Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
CAGL0M07920g5.122ON56456430220.0
KAFR0E020205.122ON56456427100.0
TDEL0E050805.122ON56356226670.0
NDAI0C031105.122ON56456426570.0
Smik_12.1065.122ON56356326520.0
YLR044C (PDC1)5.122ON56356326510.0
Suva_10.1285.122ON56356326500.0
NCAS0D016605.122ON56456426370.0
Skud_12.1105.122ON56356326310.0
ACL134C5.122ON58656426100.0
Suva_10.227na 1ON56356325930.0
SAKL0G14894g5.122ON56456425800.0
Smik_12.197na 1ON56356325770.0
NDAI0A01400na 2ON56356225760.0
ZYRO0F01606g5.122ON56356325730.0
KAFR0E01520singletonON56356325660.0
YLR134W (PDC5)na 1ON56356325650.0
Skud_12.203na 1ON56356325590.0
KLTH0B01188g5.122ON59356225540.0
SAKL0G10164gna 3ON56456425540.0
KLLA0E16303g5.122ON56356225520.0
Kpol_1010.485.122ON56356325290.0
Suva_7.369na 4ON56356325290.0
YGR087C (PDC6)na 4ON56356325190.0
NCAS0A14630na 2ON56356325060.0
Ecym_24795.122ON56456425020.0
TBLA0B075205.122ON56356324970.0
TPHA0H009505.122ON56356324810.0
AAL073Wna 3ON56356224760.0
Kwal_33.155405.122ON56456224730.0
TPHA0Q00120singletonON56356324730.0
KNAG0M012505.122ON56356324570.0
NDAI0A02510singletonON56356324510.0
SAKL0F04334gsingletonON56456324360.0
TBLA0B10060singletonON56456424070.0
NCAS0A14240singletonON56556423920.0
TBLA0E03070singletonON56356323820.0
TBLA0D02840singletonON56356323700.0
KNAG0J01330singletonON56456423480.0
KNAG0J01340singletonON56556223390.0
NDAI0D03270singletonON52152123210.0
KLTH0D08272gsingletonON56356222880.0
CAGL0G02937gna 4ON56456322200.0
Ecym_3185na 3ON56356321340.0
SAKL0E04972g2.390ON61155019550.0
ZYRO0A08426g2.390ON58454916820.0
KLTH0E09702g2.390ON60755116830.0
Suva_4.1672.390ON62055616770.0
YDL080C (THI3)2.390ON60955616750.0
Kwal_47.178782.390ON61055116710.0
TDEL0G032102.390ON60656716480.0
Skud_4.1752.390ON62055616340.0
Smik_4.1562.390ON62155616290.0
TPHA0G026202.390ON68859316140.0
KNAG0A059002.390ON62056016020.0
NCAS0A040002.390ON62556915890.0
CAGL0L06842g2.390ON63858215750.0
TBLA0B088202.390ON63558315730.0
KAFR0F029902.390ON60855915500.0
NDAI0E017002.390ON62156815500.0
Ecym_60552.390ON59256614250.0
ADR254W2.390ON58155813800.0
Kpol_1046.92.390ON59856211971e-158
KLLA0F16962g2.390ON5785579381e-119
Kpol_1062.125.456ON6305958751e-109
CAGL0A03102g5.456ON6496188691e-108
NCAS0A118305.456ON6375998601e-107
SAKL0G03036g5.456ON6376018581e-106
Suva_2.5545.456ON6356058551e-106
Skud_4.6515.456ON6356078531e-106
KLTH0F15510g5.456ON6256008461e-105
ACR211W5.456ON6295968421e-104
YDR380W (ARO10)5.456ON6356118411e-104
Smik_4.6495.456ON6356178381e-104
ZYRO0G04378g5.456ON6136118141e-100
KAFR0E037305.456ON6356148065e-99
TPHA0J026805.456ON6486288076e-99
TBLA0A064205.456ON6386067936e-97
TBLA0A026705.456ON6406057901e-96
KNAG0C047905.456ON6376097864e-96
KLLA0E02707g5.456ON6316027734e-94
Kpol_440.45.456ON6366057701e-93
TDEL0D024505.456ON6756127695e-93
SAKL0D00220gsingletonON5775817545e-92
TPHA0E016005.456ON6515997553e-91
TDEL0C07020singletonON5605686996e-84
TDEL0F00150singletonON5605686979e-84
KLTH0D00418gsingletonON5615676855e-82
NDAI0A044505.456ON5615526351e-74
Skud_7.383na 4ON86922152e-20
NDAI0H023802.441ON6855602251e-18
YMR108W (ILV2)2.441ON6875822214e-18
KAFR0A005702.441ON6825692117e-17
Smik_13.2972.441ON6875822117e-17
NCAS0F015002.441ON6845492118e-17
KNAG0E023602.441ON6935612054e-16
TBLA0I014002.441ON7105092046e-16
ZYRO0E03454g1.450ON5494961992e-15
Suva_13.2872.441ON6876031983e-15
NCAS0G039601.450ON5775081948e-15
Skud_13.2672.441ON6876221948e-15
TDEL0B055201.450ON5554941939e-15
CAGL0K03465g2.441ON6775741931e-14
Kwal_26.75822.441ON6795071921e-14
NDAI0E020502.441ON6905701893e-14
NCAS0A043202.441ON6895591885e-14
KLLA0B12584g2.441ON6915141876e-14
SAKL0E03740g2.441ON6795191868e-14
TPHA0G024402.441ON6915371851e-13
KNAG0A062502.441ON6805221832e-13
TDEL0A021602.441ON6825491832e-13
Kpol_297.122.441ON6715491804e-13
ZYRO0G19954g2.441ON7005121804e-13
KLTH0D04532g2.441ON6786171761e-12
Ecym_61072.441ON6895181752e-12
Smik_5.871.450ON5605141742e-12
AEL305C2.441ON6685131662e-11
YEL020C1.450ON5605071643e-11
Skud_5.761.450ON5605131625e-11
AEL055C1.450ON5454801609e-11
TPHA0G028852.441ON6883031591e-10
Ecym_13601.450ON5444881582e-10
Kpol_1061.501.450ON5715021465e-09
SAKL0D10934g1.450ON5503381456e-09
KLTH0H14102g1.450ON5515081448e-09
Suva_5.681.450ON5615181412e-08
TPHA0B039401.450ON5755321402e-08
Kwal_34.161161.450ON5534951367e-08
KNAG0H015801.450ON5605241351e-07
KAFR0H028901.450ON5603721000.002
NDAI0G005201.450ON575340860.076
TBLA0C015601.450ON582279860.086
CAGL0M03245g1.450ON56256830.18
Ecym_81121.166ON609176705.9
Suva_8.4277.9ON89878707.6
TDEL0C027907.418ON2786150698.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0M07920g
         (564 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0M07920g Chr13 complement(789467..791161) [1695 bp, 564 aa] ...  1168   0.0  
KAFR0E02020 Chr5 (400911..402605) [1695 bp, 564 aa] {ON} Anc_5.1...  1048   0.0  
TDEL0E05080 Chr5 (936841..938532) [1692 bp, 563 aa] {ON} Anc_5.1...  1031   0.0  
NDAI0C03110 Chr3 (707463..709157) [1695 bp, 564 aa] {ON} Anc_5.122   1028   0.0  
Smik_12.106 Chr12 complement(213431..215122) [1692 bp, 563 aa] {...  1026   0.0  
YLR044C Chr12 complement(232390..234081) [1692 bp, 563 aa] {ON} ...  1025   0.0  
Suva_10.128 Chr10 complement(233880..235571) [1692 bp, 563 aa] {...  1025   0.0  
NCAS0D01660 Chr4 complement(313684..315378) [1695 bp, 564 aa] {O...  1020   0.0  
Skud_12.110 Chr12 complement(217239..218930) [1692 bp, 563 aa] {...  1018   0.0  
ACL134C Chr3 complement(117344..119104) [1761 bp, 586 aa] {ON} S...  1009   0.0  
Suva_10.227 Chr10 (419251..420942) [1692 bp, 563 aa] {ON} YLR134...  1003   0.0  
SAKL0G14894g Chr7 (1275005..1276699) [1695 bp, 564 aa] {ON} unip...   998   0.0  
Smik_12.197 Chr12 (392030..393721) [1692 bp, 563 aa] {ON} YLR134...   997   0.0  
NDAI0A01400 Chr1 (313925..315616) [1692 bp, 563 aa] {ON}              996   0.0  
ZYRO0F01606g Chr6 complement(130346..132037) [1692 bp, 563 aa] {...   995   0.0  
KAFR0E01520 Chr5 complement(306988..308679) [1692 bp, 563 aa] {O...   993   0.0  
YLR134W Chr12 (410723..412414) [1692 bp, 563 aa] {ON}  PDC5Minor...   992   0.0  
Skud_12.203 Chr12 (393390..395081) [1692 bp, 563 aa] {ON} YLR134...   990   0.0  
KLTH0B01188g Chr2 complement(104224..106005) [1782 bp, 593 aa] {...   988   0.0  
SAKL0G10164g Chr7 complement(867445..869139) [1695 bp, 564 aa] {...   988   0.0  
KLLA0E16303g Chr5 complement(1457903..1459594) [1692 bp, 563 aa]...   987   0.0  
Kpol_1010.48 s1010 (110999..112690) [1692 bp, 563 aa] {ON} (1109...   978   0.0  
Suva_7.369 Chr7 complement(627739..629430) [1692 bp, 563 aa] {ON...   978   0.0  
YGR087C Chr7 complement(651290..652981) [1692 bp, 563 aa] {ON}  ...   974   0.0  
NCAS0A14630 Chr1 complement(2878338..2880029) [1692 bp, 563 aa] ...   969   0.0  
Ecym_2479 Chr2 (938295..939989) [1695 bp, 564 aa] {ON} similar t...   968   0.0  
TBLA0B07520 Chr2 complement(1789035..1790726) [1692 bp, 563 aa] ...   966   0.0  
TPHA0H00950 Chr8 (199181..200872) [1692 bp, 563 aa] {ON} Anc_5.1...   960   0.0  
AAL073W Chr1 (216809..218500) [1692 bp, 563 aa] {ON} Non-synteni...   958   0.0  
Kwal_33.15540 s33 (1147974..1149668) [1695 bp, 564 aa] {ON} YLR0...   957   0.0  
TPHA0Q00120 Chr17 complement(8844..10535) [1692 bp, 563 aa] {ON}      957   0.0  
KNAG0M01250 Chr13 complement(229749..231440) [1692 bp, 563 aa] {...   951   0.0  
NDAI0A02510 Chr1 complement(562483..564174) [1692 bp, 563 aa] {O...   948   0.0  
SAKL0F04334g Chr6 complement(347639..349333) [1695 bp, 564 aa] {...   942   0.0  
TBLA0B10060 Chr2 complement(2418979..2420673) [1695 bp, 564 aa] ...   931   0.0  
NCAS0A14240 Chr1 (2804135..2805832) [1698 bp, 565 aa] {ON}            926   0.0  
TBLA0E03070 Chr5 (771183..772874) [1692 bp, 563 aa] {ON}              922   0.0  
TBLA0D02840 Chr4 complement(694649..696340) [1692 bp, 563 aa] {O...   917   0.0  
KNAG0J01330 Chr10 complement(240650..242344) [1695 bp, 564 aa] {...   909   0.0  
KNAG0J01340 Chr10 complement(243186..244883) [1698 bp, 565 aa] {...   905   0.0  
