Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Ecym_11151.121ON23023011251e-158
Ecym_10021.2ON23023011251e-158
ZYRO0F15818g1.121ON2252343051e-33
ZYRO0F18568g1.2ON2252343051e-33
TPHA0E040701.2ON2312443033e-33
TPHA0E036101.121ON2312443033e-33
Kpol_2002.31.2ON2232392937e-32
Suva_3.135singletonON119972719e-30
Suva_3.74singletonON119972719e-30
Suva_3.751.121ON119972719e-30
YCR096C (HMRA2)singletonOFF119972719e-30
Skud_102.1singletonON185932715e-29
Smik_95.1singletonON185932715e-29
Smik_3.1421.121ON228932746e-29
Suva_3.1471.2ON210932726e-29
YCR039C (MATALPHA2)1.121ON210932726e-29
YCL067C (HMLALPHA2)1.2ON210932726e-29
Skud_3.1181.121ON210932727e-29
KAFR0D007201.121ON206902501e-25
CAGL0B01265g1.121ON186942272e-22
NDAI0A001101.2ON211902273e-22
NCAS0B091401.2ON2051522264e-22
KNAG0C001601.2ON2031592203e-21
CAGL0B00264g1.2ON210862179e-21
KLLA0C00374g1.2ON223872048e-19
TDEL0C070001.2ON2371951952e-17
TBLA0A070501.121ON261741841e-15
TBLA0A076001.2ON230621691e-13
YPL177C (CUP9)6.170ON306891366e-09
AFL049C6.170ON257911214e-07
Smik_6.3746.170ON294691171e-06
KLTH0F00396g1.2ON108571111e-06
Skud_16.1036.170ON295691172e-06
KAFR0G036506.170ON177921142e-06
TDEL0F018106.170ON256611152e-06
YGL096W (TOS8)6.170ON2761631152e-06
NCAS0H011306.170ON280631153e-06
Kpol_1036.566.170ON265511153e-06
Kwal_YGOB_matalpha21.121ON110491084e-06
Kwal_33.12995singletonOFF110491084e-06
Kwal_YGOB_HMalpha21.2ON110491084e-06
Kwal_33.matalpha2singletonOFF110491084e-06
Ecym_22476.170ON349891135e-06
Suva_16.1326.170ON292621136e-06
NDAI0F021706.170ON383671136e-06
KLTH0H05236g6.170ON234511116e-06
ZYRO0G22044g6.170ON201601107e-06
SAKL0A05610g6.170ON320721128e-06
KNAG0F022106.170ON324581119e-06
NDAI0I013206.170ON409851101e-05
CAGL0C01551g6.170ON221571072e-05
Smik_7.1816.170ON2741011082e-05
Skud_7.1816.170ON274591063e-05
KAFR0A043706.170ON409551074e-05
KNAG0M005006.170ON298811055e-05
Suva_7.1726.170ON270591039e-05
NCAS0D035706.170ON257511021e-04
TPHA0B025806.170ON264551002e-04
TBLA0C037406.170ON293551003e-04
Kwal_27.110926.170ON22959966e-04
CAGL0H02959g6.170ON25961940.001
KLLA0B10450g6.170ON38951950.001
CAGL0E00341gna 1ON13093720.35
KAFR0K024002.362ON77056750.43
CAGL0C00517g3.399ON84837730.77
KAFR0A040708.716ON64584720.92
ZYRO0F12298g8.777ON1362103692.3
Suva_6.528.68ON126454683.5
Kwal_14.9212.653ON139664674.2
SAKL0B02288g8.68ON122857665.5
TDEL0G00190na 2ON11259635.7
TDEL0C058201.122ON11259635.7
TDEL0E00330singletonON11259635.7
TBLA0G01060na 1ON17489637.0
TBLA0E014204.15ON187867658.0
NDAI0A006701.122ON9534618.3
NDAI0H00100na 1ON9534618.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Ecym_1002
         (230 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Ecym_1115 Chr1 (237261..237485,237542..238009) [693 bp, 230 aa] ...   437   e-158
Ecym_1002 Chr1 complement(5334..5801,5858..6082) [693 bp, 230 aa...   437   e-158
ZYRO0F15818g Chr6 complement(1302816..1303493) [678 bp, 225 aa] ...   122   1e-33
ZYRO0F18568g Chr6 complement(1532755..1533432) [678 bp, 225 aa] ...   122   1e-33
TPHA0E04070 Chr5 complement(848980..849613,849670..849731) [696 ...   121   3e-33
TPHA0E03610 Chr5 complement(765003..765636,765693..765754) [696 ...   121   3e-33
Kpol_2002.3 s2002 (4682..5353) [672 bp, 223 aa] {ON} (4682..5353...   117   7e-32
Suva_3.135 Chr3 complement(211196..211555) [360 bp, 119 aa] {ON}...   108   9e-30
Suva_3.74 Chr3 complement(112965..113324) [360 bp, 119 aa] {ON} ...   108   9e-30
Suva_3.75 Chr3 complement(112965..113324) [360 bp, 119 aa] {ON} ...   108   9e-30
YCR096C Chr3 complement(293179..293538) [360 bp, 119 aa] {OFF}  ...   108   9e-30
Skud_102.1 Chr102 (1..558) [558 bp, 185 aa] {ON} YCR039C (REAL)       108   5e-29
Smik_95.1 Chr95 (1..558) [558 bp, 185 aa] {ON} YCR039C (REAL)         108   5e-29
Smik_3.142 Chr3 complement(197575..198261) [687 bp, 228 aa] {ON}...   110   6e-29
Suva_3.147 Chr3 complement(221912..222544) [633 bp, 210 aa] {ON}...   109   6e-29
YCR039C Chr3 complement(199546..200178) [633 bp, 210 aa] {ON}  M...   109   6e-29
YCL067C Chr3 complement(12386..13018) [633 bp, 210 aa] {ON}  HML...   109   6e-29
Skud_3.118 Chr3 complement(184042..184674) [633 bp, 210 aa] {ON}...   109   7e-29
KAFR0D00720 Chr4 (128684..129304) [621 bp, 206 aa] {ON}  mating ...   100   1e-25
CAGL0B01265g Chr2 (113719..114279) [561 bp, 186 aa] {ON} similar...    92   2e-22
NDAI0A00110 Chr1 (1584..2219) [636 bp, 211 aa] {ON} Anc_1.2  sil...    92   3e-22
NCAS0B09140 Chr2 complement(1754708..1755325) [618 bp, 205 aa] {...    92   4e-22
KNAG0C00160 Chr3 (25548..26159) [612 bp, 203 aa] {ON} Anc_1.2 YC...    89   3e-21
CAGL0B00264g Chr2 (11470..12102) [633 bp, 210 aa] {ON} highly si...    88   9e-21
KLLA0C00374g Chr3 (25132..25803) [672 bp, 223 aa] {ON} uniprot|Q...    83   8e-19
TDEL0C07000 Chr3 complement(1273613..1274326) [714 bp, 237 aa] {...    80   2e-17
TBLA0A07050 Chr1 (1728941..1729002,1729096..1729189,1729249..172...    75   1e-15
TBLA0A07600 Chr1 (1882710..1882771,1882865..1882958,1883018..188...    70   1e-13
YPL177C Chr16 complement(213042..213962) [921 bp, 306 aa] {ON}  ...    57   6e-09
AFL049C Chr6 complement(346546..347319) [774 bp, 257 aa] {ON} Sy...    51   4e-07
Smik_6.374 Chr6 (610093..610977) [885 bp, 294 aa] {ON} YPL177C (...    50   1e-06
KLTH0F00396g Chr6 (31990..32051,32348..32612) [327 bp, 108 aa] {...    47   1e-06
Skud_16.103 Chr16 complement(185398..186285) [888 bp, 295 aa] {O...    50   2e-06
KAFR0G03650 Chr7 (752766..753299) [534 bp, 177 aa] {ON} Anc_6.17...    49   2e-06
TDEL0F01810 Chr6 complement(338066..338836) [771 bp, 256 aa] {ON...    49   2e-06
YGL096W Chr7 (325331..326161) [831 bp, 276 aa] {ON}  TOS8Homeodo...    49   2e-06
NCAS0H01130 Chr8 complement(216012..216854) [843 bp, 280 aa] {ON...    49   3e-06
Kpol_1036.56 s1036 (153997..154794) [798 bp, 265 aa] {ON} (15399...    49   3e-06
Kwal_YGOB_matalpha2 s33 (284511..284843) [333 bp, 110 aa] {ON} (...    46   4e-06
Kwal_33.12995 s33 (32369..32701) [333 bp, 110 aa] {OFF} YCR096C ...    46   4e-06
Kwal_YGOB_HMalpha2 s33 (32369..32701) [333 bp, 110 aa] {ON} ANNO...    46   4e-06
Kwal_33.matalpha2 s33 (284511..284843) [333 bp, 110 aa] {OFF} (m...    46   4e-06
Ecym_2247 Chr2 complement(486469..487518) [1050 bp, 349 aa] {ON}...    48   5e-06
Suva_16.132 Chr16 complement(222346..223224) [879 bp, 292 aa] {O...    48   6e-06
NDAI0F02170 Chr6 (527340..528491) [1152 bp, 383 aa] {ON} Anc_6.1...    48   6e-06
KLTH0H05236g Chr8 complement(465998..466702) [705 bp, 234 aa] {O...    47   6e-06
ZYRO0G22044g Chr7 (1814345..1814950) [606 bp, 201 aa] {ON} some ...    47   7e-06
SAKL0A05610g Chr1 complement(506437..507399) [963 bp, 320 aa] {O...    48   8e-06
KNAG0F02210 Chr6 complement(423243..424217) [975 bp, 324 aa] {ON...    47   9e-06
NDAI0I01320 Chr9 complement(318160..319389) [1230 bp, 409 aa] {O...    47   1e-05
CAGL0C01551g Chr3 complement(169232..169897) [666 bp, 221 aa] {O...    46   2e-05
Smik_7.181 Chr7 (319819..320643) [825 bp, 274 aa] {ON} YGL096W (...    46   2e-05
Skud_7.181 Chr7 (328628..329449) [822 bp, 274 aa] {ON} YGL096W (...    45   3e-05
KAFR0A04370 Chr1 complement(870590..871819) [1230 bp, 409 aa] {O...    46   4e-05
KNAG0M00500 Chr13 complement(79067..79963) [897 bp, 298 aa] {ON}...    45   5e-05
Suva_7.172 Chr7 (319317..320129) [813 bp, 270 aa] {ON} YGL096W (...    44   9e-05
NCAS0D03570 Chr4 (664388..665161) [774 bp, 257 aa] {ON} Anc_6.17...    44   1e-04
TPHA0B02580 Chr2 (592073..592867) [795 bp, 264 aa] {ON} Anc_6.17...    43   2e-04
TBLA0C03740 Chr3 complement(892360..893241) [882 bp, 293 aa] {ON...    43   3e-04
Kwal_27.11092 s27 (635052..635741) [690 bp, 229 aa] {ON} YPL177C...    42   6e-04
CAGL0H02959g Chr8 (277540..278319) [780 bp, 259 aa] {ON} some si...    41   0.001
KLLA0B10450g Chr2 (912877..914046) [1170 bp, 389 aa] {ON} some s...    41   0.001
CAGL0E00341g Chr5 (29668..29775,29840..30076,30143..30190) [393 ...    32   0.35 
KAFR0K02400 Chr11 complement(496660..498972) [2313 bp, 770 aa] {...    33   0.43 
CAGL0C00517g Chr3 (54154..56700) [2547 bp, 848 aa] {ON} similar ...    33   0.77 
KAFR0A04070 Chr1 complement(817388..819325) [1938 bp, 645 aa] {O...    32   0.92 
ZYRO0F12298g Chr6 (997873..1001961) [4089 bp, 1362 aa] {ON} cons...    31   2.3  
Suva_6.52 Chr6 (91156..94950) [3795 bp, 1264 aa] {ON} YFL008W (R...    31   3.5  
Kwal_14.921 s14 complement(112983..117173) [4191 bp, 1396 aa] {O...    30   4.2  
SAKL0B02288g Chr2 (215750..219436) [3687 bp, 1228 aa] {ON} simil...    30   5.5  
TDEL0G00190 Chr7 complement(36313..36360,36422..36712) [339 bp, ...    29   5.7  
TDEL0C05820 Chr3 (1050752..1051042,1051104..1051151) [339 bp, 11...    29   5.7  
TDEL0E00330 Chr5 complement(75774..75821,75883..76173) [339 bp, ...    29   5.7  
TBLA0G01060 Chr7 complement(267271..267300,267367..267663,267722...    29   7.0  
TBLA0E01420 Chr5 (317436..323072) [5637 bp, 1878 aa] {ON} Anc_4....    30   8.0  
NDAI0A00670 Chr1 complement(124998..125033,125093..125308,125369...    28   8.3  
NDAI0H00100 Chr8 complement(758..793,853..1068,1129..1164) [288 ...    28   8.3  

