Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Cgla_YGOB_Anc_2.2912.291ON72723802e-49
NCAS0G037602.291ON72723578e-46
Smik_14.3062.291ON72723491e-44
YNL024C-A (KSH1)2.291ON72723491e-44
Suva_14.3222.291ON72723463e-44
KNAG0H019702.291ON72723463e-44
NDAI0G006902.291ON72723455e-44
Kpol_1003.412.291ON72723334e-42
SAKL0E07568g2.291ON72723263e-41
TBLA0B069702.291ON72723256e-41
TPHA0C034302.291ON72723203e-40
ADL210W2.291ON72723152e-39
KLLA0E08251g2.291ON72723134e-39
Skud_14.3042.291ON72723101e-38
TDEL0G022102.291ON72723082e-38
KAFR0H032802.291ON72723056e-38
KLTH0G10472g2.291ON72722943e-36
Kwal_YGOB_Anc_2.2912.291ON72722934e-36
ZYRO0A01980g2.291ON72722873e-35
Ecym_33302.291ON72722597e-31
SAKL0F09702g7.283ON67638592.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Cgla_YGOB_Anc_2.291
         (72 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Cgla_YGOB_Anc_2.291 Chr13 complement(701547..701765) [219 bp, 72...   150   2e-49
NCAS0G03760 Chr7 complement(693645..693863) [219 bp, 72 aa] {ON}...   142   8e-46
Smik_14.306 Chr14 complement(548999..549214) [216 bp, 72 aa] {ON...   139   1e-44
YNL024C-A Chr14 complement(586602..586820) [219 bp, 72 aa] {ON} ...   139   1e-44
Suva_14.322 Chr14 complement(569440..569655) [216 bp, 72 aa] {ON...   137   3e-44
KNAG0H01970 Chr8 complement(347994..348212) [219 bp, 72 aa] {ON}...   137   3e-44
NDAI0G00690 Chr7 (151360..151578) [219 bp, 72 aa] {ON} Anc_2.291...   137   5e-44
Kpol_1003.41 s1003 (99502..99720) [219 bp, 72 aa] {ON} (99502..9...   132   4e-42
SAKL0E07568g Chr5 complement(613454..613672) [219 bp, 72 aa] {ON...   130   3e-41
TBLA0B06970 Chr2 (1648736..1648954) [219 bp, 72 aa] {ON} Anc_2.2...   129   6e-41
TPHA0C03430 Chr3 (751723..751941) [219 bp, 72 aa] {ON} Anc_2.291...   127   3e-40
ADL210W Chr4 (334320..334538) [219 bp, 72 aa] {ON} Syntenic homo...   125   2e-39
KLLA0E08251g Chr5 complement(744523..744741) [219 bp, 72 aa] {ON...   125   4e-39
Skud_14.304 Chr14 complement(557335..557550) [216 bp, 72 aa] {ON...   124   1e-38
TDEL0G02210 Chr7 (434303..434521) [219 bp, 72 aa] {ON} Anc_2.291...   123   2e-38
KAFR0H03280 Chr8 complement(626054..626272) [219 bp, 72 aa] {ON}...   122   6e-38
KLTH0G10472g Chr7 (885262..885480) [219 bp, 72 aa] {ON} highly s...   117   3e-36
Kwal_YGOB_Anc_2.291 s27 complement(830525..830743) [219 bp, 72 a...   117   4e-36
ZYRO0A01980g Chr1 (164037..164255) [219 bp, 72 aa] {ON} highly s...   115   3e-35
Ecym_3330 Chr3 (631388..631606) [219 bp, 72 aa] {ON} similar to ...   104   7e-31
SAKL0F09702g Chr6 complement(743532..745562) [2031 bp, 676 aa] {...    27   2.7  

>Cgla_YGOB_Anc_2.291 Chr13 complement(701547..701765) [219 bp, 72
          aa] {ON} ANNOTATED BY YGOB -
          Length = 72

 Score =  150 bits (380), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 72/72 (100%), Positives = 72/72 (100%)

Query: 1  MSALFNFASLLQVILLLICSCTYIHTQWPSLLDRYKNHDILGAFWKMARIGERASPYVSV 60
          MSALFNFASLLQVILLLICSCTYIHTQWPSLLDRYKNHDILGAFWKMARIGERASPYVSV
Sbjct: 1  MSALFNFASLLQVILLLICSCTYIHTQWPSLLDRYKNHDILGAFWKMARIGERASPYVSV 60

Query: 61 ACILMAINQFNS 72
          ACILMAINQFNS
Sbjct: 61 ACILMAINQFNS 72

>NCAS0G03760 Chr7 complement(693645..693863) [219 bp, 72 aa] {ON}
          Anc_2.291 YNL024C-A
          Length = 72

