Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Ecym_10031.1ON26326310881e-151
Ecym_11141.120ON26326310881e-151
KLTH0F00374g1.1ON249982219e-21
KLLA0C00352g1.1ON2611612192e-20
Kwal_33.matalpha1singletonOFF2441632042e-18
Kwal_33.12992singletonOFF2441632042e-18
Kwal_YGOB_matalpha11.120ON2441632042e-18
Kwal_YGOB_HMalpha11.1ON2441632042e-18
Suva_3.1481.1ON175911591e-12
YCR040W (MATALPHA1)1.120ON175951592e-12
YCL066W (HMLALPHA1)1.1ON175951592e-12
ZYRO0F18590g1.1ON200681541e-11
ZYRO0F15840g1.120ON200681541e-11
Smik_92.1singletonON156981502e-11
TBLA0A070401.120ON201661513e-11
TBLA0A075901.1ON201661513e-11
Kpol_2002.21.1ON209691514e-11
TDEL0C070101.1ON205681471e-10
Skud_3.1191.120ON174671451e-10
Skud_71.1singletonON155621404e-10
TPHA0E036201.120ON195861354e-09
TPHA0E040801.1ON195861354e-09
Suva_69.2singletonON145781317e-09
KAFR0D007101.120ON172611178e-07
CAGL0B01243g1.120ON1431011105e-06
CAGL0B00242g1.1ON184711108e-06
KNAG0C001501.1ON145531026e-05
NCAS0B091501.1ON150521026e-05
NDAI0A001001.1ON13552710.71
KNAG0H007203.354ON51677701.9
YPR065W (ROX1)3.354ON36880683.6
Suva_16.3933.354ON37280657.8
CAGL0M06149g8.587ON53093658.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Ecym_1003
         (263 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Ecym_1003 Chr1 (6314..7105) [792 bp, 263 aa] {ON} similar to Sac...   423   e-151
Ecym_1114 Chr1 complement(236238..237029) [792 bp, 263 aa] {ON} ...   423   e-151
KLTH0F00374g Chr6 complement(30927..31676) [750 bp, 249 aa] {ON}...    90   9e-21
KLLA0C00352g Chr3 complement(24124..24909) [786 bp, 261 aa] {ON}...    89   2e-20
Kwal_33.matalpha1 s33 complement(283160..283894) [735 bp, 244 aa...    83   2e-18
Kwal_33.12992 s33 complement(31018..31752) [735 bp, 244 aa] {OFF...    83   2e-18
Kwal_YGOB_matalpha1 s33 complement(283160..283894) [735 bp, 244 ...    83   2e-18
Kwal_YGOB_HMalpha1 s33 complement(31018..31752) [735 bp, 244 aa]...    83   2e-18
Suva_3.148 Chr3 (222811..223338) [528 bp, 175 aa] {ON} YCL066W (...    66   1e-12
YCR040W Chr3 (200442..200969) [528 bp, 175 aa] {ON}  MATALPHA1Tr...    66   2e-12
YCL066W Chr3 (13282..13809) [528 bp, 175 aa] {ON}  HMLALPHA1Sile...    66   2e-12
ZYRO0F18590g Chr6 (1533781..1534383) [603 bp, 200 aa] {ON} simil...    64   1e-11
ZYRO0F15840g Chr6 (1303842..1304444) [603 bp, 200 aa] {ON} simil...    64   1e-11
Smik_92.1 Chr92 complement(3..470) [468 bp, 156 aa] {ON} YCR040W...    62   2e-11
TBLA0A07040 Chr1 complement(1727988..1728593) [606 bp, 201 aa] {...    63   3e-11
TBLA0A07590 Chr1 complement(1881757..1882362) [606 bp, 201 aa] {...    63   3e-11
Kpol_2002.2 s2002 complement(3611..4240) [630 bp, 209 aa] {ON} c...    63   4e-11
TDEL0C07010 Chr3 (1274648..1275265) [618 bp, 205 aa] {ON} Anc_1....    61   1e-10
Skud_3.119 Chr3 (184941..185465) [525 bp, 174 aa] {ON} YCR040W (...    60   1e-10
Skud_71.1 Chr71 complement(3..467) [465 bp, 155 aa] {ON} YCR040W...    59   4e-10
TPHA0E03620 Chr5 (766068..766655) [588 bp, 195 aa] {ON} Anc_1.12...    57   4e-09
TPHA0E04080 Chr5 (850045..850632) [588 bp, 195 aa] {ON}   silenc...    57   4e-09
Suva_69.2 Chr69 (369..803) [435 bp, 145 aa] {ON} YCL066W (REAL)        55   7e-09
KAFR0D00710 Chr4 complement(127819..128337) [519 bp, 172 aa] {ON...    50   8e-07
CAGL0B01243g Chr2 complement(112831..113262) [432 bp, 143 aa] {O...    47   5e-06
CAGL0B00242g Chr2 complement(10582..11136) [555 bp, 184 aa] {ON}...    47   8e-06
KNAG0C00150 Chr3 complement(24902..25339) [438 bp, 145 aa] {ON} ...    44   6e-05
NCAS0B09150 Chr2 (1755595..1756047) [453 bp, 150 aa] {ON} Anc_1.1      44   6e-05
NDAI0A00100 Chr1 complement(783..1190) [408 bp, 135 aa] {ON} Anc...    32   0.71 
KNAG0H00720 Chr8 (114623..116173) [1551 bp, 516 aa] {ON} Anc_3.3...    32   1.9  
YPR065W Chr16 (679693..680799) [1107 bp, 368 aa] {ON}  ROX1Heme-...    31   3.6  
Suva_16.393 Chr16 (686503..686838,686887..687669) [1119 bp, 372 ...    30   7.8  
CAGL0M06149g Chr13 complement(640964..642556) [1593 bp, 530 aa] ...    30   8.8  