>Ecym_1115 Chr1 (237261..237485,237542..238009) [693 bp, 230 aa]
           {ON} similar to YCL067C HMLALPHA2, 1-intron
          Length = 230

 Score =  437 bits (1125), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 216/230 (93%), Positives = 216/230 (93%)

Query: 1   MNRIPIISLLNPSPGDSHNIRQXXXXXXXXXXXXXXYEADILLKMRNELMKLHSSICCTN 60
           MNRIPIISLLNPSPGDSHNIRQ              YEADILLKMRNELMKLHSSICCTN
Sbjct: 1   MNRIPIISLLNPSPGDSHNIRQTLTSSSTFSLKKDTYEADILLKMRNELMKLHSSICCTN 60

Query: 61  IENGEVNFILNKVLQGLKILSSDQVFSKPDRVVIQNISQLTAIIVRLVNKKEDIINLQKG 120
           IENGEVNFILNKVLQGLKILSSDQVFSKPDRVVIQNISQLTAIIVRLVNKKEDIINLQKG
Sbjct: 61  IENGEVNFILNKVLQGLKILSSDQVFSKPDRVVIQNISQLTAIIVRLVNKKEDIINLQKG 120

Query: 121 LVDPKEIPEAISKEKCGIIFNVVTQDMMENGRKGGSSSYKGHRLPKKHVQLLESWYKNNI 180
           LVDPKEIPEAISKEKCGIIFNVVTQDMMENGRKGGSSSYKGHRLPKKHVQLLESWYKNNI
Sbjct: 121 LVDPKEIPEAISKEKCGIIFNVVTQDMMENGRKGGSSSYKGHRLPKKHVQLLESWYKNNI 180

Query: 181 ENPYLNDTDIRILMRETGFSRSQVKNWVANKRRKDKHSTISPELSDLLAN 230
           ENPYLNDTDIRILMRETGFSRSQVKNWVANKRRKDKHSTISPELSDLLAN
Sbjct: 181 ENPYLNDTDIRILMRETGFSRSQVKNWVANKRRKDKHSTISPELSDLLAN 230

>Ecym_1002 Chr1 complement(5334..5801,5858..6082) [693 bp, 230 aa]
           {ON} similar to Saccharomyces cerevisiae YCL067C
           HMLALPHA2; 1-intron
          Length = 230

 Score =  437 bits (1125), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 216/230 (93%), Positives = 216/230 (93%)

Query: 1   MNRIPIISLLNPSPGDSHNIRQXXXXXXXXXXXXXXYEADILLKMRNELMKLHSSICCTN 60
           MNRIPIISLLNPSPGDSHNIRQ              YEADILLKMRNELMKLHSSICCTN
Sbjct: 1   MNRIPIISLLNPSPGDSHNIRQTLTSSSTFSLKKDTYEADILLKMRNELMKLHSSICCTN 60

Query: 61  IENGEVNFILNKVLQGLKILSSDQVFSKPDRVVIQNISQLTAIIVRLVNKKEDIINLQKG 120
           IENGEVNFILNKVLQGLKILSSDQVFSKPDRVVIQNISQLTAIIVRLVNKKEDIINLQKG
Sbjct: 61  IENGEVNFILNKVLQGLKILSSDQVFSKPDRVVIQNISQLTAIIVRLVNKKEDIINLQKG 120

Query: 121 LVDPKEIPEAISKEKCGIIFNVVTQDMMENGRKGGSSSYKGHRLPKKHVQLLESWYKNNI 180
           LVDPKEIPEAISKEKCGIIFNVVTQDMMENGRKGGSSSYKGHRLPKKHVQLLESWYKNNI
Sbjct: 121 LVDPKEIPEAISKEKCGIIFNVVTQDMMENGRKGGSSSYKGHRLPKKHVQLLESWYKNNI 180

Query: 181 ENPYLNDTDIRILMRETGFSRSQVKNWVANKRRKDKHSTISPELSDLLAN 230
           ENPYLNDTDIRILMRETGFSRSQVKNWVANKRRKDKHSTISPELSDLLAN
Sbjct: 181 ENPYLNDTDIRILMRETGFSRSQVKNWVANKRRKDKHSTISPELSDLLAN 230

>ZYRO0F15818g Chr6 complement(1302816..1303493) [678 bp, 225 aa]
           {ON} similar to uniprot|Q6B2C0 Saccharomyces cerevisiae
           YCR039C MATALPHA2 Homeobox-domain containing protein
           which in haploid cells acts with Mcm1p to repress
           a-specific genes in diploid cells Alpha2p acts together
           with A1p to repress transcription of haploid-specific
           genes
          Length = 225

 Score =  122 bits (305), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 80/234 (34%), Positives = 128/234 (54%), Gaps = 27/234 (11%)

Query: 1   MNRIPIISLLNPSPGDSHNIRQXXXXXXXXXXXXXXYEADILLKMRNELMKLHSSICCTN 60
           MN+IPI  LLNP   +                    +  + L  + N+L+ L S +   N
Sbjct: 1   MNKIPIERLLNPVHQE--------------------FPHEKLKNINNKLLALCSKLPSEN 40

Query: 61  IENGEVNFILNKVLQGLKILSSDQVFSKPDRVVIQNISQLTAIIVRLVNKKEDIINLQKG 120
            +  +    L K+L  L IL  +   SK D+ ++  I QL+++   L+N+  ++ + +  
Sbjct: 41  EQFEKDKAELEKILPSLNILIRECGSSKEDQKMVHRIHQLSSVFSLLLNEVSELKSKRSQ 100

Query: 121 LVDPK---EIPEAIS---KEKCGIIFNVVTQDMMENGRKGGSSSYKGHRLPKKHVQLLES 174
            +  K    +P A +     K G++FN+VTQD + + R+   + Y+GHRLPK   +LLES
Sbjct: 101 FLRSKPKYHLPYAAALGNTGKEGMVFNIVTQDTLNSARRSNKT-YRGHRLPKHITRLLES 159

Query: 175 WYKNNIENPYLNDTDIRILMRETGFSRSQVKNWVANKRRKDKHSTISPELSDLL 228
           W+  NIE+PYL  + ++ LM ET  S  Q+KNWV+N+RRK+K  TIS E+S+L+
Sbjct: 160 WFNRNIEHPYLQTSSMKELMVETKLSGPQIKNWVSNRRRKEKSLTISFEVSELV 213

>ZYRO0F18568g Chr6 complement(1532755..1533432) [678 bp, 225 aa]
           {ON} similar to uniprot|Q6B2C0 Saccharomyces cerevisiae
           YCR039C MATALPHA2 Homeobox-domain containing protein
           which in haploid cells acts with Mcm1p to repress
           a-specific genes in diploid cells Alpha2p acts together
           with A1p to repress transcription of haploid-specific
           genes
          Length = 225

 Score =  122 bits (305), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 80/234 (34%), Positives = 128/234 (54%), Gaps = 27/234 (11%)

Query: 1   MNRIPIISLLNPSPGDSHNIRQXXXXXXXXXXXXXXYEADILLKMRNELMKLHSSICCTN 60
           MN+IPI  LLNP   +                    +  + L  + N+L+ L S +   N
Sbjct: 1   MNKIPIERLLNPVHQE--------------------FPHEKLKNINNKLLALCSKLPSEN 40

Query: 61  IENGEVNFILNKVLQGLKILSSDQVFSKPDRVVIQNISQLTAIIVRLVNKKEDIINLQKG 120
            +  +    L K+L  L IL  +   SK D+ ++  I QL+++   L+N+  ++ + +  
Sbjct: 41  EQFEKDKAELEKILPSLNILIRECGSSKEDQKMVHRIHQLSSVFSLLLNEVSELKSKRSQ 100

Query: 121 LVDPK---EIPEAIS---KEKCGIIFNVVTQDMMENGRKGGSSSYKGHRLPKKHVQLLES 174
            +  K    +P A +     K G++FN+VTQD + + R+   + Y+GHRLPK   +LLES
Sbjct: 101 FLRSKPKYHLPYAAALGNTGKEGMVFNIVTQDTLNSARRSNKT-YRGHRLPKHITRLLES 159

Query: 175 WYKNNIENPYLNDTDIRILMRETGFSRSQVKNWVANKRRKDKHSTISPELSDLL 228
           W+  NIE+PYL  + ++ LM ET  S  Q+KNWV+N+RRK+K  TIS E+S+L+
Sbjct: 160 WFNRNIEHPYLQTSSMKELMVETKLSGPQIKNWVSNRRRKEKSLTISFEVSELV 213

>TPHA0E04070 Chr5 complement(848980..849613,849670..849731) [696 bp,
           231 aa] {ON}   silenced copy of alpha2 at HMLalpha locus
          Length = 231

 Score =  121 bits (303), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 88/244 (36%), Positives = 131/244 (53%), Gaps = 37/244 (15%)

Query: 1   MNRIPIISLLNPSPGDSHNIRQXXXXXXXXXXXXXXYEADILLKMRNELMKLHSSIC-CT 59
           MN+IPI  LLNPS    +N+ +                  I + + N   KL  +I   T
Sbjct: 1   MNKIPINKLLNPSQH--YNLTEKL--------------QQINITLSNLCTKLPDTITDLT 44

Query: 60  NIENGEVNFILNKVLQGLKILSSDQVFSKPDRVVIQNISQLTAIIVRLV----------N 109
             ++ E    L  +L  L  +   Q   K + ++++   QL   +  +V          N
Sbjct: 45  EADHRE----LQDILLYLTTVVKQQELKKEEIMLVKTTYQLCTTLTLMVKSCKQENDKEN 100

Query: 110 KKEDIINLQKGLVDPKEIPEAIS----KEKCGI-IFNVVTQDMMENGRKGGSSSYKGHRL 164
           K+ +II  + G  D  E   + +    ++K  I +FNV+TQDMM    K  + SY+GHRL
Sbjct: 101 KENEIIKYESGTSDNSETNSSCNSSDNEDKNSILVFNVITQDMMN-NNKKNNKSYRGHRL 159