 Score =  142 bits (357), Expect = 8e-46,   Method: Compositional matrix adjust.
 Identities = 65/72 (90%), Positives = 71/72 (98%)

Query: 1  MSALFNFASLLQVILLLICSCTYIHTQWPSLLDRYKNHDILGAFWKMARIGERASPYVSV 60
          MSALFNF+SLLQVILLLICSCTY+HTQWPSLLDRYK+H+ LGAFWKMARIGERASPYVS+
Sbjct: 1  MSALFNFSSLLQVILLLICSCTYVHTQWPSLLDRYKDHEALGAFWKMARIGERASPYVSL 60

Query: 61 ACILMAINQFNS 72
          ACI+MAINQFNS
Sbjct: 61 ACIIMAINQFNS 72

>Smik_14.306 Chr14 complement(548999..549214) [216 bp, 72 aa] {ON}
          YNL024C-A (REAL)
          Length = 72

 Score =  139 bits (349), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 63/72 (87%), Positives = 70/72 (97%)

Query: 1  MSALFNFASLLQVILLLICSCTYIHTQWPSLLDRYKNHDILGAFWKMARIGERASPYVSV 60
          MSALFNF SLLQVILLLICSC+Y+H QWPSLLDRYKNH++LGAFWKMAR+GERASPYVS+
Sbjct: 1  MSALFNFRSLLQVILLLICSCSYVHGQWPSLLDRYKNHEVLGAFWKMARVGERASPYVSL 60

Query: 61 ACILMAINQFNS 72
          ACILMAI+QFNS
Sbjct: 61 ACILMAISQFNS 72

>YNL024C-A Chr14 complement(586602..586820) [219 bp, 72 aa] {ON}
          KSH1Essential protein suggested to function early in
          the secretory pathway; inviability is suppressed by
          overexpression of Golgi protein Tvp23p; ortholog of
          human Kish
          Length = 72

 Score =  139 bits (349), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 63/72 (87%), Positives = 70/72 (97%)

Query: 1  MSALFNFASLLQVILLLICSCTYIHTQWPSLLDRYKNHDILGAFWKMARIGERASPYVSV 60
          MSALFNF SLLQVILLLICSC+Y+H QWPSLLDRYKNH++LGAFWKMAR+GERASPYVS+
Sbjct: 1  MSALFNFRSLLQVILLLICSCSYVHGQWPSLLDRYKNHEVLGAFWKMARVGERASPYVSL 60

Query: 61 ACILMAINQFNS 72
          ACILMAI+QFNS
Sbjct: 61 ACILMAISQFNS 72

>Suva_14.322 Chr14 complement(569440..569655) [216 bp, 72 aa] {ON}
          YNL024C-A (REAL)
          Length = 72

 Score =  137 bits (346), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 63/72 (87%), Positives = 69/72 (95%)

Query: 1  MSALFNFASLLQVILLLICSCTYIHTQWPSLLDRYKNHDILGAFWKMARIGERASPYVSV 60
          MSALFNF SLLQVILLLICSC+Y+H QWPSLLDRYKNH++ GAFWKMARIGERASPYVS+
Sbjct: 1  MSALFNFRSLLQVILLLICSCSYVHGQWPSLLDRYKNHEVFGAFWKMARIGERASPYVSL 60

Query: 61 ACILMAINQFNS 72
          ACILMAI+QFNS
Sbjct: 61 ACILMAISQFNS 72

>KNAG0H01970 Chr8 complement(347994..348212) [219 bp, 72 aa] {ON}
          Anc_2.291 YNL024C-A
          Length = 72

 Score =  137 bits (346), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 63/72 (87%), Positives = 69/72 (95%)

Query: 1  MSALFNFASLLQVILLLICSCTYIHTQWPSLLDRYKNHDILGAFWKMARIGERASPYVSV 60
          MSALFNF+SLLQVILLLICSCTY+HTQWPSLLDRYK H+ LGAFWKMAR+GERASPYVS+
Sbjct: 1  MSALFNFSSLLQVILLLICSCTYVHTQWPSLLDRYKEHEALGAFWKMARLGERASPYVSL 60

Query: 61 ACILMAINQFNS 72
          ACILMA+NQF S
Sbjct: 61 ACILMALNQFMS 72

>NDAI0G00690 Chr7 (151360..151578) [219 bp, 72 aa] {ON} Anc_2.291
          YNL024C-A
          Length = 72