NDAI0D03270 Chr4 (778452..780017) [1566 bp, 521 aa] {ON}              898   0.0  
KLTH0D08272g Chr4 complement(695296..696987) [1692 bp, 563 aa] {...   885   0.0  
CAGL0G02937g Chr7 complement(268985..270679) [1695 bp, 564 aa] {...   859   0.0  
Ecym_3185 Chr3 (352629..354320) [1692 bp, 563 aa] {ON} similar t...   826   0.0  
SAKL0E04972g Chr5 (403578..405413) [1836 bp, 611 aa] {ON} simila...   757   0.0  
ZYRO0A08426g Chr1 complement(675104..676858) [1755 bp, 584 aa] {...   652   0.0  
KLTH0E09702g Chr5 (874177..876000) [1824 bp, 607 aa] {ON} simila...   652   0.0  
Suva_4.167 Chr4 complement(300197..302059) [1863 bp, 620 aa] {ON...   650   0.0  
YDL080C Chr4 complement(310642..312471) [1830 bp, 609 aa] {ON}  ...   649   0.0  
Kwal_47.17878 s47 (590664..592496) [1833 bp, 610 aa] {ON} YDL080...   648   0.0  
TDEL0G03210 Chr7 complement(597217..599037) [1821 bp, 606 aa] {O...   639   0.0  
Skud_4.175 Chr4 complement(306124..307986) [1863 bp, 620 aa] {ON...   634   0.0  
Smik_4.156 Chr4 complement(287087..288952) [1866 bp, 621 aa] {ON...   632   0.0  
TPHA0G02620 Chr7 complement(547384..549450) [2067 bp, 688 aa] {O...   626   0.0  
KNAG0A05900 Chr1 complement(880996..882858) [1863 bp, 620 aa] {O...   621   0.0  
NCAS0A04000 Chr1 complement(806883..808760) [1878 bp, 625 aa] {O...   616   0.0  
CAGL0L06842g Chr12 (771870..773786) [1917 bp, 638 aa] {ON} simil...   611   0.0  
TBLA0B08820 Chr2 (2097075..2098982) [1908 bp, 635 aa] {ON} Anc_2...   610   0.0  
KAFR0F02990 Chr6 complement(589562..591388) [1827 bp, 608 aa] {O...   601   0.0  
NDAI0E01700 Chr5 (337856..339721) [1866 bp, 621 aa] {ON} Anc_2.390    601   0.0  
Ecym_6055 Chr6 complement(105018..106796) [1779 bp, 592 aa] {ON}...   553   0.0  
ADR254W Chr4 (1143623..1145368) [1746 bp, 581 aa] {ON} Syntenic ...   536   0.0  
Kpol_1046.9 s1046 (18301..18855,18984..18992,19556..19693,19697....   465   e-158
KLLA0F16962g Chr6 complement(1559454..1561190) [1737 bp, 578 aa]...   365   e-119
Kpol_1062.12 s1062 complement(31361..33253) [1893 bp, 630 aa] {O...   341   e-109
CAGL0A03102g Chr1 (317961..319910) [1950 bp, 649 aa] {ON} simila...   339   e-108
NCAS0A11830 Chr1 (2347016..2348929) [1914 bp, 637 aa] {ON} Anc_5...   335   e-107
SAKL0G03036g Chr7 (250012..251925) [1914 bp, 637 aa] {ON} simila...   335   e-106
Suva_2.554 Chr2 (984966..986873) [1908 bp, 635 aa] {ON} YDR380W ...   333   e-106
Skud_4.651 Chr4 (1157087..1158994) [1908 bp, 635 aa] {ON} YDR380...   333   e-106
KLTH0F15510g Chr6 complement(1265767..1267644) [1878 bp, 625 aa]...   330   e-105
ACR211W Chr3 (716693..718582) [1890 bp, 629 aa] {ON} Syntenic ho...   328   e-104
YDR380W Chr4 (1234218..1236125) [1908 bp, 635 aa] {ON}  ARO10Phe...   328   e-104
Smik_4.649 Chr4 (1154670..1156577) [1908 bp, 635 aa] {ON} YDR380...   327   e-104
ZYRO0G04378g Chr7 complement(350070..351911) [1842 bp, 613 aa] {...   318   e-100
KAFR0E03730 Chr5 complement(746616..748523) [1908 bp, 635 aa] {O...   315   5e-99
TPHA0J02680 Chr10 (593893..595839) [1947 bp, 648 aa] {ON} Anc_5....   315   6e-99
TBLA0A06420 Chr1 complement(1577160..1579076) [1917 bp, 638 aa] ...   310   6e-97
TBLA0A02670 Chr1 complement(648495..650417) [1923 bp, 640 aa] {O...   308   1e-96
KNAG0C04790 Chr3 complement(932051..933964) [1914 bp, 637 aa] {O...   307   4e-96
KLLA0E02707g Chr5 (251220..253115) [1896 bp, 631 aa] {ON} simila...   302   4e-94
Kpol_440.4 s440 (9465..11375) [1911 bp, 636 aa] {ON} (9465..1137...   301   1e-93
TDEL0D02450 Chr4 complement(477063..479090) [2028 bp, 675 aa] {O...   300   5e-93
SAKL0D00220g Chr4 complement(18466..20199) [1734 bp, 577 aa] {ON...   295   5e-92
TPHA0E01600 Chr5 complement(325811..327766) [1956 bp, 651 aa] {O...   295   3e-91
TDEL0C07020 Chr3 complement(1283600..1285282) [1683 bp, 560 aa] ...   273   6e-84
TDEL0F00150 Chr6 (12055..13737) [1683 bp, 560 aa] {ON}                273   9e-84
KLTH0D00418g Chr4 complement(37778..39463) [1686 bp, 561 aa] {ON...   268   5e-82
NDAI0A04450 Chr1 complement(1006559..1008244) [1686 bp, 561 aa] ...   249   1e-74
Skud_7.383 Chr7 complement(638760..638846,638850..638882,638886....    87   2e-20
NDAI0H02380 Chr8 (578157..580214) [2058 bp, 685 aa] {ON} Anc_2.441     91   1e-18
YMR108W Chr13 (484084..486147) [2064 bp, 687 aa] {ON}  ILV2Aceto...    90   4e-18
KAFR0A00570 Chr1 complement(101898..103946) [2049 bp, 682 aa] {O...    86   7e-17
Smik_13.297 Chr13 (467578..469641) [2064 bp, 687 aa] {ON} YMR108...    86   7e-17
NCAS0F01500 Chr6 (299388..301442) [2055 bp, 684 aa] {ON} Anc_2.4...    86   8e-17
KNAG0E02360 Chr5 complement(470361..472442) [2082 bp, 693 aa] {O...    84   4e-16
TBLA0I01400 Chr9 (303028..305160) [2133 bp, 710 aa] {ON} Anc_2.4...    83   6e-16
ZYRO0E03454g Chr5 complement(270926..272575) [1650 bp, 549 aa] {...    81   2e-15
Suva_13.287 Chr13 (465217..467280) [2064 bp, 687 aa] {ON} YMR108...    81   3e-15
NCAS0G03960 Chr7 (733213..734946) [1734 bp, 577 aa] {ON} Anc_1.4...    79   8e-15
Skud_13.267 Chr13 (459466..461529) [2064 bp, 687 aa] {ON} YMR108...    79   8e-15
TDEL0B05520 Chr2 complement(980893..982560) [1668 bp, 555 aa] {O...    79   9e-15
CAGL0K03465g Chr11 (320030..322063) [2034 bp, 677 aa] {ON} highl...    79   1e-14
Kwal_26.7582 s26 (427437..429476) [2040 bp, 679 aa] {ON} YMR108W...    79   1e-14
NDAI0E02050 Chr5 complement(414418..416490) [2073 bp, 690 aa] {O...    77   3e-14
NCAS0A04320 Chr1 complement(873722..875791) [2070 bp, 689 aa] {O...    77   5e-14
KLLA0B12584g Chr2 complement(1100489..1102564) [2076 bp, 691 aa]...    77   6e-14
SAKL0E03740g Chr5 (302160..304199) [2040 bp, 679 aa] {ON} highly...    76   8e-14
TPHA0G02440 Chr7 complement(498107..500182) [2076 bp, 691 aa] {O...    76   1e-13
KNAG0A06250 Chr1 complement(948840..950882) [2043 bp, 680 aa] {O...    75   2e-13
TDEL0A02160 Chr1 complement(389068..391116) [2049 bp, 682 aa] {O...    75   2e-13
Kpol_297.12 s297 complement(20788..22803) [2016 bp, 671 aa] {ON}...    74   4e-13
ZYRO0G19954g Chr7 (1653353..1655455) [2103 bp, 700 aa] {ON} high...    74   4e-13
KLTH0D04532g Chr4 (417085..419121) [2037 bp, 678 aa] {ON} highly...    72   1e-12
Ecym_6107 Chr6 complement(201133..203202) [2070 bp, 689 aa] {ON}...    72   2e-12
Smik_5.87 Chr5 complement(124637..126319) [1683 bp, 560 aa] {ON}...    72   2e-12
AEL305C Chr5 complement(69381..71387) [2007 bp, 668 aa] {ON} Syn...    69   2e-11
YEL020C Chr5 complement(118617..120299) [1683 bp, 560 aa] {ON} P...    68   3e-11
Skud_5.76 Chr5 complement(117925..119607) [1683 bp, 560 aa] {ON}...    67   5e-11
AEL055C Chr5 complement(533904..535541) [1638 bp, 545 aa] {ON} S...    66   9e-11
TPHA0G02885 Chr7 complement(616977..619043) [2067 bp, 688 aa] {ON}     66   1e-10
Ecym_1360 Chr1 (739963..741597) [1635 bp, 544 aa] {ON} similar t...    65   2e-10
Kpol_1061.50 s1061 (141784..143499) [1716 bp, 571 aa] {ON} (1417...    61   5e-09
SAKL0D10934g Chr4 (907649..909301) [1653 bp, 550 aa] {ON} simila...    60   6e-09
KLTH0H14102g Chr8 (1226474..1228129) [1656 bp, 551 aa] {ON} simi...    60   8e-09
Suva_5.68 Chr5 (108954..110639) [1686 bp, 561 aa] {ON} YEL020C (...    59   2e-08
TPHA0B03940 Chr2 (928983..930710) [1728 bp, 575 aa] {ON} Anc_1.4...    59   2e-08
Kwal_34.16116 s34 complement(208847..210508) [1662 bp, 553 aa] {...    57   7e-08
KNAG0H01580 Chr8 complement(279178..280860) [1683 bp, 560 aa] {O...    57   1e-07
KAFR0H02890 Chr8 complement(551945..553627) [1683 bp, 560 aa] {O...    43   0.002
NDAI0G00520 Chr7 complement(112068..113795) [1728 bp, 575 aa] {O...    38   0.076
TBLA0C01560 Chr3 (362966..364714) [1749 bp, 582 aa] {ON} Anc_1.4...    38   0.086
CAGL0M03245g Chr13 complement(372122..373810) [1689 bp, 562 aa] ...    37   0.18 
Ecym_8112 Chr8 complement(237472..239301) [1830 bp, 609 aa] {ON}...    32   5.9  
Suva_8.427 Chr8 complement(769308..772004) [2697 bp, 898 aa] {ON...    32   7.6  
TDEL0C02790 Chr3 (487977..496337) [8361 bp, 2786 aa] {ON} Anc_7....    31   8.7  