Query: 165 PKKHVQLLESWYKNNIENPYLNDTDIRILMRETGFSRSQVKNWVANKRRKDKHSTISPEL 224
           PKK+VQ LE WY ++ +NPYLN+ +I++LM +T  SR QVKNW++N+RRK+K  TISPE+
Sbjct: 160 PKKNVQYLEDWYMDHRKNPYLNEINIKLLMSKTSLSRIQVKNWISNRRRKEKSITISPEV 219

Query: 225 SDLL 228
           S LL
Sbjct: 220 SALL 223

>TPHA0E03610 Chr5 complement(765003..765636,765693..765754) [696 bp,
           231 aa] {ON} Anc_1.122 YCR039C MATalpha2 gene at MAT
           locus
          Length = 231

 Score =  121 bits (303), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 88/244 (36%), Positives = 131/244 (53%), Gaps = 37/244 (15%)

Query: 1   MNRIPIISLLNPSPGDSHNIRQXXXXXXXXXXXXXXYEADILLKMRNELMKLHSSIC-CT 59
           MN+IPI  LLNPS    +N+ +                  I + + N   KL  +I   T
Sbjct: 1   MNKIPINKLLNPSQH--YNLTEKL--------------QQINITLSNLCTKLPDTITDLT 44

Query: 60  NIENGEVNFILNKVLQGLKILSSDQVFSKPDRVVIQNISQLTAIIVRLV----------N 109
             ++ E    L  +L  L  +   Q   K + ++++   QL   +  +V          N
Sbjct: 45  EADHRE----LQDILLYLTTVVKQQELKKEEIMLVKTTYQLCTTLTLMVKSCKQENDKEN 100

Query: 110 KKEDIINLQKGLVDPKEIPEAIS----KEKCGI-IFNVVTQDMMENGRKGGSSSYKGHRL 164
           K+ +II  + G  D  E   + +    ++K  I +FNV+TQDMM    K  + SY+GHRL
Sbjct: 101 KENEIIKYESGTSDNSETNSSCNSSDNEDKNSILVFNVITQDMMN-NNKKNNKSYRGHRL 159

Query: 165 PKKHVQLLESWYKNNIENPYLNDTDIRILMRETGFSRSQVKNWVANKRRKDKHSTISPEL 224
           PKK+VQ LE WY ++ +NPYLN+ +I++LM +T  SR QVKNW++N+RRK+K  TISPE+
Sbjct: 160 PKKNVQYLEDWYMDHRKNPYLNEINIKLLMSKTSLSRIQVKNWISNRRRKEKSITISPEV 219

Query: 225 SDLL 228
           S LL
Sbjct: 220 SALL 223

>Kpol_2002.3 s2002 (4682..5353) [672 bp, 223 aa] {ON} (4682..5353)
           [672 nt, 224 aa]
          Length = 223

 Score =  117 bits (293), Expect = 7e-32,   Method: Compositional matrix adjust.
 Identities = 84/239 (35%), Positives = 131/239 (54%), Gaps = 35/239 (14%)

Query: 1   MNRIPIISLLNPSPGDSHNIRQXXXXXXXXXXXXXXYEADILLKMRNELMKLHSSICC-T 59
           MN+IPI  LLNPS  +  N++                  D L ++ ++L  L S I   T
Sbjct: 1   MNKIPINILLNPSHQE--NLK------------------DKLQQINDKLTSLCSKIPGNT 40

Query: 60  NIENGEVNFILNKVLQGLKILSSDQVFSKPDRVVIQNISQLTAII------VRLVNK--- 110
           +    E +  L ++L  L  +  ++     + ++++   QL+  +      +R+ N+   
Sbjct: 41  SGLEQEDHLELQRILLFLTTVVKNEKLDNDEIMLVRTTYQLSTTLSIMVKSLRMANENYE 100

Query: 111 -KEDIINLQKGLVDPKEIPEAISKEKCGIIFNVVTQDMMENGRKGGSSSYKGHRLPKKHV 169
            +    N ++ L  P     + S ++   +FN+VTQDMM N +K    SY+GHRLPK++V
Sbjct: 101 SQTSKENSEEELTSP---SSSDSNDRNEFVFNIVTQDMM-NKKKMNIKSYRGHRLPKQNV 156

Query: 170 QLLESWYKNNIENPYLNDTDIRILMRETGFSRSQVKNWVANKRRKDKHSTISPELSDLL 228
           +LLE WY  N+ENPYL+D  I  LM+ T  S+ Q+KNWV+N+RRK+K  TISPE+S LL
Sbjct: 157 KLLERWYIQNVENPYLDDKSISELMKITSLSKVQIKNWVSNRRRKEKSITISPEVSRLL 215

>Suva_3.135 Chr3 complement(211196..211555) [360 bp, 119 aa] {ON}
           YCR096C (REAL)
          Length = 119

 Score =  108 bits (271), Expect = 9e-30,   Method: Compositional matrix adjust.
 Identities = 51/97 (52%), Positives = 70/97 (72%), Gaps = 4/97 (4%)

Query: 133 KEKCGIIFNVVTQDMMENGRKGGSSSYKGHRLPKKHVQLLESWYKNNIENPYLNDTDIRI 192
           K   G++FNVVTQDM+    K     Y+GHR  K++V++LESW+  NIENPYL+   +  
Sbjct: 18  KSADGLVFNVVTQDMINKSTK----PYRGHRFTKENVRILESWFAKNIENPYLDTKGLEN 73

Query: 193 LMRETGFSRSQVKNWVANKRRKDKHSTISPELSDLLA 229
           LM+ T  SR Q+KNWV+N+RRK+K  TI+PEL+DLL+
Sbjct: 74  LMKNTSLSRIQIKNWVSNRRRKEKTITIAPELADLLS 110

>Suva_3.74 Chr3 complement(112965..113324) [360 bp, 119 aa] {ON}
           YCR039C (REAL)
          Length = 119

 Score =  108 bits (271), Expect = 9e-30,   Method: Compositional matrix adjust.
 Identities = 51/97 (52%), Positives = 70/97 (72%), Gaps = 4/97 (4%)

Query: 133 KEKCGIIFNVVTQDMMENGRKGGSSSYKGHRLPKKHVQLLESWYKNNIENPYLNDTDIRI 192
           K   G++FNVVTQDM+    K     Y+GHR  K++V++LESW+  NIENPYL+   +  
Sbjct: 18  KSADGLVFNVVTQDMINKSTK----PYRGHRFTKENVRILESWFAKNIENPYLDTKGLEN 73

Query: 193 LMRETGFSRSQVKNWVANKRRKDKHSTISPELSDLLA 229
           LM+ T  SR Q+KNWV+N+RRK+K  TI+PEL+DLL+
Sbjct: 74  LMKNTSLSRIQIKNWVSNRRRKEKTITIAPELADLLS 110

>Suva_3.75 Chr3 complement(112965..113324) [360 bp, 119 aa] {ON}
           YCL067C (REAL)
          Length = 119

 Score =  108 bits (271), Expect = 9e-30,   Method: Compositional matrix adjust.
 Identities = 51/97 (52%), Positives = 70/97 (72%), Gaps = 4/97 (4%)

Query: 133 KEKCGIIFNVVTQDMMENGRKGGSSSYKGHRLPKKHVQLLESWYKNNIENPYLNDTDIRI 192
           K   G++FNVVTQDM+    K     Y+GHR  K++V++LESW+  NIENPYL+   +  
Sbjct: 18  KSADGLVFNVVTQDMINKSTK----PYRGHRFTKENVRILESWFAKNIENPYLDTKGLEN 73

Query: 193 LMRETGFSRSQVKNWVANKRRKDKHSTISPELSDLLA 229
           LM+ T  SR Q+KNWV+N+RRK+K  TI+PEL+DLL+
Sbjct: 74  LMKNTSLSRIQIKNWVSNRRRKEKTITIAPELADLLS 110

>YCR096C Chr3 complement(293179..293538) [360 bp, 119 aa] {OFF}
           HMRA2Silenced copy of a2 at HMR; similarity to Alpha2p;
           required along with a1p for inhibiting expression of the
           HO endonuclease in a/alpha HO/HO diploid cells with an
           active mating-type interconversion system
          Length = 119

 Score =  108 bits (271), Expect = 9e-30,   Method: Compositional matrix adjust.
 Identities = 51/97 (52%), Positives = 70/97 (72%), Gaps = 4/97 (4%)

Query: 133 KEKCGIIFNVVTQDMMENGRKGGSSSYKGHRLPKKHVQLLESWYKNNIENPYLNDTDIRI 192
           K   G++FNVVTQDM+    K     Y+GHR  K++V++LESW+  NIENPYL+   +  
Sbjct: 18  KSADGLVFNVVTQDMINKSTK----PYRGHRFTKENVRILESWFAKNIENPYLDTKGLEN 73

Query: 193 LMRETGFSRSQVKNWVANKRRKDKHSTISPELSDLLA 229
           LM+ T  SR Q+KNWV+N+RRK+K  TI+PEL+DLL+
Sbjct: 74  LMKNTSLSRIQIKNWVSNRRRKEKTITIAPELADLLS 110

>Skud_102.1 Chr102 (1..558) [558 bp, 185 aa] {ON} YCR039C (REAL)
          Length = 185

 Score =  108 bits (271), Expect = 5e-29,   Method: Compositional matrix adjust.
 Identities = 50/93 (53%), Positives = 69/93 (74%), Gaps = 4/93 (4%)

Query: 137 GIIFNVVTQDMMENGRKGGSSSYKGHRLPKKHVQLLESWYKNNIENPYLNDTDIRILMRE 196
           G++FNVVTQDM+    K     Y+GHR  K++V++LESW+  NIENPYL+   +  LM+ 
Sbjct: 88  GLVFNVVTQDMINKSTK----PYRGHRFTKENVRILESWFAKNIENPYLDTKGLENLMKN 143

Query: 197 TGFSRSQVKNWVANKRRKDKHSTISPELSDLLA 229
           T  SR Q+KNWV+N+RRK+K  TI+PEL+DLL+
Sbjct: 144 TSLSRIQIKNWVSNRRRKEKTITIAPELADLLS 176

>Smik_95.1 Chr95 (1..558) [558 bp, 185 aa] {ON} YCR039C (REAL)
          Length = 185

 Score =  108 bits (271), Expect = 5e-29,   Method: Compositional matrix adjust.
 Identities = 50/93 (53%), Positives = 69/93 (74%), Gaps = 4/93 (4%)

Query: 137 GIIFNVVTQDMMENGRKGGSSSYKGHRLPKKHVQLLESWYKNNIENPYLNDTDIRILMRE 196
           G++FNVVTQDM+    K     Y+GHR  K++V++LESW+  NIENPYL+   +  LM+ 
Sbjct: 88  GLVFNVVTQDMINKSTK----PYRGHRFTKENVRILESWFAKNIENPYLDTKGLENLMKN 143

Query: 197 TGFSRSQVKNWVANKRRKDKHSTISPELSDLLA 229
           T  SR Q+KNWV+N+RRK+K  TI+PEL+DLL+
Sbjct: 144 TSLSRIQIKNWVSNRRRKEKTITIAPELADLLS 176

>Smik_3.142 Chr3 complement(197575..198261) [687 bp, 228 aa] {ON}
           YCL067C (REAL)
          Length = 228

 Score =  110 bits (274), Expect = 6e-29,   Method: Compositional matrix adjust.
 Identities = 50/93 (53%), Positives = 69/93 (74%), Gaps = 4/93 (4%)