>Ecym_1003 Chr1 (6314..7105) [792 bp, 263 aa] {ON} similar to
           Saccharomyces cerevisiae YCL066W HMLALPHA1
          Length = 263

 Score =  423 bits (1088), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 213/263 (80%), Positives = 213/263 (80%)

Query: 1   MSEINYKTPMFRVKIXXXXXXXXXXXXXXXXVLKILEIKNQDNYNKKKGYYKCEGVNLYM 60
           MSEINYKTPMFRVKI                VLKILEIKNQDNYNKKKGYYKCEGVNLYM
Sbjct: 1   MSEINYKTPMFRVKIKKPKTRKGSRRRKGSSVLKILEIKNQDNYNKKKGYYKCEGVNLYM 60

Query: 61  TSGXXXXXXXXXXXLLRYIKQQNFEFEDIKQSNNNKSIAYSEETDIPKKRKKINEFMAFR 120
           TSG           LLRYIKQQNFEFEDIKQSNNNKSIAYSEETDIPKKRKKINEFMAFR
Sbjct: 61  TSGPPKKIPEPPKELLRYIKQQNFEFEDIKQSNNNKSIAYSEETDIPKKRKKINEFMAFR 120

Query: 121 SYYSRFFRGIVPQLELSRILAQLWHEKPKMKRTWEMFAEHYNMEQPDQSFPEWLEKTYTS 180
           SYYSRFFRGIVPQLELSRILAQLWHEKPKMKRTWEMFAEHYNMEQPDQSFPEWLEKTYTS
Sbjct: 121 SYYSRFFRGIVPQLELSRILAQLWHEKPKMKRTWEMFAEHYNMEQPDQSFPEWLEKTYTS 180

Query: 181 SYTPKGKVKIDDDQDEKSKHPYVEDLYLXXXXXXXXXDLVHKLNTAFNPNIQKSTDEDVG 240
           SYTPKGKVKIDDDQDEKSKHPYVEDLYL         DLVHKLNTAFNPNIQKSTDEDVG
Sbjct: 181 SYTPKGKVKIDDDQDEKSKHPYVEDLYLNTGNNGGNTDLVHKLNTAFNPNIQKSTDEDVG 240

Query: 241 VPLNNXXXXXXXXXXXXXXVPSF 263
           VPLNN              VPSF
Sbjct: 241 VPLNNLLFTELDLFHLLDEVPSF 263

>Ecym_1114 Chr1 complement(236238..237029) [792 bp, 263 aa] {ON}
           similar to YCL066W HMLALPHA1
          Length = 263

 Score =  423 bits (1088), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 213/263 (80%), Positives = 213/263 (80%)

Query: 1   MSEINYKTPMFRVKIXXXXXXXXXXXXXXXXVLKILEIKNQDNYNKKKGYYKCEGVNLYM 60
           MSEINYKTPMFRVKI                VLKILEIKNQDNYNKKKGYYKCEGVNLYM
Sbjct: 1   MSEINYKTPMFRVKIKKPKTRKGSRRRKGSSVLKILEIKNQDNYNKKKGYYKCEGVNLYM 60

Query: 61  TSGXXXXXXXXXXXLLRYIKQQNFEFEDIKQSNNNKSIAYSEETDIPKKRKKINEFMAFR 120
           TSG           LLRYIKQQNFEFEDIKQSNNNKSIAYSEETDIPKKRKKINEFMAFR
Sbjct: 61  TSGPPKKIPEPPKELLRYIKQQNFEFEDIKQSNNNKSIAYSEETDIPKKRKKINEFMAFR 120

Query: 121 SYYSRFFRGIVPQLELSRILAQLWHEKPKMKRTWEMFAEHYNMEQPDQSFPEWLEKTYTS 180
           SYYSRFFRGIVPQLELSRILAQLWHEKPKMKRTWEMFAEHYNMEQPDQSFPEWLEKTYTS
Sbjct: 121 SYYSRFFRGIVPQLELSRILAQLWHEKPKMKRTWEMFAEHYNMEQPDQSFPEWLEKTYTS 180

Query: 181 SYTPKGKVKIDDDQDEKSKHPYVEDLYLXXXXXXXXXDLVHKLNTAFNPNIQKSTDEDVG 240
           SYTPKGKVKIDDDQDEKSKHPYVEDLYL         DLVHKLNTAFNPNIQKSTDEDVG
Sbjct: 181 SYTPKGKVKIDDDQDEKSKHPYVEDLYLNTGNNGGNTDLVHKLNTAFNPNIQKSTDEDVG 240

Query: 241 VPLNNXXXXXXXXXXXXXXVPSF 263
           VPLNN              VPSF
Sbjct: 241 VPLNNLLFTELDLFHLLDEVPSF 263

>KLTH0F00374g Chr6 complement(30927..31676) [750 bp, 249 aa] {ON}
           weakly similar to uniprot|P01365 Saccharomyces
           cerevisiae YCR040W MATALPHA1 Transcriptional
           co-activator involved in regulation of
           mating-type-specific gene expression targets the
           transcription factor Mcm1p to the promoters of
           alpha-specific genes one of two genes encoded by the
           alpha mating type cassette
          Length = 249

