Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Cgla_YGOB_Anc_5.7075.707ON1301306882e-94
TBLA0I016905.707ON320114860.003
ZYRO0B16434g5.707ON23786850.004
TPHA0E001805.707ON16594700.31
NCAS0C031908.341ON99439700.50
TPHA0C005808.359ON97660700.51
CAGL0L09801g2.661ON31977671.3
CAGL0F07425g6.145ON61427671.3
ADL093W7.201ON112043643.2
Smik_14.2792.267ON65651633.9
Suva_4.2943.269ON37019634.2
Kwal_55.201715.379ON69867616.8
NOTE: 14 genes in the same pillar as Cgla_YGOB_Anc_5.707 were not hit in these BLAST results
LIST: Kpol_1043.74 Skud_9.16 Smik_9.17 YIL152W NCAS0G00210 KAFR0D02200 Suva_9.36 KLTH0E00946g Kwal_55.19675 TDEL0B02130 KLLA0A00506g KNAG0L02160 NDAI0F00270 SAKL0E15026g

BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Cgla_YGOB_Anc_5.707
         (130 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Cgla_YGOB_Anc_5.707 Chr8 complement(657571..657963) [393 bp, 130...   269   2e-94
TBLA0I01690 Chr9 complement(376667..377629) [963 bp, 320 aa] {ON...    38   0.003
ZYRO0B16434g Chr2 complement(1333310..1334023) [714 bp, 237 aa] ...    37   0.004
TPHA0E00180 Chr5 (19852..20349) [498 bp, 165 aa] {ON} Anc_5.707 ...    32   0.31 
NCAS0C03190 Chr3 complement(626407..629391) [2985 bp, 994 aa] {O...    32   0.50 
TPHA0C00580 Chr3 complement(107936..110866) [2931 bp, 976 aa] {O...    32   0.51 
CAGL0L09801g Chr12 complement(1050844..1051803) [960 bp, 319 aa]...    30   1.3  
CAGL0F07425g Chr6 complement(722699..724543) [1845 bp, 614 aa] {...    30   1.3  
ADL093W Chr4 (518394..521756) [3363 bp, 1120 aa] {ON} Syntenic h...    29   3.2  
Smik_14.279 Chr14 complement(513918..515888) [1971 bp, 656 aa] {...    29   3.9  
Suva_4.294 Chr4 complement(518976..520088) [1113 bp, 370 aa] {ON...    29   4.2  
Kwal_55.20171 s55 complement(281102..283198) [2097 bp, 698 aa] {...    28   6.8  

>Cgla_YGOB_Anc_5.707 Chr8 complement(657571..657963) [393 bp, 130
           aa] {ON} ANNOTATED BY YGOB -
          Length = 130

 Score =  269 bits (688), Expect = 2e-94,   Method: Compositional matrix adjust.
 Identities = 130/130 (100%), Positives = 130/130 (100%)

Query: 1   MIRITEVVFRKRSKSVHNKRKPLAAPRFRRTVYRQGTQNHLRLPFLHSFKTVLRQRAEGA 60
           MIRITEVVFRKRSKSVHNKRKPLAAPRFRRTVYRQGTQNHLRLPFLHSFKTVLRQRAEGA
Sbjct: 1   MIRITEVVFRKRSKSVHNKRKPLAAPRFRRTVYRQGTQNHLRLPFLHSFKTVLRQRAEGA 60

Query: 61  TISVPVCRCIQLSPNEIMVWTNANGVEPLILHSNTKLQIATTKYTRIQYCPSNKFQLTRR 120
           TISVPVCRCIQLSPNEIMVWTNANGVEPLILHSNTKLQIATTKYTRIQYCPSNKFQLTRR
Sbjct: 61  TISVPVCRCIQLSPNEIMVWTNANGVEPLILHSNTKLQIATTKYTRIQYCPSNKFQLTRR 120

Query: 121 ISWYFQWELH 130
           ISWYFQWELH
Sbjct: 121 ISWYFQWELH 130

>TBLA0I01690 Chr9 complement(376667..377629) [963 bp, 320 aa] {ON}
           Anc_5.707 YIL152W
          Length = 320

 Score = 37.7 bits (86), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 26/114 (22%), Positives = 50/114 (43%), Gaps = 14/114 (12%)