Query: 137 GIIFNVVTQDMMENGRKGGSSSYKGHRLPKKHVQLLESWYKNNIENPYLNDTDIRILMRE 196
           G++FNVVTQDM+    K     Y+GHR  K++V++LESW+  NIENPYL+   +  LM+ 
Sbjct: 131 GLVFNVVTQDMINKSTK----PYRGHRFTKENVRILESWFAKNIENPYLDTKGLENLMKN 186

Query: 197 TGFSRSQVKNWVANKRRKDKHSTISPELSDLLA 229
           T  SR Q+KNWV+N+RRK+K  TI+PEL+DLL+
Sbjct: 187 TSLSRIQIKNWVSNRRRKEKTITIAPELADLLS 219

>Suva_3.147 Chr3 complement(221912..222544) [633 bp, 210 aa] {ON}
           (REAL)
          Length = 210

 Score =  109 bits (272), Expect = 6e-29,   Method: Compositional matrix adjust.
 Identities = 50/93 (53%), Positives = 69/93 (74%), Gaps = 4/93 (4%)

Query: 137 GIIFNVVTQDMMENGRKGGSSSYKGHRLPKKHVQLLESWYKNNIENPYLNDTDIRILMRE 196
           G++FNVVTQDM+    K     Y+GHR  K++V++LESW+  NIENPYL+   +  LM+ 
Sbjct: 113 GLVFNVVTQDMINKSTK----PYRGHRFTKENVRILESWFAKNIENPYLDTKGLENLMKN 168

Query: 197 TGFSRSQVKNWVANKRRKDKHSTISPELSDLLA 229
           T  SR Q+KNWV+N+RRK+K  TI+PEL+DLL+
Sbjct: 169 TSLSRIQIKNWVSNRRRKEKTITIAPELADLLS 201

>YCR039C Chr3 complement(199546..200178) [633 bp, 210 aa] {ON}
           MATALPHA2Homeobox-domain protein that, with Mcm1p,
           represses a-specific genes in haploids; acts with A1p to
           repress transcription of haploid-specific genes in
           diploids; one of two genes encoded by the MATalpha
           mating type cassette
          Length = 210

 Score =  109 bits (272), Expect = 6e-29,   Method: Compositional matrix adjust.
 Identities = 50/93 (53%), Positives = 69/93 (74%), Gaps = 4/93 (4%)

Query: 137 GIIFNVVTQDMMENGRKGGSSSYKGHRLPKKHVQLLESWYKNNIENPYLNDTDIRILMRE 196
           G++FNVVTQDM+    K     Y+GHR  K++V++LESW+  NIENPYL+   +  LM+ 
Sbjct: 113 GLVFNVVTQDMINKSTK----PYRGHRFTKENVRILESWFAKNIENPYLDTKGLENLMKN 168

Query: 197 TGFSRSQVKNWVANKRRKDKHSTISPELSDLLA 229
           T  SR Q+KNWV+N+RRK+K  TI+PEL+DLL+
Sbjct: 169 TSLSRIQIKNWVSNRRRKEKTITIAPELADLLS 201

>YCL067C Chr3 complement(12386..13018) [633 bp, 210 aa] {ON}
           HMLALPHA2Silenced copy of ALPHA2 at HML; homeobox-domain
           protein that associates with Mcm1p in haploid cells to
           repress a-specific gene expression and interacts with
           a1p in diploid cells to repress haploid-specific gene
           expression
          Length = 210

 Score =  109 bits (272), Expect = 6e-29,   Method: Compositional matrix adjust.
 Identities = 50/93 (53%), Positives = 69/93 (74%), Gaps = 4/93 (4%)

Query: 137 GIIFNVVTQDMMENGRKGGSSSYKGHRLPKKHVQLLESWYKNNIENPYLNDTDIRILMRE 196
           G++FNVVTQDM+    K     Y+GHR  K++V++LESW+  NIENPYL+   +  LM+ 
Sbjct: 113 GLVFNVVTQDMINKSTK----PYRGHRFTKENVRILESWFAKNIENPYLDTKGLENLMKN 168

Query: 197 TGFSRSQVKNWVANKRRKDKHSTISPELSDLLA 229
           T  SR Q+KNWV+N+RRK+K  TI+PEL+DLL+
Sbjct: 169 TSLSRIQIKNWVSNRRRKEKTITIAPELADLLS 201

>Skud_3.118 Chr3 complement(184042..184674) [633 bp, 210 aa] {ON}
           YCR039C (REAL)
          Length = 210

 Score =  109 bits (272), Expect = 7e-29,   Method: Compositional matrix adjust.
 Identities = 50/93 (53%), Positives = 69/93 (74%), Gaps = 4/93 (4%)

Query: 137 GIIFNVVTQDMMENGRKGGSSSYKGHRLPKKHVQLLESWYKNNIENPYLNDTDIRILMRE 196
           G++FNVVTQDM+    K     Y+GHR  K++V++LESW+  NIENPYL+   +  LM+ 
Sbjct: 113 GLVFNVVTQDMINKSTK----PYRGHRFTKENVRILESWFAKNIENPYLDTKGLENLMKN 168

Query: 197 TGFSRSQVKNWVANKRRKDKHSTISPELSDLLA 229
           T  SR Q+KNWV+N+RRK+K  TI+PEL+DLL+
Sbjct: 169 TSLSRIQIKNWVSNRRRKEKTITIAPELADLLS 201

>KAFR0D00720 Chr4 (128684..129304) [621 bp, 206 aa] {ON}  mating
           type gene MATalpha2
          Length = 206

 Score =  100 bits (250), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 48/90 (53%), Positives = 63/90 (70%), Gaps = 2/90 (2%)

Query: 139 IFNVVTQDMMENGRKGGSSSYKGHRLPKKHVQLLESWYKNNIENPYLNDTDIRILMRETG 198
           +FNVVTQDMM   R G   SY+GHR  K++V++LE WY  +I+ PYLN      L+ +TG
Sbjct: 115 VFNVVTQDMMNLNRTG--ISYRGHRFSKENVKVLERWYTAHIDRPYLNRQSTEYLISKTG 172

Query: 199 FSRSQVKNWVANKRRKDKHSTISPELSDLL 228
            SR Q+KNWV+N+RRK+K   +SPEL  LL
Sbjct: 173 LSRVQIKNWVSNRRRKEKSVHVSPELIQLL 202

>CAGL0B01265g Chr2 (113719..114279) [561 bp, 186 aa] {ON} similar to
           uniprot|P01367 Saccharomyces cerevisiae YCR039c or
           uniprot|P01367 Saccharomyces cerevisiae YCL067c HMLALP2
           mating type regulatory protein
          Length = 186

 Score = 92.0 bits (227), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 44/94 (46%), Positives = 68/94 (72%), Gaps = 2/94 (2%)

Query: 138 IIFNVVTQD-MMENGRKGG-SSSYKGHRLPKKHVQLLESWYKNNIENPYLNDTDIRILMR 195
           I+FNVVT+D +++ G     ++SY+GHR  +++VQ+LE+WY+N+I+NPYL+    + L +
Sbjct: 87  IVFNVVTKDHLLKKGVPNHYAASYRGHRFTRENVQILETWYRNHIDNPYLDHNSQQYLAQ 146

Query: 196 ETGFSRSQVKNWVANKRRKDKHSTISPELSDLLA 229
           +T  S+ Q+KNWVAN+RRK K   ISP    L+A
Sbjct: 147 KTNLSKIQIKNWVANRRRKQKSIYISPFRPTLMA 180

>NDAI0A00110 Chr1 (1584..2219) [636 bp, 211 aa] {ON} Anc_1.2  silent
           copy of MATalpha2 gene at HMLalpha
          Length = 211

 Score = 92.0 bits (227), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 40/90 (44%), Positives = 66/90 (73%), Gaps = 3/90 (3%)

Query: 139 IFNVVTQDMMENGRKGGSSSYKGHRLPKKHVQLLESWYKNNIENPYLNDTDIRILMRETG 198
           +FNV+TQDMM   +   +  ++GHRLPK+ V  LE WY  +I+ PYL+  ++++LM ET 
Sbjct: 119 VFNVITQDMMIPEK---NKPHRGHRLPKEKVNRLEHWYLAHIQKPYLDSKNLKVLMEETK 175

Query: 199 FSRSQVKNWVANKRRKDKHSTISPELSDLL 228
            S+ Q+KNW++N+RRK+K  +ISP++ +++
Sbjct: 176 LSKVQIKNWISNRRRKEKLLSISPDIVEII 205

>NCAS0B09140 Chr2 complement(1754708..1755325) [618 bp, 205 aa] {ON}
           Anc_1.2
          Length = 205

 Score = 91.7 bits (226), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 49/152 (32%), Positives = 90/152 (59%), Gaps = 8/152 (5%)

Query: 77  LKILSSDQVFSKPDRVVIQNISQLTAIIVRLVNKKEDIINLQKGLVDPKEIPEAISKEKC 136
           L  L++    S  ++ V++   Q+++++++L+ +     +  K      E     S+   
Sbjct: 58  LSSLTNQNELSSENKNVLRVTYQISSVLLKLLGENAHNKDQPKTPTSGSE-----SERNP 112

Query: 137 GIIFNVVTQDMMENGRKGGSSSYKGHRLPKKHVQLLESWYKNNIENPYLNDTDIRILMRE 196
            ++FN++T+  M       +   +GHRL K+ V LLE WY  +++NPYLN   +++LM+E
Sbjct: 113 KLVFNILTKKRMS---PTSNEPRRGHRLAKEKVDLLEHWYIQHMDNPYLNKASLQMLMQE 169

Query: 197 TGFSRSQVKNWVANKRRKDKHSTISPELSDLL 228
           T  S+ Q+KNWV+N+RRK+K  +I+PE+ D+L
Sbjct: 170 TSLSKMQIKNWVSNRRRKEKSLSIAPEIVDIL 201

>KNAG0C00160 Chr3 (25548..26159) [612 bp, 203 aa] {ON} Anc_1.2
           YCL067C silent copy of mating type alpha2 gene at HML
           locus
          Length = 203

 Score = 89.4 bits (220), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 57/159 (35%), Positives = 83/159 (52%), Gaps = 12/159 (7%)

Query: 74  LQGLKILSSDQVFSKPDRVVIQN----ISQLTAIIVRLVNKKEDIINLQKGLVDPKEIPE 129
           LQG+ +  +  V      V ++N      Q + II  L+   ED    +K   DP     
Sbjct: 51  LQGILLFLTKLVGKNDLSVTLKNEARMTYQFSKIIASLLKSFEDFFFERKEYNDP----- 105

Query: 130 AISKEKCGIIFNVVTQDMMENGRKGGSSSYKGHRLPKKHVQLLESWYKNNIENPYLNDTD 189
           A S+ +   +F+VVTQDMM N RK      +GHR      + LE WYK + E PYL+   
Sbjct: 106 ATSENE--FVFSVVTQDMM-NKRKESMRPCRGHRFSSNSTETLEDWYKKHHEKPYLDKRS 162

Query: 190 IRILMRETGFSRSQVKNWVANKRRKDKHSTISPELSDLL 228
           +  L  +T  S+ Q++NWV+N+RRK+K   +SP + DLL
Sbjct: 163 LHELEFKTKLSKMQIRNWVSNRRRKEKSIHVSPVIQDLL 201

>CAGL0B00264g Chr2 (11470..12102) [633 bp, 210 aa] {ON} highly
           similar to uniprot|P01367 Saccharomyces cerevisiae
           YCR039c or uniprot|P01367 Saccharomyces cerevisiae
           YCL067c HMLALP 2 mating type regulatory protein
          Length = 210