 Score = 89.7 bits (221), Expect = 9e-21,   Method: Compositional matrix adjust.
 Identities = 43/98 (43%), Positives = 60/98 (61%), Gaps = 3/98 (3%)

Query: 110 RKKINEFMAFRSYYSRFFRGIVPQLELSRILAQLWHEKPKMKRTWEMFAEHYNMEQPDQS 169
           +KKIN F+ FRSYY++F +G V Q ELS+IL++ W +  K+   WE F +HYN E     
Sbjct: 95  KKKINPFIGFRSYYAKFAKGRVRQQELSKILSEYWTKNSKIHSVWEFFTQHYNREVTSMC 154

Query: 170 FPEWLEKTYTSSYTPKGKVKIDDDQDEKSKHPYVEDLY 207
           F  WLE+ Y  SY    + ++D +   K   PY+EDLY
Sbjct: 155 FTLWLEENYQQSYE---ESELDSECMAKRSQPYIEDLY 189

>KLLA0C00352g Chr3 complement(24124..24909) [786 bp, 261 aa] {ON}
           uniprot|Q08398 Kluyveromyces lactis HMLAPLHA1 Mating-
           type protein ALPHA1
          Length = 261

 Score = 89.0 bits (219), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 54/161 (33%), Positives = 83/161 (51%), Gaps = 3/161 (1%)

Query: 50  YYKCEGVNLYMTSGXXXXXXXXXXXLLRYIKQQ--NFEFEDIKQSNNNKSIAYSEETDIP 107
           Y K EGVNLYM+             L+ YIK++       ++  S  N +   S +    
Sbjct: 41  YRKHEGVNLYMSKVTPTSIPAPPQVLVAYIKEKVKTLNKSEVLMSLGNSNQLSSRDVKTK 100

Query: 108 KKRKKINEFMAFRSYYSRFFRGIVPQLELSRILAQLWHEKPKMKRTWEMFAEHYNMEQPD 167
            K+K+IN+F+AFRSYYSR   GI+ Q ELS I+++ W    + ++ WE+ A+ YN +   
Sbjct: 101 TKKKQINDFIAFRSYYSRLLNGILTQTELSTIISKHWTVDKQTRKNWELIAQEYNCDASG 160

Query: 168 QSFPEWLEKTY-TSSYTPKGKVKIDDDQDEKSKHPYVEDLY 207
           + F  WLE  Y          V+ ++     +K PYVE++Y
Sbjct: 161 KHFFNWLEVNYGIDKQWLYEIVQYEECLTPTTKKPYVENIY 201

>Kwal_33.matalpha1 s33 complement(283160..283894) [735 bp, 244 aa]
           {OFF} (matalpha1) - mating type alpha1 protein [contig
           MAT] FULL
          Length = 244

 Score = 83.2 bits (204), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 51/163 (31%), Positives = 78/163 (47%), Gaps = 15/163 (9%)

Query: 51  YKCEGVNLYMTSGXXXXXXXXXXXLLRYIKQQNFEF------EDIKQSNNNKSIAYSEET 104
           Y  EGVNLYM+             +++ +   + +       + I +   +++   S + 
Sbjct: 33  YVSEGVNLYMSYSKQELIPKPPKAVMKILGSDHGKGLSKGLSKGIHKDQKSQTFLGSGKC 92

Query: 105 DIPKKRKKINEFMAFRSYYSRFFRGIVPQLELSRILAQLWHEKPKMKRTWEMFAEHYNME 164
                +KKIN F+ FRSYY+R  +G + Q ELS IL+Q W    ++ +TWE F EHYN +
Sbjct: 93  T---SKKKINPFIGFRSYYARIVKGRIRQQELSTILSQYWLSHHQVHKTWEFFTEHYNRD 149

Query: 165 QPDQSFPEWLEKTYTSSYTPKGKVKIDDDQDEKSKHPYVEDLY 207
                F EWLEK Y         V+I          P++ED+Y
Sbjct: 150 NTVMCFTEWLEKNYKPEIEGTAAVEISYGL------PFIEDIY 186

>Kwal_33.12992 s33 complement(31018..31752) [735 bp, 244 aa] {OFF}
           YCR040W (MATALPHA1) - transcription factor involved in
           the regulation of alpha-specific genes [contig 123] FULL
          Length = 244

 Score = 83.2 bits (204), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 51/163 (31%), Positives = 78/163 (47%), Gaps = 15/163 (9%)

Query: 51  YKCEGVNLYMTSGXXXXXXXXXXXLLRYIKQQNFEF------EDIKQSNNNKSIAYSEET 104
           Y  EGVNLYM+             +++ +   + +       + I +   +++   S + 
Sbjct: 33  YVSEGVNLYMSYSKQELIPKPPKAVMKILGSDHGKGLSKGLSKGIHKDQKSQTFLGSGKC 92

Query: 105 DIPKKRKKINEFMAFRSYYSRFFRGIVPQLELSRILAQLWHEKPKMKRTWEMFAEHYNME 164
                +KKIN F+ FRSYY+R  +G + Q ELS IL+Q W    ++ +TWE F EHYN +
Sbjct: 93  T---SKKKINPFIGFRSYYARIVKGRIRQQELSTILSQYWLSHHQVHKTWEFFTEHYNRD 149

Query: 165 QPDQSFPEWLEKTYTSSYTPKGKVKIDDDQDEKSKHPYVEDLY 207
                F EWLEK Y         V+I          P++ED+Y
Sbjct: 150 NTVMCFTEWLEKNYKPEIEGTAAVEISYGL------PFIEDIY 186