Query: 28  FRRTVYRQGTQNHLRLPFLHSFKTVLRQ--------RAEGATISVPVCRCIQLSPNEIMV 79
           F +  Y +    +L+ P ++   T+L          R         + +  +LS  E++V
Sbjct: 208 FLKVAYSKSYNEYLKTPLVNGLHTILSNLNTRIHSSRNLKFDKIFQISKLTKLSDTELLV 267

Query: 80  WTNANGVEPLILHSNTKL-QIATTKYTRIQYCPSNK---FQLTRRISWYFQWEL 129
            TN N    L+LHS++ + Q     YT  +   +N     ++T  ++WY +W+ 
Sbjct: 268 ITNTNS--SLLLHSDSTIGQSEFNNYTLKEKVATNSISILKITEDLNWYLKWKF 319

>ZYRO0B16434g Chr2 complement(1333310..1334023) [714 bp, 237 aa]
           {ON} weakly similar to uniprot|P40455 Saccharomyces
           cerevisiae YIL152W Hypothetical ORF
          Length = 237

 Score = 37.4 bits (85), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 24/86 (27%), Positives = 42/86 (48%), Gaps = 2/86 (2%)

Query: 46  LHSFKTVLR--QRAEGATISVPVCRCIQLSPNEIMVWTNANGVEPLILHSNTKLQIATTK 103
           L+ F  +++  Q+ +   I V +   I LSP EIMV ++   V+  ILHS+  +      
Sbjct: 151 LNDFNLMVKTSQQNQNYDILVDIRHAIWLSPFEIMVISDDPRVKRAILHSHKAIPKFVNS 210

Query: 104 YTRIQYCPSNKFQLTRRISWYFQWEL 129
            +R+  C      L   ++WY +W+ 
Sbjct: 211 PSRLAICSKCCLTLYNDMNWYLKWKF 236

>TPHA0E00180 Chr5 (19852..20349) [498 bp, 165 aa] {ON} Anc_5.707
           YIL152W
          Length = 165

 Score = 31.6 bits (70), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 26/94 (27%), Positives = 45/94 (47%), Gaps = 7/94 (7%)

Query: 41  LRLPFLHSFKTVLRQRAEGATISVPVCRCIQLSPNEIMVWTNANGVEPLILHSNTKLQIA 100
           LRL  ++ F  +L+  +        +    +LS NE +V T     + LILHSN K  + 
Sbjct: 62  LRLS-INKFNMLLKASSNKYDEIHDINSIEKLSQNEFIVTTI--DSKTLILHSNEKNVVN 118

Query: 101 TTKYT--RIQYCPSNKFQLT--RRISWYFQWELH 130
           +  YT    Q   ++K+ L+    ++WY  W+ +
Sbjct: 119 SNNYTLKYQQVAINSKYYLSLYNDLNWYLDWKFY 152

>NCAS0C03190 Chr3 complement(626407..629391) [2985 bp, 994 aa] {ON}
           Anc_8.341
          Length = 994

 Score = 31.6 bits (70), Expect = 0.50,   Method: Composition-based stats.
 Identities = 13/39 (33%), Positives = 22/39 (56%)

Query: 4   ITEVVFRKRSKSVHNKRKPLAAPRFRRTVYRQGTQNHLR 42
           +   V R+ S S+HN ++ L+ P   R V  QG+  H++
Sbjct: 694 LASTVSRESSNSLHNLKRILSPPEKLRQVISQGSDKHMK 732

>TPHA0C00580 Chr3 complement(107936..110866) [2931 bp, 976 aa] {ON}
           Anc_8.359 YLR148W
          Length = 976

 Score = 31.6 bits (70), Expect = 0.51,   Method: Composition-based stats.
 Identities = 17/60 (28%), Positives = 27/60 (45%), Gaps = 1/60 (1%)

Query: 65  PVCRCIQLSPNEIMVWTNANGVEPLILHSNTKLQIATTKYTRIQYCPSNKFQLTR-RISW 123
           P   CI +S + IM W N +   P+    N K+     ++ ++    +NKF     R SW
Sbjct: 198 PYIECIIVSDSNIMYWGNIDSDNPIRSLKNRKVPEEKEQFDKLSANTTNKFSTYEDRFSW 257

>CAGL0L09801g Chr12 complement(1050844..1051803) [960 bp, 319 aa]
           {ON} similar to uniprot|P29703 Saccharomyces cerevisiae
           YKL019w RAM2 protein farnesyltransferase
          Length = 319