 Score = 88.2 bits (217), Expect = 9e-21,   Method: Compositional matrix adjust.
 Identities = 41/86 (47%), Positives = 64/86 (74%), Gaps = 2/86 (2%)

Query: 138 IIFNVVTQD-MMENGRKGG-SSSYKGHRLPKKHVQLLESWYKNNIENPYLNDTDIRILMR 195
           I+FNVVT+D +++ G     ++SY+GHR  +++VQ+LE+WY+N+I+NPYL+    + L +
Sbjct: 87  IVFNVVTKDHLLKKGVPNHYAASYRGHRFTRENVQILETWYRNHIDNPYLDHNSQQYLAQ 146

Query: 196 ETGFSRSQVKNWVANKRRKDKHSTIS 221
           +T  S+ Q+KNWVAN+RRK K   IS
Sbjct: 147 KTNLSKIQIKNWVANRRRKQKSIYIS 172

>KLLA0C00374g Chr3 (25132..25803) [672 bp, 223 aa] {ON}
           uniprot|Q9HDS5 Kluyveromyces lactis HMLALPHA2 Mating-
           type protein ALPHA2
          Length = 223

 Score = 83.2 bits (204), Expect = 8e-19,   Method: Compositional matrix adjust.
 Identities = 36/87 (41%), Positives = 59/87 (67%), Gaps = 3/87 (3%)

Query: 142 VVTQDMMENGRKGGSSSYKGHRLPKKHVQLLESWYKNNIENPYLNDTDIRILMRETGFSR 201
           ++TQD+M +     +   KG R PK H+QLLE+WY  N  NPYL + D+  + + T  ++
Sbjct: 139 ILTQDLMHSN---NNEFKKGKRFPKSHIQLLENWYSMNRRNPYLAENDLAYISKNTTLTK 195

Query: 202 SQVKNWVANKRRKDKHSTISPELSDLL 228
           +Q+KNW+AN+RRKDK + +S ++ ++L
Sbjct: 196 TQIKNWLANRRRKDKITEVSSDIRNIL 222

>TDEL0C07000 Chr3 complement(1273613..1274326) [714 bp, 237 aa] {ON}
           Anc_1.122 YCR039C silenced copy of alpha2 gene at T.
           delbrueckii HML locus
          Length = 237

 Score = 79.7 bits (195), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 57/195 (29%), Positives = 100/195 (51%), Gaps = 16/195 (8%)

Query: 38  EAD-ILLKMRNELMKLHSSICCTNIENGEVNFILNKVLQGLKILSSDQVFSKPDRVVIQN 96
           EAD +  K+ N + K    + C           L KVL  LK+++++    +   ++++ 
Sbjct: 43  EADELFFKLSNGIGKPEFELRCE----------LKKVLSSLKVVTTNGKLEENGELLLRT 92

Query: 97  ISQLTAIIVRLVN--KKEDIINLQKGLVDPKEIPEAISKEKCGII-FNVVTQDMMENGRK 153
             QL+  +  +++  KK +  N+Q       +     +  +C +  F +V  +  ++   
Sbjct: 93  TFQLSKTLSVVLSEFKKVEESNIQFHKSRDWDSERKETNLRCKVPNFEIVPLNTKQDYST 152

Query: 154 GGSSSYKGHRLPKKHVQLLESWYKNNIENPYLNDTDIRILMRETGFSRSQVKNWVANKRR 213
           G    ++GHRLP + V+ LE W+  NI  PYLN   +R L+ ET  S  Q+KNW++N+RR
Sbjct: 153 G--KRHRGHRLPSEKVEKLELWFNQNISKPYLNQRALRTLVHETSLSPIQIKNWLSNRRR 210

Query: 214 KDKHSTISPELSDLL 228
           K K + I+  +SDLL
Sbjct: 211 KKKSAGIADTISDLL 225

>TBLA0A07050 Chr1
           (1728941..1729002,1729096..1729189,1729249..1729878)
           [786 bp, 261 aa] {ON}  MATalpha2 gene at MAT locus
          Length = 261

 Score = 75.5 bits (184), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 33/74 (44%), Positives = 55/74 (74%), Gaps = 1/74 (1%)

Query: 158 SYKGHRLPKKHVQLLESWYKNNIENPYLNDTDIRILMRETGFSRSQVKNWVANKRRKDKH 217
           S++GHRLPK  +  LE W+ +N  +PYL+++D++ L  ++  S++QVKNW++N+RRK++H
Sbjct: 168 SHRGHRLPKHTLIPLEKWFLHNKSHPYLHNSDLQALTTQSSLSKTQVKNWISNRRRKERH 227

Query: 218 S-TISPELSDLLAN 230
           S  IS  ++ LL N
Sbjct: 228 SLKISNNIASLLQN 241

>TBLA0A07600 Chr1
           (1882710..1882771,1882865..1882958,1883018..1883554)
           [693 bp, 230 aa] {ON} Anc_1.2 YCL067C silenced copy of
           alpha2 gene at HML locus
          Length = 230

 Score = 69.7 bits (169), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 26/62 (41%), Positives = 48/62 (77%)

Query: 156 SSSYKGHRLPKKHVQLLESWYKNNIENPYLNDTDIRILMRETGFSRSQVKNWVANKRRKD 215
           + S++GHRLPK  +  LE W+ +N  +PYL+++D++ L  ++  S++QVKNW++N+RRK+
Sbjct: 166 TPSHRGHRLPKHTLIPLEKWFLHNKSHPYLHNSDLQALTTQSSLSKTQVKNWISNRRRKE 225

Query: 216 KH 217
           ++
Sbjct: 226 RY 227

>YPL177C Chr16 complement(213042..213962) [921 bp, 306 aa] {ON}
           CUP9Homeodomain-containing transcriptional repressor of
           PTR2, which encodes a major peptide transporter;
           imported peptides activate ubiquitin-dependent
           proteolysis, resulting in degradation of Cup9p and
           de-repression of PTR2 transcription
          Length = 306

 Score = 57.0 bits (136), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 32/89 (35%), Positives = 51/89 (57%), Gaps = 1/89 (1%)

Query: 127 IPEAISKEK-CGIIFNVVTQDMMENGRKGGSSSYKGHRLPKKHVQLLESWYKNNIENPYL 185
           I E I+KEK  G  +N    D +E+  +   +S +   LPK+ VQ+L +W  N++ NPY 
Sbjct: 131 IYEIINKEKDAGAQYNRPFSDFVESKSRRKQNSGRRSNLPKETVQILNTWLLNHLNNPYP 190

Query: 186 NDTDIRILMRETGFSRSQVKNWVANKRRK 214
              + R L+ +TG ++ Q+ NW  N RR+
Sbjct: 191 TQQEKRELLIKTGLTKIQLSNWFINVRRR 219

>AFL049C Chr6 complement(346546..347319) [774 bp, 257 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPL177C
           (CUP9) and YGL096W (TOS8)
          Length = 257

 Score = 51.2 bits (121), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 29/91 (31%), Positives = 48/91 (52%), Gaps = 4/91 (4%)

Query: 128 PEAISKEKCGIIFNVVTQDMMENGRKGG-SSSYKGHR---LPKKHVQLLESWYKNNIENP 183
           P A + E   +      Q+   +G KG    + K HR   LPK+ V +L  W +N+ +NP
Sbjct: 98  PAAPATEPFTVYGRDDQQEPAPDGTKGKLKETKKQHRRSNLPKETVDILNEWLRNHYDNP 157

Query: 184 YLNDTDIRILMRETGFSRSQVKNWVANKRRK 214
           Y +  + + L+++TG +  Q+ NW  N RR+
Sbjct: 158 YPSPQEKKELLKQTGLNPVQLSNWFINVRRR 188

>Smik_6.374 Chr6 (610093..610977) [885 bp, 294 aa] {ON} YPL177C
           (REAL)
          Length = 294

 Score = 49.7 bits (117), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 25/69 (36%), Positives = 39/69 (56%)

Query: 146 DMMENGRKGGSSSYKGHRLPKKHVQLLESWYKNNIENPYLNDTDIRILMRETGFSRSQVK 205
           D  E   K   +S +   LPK+ VQ+L +W  N++ NPY    + R L+ +TG ++ Q+ 
Sbjct: 139 DFEEPKSKKKQNSGRRSNLPKETVQILNTWLLNHLNNPYPTQQEKRELLIKTGLTKIQLS 198

Query: 206 NWVANKRRK 214
           NW  N RR+
Sbjct: 199 NWFINVRRR 207

>KLTH0F00396g Chr6 (31990..32051,32348..32612) [327 bp, 108 aa] {ON}
           conserved hypothetical protein
          Length = 108

 Score = 47.4 bits (111), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 22/57 (38%), Positives = 34/57 (59%)

Query: 172 LESWYKNNIENPYLNDTDIRILMRETGFSRSQVKNWVANKRRKDKHSTISPELSDLL 228
           LE W+ +NI+ PY N   I  L + T  S  Q++NW++N+RRK +  +I   L  +L
Sbjct: 50  LERWFCSNIQYPYPNKIQILSLSKNTNLSIKQIQNWMSNRRRKSRKESIDSLLEPIL 106

>Skud_16.103 Chr16 complement(185398..186285) [888 bp, 295 aa] {ON}
           YPL177C (REAL)
          Length = 295

 Score = 49.7 bits (117), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 24/69 (34%), Positives = 40/69 (57%)

Query: 146 DMMENGRKGGSSSYKGHRLPKKHVQLLESWYKNNIENPYLNDTDIRILMRETGFSRSQVK 205
           D  ++  K   +S +   LPK+ VQ+L +W  N++ NPY    + R L+ +TG ++ Q+ 
Sbjct: 140 DFEDSKSKRKQNSGRRSNLPKETVQILNTWLLNHLNNPYPTQQEKRELLIKTGLTKIQLS 199

Query: 206 NWVANKRRK 214
           NW  N RR+
Sbjct: 200 NWFINVRRR 208

>KAFR0G03650 Chr7 (752766..753299) [534 bp, 177 aa] {ON} Anc_6.170
           YPL177C
          Length = 177

 Score = 48.5 bits (114), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 27/92 (29%), Positives = 49/92 (53%), Gaps = 9/92 (9%)

Query: 126 EIPEAISKEKCGIIFN---VVTQDMMENGRKGGSSSYKGHRLPKKHVQLLESWYKNNIEN 182
           +IP+A ++     + N    ++  M    R+  S+      LPK+ +Q+L +W  N++ N
Sbjct: 41  DIPKADNRNTIEALLNESSPISNSMDSKSRQSRSN------LPKETIQILNAWLLNHLHN 94

Query: 183 PYLNDTDIRILMRETGFSRSQVKNWVANKRRK 214
           PY    + R L+ +TG ++ Q+ NW  N RR+
Sbjct: 95  PYPTSQEKRDLLIKTGLTKIQLSNWFINVRRR 126

>TDEL0F01810 Chr6 complement(338066..338836) [771 bp, 256 aa] {ON}
           Anc_6.170 YPL177C
          Length = 256

 Score = 48.9 bits (115), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 23/61 (37%), Positives = 38/61 (62%)

Query: 154 GGSSSYKGHRLPKKHVQLLESWYKNNIENPYLNDTDIRILMRETGFSRSQVKNWVANKRR 213
           GG S+ +   LPK+ VQ+L +W  +++ NPY    + R L+ +TG ++ Q+ NW  N RR
Sbjct: 126 GGISNGRRSNLPKETVQILNTWLLDHLRNPYPTPQEKRELLIKTGLTKIQLSNWFINVRR 185