>CAGL0M07920g Chr13 complement(789467..791161) [1695 bp, 564 aa]
           {ON} highly similar to uniprot|P06169 Saccharomyces
           cerevisiae YLR044c PDC1 pyruvate decarboxylase or
           uniprot|P16467 Saccharomyces cerevisiae YLR134w PDC5
          Length = 564

 Score = 1168 bits (3022), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 564/564 (100%), Positives = 564/564 (100%)

Query: 1   MSEITLGRYLFERLNQVDVKTIFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADG 60
           MSEITLGRYLFERLNQVDVKTIFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADG
Sbjct: 1   MSEITLGRYLFERLNQVDVKTIFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADG 60

Query: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNG 120
           YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNG
Sbjct: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNG 120

Query: 121 DFTVFHRMSANISETTAMVTDIATAPAEIDRCIRTTYITQRPVYLGLPANLVDLKVPAKL 180
           DFTVFHRMSANISETTAMVTDIATAPAEIDRCIRTTYITQRPVYLGLPANLVDLKVPAKL
Sbjct: 121 DFTVFHRMSANISETTAMVTDIATAPAEIDRCIRTTYITQRPVYLGLPANLVDLKVPAKL 180

Query: 181 LETPIDLSLKPNDPEAETEVVDTVLELIKAAKNPVILADACASRHDVKAETKKLIDATQF 240
           LETPIDLSLKPNDPEAETEVVDTVLELIKAAKNPVILADACASRHDVKAETKKLIDATQF
Sbjct: 181 LETPIDLSLKPNDPEAETEVVDTVLELIKAAKNPVILADACASRHDVKAETKKLIDATQF 240

Query: 241 PSFVTPMGKGSIDEQHPRFGGVYVGTLSRPEVKEAVESADLILSVGALLSDFNTGSFSYS 300
           PSFVTPMGKGSIDEQHPRFGGVYVGTLSRPEVKEAVESADLILSVGALLSDFNTGSFSYS
Sbjct: 241 PSFVTPMGKGSIDEQHPRFGGVYVGTLSRPEVKEAVESADLILSVGALLSDFNTGSFSYS 300

Query: 301 YKTKNIVEFHSDYIKIRNATFPGVQMKFALQKLLNAVPEAIKGYKPVPVPARVPENKSCD 360
           YKTKNIVEFHSDYIKIRNATFPGVQMKFALQKLLNAVPEAIKGYKPVPVPARVPENKSCD
Sbjct: 301 YKTKNIVEFHSDYIKIRNATFPGVQMKFALQKLLNAVPEAIKGYKPVPVPARVPENKSCD 360

Query: 361 PATPLKQEWMWNQVSKFLQEGDVVITETGTSAFGINQTPFPNNAYGISQVLWGSIGFTTG 420
           PATPLKQEWMWNQVSKFLQEGDVVITETGTSAFGINQTPFPNNAYGISQVLWGSIGFTTG
Sbjct: 361 PATPLKQEWMWNQVSKFLQEGDVVITETGTSAFGINQTPFPNNAYGISQVLWGSIGFTTG 420

Query: 421 ACLGAAFAAEEIDPKKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNDGYTIERLI 480
           ACLGAAFAAEEIDPKKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNDGYTIERLI
Sbjct: 421 ACLGAAFAAEEIDPKKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNDGYTIERLI 480

Query: 481 HGEKAGYNDIQNWDHLALLPTFGAKDYENHRVATTGEWDKLTQDKEFNKNSKIRMIEVML 540
           HGEKAGYNDIQNWDHLALLPTFGAKDYENHRVATTGEWDKLTQDKEFNKNSKIRMIEVML
Sbjct: 481 HGEKAGYNDIQNWDHLALLPTFGAKDYENHRVATTGEWDKLTQDKEFNKNSKIRMIEVML 540

Query: 541 PVMDAPTSLIEQAKLTASINAKQE 564
           PVMDAPTSLIEQAKLTASINAKQE
Sbjct: 541 PVMDAPTSLIEQAKLTASINAKQE 564

>KAFR0E02020 Chr5 (400911..402605) [1695 bp, 564 aa] {ON} Anc_5.122
           YLR044C
          Length = 564

 Score = 1048 bits (2710), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 511/564 (90%), Positives = 536/564 (95%)

Query: 1   MSEITLGRYLFERLNQVDVKTIFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADG 60
           M+EITLG+YLFERL QVDVKTIFGLPGDFNLSLLDKIYEV GMRWAGNANELNAAYAADG
Sbjct: 1   MAEITLGKYLFERLAQVDVKTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADG 60

Query: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNG 120
           YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNG
Sbjct: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNG 120

Query: 121 DFTVFHRMSANISETTAMVTDIATAPAEIDRCIRTTYITQRPVYLGLPANLVDLKVPAKL 180
           DFTVFHRMSANISETTAMVTDIATAPAEIDRCIRTTY+TQRPVYLGLPANLVDLKVPAKL
Sbjct: 121 DFTVFHRMSANISETTAMVTDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLKVPAKL 180

Query: 181 LETPIDLSLKPNDPEAETEVVDTVLELIKAAKNPVILADACASRHDVKAETKKLIDATQF 240
           LETPIDLSLKPND EAE EVVDT+L LIK AKNPVIL+DACASRHDVKAETK+LIDATQF
Sbjct: 181 LETPIDLSLKPNDAEAEKEVVDTILSLIKDAKNPVILSDACASRHDVKAETKQLIDATQF 240

Query: 241 PSFVTPMGKGSIDEQHPRFGGVYVGTLSRPEVKEAVESADLILSVGALLSDFNTGSFSYS 300
           P+F TPMGKGSIDEQHPRFGGVYVGTLSRPEVKEAVESADLILSVGALLSDFNTGSFSYS
Sbjct: 241 PAFTTPMGKGSIDEQHPRFGGVYVGTLSRPEVKEAVESADLILSVGALLSDFNTGSFSYS 300

Query: 301 YKTKNIVEFHSDYIKIRNATFPGVQMKFALQKLLNAVPEAIKGYKPVPVPARVPENKSCD 360
           YKTKNI+EFHSDY KIRNATFPGVQMKF L+KLL +V +A KGYKPV VPARVPENK+CD
Sbjct: 301 YKTKNIIEFHSDYTKIRNATFPGVQMKFVLRKLLASVADAAKGYKPVAVPARVPENKACD 360

Query: 361 PATPLKQEWMWNQVSKFLQEGDVVITETGTSAFGINQTPFPNNAYGISQVLWGSIGFTTG 420
           P+TPL QEWMWNQ +KF QEGDV+ITETGTSAFGINQ+ FPNN+ GISQVLWGSIGFT G
Sbjct: 361 PSTPLAQEWMWNQCAKFFQEGDVIITETGTSAFGINQSLFPNNSVGISQVLWGSIGFTGG 420

Query: 421 ACLGAAFAAEEIDPKKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNDGYTIERLI 480
           A LGAAFAAEEIDPKKRVILFIGDGSLQLTVQEISTMIRW LKPYLFVLNNDGYTIERLI
Sbjct: 421 AVLGAAFAAEEIDPKKRVILFIGDGSLQLTVQEISTMIRWNLKPYLFVLNNDGYTIERLI 480

Query: 481 HGEKAGYNDIQNWDHLALLPTFGAKDYENHRVATTGEWDKLTQDKEFNKNSKIRMIEVML 540
           HGEKAGYNDIQNW HL LL TFGAKDYENHRVATTGEWD L  DKEFNKNS+IRMIEVML
Sbjct: 481 HGEKAGYNDIQNWKHLMLLETFGAKDYENHRVATTGEWDALMGDKEFNKNSRIRMIEVML 540

Query: 541 PVMDAPTSLIEQAKLTASINAKQE 564
           PVMDAP++L++QAK+TA+ NAKQ+
Sbjct: 541 PVMDAPSNLVQQAKITAATNAKQD 564

>TDEL0E05080 Chr5 (936841..938532) [1692 bp, 563 aa] {ON} Anc_5.122
           YLR044C
          Length = 563

 Score = 1031 bits (2667), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 496/562 (88%), Positives = 521/562 (92%)

Query: 1   MSEITLGRYLFERLNQVDVKTIFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADG 60
           MSEITLGRYLFERL QVD  TIFGLPGDFNLSLLDKIYEV GMRWAGNANELNAAYAADG
Sbjct: 1   MSEITLGRYLFERLKQVDTNTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADG 60

Query: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNG 120
           YAR+KGM+ ++TTFGVGELSALNGIAGSYAEHVGVLH+VGVPSISSQAKQLLLHHTLGNG
Sbjct: 61  YARVKGMAALVTTFGVGELSALNGIAGSYAEHVGVLHIVGVPSISSQAKQLLLHHTLGNG 120

Query: 121 DFTVFHRMSANISETTAMVTDIATAPAEIDRCIRTTYITQRPVYLGLPANLVDLKVPAKL 180
           DFTVFHRMSANISETTAM+TDI +APAEIDRCIRTTY++QRPVYLGLPANLVDLKVPA L
Sbjct: 121 DFTVFHRMSANISETTAMITDINSAPAEIDRCIRTTYVSQRPVYLGLPANLVDLKVPASL 180

Query: 181 LETPIDLSLKPNDPEAETEVVDTVLELIKAAKNPVILADACASRHDVKAETKKLIDATQF 240
           L+TPIDLSLK ND EAE EVVD VL LIKAAKNPVILADAC SRHDVK ET+KLID TQF
Sbjct: 181 LDTPIDLSLKANDAEAEQEVVDDVLALIKAAKNPVILADACCSRHDVKDETRKLIDITQF 240

Query: 241 PSFVTPMGKGSIDEQHPRFGGVYVGTLSRPEVKEAVESADLILSVGALLSDFNTGSFSYS 300
           PSFVTPMGKGSIDEQ+PRFGGVYVGTLS PEVKEAVESADLILSVGALLSDFNTGSFSYS
Sbjct: 241 PSFVTPMGKGSIDEQNPRFGGVYVGTLSSPEVKEAVESADLILSVGALLSDFNTGSFSYS 300

Query: 301 YKTKNIVEFHSDYIKIRNATFPGVQMKFALQKLLNAVPEAIKGYKPVPVPARVPENKSCD 360
           YKTKNIVEFHSDYIKIRNATFPGVQMKFALQKLL  V +  K YKPV VPAR PEN +  
Sbjct: 301 YKTKNIVEFHSDYIKIRNATFPGVQMKFALQKLLAKVGDVAKDYKPVQVPARTPENAATA 360

Query: 361 PATPLKQEWMWNQVSKFLQEGDVVITETGTSAFGINQTPFPNNAYGISQVLWGSIGFTTG 420
            +TPLKQ+W+WNQV KFLQEGDVVITETGTSAFGINQ+ FPN  YGISQVLWGSIGFTTG
Sbjct: 361 DSTPLKQQWIWNQVGKFLQEGDVVITETGTSAFGINQSHFPNKTYGISQVLWGSIGFTTG 420

Query: 421 ACLGAAFAAEEIDPKKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNDGYTIERLI 480
           A LGAAFAAEEIDPKKRVILFIGDGSLQLTVQEISTM+RWGLKPYLFVLNNDGYTIERLI
Sbjct: 421 ATLGAAFAAEEIDPKKRVILFIGDGSLQLTVQEISTMVRWGLKPYLFVLNNDGYTIERLI 480

Query: 481 HGEKAGYNDIQNWDHLALLPTFGAKDYENHRVATTGEWDKLTQDKEFNKNSKIRMIEVML 540
           HGEKA YNDIQ W +L LLPTFGAKDYE HRV+TTGEW+KLT D EFNKNSKIRMIEVML
Sbjct: 481 HGEKAQYNDIQPWKNLDLLPTFGAKDYETHRVSTTGEWNKLTTDSEFNKNSKIRMIEVML 540

Query: 541 PVMDAPTSLIEQAKLTASINAK 562
           PVMDAP+SL+ QA+LTASINAK
Sbjct: 541 PVMDAPSSLVAQAQLTASINAK 562

>NDAI0C03110 Chr3 (707463..709157) [1695 bp, 564 aa] {ON} Anc_5.122
          Length = 564