>Kwal_YGOB_matalpha1 s33 complement(283160..283894) [735 bp, 244 aa]
           {ON} (matalpha1) - mating type alpha1 protein [contig
           MAT] FULL
          Length = 244

 Score = 83.2 bits (204), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 51/163 (31%), Positives = 78/163 (47%), Gaps = 15/163 (9%)

Query: 51  YKCEGVNLYMTSGXXXXXXXXXXXLLRYIKQQNFEF------EDIKQSNNNKSIAYSEET 104
           Y  EGVNLYM+             +++ +   + +       + I +   +++   S + 
Sbjct: 33  YVSEGVNLYMSYSKQELIPKPPKAVMKILGSDHGKGLSKGLSKGIHKDQKSQTFLGSGKC 92

Query: 105 DIPKKRKKINEFMAFRSYYSRFFRGIVPQLELSRILAQLWHEKPKMKRTWEMFAEHYNME 164
                +KKIN F+ FRSYY+R  +G + Q ELS IL+Q W    ++ +TWE F EHYN +
Sbjct: 93  T---SKKKINPFIGFRSYYARIVKGRIRQQELSTILSQYWLSHHQVHKTWEFFTEHYNRD 149

Query: 165 QPDQSFPEWLEKTYTSSYTPKGKVKIDDDQDEKSKHPYVEDLY 207
                F EWLEK Y         V+I          P++ED+Y
Sbjct: 150 NTVMCFTEWLEKNYKPEIEGTAAVEISYGL------PFIEDIY 186

>Kwal_YGOB_HMalpha1 s33 complement(31018..31752) [735 bp, 244 aa]
           {ON} ANNOTATED BY YGOB - This is Kwal_33.12992
          Length = 244

 Score = 83.2 bits (204), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 51/163 (31%), Positives = 78/163 (47%), Gaps = 15/163 (9%)

Query: 51  YKCEGVNLYMTSGXXXXXXXXXXXLLRYIKQQNFEF------EDIKQSNNNKSIAYSEET 104
           Y  EGVNLYM+             +++ +   + +       + I +   +++   S + 
Sbjct: 33  YVSEGVNLYMSYSKQELIPKPPKAVMKILGSDHGKGLSKGLSKGIHKDQKSQTFLGSGKC 92

Query: 105 DIPKKRKKINEFMAFRSYYSRFFRGIVPQLELSRILAQLWHEKPKMKRTWEMFAEHYNME 164
                +KKIN F+ FRSYY+R  +G + Q ELS IL+Q W    ++ +TWE F EHYN +
Sbjct: 93  T---SKKKINPFIGFRSYYARIVKGRIRQQELSTILSQYWLSHHQVHKTWEFFTEHYNRD 149

Query: 165 QPDQSFPEWLEKTYTSSYTPKGKVKIDDDQDEKSKHPYVEDLY 207
                F EWLEK Y         V+I          P++ED+Y
Sbjct: 150 NTVMCFTEWLEKNYKPEIEGTAAVEISYGL------PFIEDIY 186

>Suva_3.148 Chr3 (222811..223338) [528 bp, 175 aa] {ON} YCL066W
           (REAL)
          Length = 175

 Score = 65.9 bits (159), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 35/91 (38%), Positives = 45/91 (49%), Gaps = 1/91 (1%)

Query: 89  IKQSNNNKSIAYSEETDIPKKRKKINEFMAFRSYYSRFFRGIVPQLELSRILAQLWHEKP 148
           I   N N     S +  I   +K +N FMAFR+YYS+F  G V Q  LS +L++ WH   
Sbjct: 69  IASGNQNIQCRQSRKASITPSKKYLNSFMAFRAYYSQFGAG-VKQNILSSLLSEEWHADK 127

Query: 149 KMKRTWEMFAEHYNMEQPDQSFPEWLEKTYT 179
                W+ FA+ YN   P   F EWL   Y 
Sbjct: 128 MQHGIWDYFAQQYNFINPGFGFVEWLTNNYA 158

>YCR040W Chr3 (200442..200969) [528 bp, 175 aa] {ON}
           MATALPHA1Transcriptional co-activator involved in
           regulation of mating-type-specific gene expression;
           targets the transcription factor Mcm1p to the promoters
           of alpha-specific genes; one of two genes encoded by the
           MATalpha mating type cassette
          Length = 175

 Score = 65.9 bits (159), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 35/95 (36%), Positives = 46/95 (48%), Gaps = 1/95 (1%)

Query: 85  EFEDIKQSNNNKSIAYSEETDIPKKRKKINEFMAFRSYYSRFFRGIVPQLELSRILAQLW 144
           +   I   + N       +T I   +K +N FMAFR+YYS+F  G V Q  LS +LA+ W
Sbjct: 65  QIHRIASGSQNTQFRQFNKTSIKSSKKYLNSFMAFRAYYSQFGSG-VKQNVLSSLLAEEW 123

Query: 145 HEKPKMKRTWEMFAEHYNMEQPDQSFPEWLEKTYT 179
           H        W+ FA+ YN   P   F EWL   Y 
Sbjct: 124 HADKMQHGIWDYFAQQYNFINPGFGFVEWLTNNYA 158

>YCL066W Chr3 (13282..13809) [528 bp, 175 aa] {ON}
           HMLALPHA1Silenced copy of ALPHA1 at HML, encoding a
           transcriptional coactivator involved in the regulation
           of mating-type alpha-specific gene expression
          Length = 175

 Score = 65.9 bits (159), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 35/95 (36%), Positives = 46/95 (48%), Gaps = 1/95 (1%)