Query: 214 K 214
           +
Sbjct: 186 R 186

>YGL096W Chr7 (325331..326161) [831 bp, 276 aa] {ON}
           TOS8Homeodomain-containing protein and putative
           transcription factor found associated with chromatin;
           target of SBF transcription factor; induced during
           meiosis and under cell-damaging conditions; similar to
           Cup9p transcription factor
          Length = 276

 Score = 48.9 bits (115), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 46/163 (28%), Positives = 73/163 (44%), Gaps = 23/163 (14%)

Query: 61  IENGEVNFILNKVLQGLKILSSDQVF---SKPDRVVIQNISQLTAIIVRLVNKKEDIINL 117
           I  GE N+I+   + G  + SS   +   S P+    Q ++Q        VN+   I   
Sbjct: 103 ISTGERNYII--TVGGPPVTSSQPEYEHISTPNFYQEQRLAQPHP-----VNESMMI--- 152

Query: 118 QKGLVDPKEIPEAISKEKCGIIFNVVTQDMM--ENGRKGGSSSYKGH----RLPKKHVQL 171
             G  +P+ I  +IS+ K  +  N+ T  +    NG       +K H     LPK  V +
Sbjct: 153 -GGYTNPQPI--SISRGKM-LSGNISTNSVRGSNNGYSAKEKKHKAHGKRSNLPKATVSI 208

Query: 172 LESWYKNNIENPYLNDTDIRILMRETGFSRSQVKNWVANKRRK 214
           L  W   ++ NPY    + R L+ +TG ++ Q+ NW  N RR+
Sbjct: 209 LNKWLHEHVNNPYPTVQEKRELLAKTGLTKLQISNWFINARRR 251

>NCAS0H01130 Chr8 complement(216012..216854) [843 bp, 280 aa] {ON}
           Anc_6.170 YGL096W
          Length = 280

 Score = 48.9 bits (115), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 23/63 (36%), Positives = 39/63 (61%)

Query: 152 RKGGSSSYKGHRLPKKHVQLLESWYKNNIENPYLNDTDIRILMRETGFSRSQVKNWVANK 211
           +K  S + +   LPK+ VQ+L +W  N+++NPY    + R L+ +TG ++ Q+ NW  N 
Sbjct: 121 KKQVSHNNRRSNLPKEMVQILNTWLLNHLQNPYPTSQEKRELLIKTGLTKVQLSNWFINV 180

Query: 212 RRK 214
           RR+
Sbjct: 181 RRR 183

>Kpol_1036.56 s1036 (153997..154794) [798 bp, 265 aa] {ON}
           (153997..154794) [798 nt, 266 aa]
          Length = 265

 Score = 48.9 bits (115), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 33/51 (64%)

Query: 164 LPKKHVQLLESWYKNNIENPYLNDTDIRILMRETGFSRSQVKNWVANKRRK 214
           LPK  VQ+L  W  N+++NPY    + + L+++TG ++ Q+ NW  N RR+
Sbjct: 163 LPKNSVQILNQWLLNHLQNPYPTPQEKKELLKQTGLTKIQLSNWFINVRRR 213

>Kwal_YGOB_matalpha2 s33 (284511..284843) [333 bp, 110 aa] {ON}
           (matalpha2) - mating type alpha2 protein [contig MAT]
           FULL
          Length = 110

 Score = 46.2 bits (108), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 20/49 (40%), Positives = 30/49 (61%)

Query: 172 LESWYKNNIENPYLNDTDIRILMRETGFSRSQVKNWVANKRRKDKHSTI 220
           LE+W+  N  +PYL    I +L   T  S  Q++NW++N+RRK K + I
Sbjct: 47  LENWFHLNSSHPYLTRKQISLLSERTNLSSKQIRNWMSNRRRKSKKNPI 95

>Kwal_33.12995 s33 (32369..32701) [333 bp, 110 aa] {OFF} YCR096C
           (HMRA2) - Regulatory protein MATa2p (no known function);
           sequence is the same as the last 119 residues of
           MATalpha2p [contig 123] FULL
          Length = 110

 Score = 46.2 bits (108), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 20/49 (40%), Positives = 30/49 (61%)

Query: 172 LESWYKNNIENPYLNDTDIRILMRETGFSRSQVKNWVANKRRKDKHSTI 220
           LE+W+  N  +PYL    I +L   T  S  Q++NW++N+RRK K + I
Sbjct: 47  LENWFHLNSSHPYLTRKQISLLSERTNLSSKQIRNWMSNRRRKSKKNPI 95

>Kwal_YGOB_HMalpha2 s33 (32369..32701) [333 bp, 110 aa] {ON}
           ANNOTATED BY YGOB - This is Kwal_33.12995
          Length = 110

 Score = 46.2 bits (108), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 20/49 (40%), Positives = 30/49 (61%)

Query: 172 LESWYKNNIENPYLNDTDIRILMRETGFSRSQVKNWVANKRRKDKHSTI 220
           LE+W+  N  +PYL    I +L   T  S  Q++NW++N+RRK K + I
Sbjct: 47  LENWFHLNSSHPYLTRKQISLLSERTNLSSKQIRNWMSNRRRKSKKNPI 95

>Kwal_33.matalpha2 s33 (284511..284843) [333 bp, 110 aa] {OFF}
           (matalpha2) - mating type alpha2 protein [contig MAT]
           FULL
          Length = 110

 Score = 46.2 bits (108), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 20/49 (40%), Positives = 30/49 (61%)

Query: 172 LESWYKNNIENPYLNDTDIRILMRETGFSRSQVKNWVANKRRKDKHSTI 220
           LE+W+  N  +PYL    I +L   T  S  Q++NW++N+RRK K + I
Sbjct: 47  LENWFHLNSSHPYLTRKQISLLSERTNLSSKQIRNWMSNRRRKSKKNPI 95

>Ecym_2247 Chr2 complement(486469..487518) [1050 bp, 349 aa] {ON}
           similar to Ashbya gossypii AFL049C
          Length = 349

 Score = 48.1 bits (113), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 27/89 (30%), Positives = 45/89 (50%), Gaps = 7/89 (7%)

Query: 129 EAISKEKCGIIFNVVTQDMMENGRKGGSSSYKGHR---LPKKHVQLLESWYKNNIENPYL 185
           E IS  + G     V    +    K    + K HR   LPK+ V +L  W +++ +NPY 
Sbjct: 196 EPISASQAGTAIPKVPHKAL----KSVEHTKKQHRRSNLPKETVDILNEWLRDHYDNPYP 251

Query: 186 NDTDIRILMRETGFSRSQVKNWVANKRRK 214
           +  + + L+++TG +  Q+ NW  N RR+
Sbjct: 252 SPQEKKELLKQTGLNPVQLSNWFINVRRR 280

>Suva_16.132 Chr16 complement(222346..223224) [879 bp, 292 aa] {ON}
           YPL177C (REAL)
          Length = 292

 Score = 48.1 bits (113), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 23/62 (37%), Positives = 37/62 (59%)

Query: 153 KGGSSSYKGHRLPKKHVQLLESWYKNNIENPYLNDTDIRILMRETGFSRSQVKNWVANKR 212
           K   +S +   LPK+ VQ+L +W  N++ NPY    + R L+ +TG ++ Q+ NW  N R
Sbjct: 144 KKKQNSGRRSNLPKETVQVLNTWLLNHLNNPYPTQQEKRELLIKTGLTKIQLSNWFINVR 203

Query: 213 RK 214
           R+
Sbjct: 204 RR 205

>NDAI0F02170 Chr6 (527340..528491) [1152 bp, 383 aa] {ON} Anc_6.170
           YGL096W
          Length = 383

 Score = 48.1 bits (113), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 22/67 (32%), Positives = 40/67 (59%), Gaps = 8/67 (11%)

Query: 148 MENGRKGGSSSYKGHRLPKKHVQLLESWYKNNIENPYLNDTDIRILMRETGFSRSQVKNW 207
           +++GR+          LPK+ +++L SW  N+++NPY    + R L+ +TG ++ Q+ NW
Sbjct: 262 LQHGRRSN--------LPKETIRILNSWLLNHLQNPYPTSQEKRDLLIKTGLTKVQLSNW 313

Query: 208 VANKRRK 214
             N RR+
Sbjct: 314 FINVRRR 320

>KLTH0H05236g Chr8 complement(465998..466702) [705 bp, 234 aa] {ON}
           some similarities with uniprot|P41817 Saccharomyces
           cerevisiae YPL177C CUP9 Homeodomain-containing
           transcriptional repressor of PTR2 which encodes a major
           peptide transporter imported peptides activate
           ubiquitin- dependent proteolysis resulting in
           degradation of Cup9p and de-repression of PTR2
           transcription
          Length = 234

 Score = 47.4 bits (111), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 34/51 (66%)

Query: 164 LPKKHVQLLESWYKNNIENPYLNDTDIRILMRETGFSRSQVKNWVANKRRK 214
           LPK+ V++L +W  +++ NPY +  + R L+ +TG S+ Q+ NW  N RR+
Sbjct: 109 LPKETVEILNAWLASHLNNPYPSPQEKRELLVQTGLSKVQLSNWFINVRRR 159

>ZYRO0G22044g Chr7 (1814345..1814950) [606 bp, 201 aa] {ON} some
           similarities with uniprot|P41817 Saccharomyces
           cerevisiae YPL177C CUP9 Homeodomain-containing
           transcriptional repressor of PTR2 which encodes a major
           peptide transporter imported peptides activate
           ubiquitin- dependent proteolysis resulting in
           degradation of Cup9p and de-repression of PTR2
           transcription
          Length = 201

 Score = 47.0 bits (110), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 23/60 (38%), Positives = 36/60 (60%)

Query: 155 GSSSYKGHRLPKKHVQLLESWYKNNIENPYLNDTDIRILMRETGFSRSQVKNWVANKRRK 214
           GS S +   LPK+ VQ+L  W  +++ NPY    + R L+ +TG ++ Q+ NW  N RR+
Sbjct: 75  GSRSGRRSNLPKETVQILNRWLLDHLGNPYPTPQEKRDLLIKTGLTKIQLSNWFINVRRR 134

>SAKL0A05610g Chr1 complement(506437..507399) [963 bp, 320 aa] {ON}
           some similarities with uniprot|P41817 Saccharomyces
           cerevisiae YPL177C CUP9 Homeodomain-containing
           transcriptional repressor of PTR2 which encodes a major
           peptide transporter imported peptides activate
           ubiquitin- dependent proteolysis resulting in
           degradation of Cup9p and de-repression of PTR2
           transcription
          Length = 320

 Score = 47.8 bits (112), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 25/72 (34%), Positives = 41/72 (56%)

Query: 143 VTQDMMENGRKGGSSSYKGHRLPKKHVQLLESWYKNNIENPYLNDTDIRILMRETGFSRS 202
            T  + ++ +K  S S K   LPK+ VQ+L +W   ++ NPY +  + R L+ +TG +  
Sbjct: 192 TTGRLSKSHQKRSSPSNKRTNLPKETVQILNNWLLAHLHNPYPSPQEKRELLLKTGLNPV 251

Query: 203 QVKNWVANKRRK 214
           Q+ NW  N RR+
Sbjct: 252 QLSNWFINVRRR 263

>KNAG0F02210 Chr6 complement(423243..424217) [975 bp, 324 aa] {ON}
           Anc_6.170 YPL177C
          Length = 324

 Score = 47.4 bits (111), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 22/58 (37%), Positives = 36/58 (62%)