 Score = 1028 bits (2657), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 508/564 (90%), Positives = 535/564 (94%)

Query: 1   MSEITLGRYLFERLNQVDVKTIFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADG 60
           MSEITLGRYLFERL+QVDVKTIFGLPGDFNLSLLDKIYE  GMRWAGNANELNAAYAADG
Sbjct: 1   MSEITLGRYLFERLSQVDVKTIFGLPGDFNLSLLDKIYETPGMRWAGNANELNAAYAADG 60

Query: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNG 120
           YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPS+SSQAKQLLLHHTLGNG
Sbjct: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSVSSQAKQLLLHHTLGNG 120

Query: 121 DFTVFHRMSANISETTAMVTDIATAPAEIDRCIRTTYITQRPVYLGLPANLVDLKVPAKL 180
           DFTVFHRMSANISETTAMVTDIATAPAEIDRCIRTTY+TQRPVYLGLPANLVDLKVPA L
Sbjct: 121 DFTVFHRMSANISETTAMVTDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLKVPASL 180

Query: 181 LETPIDLSLKPNDPEAETEVVDTVLELIKAAKNPVILADACASRHDVKAETKKLIDATQF 240
           LETPIDLSLK ND EAETEVV+T+LELIK AKNPVILADACASRHDVKAETKKLID TQF
Sbjct: 181 LETPIDLSLKANDVEAETEVVNTILELIKDAKNPVILADACASRHDVKAETKKLIDITQF 240

Query: 241 PSFVTPMGKGSIDEQHPRFGGVYVGTLSRPEVKEAVESADLILSVGALLSDFNTGSFSYS 300
           PSFVTPMGKGSIDEQHPRFGGVYVGTLS P VKEAVESADLILSVGALLSDFNTGSFSYS
Sbjct: 241 PSFVTPMGKGSIDEQHPRFGGVYVGTLSSPAVKEAVESADLILSVGALLSDFNTGSFSYS 300

Query: 301 YKTKNIVEFHSDYIKIRNATFPGVQMKFALQKLLNAVPEAIKGYKPVPVPARVPENKSCD 360
           YKTKNIVEFHSDYIKI+NATFPGVQMKFALQKLL +V EA KGYKPV VPA+   N + D
Sbjct: 301 YKTKNIVEFHSDYIKIKNATFPGVQMKFALQKLLGSVAEAAKGYKPVAVPAKPAANAAVD 360

Query: 361 PATPLKQEWMWNQVSKFLQEGDVVITETGTSAFGINQTPFPNNAYGISQVLWGSIGFTTG 420
            ATPLKQEWMWNQV KFLQEGDVVITETGTSAFGINQT FPNN YGISQVLWGSIGFTTG
Sbjct: 361 AATPLKQEWMWNQVGKFLQEGDVVITETGTSAFGINQTHFPNNTYGISQVLWGSIGFTTG 420

Query: 421 ACLGAAFAAEEIDPKKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNDGYTIERLI 480
           ACLGAAFAAEE+DPKKRVILFIGDGSLQLTVQEISTM+RW LKPYLFVLNN+GYTIE+LI
Sbjct: 421 ACLGAAFAAEEVDPKKRVILFIGDGSLQLTVQEISTMVRWNLKPYLFVLNNNGYTIEKLI 480

Query: 481 HGEKAGYNDIQNWDHLALLPTFGAKDYENHRVATTGEWDKLTQDKEFNKNSKIRMIEVML 540
           HG  A YN+IQ+WDHL+LLPTFGAKDYENHRVATTGEW KLT++KEFN+NS+IR+IE+ML
Sbjct: 481 HGPTAQYNEIQSWDHLSLLPTFGAKDYENHRVATTGEWIKLTENKEFNQNSRIRLIEIML 540

Query: 541 PVMDAPTSLIEQAKLTASINAKQE 564
           PVMDAP++L+ QA+LTA INAKQ+
Sbjct: 541 PVMDAPSNLVAQAQLTAKINAKQD 564

>Smik_12.106 Chr12 complement(213431..215122) [1692 bp, 563 aa] {ON}
           YLR044C (REAL)
          Length = 563

 Score = 1026 bits (2652), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 499/563 (88%), Positives = 526/563 (93%)

Query: 1   MSEITLGRYLFERLNQVDVKTIFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADG 60
           MSEITLG+YLFERL QV+V T+FGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADG
Sbjct: 1   MSEITLGKYLFERLKQVNVNTVFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADG 60

Query: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNG 120
           YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSIS+QAKQLLLHHTLGNG
Sbjct: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTLGNG 120

Query: 121 DFTVFHRMSANISETTAMVTDIATAPAEIDRCIRTTYITQRPVYLGLPANLVDLKVPAKL 180
           DFTVFHRMSANISETTAM+TDIATAPAEIDRCIRTTY+TQRPVYLGLPANLVDL VPAKL
Sbjct: 121 DFTVFHRMSANISETTAMITDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLNVPAKL 180

Query: 181 LETPIDLSLKPNDPEAETEVVDTVLELIKAAKNPVILADACASRHDVKAETKKLIDATQF 240
           LETPID+SLK ND E+E EV+DT+L L+K AKNPVILADAC SRHDVKAETKKLID TQF
Sbjct: 181 LETPIDMSLKANDAESEKEVIDTILSLVKDAKNPVILADACCSRHDVKAETKKLIDLTQF 240

Query: 241 PSFVTPMGKGSIDEQHPRFGGVYVGTLSRPEVKEAVESADLILSVGALLSDFNTGSFSYS 300
           P+FVTPMGKGSIDEQHPR+GGVYVGTLS+PEVKEAVESADLILSVGALLSDFNTGSFSYS
Sbjct: 241 PAFVTPMGKGSIDEQHPRYGGVYVGTLSKPEVKEAVESADLILSVGALLSDFNTGSFSYS 300

Query: 301 YKTKNIVEFHSDYIKIRNATFPGVQMKFALQKLLNAVPEAIKGYKPVPVPARVPENKSCD 360
           YKTKNIVEFHSD++KIRNATFPGVQMKF LQKLL  + +A KGYKPV VPA  P N +  
Sbjct: 301 YKTKNIVEFHSDHMKIRNATFPGVQMKFVLQKLLTVIADAAKGYKPVAVPANTPANAAVP 360

Query: 361 PATPLKQEWMWNQVSKFLQEGDVVITETGTSAFGINQTPFPNNAYGISQVLWGSIGFTTG 420
            +TPLKQEWMWNQ+  FLQEGDVVI ETGTSAFGINQT FPNN YGISQVLWGSIGFTTG
Sbjct: 361 ASTPLKQEWMWNQLGSFLQEGDVVIAETGTSAFGINQTTFPNNTYGISQVLWGSIGFTTG 420

Query: 421 ACLGAAFAAEEIDPKKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNDGYTIERLI 480
           A LGAAFAAEEIDPKKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNDGYTIE+LI
Sbjct: 421 ATLGAAFAAEEIDPKKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNDGYTIEKLI 480

Query: 481 HGEKAGYNDIQNWDHLALLPTFGAKDYENHRVATTGEWDKLTQDKEFNKNSKIRMIEVML 540
           HG KA YN+IQNWDHL+LLPTFGAKDYE HRVATTGEWDKLTQDK FN NSKIRMIEVML
Sbjct: 481 HGPKAQYNEIQNWDHLSLLPTFGAKDYETHRVATTGEWDKLTQDKSFNDNSKIRMIEVML 540

Query: 541 PVMDAPTSLIEQAKLTASINAKQ 563
           PV DAP +L+EQAKLTA+ NAKQ
Sbjct: 541 PVFDAPQNLVEQAKLTAATNAKQ 563

>YLR044C Chr12 complement(232390..234081) [1692 bp, 563 aa] {ON}
           PDC1Major of three pyruvate decarboxylase isozymes, key
           enzyme in alcoholic fermentation, decarboxylates
           pyruvate to acetaldehyde; subject to glucose-, ethanol-,
           and autoregulation; involved in amino acid catabolism
          Length = 563

 Score = 1025 bits (2651), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 498/563 (88%), Positives = 527/563 (93%)

Query: 1   MSEITLGRYLFERLNQVDVKTIFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADG 60
           MSEITLG+YLFERL QV+V T+FGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADG
Sbjct: 1   MSEITLGKYLFERLKQVNVNTVFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADG 60

Query: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNG 120
           YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSIS+QAKQLLLHHTLGNG
Sbjct: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTLGNG 120

Query: 121 DFTVFHRMSANISETTAMVTDIATAPAEIDRCIRTTYITQRPVYLGLPANLVDLKVPAKL 180
           DFTVFHRMSANISETTAM+TDIATAPAEIDRCIRTTY+TQRPVYLGLPANLVDL VPAKL
Sbjct: 121 DFTVFHRMSANISETTAMITDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLNVPAKL 180

Query: 181 LETPIDLSLKPNDPEAETEVVDTVLELIKAAKNPVILADACASRHDVKAETKKLIDATQF 240
           L+TPID+SLKPND E+E EV+DT+L L+K AKNPVILADAC SRHDVKAETKKLID TQF
Sbjct: 181 LQTPIDMSLKPNDAESEKEVIDTILALVKDAKNPVILADACCSRHDVKAETKKLIDLTQF 240

Query: 241 PSFVTPMGKGSIDEQHPRFGGVYVGTLSRPEVKEAVESADLILSVGALLSDFNTGSFSYS 300
           P+FVTPMGKGSIDEQHPR+GGVYVGTLS+PEVKEAVESADLILSVGALLSDFNTGSFSYS
Sbjct: 241 PAFVTPMGKGSIDEQHPRYGGVYVGTLSKPEVKEAVESADLILSVGALLSDFNTGSFSYS 300

Query: 301 YKTKNIVEFHSDYIKIRNATFPGVQMKFALQKLLNAVPEAIKGYKPVPVPARVPENKSCD 360
           YKTKNIVEFHSD++KIRNATFPGVQMKF LQKLL  + +A KGYKPV VPAR P N +  
Sbjct: 301 YKTKNIVEFHSDHMKIRNATFPGVQMKFVLQKLLTTIADAAKGYKPVAVPARTPANAAVP 360

Query: 361 PATPLKQEWMWNQVSKFLQEGDVVITETGTSAFGINQTPFPNNAYGISQVLWGSIGFTTG 420
            +TPLKQEWMWNQ+  FLQEGDVVI ETGTSAFGINQT FPNN YGISQVLWGSIGFTTG
Sbjct: 361 ASTPLKQEWMWNQLGNFLQEGDVVIAETGTSAFGINQTTFPNNTYGISQVLWGSIGFTTG 420

Query: 421 ACLGAAFAAEEIDPKKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNDGYTIERLI 480
           A LGAAFAAEEIDPKKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNDGYTIE+LI
Sbjct: 421 ATLGAAFAAEEIDPKKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNDGYTIEKLI 480

Query: 481 HGEKAGYNDIQNWDHLALLPTFGAKDYENHRVATTGEWDKLTQDKEFNKNSKIRMIEVML 540
           HG KA YN+IQ WDHL+LLPTFGAKDYE HRVATTGEWDKLTQDK FN NSKIRMIE+ML
Sbjct: 481 HGPKAQYNEIQGWDHLSLLPTFGAKDYETHRVATTGEWDKLTQDKSFNDNSKIRMIEIML 540

Query: 541 PVMDAPTSLIEQAKLTASINAKQ 563
           PV DAP +L+EQAKLTA+ NAKQ
Sbjct: 541 PVFDAPQNLVEQAKLTAATNAKQ 563

>Suva_10.128 Chr10 complement(233880..235571) [1692 bp, 563 aa] {ON}
           YLR044C (REAL)
          Length = 563