Query: 85  EFEDIKQSNNNKSIAYSEETDIPKKRKKINEFMAFRSYYSRFFRGIVPQLELSRILAQLW 144
           +   I   + N       +T I   +K +N FMAFR+YYS+F  G V Q  LS +LA+ W
Sbjct: 65  QIHRIASGSQNTQFRQFNKTSIKSSKKYLNSFMAFRAYYSQFGSG-VKQNVLSSLLAEEW 123

Query: 145 HEKPKMKRTWEMFAEHYNMEQPDQSFPEWLEKTYT 179
           H        W+ FA+ YN   P   F EWL   Y 
Sbjct: 124 HADKMQHGIWDYFAQQYNFINPGFGFVEWLTNNYA 158

>ZYRO0F18590g Chr6 (1533781..1534383) [603 bp, 200 aa] {ON} similar
           to uniprot|P01365 Saccharomyces cerevisiae YCR040W
           MATALPHA1 Transcriptional co-activator involved in
           regulation of mating-type-specific gene expression
           targets the transcription factor Mcm1p to the promoters
           of alpha- specific genes one of two genes encoded by the
           alpha mating type cassette
          Length = 200

 Score = 63.9 bits (154), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 27/68 (39%), Positives = 43/68 (63%), Gaps = 1/68 (1%)

Query: 111 KKINEFMAFRSYYSRFFRGIVPQLELSRILAQLWHEKPKMKRTWEMFAEHYNMEQPDQSF 170
           K +N FMAFR+Y S+F  G+   + LS +LA  WH  P+ ++ W+ FA+ +N  +P   F
Sbjct: 128 KPLNSFMAFRAYNSQFGNGLKQNI-LSSLLAAAWHSHPEQQKIWDTFAQQFNFVKPKCGF 186

Query: 171 PEWLEKTY 178
            EW+++ Y
Sbjct: 187 VEWVDQRY 194

>ZYRO0F15840g Chr6 (1303842..1304444) [603 bp, 200 aa] {ON} similar
           to uniprot|P01365 Saccharomyces cerevisiae YCR040W
           MATALPHA1 Transcriptional co-activator involved in
           regulation of mating-type-specific gene expression
           targets the transcription factor Mcm1p to the promoters
           of alpha- specific genes one of two genes encoded by the
           alpha mating type cassette
          Length = 200

 Score = 63.9 bits (154), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 27/68 (39%), Positives = 43/68 (63%), Gaps = 1/68 (1%)

Query: 111 KKINEFMAFRSYYSRFFRGIVPQLELSRILAQLWHEKPKMKRTWEMFAEHYNMEQPDQSF 170
           K +N FMAFR+Y S+F  G+   + LS +LA  WH  P+ ++ W+ FA+ +N  +P   F
Sbjct: 128 KPLNSFMAFRAYNSQFGNGLKQNI-LSSLLAAAWHSHPEQQKIWDTFAQQFNFVKPKCGF 186

Query: 171 PEWLEKTY 178
            EW+++ Y
Sbjct: 187 VEWVDQRY 194

>Smik_92.1 Chr92 complement(3..470) [468 bp, 156 aa] {ON} YCR040W
           (REAL)
          Length = 156

 Score = 62.4 bits (150), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 35/98 (35%), Positives = 50/98 (51%), Gaps = 3/98 (3%)

Query: 77  RYIKQQNFEFEDIKQSNNNKSIAYSEETDIPKKRKKINEFMAFRSYYSRFFRGIVPQLEL 136
           R++K+   +   I   N +       +T I   +K +N FMAFR+YYS+F  G V Q  L
Sbjct: 59  RFLKK--IQIHRIASGNQHIQCRQLNKTSIKSTKKYLNSFMAFRAYYSQFGSG-VKQNIL 115

Query: 137 SRILAQLWHEKPKMKRTWEMFAEHYNMEQPDQSFPEWL 174
           S +L++ WH        W+ FA+ YN   P   F EWL
Sbjct: 116 SSLLSEEWHADKTQHGIWDYFAQQYNFINPGFGFVEWL 153

>TBLA0A07040 Chr1 complement(1727988..1728593) [606 bp, 201 aa] {ON}
            MATalpha1 gene at MAT locus
          Length = 201

 Score = 62.8 bits (151), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 27/66 (40%), Positives = 40/66 (60%), Gaps = 1/66 (1%)

Query: 113 INEFMAFRSYYSRFFRGIVPQLELSRILAQLWHEKPKMKRTWEMFAEHYNMEQPDQSFPE 172
           +N F+AFR+Y S+F  G+   + LS +L+  WHE P  +  W  F++ YN  +P   F E
Sbjct: 129 LNGFIAFRAYNSQFGYGLKQNI-LSSLLSTAWHENPNQQNVWNFFSQEYNFVKPKCGFVE 187

Query: 173 WLEKTY 178
           WL +TY
Sbjct: 188 WLGQTY 193

>TBLA0A07590 Chr1 complement(1881757..1882362) [606 bp, 201 aa] {ON}
           Anc_1.1 YCL066W silenced copy of alpha1 gene at HML
           locus
          Length = 201

 Score = 62.8 bits (151), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 27/66 (40%), Positives = 40/66 (60%), Gaps = 1/66 (1%)

Query: 113 INEFMAFRSYYSRFFRGIVPQLELSRILAQLWHEKPKMKRTWEMFAEHYNMEQPDQSFPE 172
           +N F+AFR+Y S+F  G+   + LS +L+  WHE P  +  W  F++ YN  +P   F E
Sbjct: 129 LNGFIAFRAYNSQFGYGLKQNI-LSSLLSTAWHENPNQQNVWNFFSQEYNFVKPKCGFVE 187