Query: 157 SSYKGHRLPKKHVQLLESWYKNNIENPYLNDTDIRILMRETGFSRSQVKNWVANKRRK 214
           SS K   LP++ VQ+L +W  N++ +PY    +   L+R+TG ++ Q+ NW  N RR+
Sbjct: 239 SSSKRSNLPRETVQMLNNWLLNHLHDPYPTPHEKLELLRQTGLTKIQLSNWFINVRRR 296

>NDAI0I01320 Chr9 complement(318160..319389) [1230 bp, 409 aa] {ON}
           Anc_6.170 YGL096W
          Length = 409

 Score = 47.0 bits (110), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 27/85 (31%), Positives = 44/85 (51%), Gaps = 2/85 (2%)

Query: 130 AISKEKCGIIFNVVTQDMMENGRKGGSSSYKGHRLPKKHVQLLESWYKNNIENPYLNDTD 189
           +ISK+          Q+ M   RK GS   +   LP   VQ+L  W  +++ NPY    +
Sbjct: 280 SISKKNHHTTAITSPQNEMNMRRKKGSG--RRSSLPITTVQILNEWLLDHLTNPYPTTQE 337

Query: 190 IRILMRETGFSRSQVKNWVANKRRK 214
            + L+++TG ++ Q+ NW  N RR+
Sbjct: 338 KKELLKQTGLTKIQLSNWFINVRRR 362

>CAGL0C01551g Chr3 complement(169232..169897) [666 bp, 221 aa] {ON}
           similar to uniprot|P41817 Saccharomyces cerevisiae
           YPL177c CUP9
          Length = 221

 Score = 45.8 bits (107), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 21/57 (36%), Positives = 33/57 (57%)

Query: 158 SYKGHRLPKKHVQLLESWYKNNIENPYLNDTDIRILMRETGFSRSQVKNWVANKRRK 214
           S +   LPK  +Q+L  W  ++I NPY    + R L+ +TG ++ Q+ NW  N RR+
Sbjct: 76  SKRRSNLPKDTIQILNQWLLDHIHNPYPTQQEKRDLLIKTGLTKIQLSNWFINVRRR 132

>Smik_7.181 Chr7 (319819..320643) [825 bp, 274 aa] {ON} YGL096W
           (REAL)
          Length = 274

 Score = 46.2 bits (108), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 28/101 (27%), Positives = 46/101 (45%), Gaps = 7/101 (6%)

Query: 121 LVDPKEIPEAISKEKCGIIFNVVTQDMMENGRKGGSSSYKGHR-------LPKKHVQLLE 173
           +V    IP+ IS  +  ++   +  + +       S   K H+       LPK  V +L 
Sbjct: 149 MVGSYTIPQPISISRGKMVSGNINMNTVHGSSNEFSVKEKKHKAHGKRTNLPKATVSILN 208

Query: 174 SWYKNNIENPYLNDTDIRILMRETGFSRSQVKNWVANKRRK 214
            W   +I NPY    + R L+ +TG ++ Q+ NW  N RR+
Sbjct: 209 KWLLEHINNPYPTVQEKRELLAKTGLTKLQISNWFINARRR 249

>Skud_7.181 Chr7 (328628..329449) [822 bp, 274 aa] {ON} YGL096W
           (REAL)
          Length = 274

 Score = 45.4 bits (106), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 23/59 (38%), Positives = 32/59 (54%), Gaps = 4/59 (6%)

Query: 160 KGH----RLPKKHVQLLESWYKNNIENPYLNDTDIRILMRETGFSRSQVKNWVANKRRK 214
           KGH     LPK  V +L  W   +I NPY    + R L+ +TG ++ Q+ NW  N RR+
Sbjct: 191 KGHGKRSNLPKATVCILNQWLLEHIHNPYPTVQEKRDLLAKTGLTKLQISNWFINARRR 249

>KAFR0A04370 Chr1 complement(870590..871819) [1230 bp, 409 aa] {ON}
           Anc_6.170 YPL177C
          Length = 409

 Score = 45.8 bits (107), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 21/55 (38%), Positives = 34/55 (61%)

Query: 160 KGHRLPKKHVQLLESWYKNNIENPYLNDTDIRILMRETGFSRSQVKNWVANKRRK 214
           K   LPK+ VQ+L +W  N++ NPY    +   L+++TG ++ Q+ NW  N RR+
Sbjct: 271 KRSNLPKETVQILNNWLVNHLGNPYPTAIEKNELLKQTGLTKIQLSNWFINVRRR 325

>KNAG0M00500 Chr13 complement(79067..79963) [897 bp, 298 aa] {ON}
           Anc_6.170 YPL177C
          Length = 298

 Score = 45.1 bits (105), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 28/81 (34%), Positives = 39/81 (48%), Gaps = 13/81 (16%)

Query: 134 EKCGIIFNVVTQDMMENGRKGGSSSYKGHRLPKKHVQLLESWYKNNIENPYLNDTDIRIL 193
           EKCG            +GR    S Y    LPK  V +L  W  +++ NPY    + R L
Sbjct: 166 EKCG----------GSSGRDRKQSRYN---LPKDTVLILNRWLLDHLHNPYPTSQEKREL 212

Query: 194 MRETGFSRSQVKNWVANKRRK 214
           + +TG S+ Q+ NW  N RR+
Sbjct: 213 LIKTGLSKIQLSNWFINVRRR 233

>Suva_7.172 Chr7 (319317..320129) [813 bp, 270 aa] {ON} YGL096W
           (REAL)
          Length = 270

 Score = 44.3 bits (103), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 22/59 (37%), Positives = 31/59 (52%), Gaps = 4/59 (6%)

Query: 160 KGH----RLPKKHVQLLESWYKNNIENPYLNDTDIRILMRETGFSRSQVKNWVANKRRK 214
           KGH     LP   V +L  W   +I NPY    + R L+ +TG ++ Q+ NW  N RR+
Sbjct: 193 KGHGKRSNLPGATVHILNKWLLEHINNPYPTLQEKRELLAQTGLTKLQISNWFINARRR 251

>NCAS0D03570 Chr4 (664388..665161) [774 bp, 257 aa] {ON} Anc_6.170
           YGL096W
          Length = 257

 Score = 43.9 bits (102), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 31/51 (60%)

Query: 164 LPKKHVQLLESWYKNNIENPYLNDTDIRILMRETGFSRSQVKNWVANKRRK 214
           LP+  V++L  W   ++ NPY N  + ++L+  TG ++ Q+ NW  N RR+
Sbjct: 187 LPRGTVEVLNGWLLEHLNNPYPNVQEKKLLLELTGLTKVQLSNWFINVRRR 237

>TPHA0B02580 Chr2 (592073..592867) [795 bp, 264 aa] {ON} Anc_6.170
           YPL177C
          Length = 264

 Score = 43.1 bits (100), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 21/55 (38%), Positives = 30/55 (54%)

Query: 160 KGHRLPKKHVQLLESWYKNNIENPYLNDTDIRILMRETGFSRSQVKNWVANKRRK 214
           K   LPK+ V +L  W  N++ NPY    +   L+  TG S+ Q+ NW  N RR+
Sbjct: 156 KRSNLPKQSVDVLNKWLLNHLGNPYPTPKEKEELLELTGLSKIQLSNWFINVRRR 210

>TBLA0C03740 Chr3 complement(892360..893241) [882 bp, 293 aa] {ON}
           Anc_6.170 YPL177C
          Length = 293

 Score = 43.1 bits (100), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 21/55 (38%), Positives = 31/55 (56%)

Query: 160 KGHRLPKKHVQLLESWYKNNIENPYLNDTDIRILMRETGFSRSQVKNWVANKRRK 214
           K   LPK+ VQ+L  W  N++ NPY    +   L+  TG ++ Q+ NW  N RR+
Sbjct: 178 KRSNLPKETVQILNDWLLNHLRNPYPTPKEKSELLVLTGLTKIQLSNWFINVRRR 232

>Kwal_27.11092 s27 (635052..635741) [690 bp, 229 aa] {ON} YPL177C
           (CUP9) - putative DNA binding protein which shows
           similarity in homeobox domain to human proto-oncogene
           PBX1 [contig 31] FULL
          Length = 229

 Score = 41.6 bits (96), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 21/59 (35%), Positives = 33/59 (55%)

Query: 164 LPKKHVQLLESWYKNNIENPYLNDTDIRILMRETGFSRSQVKNWVANKRRKDKHSTISP 222
           LPK+ V +L +W   ++  PY +  + R L+ +TG S+ Q+ NW  N RR+   S   P
Sbjct: 125 LPKETVDILNNWLLAHLNYPYPSPQEKRELLIKTGLSKVQLSNWFINVRRRKVFSDYYP 183

>CAGL0H02959g Chr8 (277540..278319) [780 bp, 259 aa] {ON} some
           similarities with uniprot|P53147 Saccharomyces
           cerevisiae YGL096w TOS8
          Length = 259

 Score = 40.8 bits (94), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 21/61 (34%), Positives = 33/61 (54%)

Query: 154 GGSSSYKGHRLPKKHVQLLESWYKNNIENPYLNDTDIRILMRETGFSRSQVKNWVANKRR 213
           G  +  K   LPK+ V++L  W  ++I NPY    +   L  +TG ++ Q+ NW  N RR
Sbjct: 158 GQGAVKKRANLPKETVKILNEWLYDHINNPYPTPQEKMELSLKTGLTKIQLSNWFINVRR 217

Query: 214 K 214
           +
Sbjct: 218 R 218

>KLLA0B10450g Chr2 (912877..914046) [1170 bp, 389 aa] {ON} some
           similarities with uniprot|P41817 Saccharomyces
           cerevisiae YPL177C CUP9 Homeodomain-containing
           transcriptional repressor of PTR2 which encodes a major
           peptide transporter imported peptides activate
           ubiquitin- dependent proteolysis resulting in
           degradation of Cup9p and de-repression of PTR2
           transcription
          Length = 389

 Score = 41.2 bits (95), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 28/51 (54%)

Query: 164 LPKKHVQLLESWYKNNIENPYLNDTDIRILMRETGFSRSQVKNWVANKRRK 214
           LPK+ + +L  W   N+ NPY      R L+ +TG +  Q+ NW  N RR+
Sbjct: 256 LPKEVINVLNDWLLKNLHNPYPTPQVKRELLEKTGLNPVQLSNWFINVRRR 306

>CAGL0E00341g Chr5 (29668..29775,29840..30076,30143..30190) [393 bp,
           130 aa] {ON} similar to uniprot|P09091 Saccharomyces
           cerevisiae YCR097w Mating-type protein a1
          Length = 130

 Score = 32.3 bits (72), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 23/93 (24%), Positives = 44/93 (47%), Gaps = 12/93 (12%)

Query: 124 PKEIPEAISKEKCGIIFNVVTQDMMENGRKGGSSSYKGHRLPKKHVQLLESWYKNNIENP 183
           PK+  EA+ +          +Q ++   RK  + + +     K  +QL+E++ K      
Sbjct: 44  PKQTREALRRS--------ASQYLLYCQRKNKTYTTRKPLPAKAKLQLVETFSKKR---- 91

Query: 184 YLNDTDIRILMRETGFSRSQVKNWVANKRRKDK 216
           YL   +   L  + G + +QV+ W AN+R++ K
Sbjct: 92  YLTRCEKHQLAVQCGITTNQVQIWFANRRKRSK 124

>KAFR0K02400 Chr11 complement(496660..498972) [2313 bp, 770 aa] {ON}
           Anc_2.362 YDL095W
          Length = 770