 Score = 1025 bits (2650), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 498/563 (88%), Positives = 529/563 (93%)

Query: 1   MSEITLGRYLFERLNQVDVKTIFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADG 60
           MSEITLG+YLFERLNQV+V T+FGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADG
Sbjct: 1   MSEITLGKYLFERLNQVNVNTVFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADG 60

Query: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNG 120
           YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSIS+QAKQLLLHHTLGNG
Sbjct: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTLGNG 120

Query: 121 DFTVFHRMSANISETTAMVTDIATAPAEIDRCIRTTYITQRPVYLGLPANLVDLKVPAKL 180
           DFTVFHRMSANISETTAM+TDIATAPAEIDRCIRTTY+TQRPVYLGLPANLVDL VPAKL
Sbjct: 121 DFTVFHRMSANISETTAMITDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLNVPAKL 180

Query: 181 LETPIDLSLKPNDPEAETEVVDTVLELIKAAKNPVILADACASRHDVKAETKKLIDATQF 240
           LETPID+SLKPND E+E EV+DT+L L+K AKNP+ILADAC SRHDVKAETKKLID TQF
Sbjct: 181 LETPIDMSLKPNDAESEKEVIDTILALVKDAKNPIILADACCSRHDVKAETKKLIDLTQF 240

Query: 241 PSFVTPMGKGSIDEQHPRFGGVYVGTLSRPEVKEAVESADLILSVGALLSDFNTGSFSYS 300
           PSFVTPMGKGSIDE+HPR+GGVYVGTLS+PEVK+AVESADLILSVGALLSDFNTGSFSYS
Sbjct: 241 PSFVTPMGKGSIDEKHPRYGGVYVGTLSKPEVKKAVESADLILSVGALLSDFNTGSFSYS 300

Query: 301 YKTKNIVEFHSDYIKIRNATFPGVQMKFALQKLLNAVPEAIKGYKPVPVPARVPENKSCD 360
           YKTKNIVEFHSD++KIRNATFPGVQMKF LQKLL  V +A KGYKPV VPA  P N +  
Sbjct: 301 YKTKNIVEFHSDHMKIRNATFPGVQMKFVLQKLLTTVADAAKGYKPVAVPAPTPANAAVP 360

Query: 361 PATPLKQEWMWNQVSKFLQEGDVVITETGTSAFGINQTPFPNNAYGISQVLWGSIGFTTG 420
            +TPLKQEWMWNQ+ +FLQEGDVVI ETGTSAFGINQ  FPNN YGISQVLWGSIGFTTG
Sbjct: 361 ASTPLKQEWMWNQLGEFLQEGDVVIAETGTSAFGINQVAFPNNTYGISQVLWGSIGFTTG 420

Query: 421 ACLGAAFAAEEIDPKKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNDGYTIERLI 480
           A LGAAFAAEEIDPKKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNDGYTIE+LI
Sbjct: 421 ATLGAAFAAEEIDPKKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNDGYTIEKLI 480

Query: 481 HGEKAGYNDIQNWDHLALLPTFGAKDYENHRVATTGEWDKLTQDKEFNKNSKIRMIEVML 540
           HG KA YN+IQNWDHL+LLPTFGAKDYE HRVATTGEWDKLTQDK FN+NSKIRMIE+ML
Sbjct: 481 HGPKAQYNEIQNWDHLSLLPTFGAKDYETHRVATTGEWDKLTQDKSFNENSKIRMIEIML 540

Query: 541 PVMDAPTSLIEQAKLTASINAKQ 563
           PV DAP +L+EQAKLTA+ NAKQ
Sbjct: 541 PVFDAPQNLVEQAKLTAATNAKQ 563

>NCAS0D01660 Chr4 complement(313684..315378) [1695 bp, 564 aa] {ON}
           Anc_5.122
          Length = 564

 Score = 1020 bits (2637), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 491/564 (87%), Positives = 530/564 (93%)

Query: 1   MSEITLGRYLFERLNQVDVKTIFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADG 60
           MSEITLG+YLFERLNQ+DVKTIFGLPGDFNLSLLDKIYE+ GMRWAGNANELNAAYAADG
Sbjct: 1   MSEITLGKYLFERLNQIDVKTIFGLPGDFNLSLLDKIYEIPGMRWAGNANELNAAYAADG 60

Query: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNG 120
           YAR+KGMSC+ITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNG
Sbjct: 61  YARLKGMSCLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNG 120

Query: 121 DFTVFHRMSANISETTAMVTDIATAPAEIDRCIRTTYITQRPVYLGLPANLVDLKVPAKL 180
           DFTVFHRMSANISETTAMVTDIATAPAEIDRCIRTTY+TQRPVYLGLPANLVDLKVPA L
Sbjct: 121 DFTVFHRMSANISETTAMVTDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLKVPASL 180

Query: 181 LETPIDLSLKPNDPEAETEVVDTVLELIKAAKNPVILADACASRHDVKAETKKLIDATQF 240
           L+TPIDLSLK ND EAE EV++T+L+L+K+AKNP+ILADACASRHDVKAET+KLID TQF
Sbjct: 181 LDTPIDLSLKANDAEAEAEVIETILDLVKSAKNPIILADACASRHDVKAETRKLIDITQF 240

Query: 241 PSFVTPMGKGSIDEQHPRFGGVYVGTLSRPEVKEAVESADLILSVGALLSDFNTGSFSYS 300
           PSFVTPMGKGSIDEQHPRFGGVYVGTLS P +K++VESADLILSVGALLSDFNTGSFSYS
Sbjct: 241 PSFVTPMGKGSIDEQHPRFGGVYVGTLSSPAIKQSVESADLILSVGALLSDFNTGSFSYS 300

Query: 301 YKTKNIVEFHSDYIKIRNATFPGVQMKFALQKLLNAVPEAIKGYKPVPVPARVPENKSCD 360
           YKTKN+VEFHSDYIKI+NATFPGVQMKF LQKLL  +  A KGYKPV VPA+   N +  
Sbjct: 301 YKTKNVVEFHSDYIKIKNATFPGVQMKFVLQKLLTVIAAAAKGYKPVAVPAKPAANPATA 360

Query: 361 PATPLKQEWMWNQVSKFLQEGDVVITETGTSAFGINQTPFPNNAYGISQVLWGSIGFTTG 420
            +TPLKQEW+WNQV KFLQEGDVVI+ETGTSAFGINQT FPNN YGISQVLWGSIGF TG
Sbjct: 361 ASTPLKQEWLWNQVGKFLQEGDVVISETGTSAFGINQTHFPNNTYGISQVLWGSIGFATG 420

Query: 421 ACLGAAFAAEEIDPKKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNDGYTIERLI 480
             LGAAFAAEEIDPKKRVILF G+GSLQLTVQEISTM+RW LKPYLFVLNNDGYTIERLI
Sbjct: 421 CTLGAAFAAEEIDPKKRVILFTGEGSLQLTVQEISTMVRWNLKPYLFVLNNDGYTIERLI 480

Query: 481 HGEKAGYNDIQNWDHLALLPTFGAKDYENHRVATTGEWDKLTQDKEFNKNSKIRMIEVML 540
           HGEKA YNDIQNW+HL LLPTFGAKDYENHRV+TTGEWDKLT +KEFN+N++IRMIE+ML
Sbjct: 481 HGEKADYNDIQNWEHLNLLPTFGAKDYENHRVSTTGEWDKLTSNKEFNQNTRIRMIEIML 540

Query: 541 PVMDAPTSLIEQAKLTASINAKQE 564
           PVMDAP++L+ QAKLTASINAKQ+
Sbjct: 541 PVMDAPSNLVAQAKLTASINAKQD 564

>Skud_12.110 Chr12 complement(217239..218930) [1692 bp, 563 aa] {ON}
           YLR044C (REAL)
          Length = 563

 Score = 1018 bits (2631), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 494/563 (87%), Positives = 525/563 (93%)

Query: 1   MSEITLGRYLFERLNQVDVKTIFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADG 60
           MSE+TLG+YLFERL QV+V T+FGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADG
Sbjct: 1   MSELTLGKYLFERLKQVNVNTVFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADG 60

Query: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNG 120
           YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSIS+QAKQLLLHHTLGNG
Sbjct: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTLGNG 120

Query: 121 DFTVFHRMSANISETTAMVTDIATAPAEIDRCIRTTYITQRPVYLGLPANLVDLKVPAKL 180
           DFTVFHRMSANISETTAM+TDIATAPAEIDRCIRTTY+TQRPVYLGLPANLVDL V AKL
Sbjct: 121 DFTVFHRMSANISETTAMITDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLNVDAKL 180

Query: 181 LETPIDLSLKPNDPEAETEVVDTVLELIKAAKNPVILADACASRHDVKAETKKLIDATQF 240
           L+TPID+SLKPND E+E EV+DT++ L+K AKNPVILADAC SRHDVKAETKKLID TQF
Sbjct: 181 LDTPIDMSLKPNDAESEKEVIDTIMALVKDAKNPVILADACCSRHDVKAETKKLIDLTQF 240

Query: 241 PSFVTPMGKGSIDEQHPRFGGVYVGTLSRPEVKEAVESADLILSVGALLSDFNTGSFSYS 300
           P+FVTPMGKGSIDEQHPR+GGVYVGTLS+P VKEAVESADLILSVGALLSDFNTGSFSYS
Sbjct: 241 PAFVTPMGKGSIDEQHPRYGGVYVGTLSKPAVKEAVESADLILSVGALLSDFNTGSFSYS 300

Query: 301 YKTKNIVEFHSDYIKIRNATFPGVQMKFALQKLLNAVPEAIKGYKPVPVPARVPENKSCD 360
           YKTKNIVEFHSD+IKIRNATFPGVQMKF LQKLL  + +A KGYKPV VPA  P N +  
Sbjct: 301 YKTKNIVEFHSDHIKIRNATFPGVQMKFVLQKLLTTIADAAKGYKPVAVPAGTPANAAVA 360

Query: 361 PATPLKQEWMWNQVSKFLQEGDVVITETGTSAFGINQTPFPNNAYGISQVLWGSIGFTTG 420
            +TPLKQEWMWNQ+  FLQEGDVVI ETGTSAFGINQT FPNN YGISQVLWGSIGFTTG
Sbjct: 361 ASTPLKQEWMWNQLGNFLQEGDVVIAETGTSAFGINQTTFPNNTYGISQVLWGSIGFTTG 420

Query: 421 ACLGAAFAAEEIDPKKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNDGYTIERLI 480
           A LGAAFAAEEIDPKKRVILFIGDGSLQLTVQEISTMIRWGLKPYLF+LNNDGYTIE+LI
Sbjct: 421 ATLGAAFAAEEIDPKKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFILNNDGYTIEKLI 480

Query: 481 HGEKAGYNDIQNWDHLALLPTFGAKDYENHRVATTGEWDKLTQDKEFNKNSKIRMIEVML 540
           HG KA YN+IQNWDHL+LLPTFGAKDYE HRVATTGEWDKLTQDK FN NSKIRMIE+ML
Sbjct: 481 HGPKAQYNEIQNWDHLSLLPTFGAKDYETHRVATTGEWDKLTQDKSFNDNSKIRMIEIML 540

Query: 541 PVMDAPTSLIEQAKLTASINAKQ 563
           PV DAP +L+EQAKLTA+ NAKQ
Sbjct: 541 PVFDAPQNLVEQAKLTAATNAKQ 563

>ACL134C Chr3 complement(117344..119104) [1761 bp, 586 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR044C
           (PDC1) and Non-syntenic homolog of Saccharomyces
           cerevisiae YLR134W (PDC5) and YGR087C (PDC6)
          Length = 586

 Score = 1009 bits (2610), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 489/564 (86%), Positives = 527/564 (93%)