Query: 173 WLEKTY 178
           WL +TY
Sbjct: 188 WLGQTY 193

>Kpol_2002.2 s2002 complement(3611..4240) [630 bp, 209 aa] {ON}
           complement(3611..4240) [630 nt, 210 aa]
          Length = 209

 Score = 62.8 bits (151), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 25/69 (36%), Positives = 45/69 (65%), Gaps = 1/69 (1%)

Query: 110 RKKINEFMAFRSYYSRFFRGIVPQLELSRILAQLWHEKPKMKRTWEMFAEHYNMEQPDQS 169
           +K +N FMAFR+Y S+F  G+  ++ LS +L++ WH  P+ ++ W + ++ +N  +P   
Sbjct: 134 KKSLNGFMAFRAYNSQFGYGLKQEI-LSSLLSEAWHSDPEQQKKWTVLSQQFNFVKPKCG 192

Query: 170 FPEWLEKTY 178
           F EW+ +TY
Sbjct: 193 FVEWVGQTY 201

>TDEL0C07010 Chr3 (1274648..1275265) [618 bp, 205 aa] {ON} Anc_1.121
           YCR040W silenced copy of alpha1 gene at T. delbrueckii
           HML locus
          Length = 205

 Score = 61.2 bits (147), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 27/68 (39%), Positives = 42/68 (61%), Gaps = 1/68 (1%)

Query: 111 KKINEFMAFRSYYSRFFRGIVPQLELSRILAQLWHEKPKMKRTWEMFAEHYNMEQPDQSF 170
           K +N FMAFR+Y S+F  G+   + LS +LA  WH  P+ +  W+ FA+ +N  +P   F
Sbjct: 135 KPLNSFMAFRAYNSQFGYGLKQNI-LSSLLASAWHSHPEQQGIWDTFAQQFNFVKPKCGF 193

Query: 171 PEWLEKTY 178
            EW+++ Y
Sbjct: 194 VEWVDQRY 201

>Skud_3.119 Chr3 (184941..185465) [525 bp, 174 aa] {ON} YCR040W
           (REAL)
          Length = 174

 Score = 60.5 bits (145), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 30/67 (44%), Positives = 37/67 (55%), Gaps = 1/67 (1%)

Query: 113 INEFMAFRSYYSRFFRGIVPQLELSRILAQLWHEKPKMKRTWEMFAEHYNMEQPDQSFPE 172
           IN FMAFR+YYS+F  G V Q  LS +L++ WH        W+ FA+ YN   P   F E
Sbjct: 92  INSFMAFRAYYSQFGSG-VKQNILSSLLSEEWHADKMQHGIWDYFAQQYNFINPGFGFVE 150

Query: 173 WLEKTYT 179
           WL   Y 
Sbjct: 151 WLTNNYA 157

>Skud_71.1 Chr71 complement(3..467) [465 bp, 155 aa] {ON} YCR040W
           (REAL)
          Length = 155

 Score = 58.5 bits (140), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 29/62 (46%), Positives = 36/62 (58%), Gaps = 1/62 (1%)

Query: 113 INEFMAFRSYYSRFFRGIVPQLELSRILAQLWHEKPKMKRTWEMFAEHYNMEQPDQSFPE 172
           IN FMAFR+YYS+F  G V Q  LS +L++ WH        W+ FA+ YN   P   F E
Sbjct: 92  INSFMAFRAYYSQFGSG-VKQNILSSLLSEEWHADKMQHGIWDYFAQQYNFINPGFGFVE 150

Query: 173 WL 174
           WL
Sbjct: 151 WL 152

>TPHA0E03620 Chr5 (766068..766655) [588 bp, 195 aa] {ON} Anc_1.121
           YCR040W MATalpha1 gene at MAT locus
          Length = 195

 Score = 56.6 bits (135), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 31/86 (36%), Positives = 50/86 (58%), Gaps = 2/86 (2%)

Query: 98  IAYSEETDIPKKRKKINEFMAFRSYYSRFFRGIVPQLELSRILAQLWHEKPKMKRTWEMF 157
           I YS E ++  K K +N F+AFR+Y ++F  G+  Q  LS +L+  WH  P+    W++F
Sbjct: 110 INYSSEEELLFK-KSLNSFIAFRAYNAQFGNGL-NQHLLSHLLSLAWHSAPEQHHVWDVF 167

Query: 158 AEHYNMEQPDQSFPEWLEKTYTSSYT 183
           A+ +N  +P   F EW+ +TY   + 
Sbjct: 168 AQQFNFVKPKCGFVEWVGQTYEREWC 193

>TPHA0E04080 Chr5 (850045..850632) [588 bp, 195 aa] {ON}   silenced
           copy of alpha1 at HMLalpha locus
          Length = 195

 Score = 56.6 bits (135), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 31/86 (36%), Positives = 50/86 (58%), Gaps = 2/86 (2%)

Query: 98  IAYSEETDIPKKRKKINEFMAFRSYYSRFFRGIVPQLELSRILAQLWHEKPKMKRTWEMF 157
           I YS E ++  K K +N F+AFR+Y ++F  G+  Q  LS +L+  WH  P+    W++F
Sbjct: 110 INYSSEEELLFK-KSLNSFIAFRAYNAQFGNGL-NQHLLSHLLSLAWHSAPEQHHVWDVF 167

