Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Cgla_YGOB_Anc_3.4843.484ON71492604e-31
SAKL0C10736g3.195ON94736576.3
NOTE: 11 genes in the same pillar as Cgla_YGOB_Anc_3.484 were not hit in these BLAST results
LIST: Kpol_YGOB_YPR145C-A KAFR0G03675 Skud_16.440 Smik_16.397 YPR145C-A NCAS0F03520 KNAG0A07925 Suva_16.475 Agos_YGOB_YPR145C-A TPHA0D04205 NDAI0B05820

BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Cgla_YGOB_Anc_3.484
         (71 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Cgla_YGOB_Anc_3.484 Chr12 (935434..935649) [216 bp, 71 aa] {ON} ...   104   4e-31
SAKL0C10736g Chr3 (972764..975607) [2844 bp, 947 aa] {ON} simila...    27   6.3  

>Cgla_YGOB_Anc_3.484 Chr12 (935434..935649) [216 bp, 71 aa] {ON}
          ANNOTATED BY YGOB -
          Length = 71

 Score =  104 bits (260), Expect = 4e-31,   Method: Compositional matrix adjust.
 Identities = 49/49 (100%), Positives = 49/49 (100%)

Query: 1  MDQTLQKIKDIFFGWKKEKAVDRTSERWQKRHAVVTRHDLLNGHNDAIK 49
          MDQTLQKIKDIFFGWKKEKAVDRTSERWQKRHAVVTRHDLLNGHNDAIK
Sbjct: 1  MDQTLQKIKDIFFGWKKEKAVDRTSERWQKRHAVVTRHDLLNGHNDAIK 49

>SAKL0C10736g Chr3 (972764..975607) [2844 bp, 947 aa] {ON} similar
           to uniprot|Q757K1 Ashbya gossypii and weakly similar to
           YDR006C, uniprot|P40317 Saccharomyces cerevisiae YDR006C
           (SOK1),
          Length = 947

 Score = 26.6 bits (57), Expect = 6.3,   Method: Composition-based stats.
 Identities = 11/36 (30%), Positives = 18/36 (50%)

Query: 13  FGWKKEKAVDRTSERWQKRHAVVTRHDLLNGHNDAI 48
           +G  K+K   + +     RHA++  H L + HN  I
Sbjct: 309 YGINKKKKTSKANNHHSLRHAILMNHRLQSSHNGQI 344

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.320    0.132    0.410 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 5,236,289
Number of extensions: 135455
Number of successful extensions: 371
Number of sequences better than 10.0: 2
Number of HSP's gapped: 371
Number of HSP's successfully gapped: 2
Length of query: 71
Length of database: 53,481,399
Length adjustment: 44
Effective length of query: 27
Effective length of database: 48,436,095
Effective search space: 1307774565
Effective search space used: 1307774565
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 59 (27.3 bits)