Query: 1   MSEITLGRYLFERLNQVDVKTIFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADG 60
           MSEITLGRYLFERL Q++V+TIFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADG
Sbjct: 23  MSEITLGRYLFERLRQIEVQTIFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADG 82

Query: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNG 120
           YAR+KGMSC+ITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSIS+QAKQLLLHHTLGNG
Sbjct: 83  YARLKGMSCLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTLGNG 142

Query: 121 DFTVFHRMSANISETTAMVTDIATAPAEIDRCIRTTYITQRPVYLGLPANLVDLKVPAKL 180
           DFTVFHRMSANIS TTAM++DI +APAEIDRCIRT YITQRPVYLGLPAN+VDLKVPA L
Sbjct: 143 DFTVFHRMSANISGTTAMISDITSAPAEIDRCIRTCYITQRPVYLGLPANMVDLKVPASL 202

Query: 181 LETPIDLSLKPNDPEAETEVVDTVLELIKAAKNPVILADACASRHDVKAETKKLIDATQF 240
           LETPIDL+LKPNDPEAE EVV+TVLE+I AAKNPVIL+DACASRHDVKAET KLID TQF
Sbjct: 203 LETPIDLNLKPNDPEAEAEVVETVLEMIAAAKNPVILSDACASRHDVKAETMKLIDVTQF 262

Query: 241 PSFVTPMGKGSIDEQHPRFGGVYVGTLSRPEVKEAVESADLILSVGALLSDFNTGSFSYS 300
           P+FVTPMGKGSI EQHPRFGGVYVGTLS PEVKEAVESADL+LSVGALLSDFNTGSFSYS
Sbjct: 263 PAFVTPMGKGSIYEQHPRFGGVYVGTLSSPEVKEAVESADLVLSVGALLSDFNTGSFSYS 322

Query: 301 YKTKNIVEFHSDYIKIRNATFPGVQMKFALQKLLNAVPEAIKGYKPVPVPARVPENKSCD 360
           YKTKN+VEFHSD+IKIRNATFPGVQMK+ L+KL++ V E IK Y PVPVP++   N+  D
Sbjct: 323 YKTKNVVEFHSDHIKIRNATFPGVQMKYVLRKLVDNVAEVIKSYVPVPVPSKPANNEEID 382

Query: 361 PATPLKQEWMWNQVSKFLQEGDVVITETGTSAFGINQTPFPNNAYGISQVLWGSIGFTTG 420
            ATPLKQEW+WNQV KFL+EGDVVITETGTSAFGINQT FPNN YGISQVLWGSIGFTTG
Sbjct: 383 SATPLKQEWLWNQVGKFLREGDVVITETGTSAFGINQTHFPNNTYGISQVLWGSIGFTTG 442

Query: 421 ACLGAAFAAEEIDPKKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNDGYTIERLI 480
           ACLGAAFAAEE+DP +RVILFIGDGSLQLTVQEISTM+RWGLKPYLFVLNNDGYTIERLI
Sbjct: 443 ACLGAAFAAEELDPNRRVILFIGDGSLQLTVQEISTMVRWGLKPYLFVLNNDGYTIERLI 502

Query: 481 HGEKAGYNDIQNWDHLALLPTFGAKDYENHRVATTGEWDKLTQDKEFNKNSKIRMIEVML 540
           HGE A YNDIQ W HL LLPTFGAKDYE  RV+TTGEWD LTQDK FN+NSKIRMIEVML
Sbjct: 503 HGETAQYNDIQPWQHLNLLPTFGAKDYEAVRVSTTGEWDALTQDKAFNENSKIRMIEVML 562

Query: 541 PVMDAPTSLIEQAKLTASINAKQE 564
           PVMDAP++L++QA+LTA+ NAKQE
Sbjct: 563 PVMDAPSNLVKQAELTAATNAKQE 586

>Suva_10.227 Chr10 (419251..420942) [1692 bp, 563 aa] {ON} YLR134W
           (REAL)
          Length = 563

 Score = 1003 bits (2593), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 485/563 (86%), Positives = 523/563 (92%)

Query: 1   MSEITLGRYLFERLNQVDVKTIFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADG 60
           MSEITLG+YLFERL+QVD  T+FGLPGDFNLSLLDK+YEVEGMRWAGNANELNAAYAADG
Sbjct: 1   MSEITLGKYLFERLSQVDCNTVFGLPGDFNLSLLDKLYEVEGMRWAGNANELNAAYAADG 60

Query: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNG 120
           YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNG
Sbjct: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNG 120

Query: 121 DFTVFHRMSANISETTAMVTDIATAPAEIDRCIRTTYITQRPVYLGLPANLVDLKVPAKL 180
           DFTVFHRMSANISETTAM+TDIA APAEIDRCIRTT+ TQRPVYLGLPANLVDL VPAKL
Sbjct: 121 DFTVFHRMSANISETTAMITDIANAPAEIDRCIRTTFTTQRPVYLGLPANLVDLNVPAKL 180

Query: 181 LETPIDLSLKPNDPEAETEVVDTVLELIKAAKNPVILADACASRHDVKAETKKLIDATQF 240
           LETPID++LKPND EAE EVV TV+E+I+ AKNPVILADACASRHDVKAETKKLID TQF
Sbjct: 181 LETPIDMALKPNDAEAEAEVVRTVIEMIQDAKNPVILADACASRHDVKAETKKLIDLTQF 240

Query: 241 PSFVTPMGKGSIDEQHPRFGGVYVGTLSRPEVKEAVESADLILSVGALLSDFNTGSFSYS 300
           P+FVTPMGKGSIDEQHPR+GGVYVGTLS+PEVK+AVESADLILSVGALLSDFNTGSFSYS
Sbjct: 241 PTFVTPMGKGSIDEQHPRYGGVYVGTLSKPEVKKAVESADLILSVGALLSDFNTGSFSYS 300

Query: 301 YKTKNIVEFHSDYIKIRNATFPGVQMKFALQKLLNAVPEAIKGYKPVPVPARVPENKSCD 360
           Y+TKNIVEFHSD+IKIRNATFPGVQMKFALQ+LL+A+PE +K YKPV VPAR P NK+  
Sbjct: 301 YRTKNIVEFHSDHIKIRNATFPGVQMKFALQRLLSAIPEVVKDYKPVAVPARTPANKALP 360

Query: 361 PATPLKQEWMWNQVSKFLQEGDVVITETGTSAFGINQTPFPNNAYGISQVLWGSIGFTTG 420
            +TP+KQEWMWNQ+S FLQEGD+VI ETGTSAFGINQT FP + Y I QVLWGSIGFT G
Sbjct: 361 ASTPMKQEWMWNQLSTFLQEGDIVIAETGTSAFGINQTTFPTDVYAIVQVLWGSIGFTVG 420

Query: 421 ACLGAAFAAEEIDPKKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNDGYTIERLI 480
           A LGA  AAEEIDPKKRVILFIGDGSLQLTVQEISTMIRWGLKPY+FVLNN+GYTIE+LI
Sbjct: 421 ALLGATMAAEEIDPKKRVILFIGDGSLQLTVQEISTMIRWGLKPYIFVLNNNGYTIEKLI 480

Query: 481 HGEKAGYNDIQNWDHLALLPTFGAKDYENHRVATTGEWDKLTQDKEFNKNSKIRMIEVML 540
           HG  A YN++Q WDHLALLPTFGAKDYE HRV TTGEWDKLTQDKEF  NS+IRMIEVML
Sbjct: 481 HGPHAEYNEVQPWDHLALLPTFGAKDYETHRVVTTGEWDKLTQDKEFQDNSRIRMIEVML 540

Query: 541 PVMDAPTSLIEQAKLTASINAKQ 563
           PV DAP +L++QA+LTA+ NAKQ
Sbjct: 541 PVFDAPQNLVKQAQLTAATNAKQ 563

>SAKL0G14894g Chr7 (1275005..1276699) [1695 bp, 564 aa] {ON}
           uniprot|Q6XAF0 Saccharomyces kluyveri PDC12 Pyruvate
           decarboxylase
          Length = 564

 Score =  998 bits (2580), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 501/564 (88%), Positives = 532/564 (94%)

Query: 1   MSEITLGRYLFERLNQVDVKTIFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADG 60
           MSEITLGRYLFERLNQV+V+TIFGLPGDFNLSLLDKIYEV GMRWAGNANELNAAYAADG
Sbjct: 1   MSEITLGRYLFERLNQVEVQTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADG 60

Query: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNG 120
           YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPS+SSQAKQLLLHHTLGNG
Sbjct: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSVSSQAKQLLLHHTLGNG 120

Query: 121 DFTVFHRMSANISETTAMVTDIATAPAEIDRCIRTTYITQRPVYLGLPANLVDLKVPAKL 180
           DFTVFHRMSANISETTA VTDIATAPAEIDRCIRTTY+TQRPVYLGLPANLVDL VPA L
Sbjct: 121 DFTVFHRMSANISETTAWVTDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLMVPASL 180

Query: 181 LETPIDLSLKPNDPEAETEVVDTVLELIKAAKNPVILADACASRHDVKAETKKLIDATQF 240
           L+TPIDLSLKPNDPEAE EVV+TVLELIK AKNPVILADACASRH+VK+ETK+LID TQF
Sbjct: 181 LDTPIDLSLKPNDPEAEAEVVNTVLELIKDAKNPVILADACASRHNVKSETKQLIDITQF 240

Query: 241 PSFVTPMGKGSIDEQHPRFGGVYVGTLSRPEVKEAVESADLILSVGALLSDFNTGSFSYS 300
           P+FVTP+GKGSIDEQHPRFGGVYVGTLS  +VKEAVESADLILSVGALLSDFNTGSFSYS
Sbjct: 241 PAFVTPLGKGSIDEQHPRFGGVYVGTLSNDDVKEAVESADLILSVGALLSDFNTGSFSYS 300

Query: 301 YKTKNIVEFHSDYIKIRNATFPGVQMKFALQKLLNAVPEAIKGYKPVPVPARVPENKSCD 360
           YKTKNIVEFHSDYIKIRNATFPGVQMKFALQKLL+ V E +K YKPV VPA+   N +CD
Sbjct: 301 YKTKNIVEFHSDYIKIRNATFPGVQMKFALQKLLSQVGEVVKDYKPVAVPAKPTPNPACD 360

Query: 361 PATPLKQEWMWNQVSKFLQEGDVVITETGTSAFGINQTPFPNNAYGISQVLWGSIGFTTG 420
           P+TPLKQEW+WNQV +FLQEGDVVITETGTSAFGINQT FPNN YGISQVLWGSIGFTTG
Sbjct: 361 PSTPLKQEWVWNQVGRFLQEGDVVITETGTSAFGINQTHFPNNTYGISQVLWGSIGFTTG 420

Query: 421 ACLGAAFAAEEIDPKKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNDGYTIERLI 480
           ACLGAA AAEE+D  KRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNDGYTIERLI
Sbjct: 421 ACLGAACAAEELDKNKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNDGYTIERLI 480

Query: 481 HGEKAGYNDIQNWDHLALLPTFGAKDYENHRVATTGEWDKLTQDKEFNKNSKIRMIEVML 540
           HGE A YN+IQ W +L LLPTFGAKDYE +RVATTGEWDKL QD+ FNKNS+IRM+EVML
Sbjct: 481 HGENAQYNEIQPWKNLDLLPTFGAKDYETYRVATTGEWDKLAQDEAFNKNSRIRMVEVML 540

Query: 541 PVMDAPTSLIEQAKLTASINAKQE 564
           PVMDAP++L++QA+LTASINAKQE
Sbjct: 541 PVMDAPSNLVKQAQLTASINAKQE 564

>Smik_12.197 Chr12 (392030..393721) [1692 bp, 563 aa] {ON} YLR134W
           (REAL)
          Length = 563