Query: 158 AEHYNMEQPDQSFPEWLEKTYTSSYT 183
           A+ +N  +P   F EW+ +TY   + 
Sbjct: 168 AQQFNFVKPKCGFVEWVGQTYEREWC 193

>Suva_69.2 Chr69 (369..803) [435 bp, 145 aa] {ON} YCL066W (REAL)
          Length = 145

 Score = 55.1 bits (131), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 30/78 (38%), Positives = 40/78 (51%), Gaps = 1/78 (1%)

Query: 89  IKQSNNNKSIAYSEETDIPKKRKKINEFMAFRSYYSRFFRGIVPQLELSRILAQLWHEKP 148
           I   N N     S +  I   +K +N FMAFR+YYS+F  G V Q  LS +L++ WH   
Sbjct: 69  IASGNQNIQCRQSRKASITPSKKYLNSFMAFRAYYSQFGAG-VKQNILSSLLSEEWHADK 127

Query: 149 KMKRTWEMFAEHYNMEQP 166
                W+ FA+ YN   P
Sbjct: 128 MQHGIWDYFAQQYNFINP 145

>KAFR0D00710 Chr4 complement(127819..128337) [519 bp, 172 aa] {ON}
           mating type gene MATalpha1
          Length = 172

 Score = 49.7 bits (117), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 26/61 (42%), Positives = 38/61 (62%), Gaps = 2/61 (3%)

Query: 94  NNKSIAYSEETDIPKKRKKINEFMAFRSYYSRFFRGIVPQLELSRILAQLWHEKPKMKRT 153
           N+  IA     +I + R  +N FMAFRSYYS++ +G+  Q+ELS +LA+ WH   K +  
Sbjct: 103 NDIPIALKNPIEICQNRN-LNPFMAFRSYYSQYAQGL-KQIELSEVLAKAWHSDTKEQNY 160

Query: 154 W 154
           W
Sbjct: 161 W 161

>CAGL0B01243g Chr2 complement(112831..113262) [432 bp, 143 aa] {ON}
           some similarities with uniprot|P01365 Saccharomyces
           cerevisiae YCR040w MATALPHA1 expressed copy at MAT locus
           or uniprot|P01365 Saccharomyces cerevisiae YCL066w
           HMLALPHA1 silenced copy at HML
          Length = 143

 Score = 47.0 bits (110), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 27/101 (26%), Positives = 53/101 (52%), Gaps = 1/101 (0%)

Query: 81  QQNFEFEDIKQSNNNKSIAYSEETDIPKKRKKINEFMAFRSYYSRFFRGIVPQLELSRIL 140
           + ++E +     + N SI    ++    K++ +N FMAFR+YY++   G+  Q  LS IL
Sbjct: 43  ETSWEIDKFISHHFNTSIGNVLKSKSSSKKRPMNAFMAFRTYYAQLGTGL-KQNTLSVIL 101

Query: 141 AQLWHEKPKMKRTWEMFAEHYNMEQPDQSFPEWLEKTYTSS 181
           ++ W+     +  W++FA+ +N   P   F  ++    +S+
Sbjct: 102 SEAWNAPETDQNIWDIFAQQFNFASPRCGFVNYIMAHASSA 142

>CAGL0B00242g Chr2 complement(10582..11136) [555 bp, 184 aa] {ON}
           some similarities with uniprot|P01365 Saccharomyces
           cerevisiae YCR040w MATALPHA1 mating type regulatory
           protein or uniprot|P01365 Saccharomyces cerevisiae
           YCL066w HMLALPHA1
          Length = 184

 Score = 47.0 bits (110), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 22/71 (30%), Positives = 40/71 (56%), Gaps = 1/71 (1%)

Query: 111 KKINEFMAFRSYYSRFFRGIVPQLELSRILAQLWHEKPKMKRTWEMFAEHYNMEQPDQSF 170
           + +N FMAFR+YY++   G+  Q  LS IL++ W+     +  W++FA+ +N   P   F
Sbjct: 114 RPMNAFMAFRTYYAQLGTGL-KQNTLSVILSEAWNAPETDQNIWDIFAQQFNFASPRCGF 172

Query: 171 PEWLEKTYTSS 181
             ++    +S+
Sbjct: 173 VNYIMAHASSA 183

>KNAG0C00150 Chr3 complement(24902..25339) [438 bp, 145 aa] {ON}
           Anc_1.1 YCL066W silent copy of mating type alpha1 gene
           at HML locus
          Length = 145

 Score = 43.9 bits (102), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 21/53 (39%), Positives = 30/53 (56%), Gaps = 1/53 (1%)

Query: 109 KRKKINEFMAFRSYYSRFFRGIVPQLELSRILAQLWHEKPKMKRTWEMFAEHY 161
           K   +N F+AFR+YYS+F  GI  Q +LS IL++ W      +  W+   E Y
Sbjct: 88  KHGSLNSFIAFRAYYSQFANGI-NQNKLSSILSKFWKSNQSQQTFWDRLTEQY 139

>NCAS0B09150 Chr2 (1755595..1756047) [453 bp, 150 aa] {ON} Anc_1.1
          Length = 150

 Score = 43.9 bits (102), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 23/52 (44%), Positives = 31/52 (59%), Gaps = 1/52 (1%)

Query: 111 KKINEFMAFRSYYSRFFRGIVPQLELSRILAQLWHEKPKMKRTWEMFAEHYN 162
           K IN F+ FRSYYSR+  GI  Q  LS++LA+ W      +  W+ FA  Y+
Sbjct: 90  KPINGFILFRSYYSRWGYGIK-QTMLSQLLAKFWKSSDTDQALWDYFALQYS 140