 Score =  137 bits (345), Expect = 5e-44,   Method: Compositional matrix adjust.
 Identities = 63/72 (87%), Positives = 69/72 (95%)

Query: 1  MSALFNFASLLQVILLLICSCTYIHTQWPSLLDRYKNHDILGAFWKMARIGERASPYVSV 60
          MSALFNF SLLQVILLLICSCTY+H+QWPS+LDRYK+H  LGAFWKMARIGERASPYVS+
Sbjct: 1  MSALFNFRSLLQVILLLICSCTYVHSQWPSILDRYKDHGALGAFWKMARIGERASPYVSL 60

Query: 61 ACILMAINQFNS 72
          ACI+MAINQFNS
Sbjct: 61 ACIIMAINQFNS 72

>Kpol_1003.41 s1003 (99502..99720) [219 bp, 72 aa] {ON}
          (99502..99720) [219 nt, 73 aa]
          Length = 72

 Score =  132 bits (333), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 60/72 (83%), Positives = 67/72 (93%)

Query: 1  MSALFNFASLLQVILLLICSCTYIHTQWPSLLDRYKNHDILGAFWKMARIGERASPYVSV 60
          MSALFNF SLLQVILLLICS TYIH+QWPS LDRYK+  +LGAFWK+ARIGERASPYVS+
Sbjct: 1  MSALFNFTSLLQVILLLICSSTYIHSQWPSFLDRYKDQSVLGAFWKLARIGERASPYVSL 60

Query: 61 ACILMAINQFNS 72
          ACI+MA+NQFNS
Sbjct: 61 ACIIMAVNQFNS 72

>SAKL0E07568g Chr5 complement(613454..613672) [219 bp, 72 aa] {ON}
          similar to uniprot|Q8TGJ3 Saccharomyces cerevisiae
          YNL024C-A Identified by gene-trapping, microarray-based
          expression analysis, and genome-wide homology searching
          Length = 72

 Score =  130 bits (326), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 61/72 (84%), Positives = 65/72 (90%)

Query: 1  MSALFNFASLLQVILLLICSCTYIHTQWPSLLDRYKNHDILGAFWKMARIGERASPYVSV 60
          MSALFNF SLLQVILLLICSCTYIHTQWPSLLDRYKNH +L  FWK AR+GERASPYVS+
Sbjct: 1  MSALFNFRSLLQVILLLICSCTYIHTQWPSLLDRYKNHGMLNVFWKFARVGERASPYVSL 60

Query: 61 ACILMAINQFNS 72
          ACI MAI+QF S
Sbjct: 61 ACICMAISQFKS 72

>TBLA0B06970 Chr2 (1648736..1648954) [219 bp, 72 aa] {ON}
          Anc_2.291 YNL024C-A
          Length = 72

 Score =  129 bits (325), Expect = 6e-41,   Method: Compositional matrix adjust.
 Identities = 61/72 (84%), Positives = 65/72 (90%)

Query: 1  MSALFNFASLLQVILLLICSCTYIHTQWPSLLDRYKNHDILGAFWKMARIGERASPYVSV 60
          MSALF+F S+LQVILLLICS TYIH QWPSLLDRYKNH  LGAFWKMARIGERASPYVS+
Sbjct: 1  MSALFSFRSMLQVILLLICSSTYIHCQWPSLLDRYKNHSTLGAFWKMARIGERASPYVSL 60

Query: 61 ACILMAINQFNS 72
          ACI MAI+QFN 
Sbjct: 61 ACIAMAISQFNE 72

>TPHA0C03430 Chr3 (751723..751941) [219 bp, 72 aa] {ON} Anc_2.291
          YNL024C-A
          Length = 72

 Score =  127 bits (320), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 57/72 (79%), Positives = 66/72 (91%)

Query: 1  MSALFNFASLLQVILLLICSCTYIHTQWPSLLDRYKNHDILGAFWKMARIGERASPYVSV 60
          MSALFNF+SLLQVILLLICS TYIH+QWPSL DRYK+  +L  FWK++RIGERASPYVS+
Sbjct: 1  MSALFNFSSLLQVILLLICSSTYIHSQWPSLFDRYKDTGVLSTFWKLSRIGERASPYVSI 60

Query: 61 ACILMAINQFNS 72
          ACI+MA+NQFNS
Sbjct: 61 ACIIMAVNQFNS 72

>ADL210W Chr4 (334320..334538) [219 bp, 72 aa] {ON} Syntenic
          homolog of Saccharomyces cerevisiae YNL024CX; YNL024CX
          was overlooked in Saccharomyces cerevisiae
          Length = 72

 Score =  125 bits (315), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 57/72 (79%), Positives = 63/72 (87%)