 Score =  997 bits (2577), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 487/563 (86%), Positives = 520/563 (92%)

Query: 1   MSEITLGRYLFERLNQVDVKTIFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADG 60
           MSEITLG+YLFERL+QV   T+FGLPGDFNLSLLDK+YEVEGMRWAGNANELNAAYAADG
Sbjct: 1   MSEITLGKYLFERLSQVKCNTVFGLPGDFNLSLLDKLYEVEGMRWAGNANELNAAYAADG 60

Query: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNG 120
           YARIKG++CIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNG
Sbjct: 61  YARIKGIACIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNG 120

Query: 121 DFTVFHRMSANISETTAMVTDIATAPAEIDRCIRTTYITQRPVYLGLPANLVDLKVPAKL 180
           DFTVFHRMSANISETTAMVTDIA APAEIDRCIRTT+ TQRPVYLGLPANLVDL VPAKL
Sbjct: 121 DFTVFHRMSANISETTAMVTDIANAPAEIDRCIRTTFTTQRPVYLGLPANLVDLNVPAKL 180

Query: 181 LETPIDLSLKPNDPEAETEVVDTVLELIKAAKNPVILADACASRHDVKAETKKLIDATQF 240
           LETPIDLSLKPND EAE EVV TV+E+IK AKNPVILADACASRHDVKAETKKLI+ TQF
Sbjct: 181 LETPIDLSLKPNDAEAEAEVVRTVIEMIKDAKNPVILADACASRHDVKAETKKLIELTQF 240

Query: 241 PSFVTPMGKGSIDEQHPRFGGVYVGTLSRPEVKEAVESADLILSVGALLSDFNTGSFSYS 300
           P +VTPMGKG+IDEQHPR+GGVYVGTLSRPEVKE VE+ADLILSVGALLSDFNTGSFSYS
Sbjct: 241 PVYVTPMGKGAIDEQHPRYGGVYVGTLSRPEVKEGVENADLILSVGALLSDFNTGSFSYS 300

Query: 301 YKTKNIVEFHSDYIKIRNATFPGVQMKFALQKLLNAVPEAIKGYKPVPVPARVPENKSCD 360
           YKTKNIVEFHSD+IKIRNATFPGVQMKFALQKLL A+P  +K YKPV VPARVP NK   
Sbjct: 301 YKTKNIVEFHSDHIKIRNATFPGVQMKFALQKLLGAIPAVVKDYKPVAVPARVPLNKPSP 360

Query: 361 PATPLKQEWMWNQVSKFLQEGDVVITETGTSAFGINQTPFPNNAYGISQVLWGSIGFTTG 420
             TP+KQEWMWNQ+S FLQEGD+VI ETGTSAFGINQT FP + Y I QVLWGSIGFT G
Sbjct: 361 ANTPMKQEWMWNQLSNFLQEGDIVIAETGTSAFGINQTTFPTDVYAIVQVLWGSIGFTVG 420

Query: 421 ACLGAAFAAEEIDPKKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNDGYTIERLI 480
           A LGA  AAEEIDPKKRVILFIGDGSLQLTVQEISTMIRWGLKPY+FVLNN+GYTIE+LI
Sbjct: 421 ALLGATMAAEEIDPKKRVILFIGDGSLQLTVQEISTMIRWGLKPYIFVLNNNGYTIEKLI 480

Query: 481 HGEKAGYNDIQNWDHLALLPTFGAKDYENHRVATTGEWDKLTQDKEFNKNSKIRMIEVML 540
           HG  A YN+IQ WDHLALLPTFGAKDYENHR+ATTGEWDKLTQDK+F  NS+IR+IEVML
Sbjct: 481 HGPYADYNEIQGWDHLALLPTFGAKDYENHRIATTGEWDKLTQDKDFQDNSRIRLIEVML 540

Query: 541 PVMDAPTSLIEQAKLTASINAKQ 563
           PV DAP +L++QA+LTASINAKQ
Sbjct: 541 PVFDAPENLVQQAQLTASINAKQ 563

>NDAI0A01400 Chr1 (313925..315616) [1692 bp, 563 aa] {ON} 
          Length = 563

 Score =  996 bits (2576), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 497/562 (88%), Positives = 526/562 (93%)

Query: 1   MSEITLGRYLFERLNQVDVKTIFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADG 60
           MSEITLGRYLFERL+QV+V TIFGLPGDFNLSLLDKIYE  GMRWAGNANELNAAYAADG
Sbjct: 1   MSEITLGRYLFERLSQVNVNTIFGLPGDFNLSLLDKIYETPGMRWAGNANELNAAYAADG 60

Query: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNG 120
           YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNG
Sbjct: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNG 120

Query: 121 DFTVFHRMSANISETTAMVTDIATAPAEIDRCIRTTYITQRPVYLGLPANLVDLKVPAKL 180
           DFTVFHRMSANISETTAMVTDIATAPAEIDRCIRTTY+TQRPVYLGLPANLVDLKVPA L
Sbjct: 121 DFTVFHRMSANISETTAMVTDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLKVPASL 180

Query: 181 LETPIDLSLKPNDPEAETEVVDTVLELIKAAKNPVILADACASRHDVKAETKKLIDATQF 240
           LETPIDLSLKPND EAE EV++ VL LIK AKNPVILADAC SRHDVK ET+KLID TQF
Sbjct: 181 LETPIDLSLKPNDAEAEAEVLEEVLSLIKNAKNPVILADACCSRHDVKVETRKLIDITQF 240

Query: 241 PSFVTPMGKGSIDEQHPRFGGVYVGTLSRPEVKEAVESADLILSVGALLSDFNTGSFSYS 300
           PSFVTPMGKGSIDEQ+PRFGGVYVGTLSRPEVKEAVESADLILSVGALLSDFNTGSFSYS
Sbjct: 241 PSFVTPMGKGSIDEQNPRFGGVYVGTLSRPEVKEAVESADLILSVGALLSDFNTGSFSYS 300

Query: 301 YKTKNIVEFHSDYIKIRNATFPGVQMKFALQKLLNAVPEAIKGYKPVPVPARVPENKSCD 360
           YKTKNIVEFHSD+IKIRNATFPGVQMKF LQKLL +VP A+KGYKPVPVPA +P NK   
Sbjct: 301 YKTKNIVEFHSDHIKIRNATFPGVQMKFVLQKLLKSVPAAVKGYKPVPVPAGIPANKKVA 360

Query: 361 PATPLKQEWMWNQVSKFLQEGDVVITETGTSAFGINQTPFPNNAYGISQVLWGSIGFTTG 420
            +TPLKQEWMWNQV KFLQEGD+VITETGTSAFGINQT FPNN YGISQVLWGSIGFTTG
Sbjct: 361 DSTPLKQEWMWNQVGKFLQEGDIVITETGTSAFGINQTHFPNNTYGISQVLWGSIGFTTG 420

Query: 421 ACLGAAFAAEEIDPKKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNDGYTIERLI 480
           A LGAAFAAEEIDPK+RVILFIGDGSLQLTVQEISTM+RW LKPYLF+LNN+GYTIE+LI
Sbjct: 421 ATLGAAFAAEEIDPKRRVILFIGDGSLQLTVQEISTMVRWNLKPYLFILNNNGYTIEKLI 480

Query: 481 HGEKAGYNDIQNWDHLALLPTFGAKDYENHRVATTGEWDKLTQDKEFNKNSKIRMIEVML 540
           HG  A YN+IQ+W+HL LL TFGAKDYENHRVATTGEW+KL ++KEFN NS+IR+IEVML
Sbjct: 481 HGPTAQYNEIQSWEHLKLLETFGAKDYENHRVATTGEWNKLCENKEFNVNSRIRVIEVML 540

Query: 541 PVMDAPTSLIEQAKLTASINAK 562
           PVMDAP SLI+Q +LTA INA+
Sbjct: 541 PVMDAPQSLIKQGELTAQINAR 562

>ZYRO0F01606g Chr6 complement(130346..132037) [1692 bp, 563 aa] {ON}
           highly similar to uniprot|P06169 Saccharomyces
           cerevisiae YLR044C PDC1 Major of three pyruvate
           decarboxylase isozymes key enzyme in alcoholic
           fermentation decarboxylates pyruvate to acetaldehyde
           subject to glucose- ethanol- and autoregulation involved
           in amino acid catabolism and to YLR134W uniprot|P16467
           Saccharomyces cerevisiae YLR134W PDC5 Minor isoform of
           pyruvate decarboxylase, key enzyme in alcoholic
           fermentation, decarboxylates pyruvate to acetaldehyde,
           regulation is glucose- and ethanol-dependent, repressed
           by thiamine, involved in amino acid catabolism
          Length = 563

 Score =  995 bits (2573), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 481/563 (85%), Positives = 513/563 (91%)

Query: 1   MSEITLGRYLFERLNQVDVKTIFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADG 60
           MSEITLGRYLFERL QVD  TIFG+PGDFNLSLLDK+YEV+G+RWAGNANELNAAYAADG
Sbjct: 1   MSEITLGRYLFERLKQVDTNTIFGVPGDFNLSLLDKVYEVQGLRWAGNANELNAAYAADG 60

Query: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNG 120
           YAR+KG++ +ITTFGVGELSALNGIAGSYAEHVGVLH+VGVPS+SSQAKQLLLHHTLGNG
Sbjct: 61  YARVKGLAALITTFGVGELSALNGIAGSYAEHVGVLHIVGVPSVSSQAKQLLLHHTLGNG 120

Query: 121 DFTVFHRMSANISETTAMVTDIATAPAEIDRCIRTTYITQRPVYLGLPANLVDLKVPAKL 180
           DFTVFHRMSANISETTAM+TDI  APAEIDRCIR  Y+ QRPVYLGLPANLVD KVPA L
Sbjct: 121 DFTVFHRMSANISETTAMLTDITAAPAEIDRCIRVAYVNQRPVYLGLPANLVDQKVPASL 180

Query: 181 LETPIDLSLKPNDPEAETEVVDTVLELIKAAKNPVILADACASRHDVKAETKKLIDATQF 240
           L TPIDLSLK NDPEAETEVVDTVLELIK AKNPVILADAC SRHDVKAETKKLID TQF
Sbjct: 181 LNTPIDLSLKENDPEAETEVVDTVLELIKEAKNPVILADACCSRHDVKAETKKLIDLTQF 240

Query: 241 PSFVTPMGKGSIDEQHPRFGGVYVGTLSRPEVKEAVESADLILSVGALLSDFNTGSFSYS 300
           PSFVTPMGKGSIDEQ+PRFGGVYVGTLS PEVKEAVESADL+LSVGALLSDFNTGSFSYS
Sbjct: 241 PSFVTPMGKGSIDEQNPRFGGVYVGTLSSPEVKEAVESADLVLSVGALLSDFNTGSFSYS 300

Query: 301 YKTKNIVEFHSDYIKIRNATFPGVQMKFALQKLLNAVPEAIKGYKPVPVPARVPENKSCD 360
           YKTKN+VEFHSD+IKIRNATFPGVQMKF L+KLL AVPEA+K YKP PVPA    N    
Sbjct: 301 YKTKNVVEFHSDHIKIRNATFPGVQMKFVLKKLLQAVPEAVKNYKPGPVPAPPSPNAEVA 360

Query: 361 PATPLKQEWMWNQVSKFLQEGDVVITETGTSAFGINQTPFPNNAYGISQVLWGSIGFTTG 420
            +T LKQEW+W QV  FL+EGDVVITETGTSAFGINQT FPN  YGISQVLWGSIG+TTG
Sbjct: 361 DSTTLKQEWLWRQVGSFLREGDVVITETGTSAFGINQTHFPNQTYGISQVLWGSIGYTTG 420