>NDAI0A00100 Chr1 complement(783..1190) [408 bp, 135 aa] {ON}
           Anc_1.1  silent copy of MATalpha1 gene at HMLalpha
           possible pseudogene; contains 2 copies of a 20 bp direct
           repeat, causing a frameshft; synthetic translation made
           by ignoring one copy.
          Length = 135

 Score = 32.0 bits (71), Expect = 0.71,   Method: Compositional matrix adjust.
 Identities = 22/52 (42%), Positives = 33/52 (63%), Gaps = 1/52 (1%)

Query: 111 KKINEFMAFRSYYSRFFRGIVPQLELSRILAQLWHEKPKMKRTWEMFAEHYN 162
           K IN FM FRSYYS++ +G+  Q  LS +L++LW+     +  W+ FA+  N
Sbjct: 61  KSINGFMLFRSYYSQYGKGLK-QSLLSPLLSKLWNAHETDQLLWDQFAQQCN 111

>KNAG0H00720 Chr8 (114623..116173) [1551 bp, 516 aa] {ON} Anc_3.354
           YPR065W
          Length = 516

 Score = 31.6 bits (70), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 22/77 (28%), Positives = 38/77 (49%), Gaps = 13/77 (16%)

Query: 106 IPKKRKKINEFMAFRSYYSRFF------RGI-VPQ-LELSRILAQLWHE-KPKMKRTWEM 156
           IP+ R   N F+ FR +Y R         G+ +P   ++S+IL   W E  P+ K  W+ 
Sbjct: 55  IPRPR---NAFILFRQHYHRILIDDWTKHGVDIPHNTQISKILGTKWKELGPEEKHQWDE 111

Query: 157 FAEHYNMEQPDQSFPEW 173
            A    +E  ++ +P++
Sbjct: 112 LARQEKLEH-ERKYPQY 127

>YPR065W Chr16 (679693..680799) [1107 bp, 368 aa] {ON}
           ROX1Heme-dependent repressor of hypoxic genes; contains
           an HMG domain that is responsible for DNA bending
           activity
          Length = 368

 Score = 30.8 bits (68), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 22/80 (27%), Positives = 40/80 (50%), Gaps = 10/80 (12%)

Query: 103 ETDIPKKRKKINEFMAFRSYYSRFF------RGI-VPQ-LELSRILAQLWHE-KPKMKRT 153
           ++  PK  +  N F+ FR +Y R        +G+ +P    +S+I+   W   +P+ K  
Sbjct: 4   KSSTPKIPRPKNAFILFRQHYHRILIDEWTAQGVEIPHNSNISKIIGTKWKGLQPEDKAH 63

Query: 154 WEMFAEHYNMEQPDQSFPEW 173
           WE  AE   +E  ++ +PE+
Sbjct: 64  WENLAEKEKLEH-ERKYPEY 82

>Suva_16.393 Chr16 (686503..686838,686887..687669) [1119 bp, 372 aa]
           {ON} YPR065W (REAL)
          Length = 372

 Score = 29.6 bits (65), Expect = 7.8,   Method: Compositional matrix adjust.
 Identities = 21/80 (26%), Positives = 40/80 (50%), Gaps = 10/80 (12%)

Query: 103 ETDIPKKRKKINEFMAFRSYYSRFF------RGI-VPQ-LELSRILAQLWHE-KPKMKRT 153
           ++  PK  +  N F+ FR +Y R        +G+ +P    +S+I+   W   +P+ K  
Sbjct: 4   KSSTPKIPRPKNAFILFRQHYHRVLIDEWTTQGVEIPHNSNISKIIGTKWKGLQPEEKSH 63

Query: 154 WEMFAEHYNMEQPDQSFPEW 173
           WE  A+   +E  ++ +PE+
Sbjct: 64  WESLAKKEKLEH-ERKYPEY 82

>CAGL0M06149g Chr13 complement(640964..642556) [1593 bp, 530 aa]
           {ON} weakly similar to uniprot|P32909 Saccharomyces
           cerevisiae YBR172c SMY2 kinesin-related protein and
           weakly similar to uniprot|Q02875 Saccharomyces
           cerevisiae YPL105c
          Length = 530

 Score = 29.6 bits (65), Expect = 8.8,   Method: Compositional matrix adjust.
 Identities = 22/93 (23%), Positives = 43/93 (46%), Gaps = 14/93 (15%)

Query: 82  QNFEFEDIKQSNNNKSIAYSEETDIPKKRKKINEFMAFRS---YYSRFF--RGIVPQL-- 134
           QN   +D + S NN + A +  +D+   +  +N  M F++    ++R+    GI+P    
Sbjct: 23  QNLHVQDREGSKNNLTYAKNAASDVDGSQPLLNTDMIFKANNKNHTRYIDNTGILPDFSA 82

Query: 135 -------ELSRILAQLWHEKPKMKRTWEMFAEH 160
                  +L   L+  ++  P ++ T +MF  H
Sbjct: 83  HSSGNLNDLHAELSSPFYNIPTIQNTTDMFDSH 115

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.316    0.133    0.392 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 26,541,483
Number of extensions: 1093737
Number of successful extensions: 3775
Number of sequences better than 10.0: 43
Number of HSP's gapped: 3824
Number of HSP's successfully gapped: 43
Length of query: 263
Length of database: 53,481,399
Length adjustment: 107
Effective length of query: 156
Effective length of database: 41,212,137
Effective search space: 6429093372
Effective search space used: 6429093372
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 64 (29.3 bits)