KS+   + IT    +  +T L      K+T R      A+ Y      +GEGE  D
Sbjct: 26  EMRLKSIKNIEKITMTMKIVASTRLGKADRAKQTARQYSKAEAEFYSNAGTAVGEGEARD 85

Query: 277 TCLRFTDE----SNIVTEPACGATLHLGYHPAILHKELGPLSSEDIVILIACGGSATTLA 332
             +  T +     +I ++ A     HL  HP           S D+V +     +    +
Sbjct: 86  LVIAITSDKGLCGSIHSQLAKAVRAHLANHP-----------SSDVVTVGDKVKNQIMRS 134

Query: 333 DLRELKLKYNPVTLDDSPVEIPGLITEQVL 362
               LK+ +N V  +    E   LI +++L
Sbjct: 135 HADNLKMSFNGVGKEAPTFEESALIADKIL 164

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.319    0.136    0.396 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 34,363,722
Number of extensions: 1352891
Number of successful extensions: 3450
Number of sequences better than 10.0: 61
Number of HSP's gapped: 3377
Number of HSP's successfully gapped: 61
Length of query: 364
Length of database: 53,481,399
Length adjustment: 111
Effective length of query: 253
Effective length of database: 40,753,473
Effective search space: 10310628669
Effective search space used: 10310628669
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 66 (30.0 bits)