 Score = 30.4 bits (67), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 21/77 (27%), Positives = 30/77 (38%), Gaps = 3/77 (3%)

Query: 18  NKRKPLAAPRFRRTVYRQGTQNHLRLPFLHSFKTVLRQRAEGATISVPVCRCIQLSPNEI 77
           N   P      RR +Y      H    + H+  +  +  AE   I   +   I+L+P  I
Sbjct: 165 NHELPFTDMMIRRDIYNNSAWTHRMFVWQHTESSSTQVIAE---IDNYLRGKIELAPQNI 221

Query: 78  MVWTNANGVEPLILHSN 94
             WT   G+  L LH N
Sbjct: 222 SCWTYLRGLYELFLHEN 238

>CAGL0F07425g Chr6 complement(722699..724543) [1845 bp, 614 aa] {ON}
           similar to uniprot|P53137 Saccharomyces cerevisiae
           YGL110c
          Length = 614

 Score = 30.4 bits (67), Expect = 1.3,   Method: Composition-based stats.
 Identities = 11/27 (40%), Positives = 20/27 (74%)

Query: 4   ITEVVFRKRSKSVHNKRKPLAAPRFRR 30
           I E + +++ KS++  +KPL+ PR+RR
Sbjct: 355 IVESIPKEKPKSINTIKKPLSGPRYRR 381

>ADL093W Chr4 (518394..521756) [3363 bp, 1120 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YIL026C (IRR1)
          Length = 1120

 Score = 29.3 bits (64), Expect = 3.2,   Method: Composition-based stats.
 Identities = 15/43 (34%), Positives = 22/43 (51%)

Query: 10  RKRSKSVHNKRKPLAAPRFRRTVYRQGTQNHLRLPFLHSFKTV 52
           R   K+VH     +A  +  RTV     +N ++L F+H FK V
Sbjct: 325 RPSVKAVHKLESTIADIQGTRTVLESNIENIIKLCFVHRFKDV 367

>Smik_14.279 Chr14 complement(513918..515888) [1971 bp, 656 aa] {ON}
           YNL047C (REAL)
          Length = 656

 Score = 28.9 bits (63), Expect = 3.9,   Method: Composition-based stats.
 Identities = 14/51 (27%), Positives = 24/51 (47%)

Query: 45  FLHSFKTVLRQRAEGATISVPVCRCIQLSPNEIMVWTNANGVEPLILHSNT 95
           FLH FKT  + +     +S+P+  C     ++     +  G    ILH+N+
Sbjct: 473 FLHEFKTPDKHKFTAPLMSIPLVECTVTEHSKKTKSNSEQGNNKFILHTNS 523

>Suva_4.294 Chr4 complement(518976..520088) [1113 bp, 370 aa] {ON}
           YBR057C (REAL)
          Length = 370

 Score = 28.9 bits (63), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 13/19 (68%), Positives = 15/19 (78%)

Query: 6   EVVFRKRSKSVHNKRKPLA 24
           EVVFRK S S+H+K K LA
Sbjct: 250 EVVFRKLSSSLHSKEKELA 268

>Kwal_55.20171 s55 complement(281102..283198) [2097 bp, 698 aa] {ON}
           YHR084W (STE12) - Transcription factor [contig 153] FULL
          Length = 698

 Score = 28.1 bits (61), Expect = 6.8,   Method: Composition-based stats.
 Identities = 17/67 (25%), Positives = 28/67 (41%), Gaps = 3/67 (4%)

Query: 11  KRSKSVHNKRKPLAAPRFRRTVYRQGTQNHLRLPFLHSFKTVLRQRAEGATISVPVCRCI 70
           +  K VH  RKP+  PR     Y+  T++        +F       AE +  ++P  R  
Sbjct: 612 RAQKQVHRTRKPMHMPRSTMAAYQSSTRSETENDNTVTFSI---PAAESSKTAIPAPRAK 668

Query: 71  QLSPNEI 77
              P++I
Sbjct: 669 ASPPDKI 675

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.326    0.135    0.425 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 13,142,826
Number of extensions: 475471
Number of successful extensions: 1408
Number of sequences better than 10.0: 14
Number of HSP's gapped: 1407
Number of HSP's successfully gapped: 14
Length of query: 130
Length of database: 53,481,399
Length adjustment: 97
Effective length of query: 33
Effective length of database: 42,358,797
Effective search space: 1397840301
Effective search space used: 1397840301
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.7 bits)
S2: 59 (27.3 bits)