 Score = 33.5 bits (75), Expect = 0.43,   Method: Composition-based stats.
 Identities = 19/56 (33%), Positives = 26/56 (46%), Gaps = 7/56 (12%)

Query: 166 KKHVQLLESWYKNNIENPYLNDTDIRILMRETG----FSRSQVKNWVANKRRKDKH 217
           K H+ L   WY  N E+P LN+T + +   + G    F  S  K W  NK   + H
Sbjct: 493 KAHLSL---WYVENNEHPLLNETSVHVSYEKPGFWAKFVESHEKMWNINKNLVESH 545

>CAGL0C00517g Chr3 (54154..56700) [2547 bp, 848 aa] {ON} similar to
           uniprot|P38274 Saccharomyces cerevisiae YBR133c HSL7
          Length = 848

 Score = 32.7 bits (73), Expect = 0.77,   Method: Compositional matrix adjust.
 Identities = 13/37 (35%), Positives = 21/37 (56%)

Query: 165 PKKHVQLLESWYKNNIENPYLNDTDIRILMRETGFSR 201
           PK+++ LL SW      +P L D   ++L+ E  +SR
Sbjct: 81  PKQYIGLLASWLDLETADPVLRDVAFQVLLNECKYSR 117

>KAFR0A04070 Chr1 complement(817388..819325) [1938 bp, 645 aa] {ON}
           Anc_8.716 YOR267C
          Length = 645

 Score = 32.3 bits (72), Expect = 0.92,   Method: Compositional matrix adjust.
 Identities = 20/84 (23%), Positives = 42/84 (50%), Gaps = 11/84 (13%)

Query: 64  GEVNFILNKVLQGLKILSSDQVFSKPDRV---------VIQNISQLTAIIVRLVNKKEDI 114
           GE+N    ++L+G+K L S  +  +  ++         +++ I   +A++ +   + +  
Sbjct: 315 GEINCCFRQILEGVKYLHSMGLAHRDLKLDNCCMTQDGILKLIDFGSAVVFQYPFEPDSD 374

Query: 115 INLQKGLV--DPKEIPEAISKEKC 136
           + +  G+V  DP   PEAI+  KC
Sbjct: 375 VQMAHGIVGSDPYLAPEAITSSKC 398

>ZYRO0F12298g Chr6 (997873..1001961) [4089 bp, 1362 aa] {ON}
           conserved hypothetical protein
          Length = 1362

 Score = 31.2 bits (69), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 28/103 (27%), Positives = 48/103 (46%), Gaps = 20/103 (19%)

Query: 103 IIVRLVNKKEDIINLQKGLVDPKEIPEAISKEKCGIIFNVVTQDMMENGRKGGSSSYK-- 160
            ++R   K E++ N+  G+   K+  E++ K         VT  +  + R  G S+ K  
Sbjct: 686 FVLRDRGKNENVWNI--GVKADKDASESLQK---------VTHFLYTDERHFGQSTSKLL 734

Query: 161 ------GHRLPKKHVQLLESWYKNNIENPYLN-DTDIRILMRE 196
                  H L +  + L ESW  NN ++ + N  TD+RIL+ +
Sbjct: 735 FDLVDNSHHLARLPISLQESWKHNNSDSHHQNTSTDVRILVND 777

>Suva_6.52 Chr6 (91156..94950) [3795 bp, 1264 aa] {ON} YFL008W
           (REAL)
          Length = 1264

 Score = 30.8 bits (68), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 19/54 (35%), Positives = 31/54 (57%)

Query: 47  NELMKLHSSICCTNIENGEVNFILNKVLQGLKILSSDQVFSKPDRVVIQNISQL 100
           NEL KL S I   N +  ++NF L + L  +  LS++Q  +  +R + +NI+ L
Sbjct: 508 NELKKLQSDIESANNQEYDLNFKLRETLVKIDDLSANQRETMKERKLRENIAML 561

>Kwal_14.921 s14 complement(112983..117173) [4191 bp, 1396 aa] {ON}
           YKL014C - Protein required for cell viability [contig
           245] PARTIAL
          Length = 1396

 Score = 30.4 bits (67), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 20/64 (31%), Positives = 35/64 (54%), Gaps = 4/64 (6%)

Query: 49  LMKLHSSICCTNIENGEVNFILNKVLQGLKILSSDQVFSKPDRVVIQNISQLTAIIVRLV 108
           LMKL SSI  TN    +V  +L  +L+   +  SDQ+ + P   +I ++     +I+R+ 
Sbjct: 276 LMKLASSINATNAIINKVTILLENLLKFSVVFRSDQLIASPVTALINSLQ----VIMRVE 331

Query: 109 NKKE 112
           ++ E
Sbjct: 332 DRTE 335

>SAKL0B02288g Chr2 (215750..219436) [3687 bp, 1228 aa] {ON} similar
           to uniprot|P32908 Saccharomyces cerevisiae YFL008W SMC1
           Subunit of the multiprotein cohesin complex essential
           protein involved in chromosome segregation and in
           double-strand DNA break repair SMC chromosomal ATPase
           family member binds DNA with a preference for DNA with
           secondary structure
          Length = 1228

 Score = 30.0 bits (66), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 18/57 (31%), Positives = 33/57 (57%)

Query: 48  ELMKLHSSICCTNIENGEVNFILNKVLQGLKILSSDQVFSKPDRVVIQNISQLTAII 104
           +L +L S I  TN +  E+N+ L +VL  L  LS++Q  +  +R + +N++ L  + 
Sbjct: 474 DLKELQSKIESTNSKEYELNYKLREVLVKLDDLSANQRETNKERKLRENVATLKRLF 530

>TDEL0G00190 Chr7 complement(36313..36360,36422..36712) [339 bp, 112
           aa] {ON}  silenced copy of a1 gene at T. delbrueckii
           HMR-1 locus
          Length = 112

 Score = 28.9 bits (63), Expect = 5.7,   Method: Compositional matrix adjust.
 Identities = 20/59 (33%), Positives = 29/59 (49%), Gaps = 3/59 (5%)

Query: 156 SSSYKGHRLPKKHVQLLESWYKNNIENPYLNDTDIRILMRETGFSRSQVKNWVANKRRK 214
           SS+    RL  +   LLE  Y+       LN  +  ++ +  G S  QV+ W ANKRR+
Sbjct: 49  SSTVTRKRLSDEVRLLLERLYE---RKRALNSKERHLVAKVCGLSPRQVRVWFANKRRR 104

>TDEL0C05820 Chr3 (1050752..1051042,1051104..1051151) [339 bp, 112
           aa] {ON} Anc_1.120 MATa1 gene at T. delbrueckii MAT
           locus
          Length = 112

 Score = 28.9 bits (63), Expect = 5.7,   Method: Compositional matrix adjust.
 Identities = 20/59 (33%), Positives = 29/59 (49%), Gaps = 3/59 (5%)

Query: 156 SSSYKGHRLPKKHVQLLESWYKNNIENPYLNDTDIRILMRETGFSRSQVKNWVANKRRK 214
           SS+    RL  +   LLE  Y+       LN  +  ++ +  G S  QV+ W ANKRR+
Sbjct: 49  SSTVTRKRLSDEVRLLLERLYE---RKRALNSKERHLVAKVCGLSPRQVRVWFANKRRR 104

>TDEL0E00330 Chr5 complement(75774..75821,75883..76173) [339 bp, 112
           aa] {ON}  silenced copy of a1 gene at T. delbrueckii
           HMR-2 locus
          Length = 112

 Score = 28.9 bits (63), Expect = 5.7,   Method: Compositional matrix adjust.
 Identities = 20/59 (33%), Positives = 29/59 (49%), Gaps = 3/59 (5%)

Query: 156 SSSYKGHRLPKKHVQLLESWYKNNIENPYLNDTDIRILMRETGFSRSQVKNWVANKRRK 214
           SS+    RL  +   LLE  Y+       LN  +  ++ +  G S  QV+ W ANKRR+
Sbjct: 49  SSTVTRKRLSDEVRLLLERLYE---RKRALNSKERHLVAKVCGLSPRQVRVWFANKRRR 104

>TBLA0G01060 Chr7
           complement(267271..267300,267367..267663,267722..267919)
           [525 bp, 174 aa] {ON}  silenced copy of mating-type a1
           gene at HMR locus
          Length = 174

 Score = 28.9 bits (63), Expect = 7.0,   Method: Compositional matrix adjust.
 Identities = 27/89 (30%), Positives = 40/89 (44%), Gaps = 16/89 (17%)

Query: 128 PEAISKEKCGIIFNVVTQDMMENGRKGGSSSYKGHRLPKKHVQLLESWYKNNIENPYLND 187
           PEA  KE      +V T           SS+ K  +LPK+  + LE  +K   +   LN 
Sbjct: 102 PEATCKEPINPQTHVFT-----------SSTRK--QLPKEAKEFLERVFK---KQHTLNS 145

Query: 188 TDIRILMRETGFSRSQVKNWVANKRRKDK 216
            +   + ++ G S  QV+ W  NKR + K
Sbjct: 146 KEREAVAKQCGISPIQVRVWFINKRMRSK 174

>TBLA0E01420 Chr5 (317436..323072) [5637 bp, 1878 aa] {ON} Anc_4.15
            YHL030W
          Length = 1878

 Score = 29.6 bits (65), Expect = 8.0,   Method: Compositional matrix adjust.
 Identities = 20/67 (29%), Positives = 35/67 (52%), Gaps = 3/67 (4%)

Query: 93   VIQNISQLTAIIVRLVNKKEDIINLQKGLVDPKEIPEAISKEKCGIIFNVVTQDMMENGR 152
            +IQN+S+   II    N KE      K L D  E+ + ++    G+++ + T+D+ E+  
Sbjct: 974  LIQNLSKKKEIID---NCKEIHFRFMKFLSDRDELVQEVASRGLGLVYELGTKDLQEDMV 1030

Query: 153  KGGSSSY 159
            KG   S+
Sbjct: 1031 KGLLKSF 1037

>NDAI0A00670 Chr1
           complement(124998..125033,125093..125308,125369..125404)
           [288 bp, 95 aa] {ON}
          Length = 95

 Score = 28.1 bits (61), Expect = 8.3,   Method: Compositional matrix adjust.
 Identities = 12/34 (35%), Positives = 18/34 (52%)

Query: 183 PYLNDTDIRILMRETGFSRSQVKNWVANKRRKDK 216
           P+LN  +   + +  G S  QV+ W  NKR + K
Sbjct: 60  PWLNTKEREFVAKSCGMSALQVRVWFINKRMRTK 93

>NDAI0H00100 Chr8 complement(758..793,853..1068,1129..1164) [288 bp,
           95 aa] {ON} silent copy of MATa1 gene at HMRa
          Length = 95

 Score = 28.1 bits (61), Expect = 8.3,   Method: Compositional matrix adjust.
 Identities = 12/34 (35%), Positives = 18/34 (52%)

Query: 183 PYLNDTDIRILMRETGFSRSQVKNWVANKRRKDK 216
           P+LN  +   + +  G S  QV+ W  NKR + K
Sbjct: 60  PWLNTKEREFVAKSCGMSALQVRVWFINKRMRTK 93

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.316    0.134    0.381 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 23,802,452
Number of extensions: 994962
Number of successful extensions: 3368
Number of sequences better than 10.0: 102
Number of HSP's gapped: 3404
Number of HSP's successfully gapped: 104
Length of query: 230
Length of database: 53,481,399
Length adjustment: 106
Effective length of query: 124
Effective length of database: 41,326,803
Effective search space: 5124523572
Effective search space used: 5124523572
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 64 (29.3 bits)