Query: 1  MSALFNFASLLQVILLLICSCTYIHTQWPSLLDRYKNHDILGAFWKMARIGERASPYVSV 60
          MSALF F++LLQVILLLICS TY+H QWPSLL+RYK H +LG FWK ARIGERASPYVS+
Sbjct: 1  MSALFKFSALLQVILLLICSSTYVHAQWPSLLERYKEHSVLGIFWKFARIGERASPYVSI 60

Query: 61 ACILMAINQFNS 72
          ACI MAINQ NS
Sbjct: 61 ACIAMAINQINS 72

>KLLA0E08251g Chr5 complement(744523..744741) [219 bp, 72 aa] {ON}
          highly similar to uniprot|Q8TGJ3 Saccharomyces
          cerevisiae YNL024C-A Identified by gene-trapping
          microarray-based expression analysis and genome-wide
          homology searching
          Length = 72

 Score =  125 bits (313), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 59/72 (81%), Positives = 63/72 (87%)

Query: 1  MSALFNFASLLQVILLLICSCTYIHTQWPSLLDRYKNHDILGAFWKMARIGERASPYVSV 60
          MSALFNF SLLQVILL ICSCTYIH Q PSLLDRYK+  ILG FWK ARIGERASPYVS+
Sbjct: 1  MSALFNFKSLLQVILLFICSCTYIHAQRPSLLDRYKDSGILGVFWKFARIGERASPYVSL 60

Query: 61 ACILMAINQFNS 72
          ACI MA++QFNS
Sbjct: 61 ACIAMAVSQFNS 72

>Skud_14.304 Chr14 complement(557335..557550) [216 bp, 72 aa] {ON}
          YNL024C-A (REAL)
          Length = 72

 Score =  124 bits (310), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 63/72 (87%), Positives = 70/72 (97%)

Query: 1  MSALFNFASLLQVILLLICSCTYIHTQWPSLLDRYKNHDILGAFWKMARIGERASPYVSV 60
          MSALFNF SLLQV+LLLICSC+Y+H QWPSLLDRYKNH++LGAFWKMARIGERASPYVS+
Sbjct: 1  MSALFNFRSLLQVLLLLICSCSYVHGQWPSLLDRYKNHEVLGAFWKMARIGERASPYVSL 60

Query: 61 ACILMAINQFNS 72
          ACILMAI+QFNS
Sbjct: 61 ACILMAISQFNS 72

>TDEL0G02210 Chr7 (434303..434521) [219 bp, 72 aa] {ON} Anc_2.291
          YNL024C-A
          Length = 72

 Score =  123 bits (308), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 63/72 (87%), Positives = 68/72 (94%)

Query: 1  MSALFNFASLLQVILLLICSCTYIHTQWPSLLDRYKNHDILGAFWKMARIGERASPYVSV 60
          MSALFNF SLLQVILLL+CSCTY+H QWPSLLDRYK+H + GAFWKMAR+GERASPYVSV
Sbjct: 1  MSALFNFKSLLQVILLLLCSCTYVHAQWPSLLDRYKDHGVFGAFWKMARVGERASPYVSV 60

Query: 61 ACILMAINQFNS 72
          ACILMAINQFNS
Sbjct: 61 ACILMAINQFNS 72

>KAFR0H03280 Chr8 complement(626054..626272) [219 bp, 72 aa] {ON}
          Anc_2.291 YNL024C-A
          Length = 72

 Score =  122 bits (305), Expect = 6e-38,   Method: Compositional matrix adjust.
 Identities = 61/72 (84%), Positives = 69/72 (95%)

Query: 1  MSALFNFASLLQVILLLICSCTYIHTQWPSLLDRYKNHDILGAFWKMARIGERASPYVSV 60
          MSALFNF+SLLQV+LLLICSCTYIHTQWPSLL+RYK+H+ LG FWKMAR+GER SPYVS+
Sbjct: 1  MSALFNFSSLLQVLLLLICSCTYIHTQWPSLLERYKDHEALGIFWKMARVGERGSPYVSL 60

Query: 61 ACILMAINQFNS 72
          ACILMA+NQFNS
Sbjct: 61 ACILMAVNQFNS 72

>KLTH0G10472g Chr7 (885262..885480) [219 bp, 72 aa] {ON} highly
          similar to uniprot|Q8TGJ3 Saccharomyces cerevisiae
          YNL024C-A Identified by gene-trapping microarray-based
          expression analysis and genome-wide homology searching
          Length = 72

 Score =  117 bits (294), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 59/72 (81%), Positives = 67/72 (93%)

Query: 1  MSALFNFASLLQVILLLICSCTYIHTQWPSLLDRYKNHDILGAFWKMARIGERASPYVSV 60
          MSALFNF +LLQV+LLLICSCTYIH+QWPSLLDRYK H +LGAFWK ARIGERASPYVS+
Sbjct: 1  MSALFNFQALLQVLLLLICSCTYIHSQWPSLLDRYKEHSMLGAFWKCARIGERASPYVSI 60

Query: 61 ACILMAINQFNS 72
          ACI+MA+NQF +
Sbjct: 61 ACIIMAVNQFQT 72

>Kwal_YGOB_Anc_2.291 s27 complement(830525..830743) [219 bp, 72
          aa] {ON} ANNOTATED BY YGOB -
          Length = 72

 Score =  117 bits (293), Expect = 4e-36,   Method: Compositional matrix adjust.
 Identities = 59/72 (81%), Positives = 68/72 (94%)

Query: 1  MSALFNFASLLQVILLLICSCTYIHTQWPSLLDRYKNHDILGAFWKMARIGERASPYVSV 60
          MSALFNF +LLQV+LLLICSCTYIH+QWPSLLDRYK+H +LGAFWK ARIGERASPYVS+
Sbjct: 1  MSALFNFQALLQVLLLLICSCTYIHSQWPSLLDRYKDHSMLGAFWKCARIGERASPYVSL 60

Query: 61 ACILMAINQFNS 72
          ACI+MA+NQF +
Sbjct: 61 ACIIMAVNQFQT 72

>ZYRO0A01980g Chr1 (164037..164255) [219 bp, 72 aa] {ON} highly
          similar to uniprot|Q8TGJ3 Saccharomyces cerevisiae
          YNL024C-A Identified by gene-trapping microarray-based
          expression analysis and genome-wide homology searching
          Length = 72

 Score =  115 bits (287), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 59/72 (81%), Positives = 66/72 (91%)

Query: 1  MSALFNFASLLQVILLLICSCTYIHTQWPSLLDRYKNHDILGAFWKMARIGERASPYVSV 60
          MSALFNF SLLQVILLL+CSCTY+H QWPSLLDRYK H +L AFWKMAR+GERASPYVS+
Sbjct: 1  MSALFNFKSLLQVILLLLCSCTYVHAQWPSLLDRYKGHGVLSAFWKMARVGERASPYVSL 60

Query: 61 ACILMAINQFNS 72
          ACILMA++Q NS
Sbjct: 61 ACILMALSQLNS 72

>Ecym_3330 Chr3 (631388..631606) [219 bp, 72 aa] {ON} similar to
          Ashbya gossypii ADL210W
          Length = 72

 Score =  104 bits (259), Expect = 7e-31,   Method: Compositional matrix adjust.
 Identities = 55/72 (76%), Positives = 62/72 (86%)

Query: 1  MSALFNFASLLQVILLLICSCTYIHTQWPSLLDRYKNHDILGAFWKMARIGERASPYVSV 60
          MSALF F+SLLQ+ILLLICS TY+H QWPSLL+RYK H +L  FWK ARIGERASPYVS+
Sbjct: 1  MSALFKFSSLLQIILLLICSSTYVHCQWPSLLERYKQHGVLSIFWKFARIGERASPYVSL 60

Query: 61 ACILMAINQFNS 72
          ACI+M  NQFNS
Sbjct: 61 ACIVMVANQFNS 72

>SAKL0F09702g Chr6 complement(743532..745562) [2031 bp, 676 aa] {ON}
           similar to uniprot|Q12027 Saccharomyces cerevisiae
           YDL176W Hypothetical ORF
          Length = 676

 Score = 27.3 bits (59), Expect = 2.7,   Method: Composition-based stats.
 Identities = 15/38 (39%), Positives = 21/38 (55%), Gaps = 2/38 (5%)

Query: 3   ALFNFASLLQVILLLICSCTYIHTQWPSLLDRYK--NH 38
           AL NF+S  ++ ++  C C    T    L+DRYK  NH
Sbjct: 519 ALSNFSSFKKLFMVNDCLCLIFDTHGVLLVDRYKISNH 556

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.331    0.138    0.447 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 6,619,725
Number of extensions: 196316
Number of successful extensions: 536
Number of sequences better than 10.0: 21
Number of HSP's gapped: 536
Number of HSP's successfully gapped: 21
Length of query: 72
Length of database: 53,481,399
Length adjustment: 45
Effective length of query: 27
Effective length of database: 48,321,429
Effective search space: 1304678583
Effective search space used: 1304678583
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (22.0 bits)
S2: 59 (27.3 bits)