Query: 421 ACLGAAFAAEEIDPKKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNDGYTIERLI 480
           + LGAAFAAEEIDPKKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNDGYTIERLI
Sbjct: 421 STLGAAFAAEEIDPKKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNDGYTIERLI 480

Query: 481 HGEKAGYNDIQNWDHLALLPTFGAKDYENHRVATTGEWDKLTQDKEFNKNSKIRMIEVML 540
           HGE A YN IQ W HL LL TFGAKDYENHRV+T GEW+KLTQD +FN+NS+IRMIEVML
Sbjct: 481 HGETAEYNCIQPWKHLELLNTFGAKDYENHRVSTVGEWNKLTQDPKFNENSRIRMIEVML 540

Query: 541 PVMDAPTSLIEQAKLTASINAKQ 563
            VMDAP+SL+ QA+LTA+ NAKQ
Sbjct: 541 EVMDAPSSLVAQAQLTAATNAKQ 563

>KAFR0E01520 Chr5 complement(306988..308679) [1692 bp, 563 aa] {ON} 
          Length = 563

 Score =  993 bits (2566), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 471/563 (83%), Positives = 524/563 (93%)

Query: 1   MSEITLGRYLFERLNQVDVKTIFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADG 60
           MSEITLGRYLFERL+QVDVKTIFGLPGDFNL+LLDKIYEV GMRWAGNANELNAAYAADG
Sbjct: 1   MSEITLGRYLFERLSQVDVKTIFGLPGDFNLALLDKIYEVPGMRWAGNANELNAAYAADG 60

Query: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNG 120
           YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHH+LGNG
Sbjct: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHSLGNG 120

Query: 121 DFTVFHRMSANISETTAMVTDIATAPAEIDRCIRTTYITQRPVYLGLPANLVDLKVPAKL 180
           DFTVFHRMSANISETTA++TDIATA AEIDRCI+TTYITQRPVYLG+PAN+ D K+PAKL
Sbjct: 121 DFTVFHRMSANISETTAVLTDIATAAAEIDRCIKTTYITQRPVYLGIPANMFDFKLPAKL 180

Query: 181 LETPIDLSLKPNDPEAETEVVDTVLELIKAAKNPVILADACASRHDVKAETKKLIDATQF 240
           LETPIDLSLKPNDPEAE EV+D +L L+KAAKNPVIL+DACASRH+V+ ET++LIDATQF
Sbjct: 181 LETPIDLSLKPNDPEAEDEVIDAILSLVKAAKNPVILSDACASRHNVRKETRQLIDATQF 240

Query: 241 PSFVTPMGKGSIDEQHPRFGGVYVGTLSRPEVKEAVESADLILSVGALLSDFNTGSFSYS 300
           P+F TPMGKGSIDEQHPR+GGVYVGTLSRPEVK+AVES+DLILSVGALLSDFNTGSFSYS
Sbjct: 241 PAFTTPMGKGSIDEQHPRYGGVYVGTLSRPEVKKAVESSDLILSVGALLSDFNTGSFSYS 300

Query: 301 YKTKNIVEFHSDYIKIRNATFPGVQMKFALQKLLNAVPEAIKGYKPVPVPARVPENKSCD 360
           YKTKN+VEFHSDY KI+NATFPGVQMKF LQKL   + + +KGYKP+PVPA+VP NK C 
Sbjct: 301 YKTKNVVEFHSDYTKIKNATFPGVQMKFVLQKLSKVIDQTVKGYKPIPVPAKVPSNKPCS 360

Query: 361 PATPLKQEWMWNQVSKFLQEGDVVITETGTSAFGINQTPFPNNAYGISQVLWGSIGFTTG 420
           P+TPL QEWMWNQ SKF QEGD++ITETGT+AFGINQ+ FP +A GISQVLWGSIGFT G
Sbjct: 361 PSTPLSQEWMWNQASKFFQEGDIIITETGTAAFGINQSEFPTHAVGISQVLWGSIGFTGG 420

Query: 421 ACLGAAFAAEEIDPKKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNDGYTIERLI 480
           A LGAAFAAEE+D  +RVILFIGDGSLQLTVQEISTMIRW L+PYLFVLNN+GYTIE+LI
Sbjct: 421 AVLGAAFAAEELDINRRVILFIGDGSLQLTVQEISTMIRWNLRPYLFVLNNNGYTIEKLI 480

Query: 481 HGEKAGYNDIQNWDHLALLPTFGAKDYENHRVATTGEWDKLTQDKEFNKNSKIRMIEVML 540
           HGE A YN+IQNW HL LL TFGAKDYENHR+ATTGEWD L  +K+FNKNS+IR+IE+ML
Sbjct: 481 HGENAQYNEIQNWKHLKLLETFGAKDYENHRIATTGEWDALLSNKDFNKNSRIRLIEIML 540

Query: 541 PVMDAPTSLIEQAKLTASINAKQ 563
           PVMDAP++L++QAK+TA+ NA+Q
Sbjct: 541 PVMDAPSNLVQQAKITAATNAQQ 563

>YLR134W Chr12 (410723..412414) [1692 bp, 563 aa] {ON}  PDC5Minor
           isoform of pyruvate decarboxylase, key enzyme in
           alcoholic fermentation, decarboxylates pyruvate to
           acetaldehyde, regulation is glucose- and
           ethanol-dependent, repressed by thiamine, involved in
           amino acid catabolism
          Length = 563

 Score =  992 bits (2565), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 483/563 (85%), Positives = 520/563 (92%)

Query: 1   MSEITLGRYLFERLNQVDVKTIFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADG 60
           MSEITLG+YLFERL+QV+  T+FGLPGDFNLSLLDK+YEV+GMRWAGNANELNAAYAADG
Sbjct: 1   MSEITLGKYLFERLSQVNCNTVFGLPGDFNLSLLDKLYEVKGMRWAGNANELNAAYAADG 60

Query: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNG 120
           YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNG
Sbjct: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNG 120

Query: 121 DFTVFHRMSANISETTAMVTDIATAPAEIDRCIRTTYITQRPVYLGLPANLVDLKVPAKL 180
           DFTVFHRMSANISETTAM+TDIA APAEIDRCIRTTY TQRPVYLGLPANLVDL VPAKL
Sbjct: 121 DFTVFHRMSANISETTAMITDIANAPAEIDRCIRTTYTTQRPVYLGLPANLVDLNVPAKL 180

Query: 181 LETPIDLSLKPNDPEAETEVVDTVLELIKAAKNPVILADACASRHDVKAETKKLIDATQF 240
           LETPIDLSLKPND EAE EVV TV+ELIK AKNPVILADACASRHDVKAETKKL+D TQF
Sbjct: 181 LETPIDLSLKPNDAEAEAEVVRTVVELIKDAKNPVILADACASRHDVKAETKKLMDLTQF 240

Query: 241 PSFVTPMGKGSIDEQHPRFGGVYVGTLSRPEVKEAVESADLILSVGALLSDFNTGSFSYS 300
           P +VTPMGKG+IDEQHPR+GGVYVGTLSRPEVK+AVESADLILS+GALLSDFNTGSFSYS
Sbjct: 241 PVYVTPMGKGAIDEQHPRYGGVYVGTLSRPEVKKAVESADLILSIGALLSDFNTGSFSYS 300

Query: 301 YKTKNIVEFHSDYIKIRNATFPGVQMKFALQKLLNAVPEAIKGYKPVPVPARVPENKSCD 360
           YKTKNIVEFHSD+IKIRNATFPGVQMKFALQKLL+A+PE +K YKPV VPARVP  KS  
Sbjct: 301 YKTKNIVEFHSDHIKIRNATFPGVQMKFALQKLLDAIPEVVKDYKPVAVPARVPITKSTP 360

Query: 361 PATPLKQEWMWNQVSKFLQEGDVVITETGTSAFGINQTPFPNNAYGISQVLWGSIGFTTG 420
             TP+KQEWMWN +  FL+EGD+VI ETGTSAFGINQT FP + Y I QVLWGSIGFT G
Sbjct: 361 ANTPMKQEWMWNHLGNFLREGDIVIAETGTSAFGINQTTFPTDVYAIVQVLWGSIGFTVG 420

Query: 421 ACLGAAFAAEEIDPKKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNDGYTIERLI 480
           A LGA  AAEE+DPKKRVILFIGDGSLQLTVQEISTMIRWGLKPY+FVLNN+GYTIE+LI
Sbjct: 421 ALLGATMAAEELDPKKRVILFIGDGSLQLTVQEISTMIRWGLKPYIFVLNNNGYTIEKLI 480

Query: 481 HGEKAGYNDIQNWDHLALLPTFGAKDYENHRVATTGEWDKLTQDKEFNKNSKIRMIEVML 540
           HG  A YN+IQ WDHLALLPTFGA++YE HRVATTGEW+KLTQDK+F  NSKIRMIEVML
Sbjct: 481 HGPHAEYNEIQGWDHLALLPTFGARNYETHRVATTGEWEKLTQDKDFQDNSKIRMIEVML 540

Query: 541 PVMDAPTSLIEQAKLTASINAKQ 563
           PV DAP +L++QA+LTA+ NAKQ
Sbjct: 541 PVFDAPQNLVKQAQLTAATNAKQ 563

>Skud_12.203 Chr12 (393390..395081) [1692 bp, 563 aa] {ON} YLR134W
           (REAL)
          Length = 563

 Score =  990 bits (2559), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 477/563 (84%), Positives = 520/563 (92%)

Query: 1   MSEITLGRYLFERLNQVDVKTIFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADG 60
           MSEITLG+YLFERL+QV+  T+FGLPGDFNLSLLDK+YEVEGMRWAGNANELNAAYAADG
Sbjct: 1   MSEITLGKYLFERLSQVNCNTVFGLPGDFNLSLLDKLYEVEGMRWAGNANELNAAYAADG 60

Query: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNG 120
           YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAK LLLHHTLGNG
Sbjct: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKHLLLHHTLGNG 120

Query: 121 DFTVFHRMSANISETTAMVTDIATAPAEIDRCIRTTYITQRPVYLGLPANLVDLKVPAKL 180
           DFTVFHRMSANISETTAM+TDIA+AP+EIDRCIRTT+ TQRPVYLGLPANLVDL VPAKL
Sbjct: 121 DFTVFHRMSANISETTAMITDIASAPSEIDRCIRTTFTTQRPVYLGLPANLVDLNVPAKL 180

Query: 181 LETPIDLSLKPNDPEAETEVVDTVLELIKAAKNPVILADACASRHDVKAETKKLIDATQF 240
           L+TPID+SLKPND EAE EVV TV+E+IK AKNPVILADACASRHDVKAETKKLI+ TQF
Sbjct: 181 LDTPIDMSLKPNDAEAEAEVVRTVIEMIKDAKNPVILADACASRHDVKAETKKLIELTQF 240

Query: 241 PSFVTPMGKGSIDEQHPRFGGVYVGTLSRPEVKEAVESADLILSVGALLSDFNTGSFSYS 300
           P FVTPMGKG+IDEQHPR+GGVYVGTLSRPEVK+AVESADLILSVGALLSDFNTGSFSYS
Sbjct: 241 PIFVTPMGKGAIDEQHPRYGGVYVGTLSRPEVKKAVESADLILSVGALLSDFNTGSFSYS 300

Query: 301 YKTKNIVEFHSDYIKIRNATFPGVQMKFALQKLLNAVPEAIKGYKPVPVPARVPENKSCD 360
           YKTKN+VEFHSD+IKIRNATFPGVQMKF LQKLLNA+PE +K YKPV VPARVP NK+  
Sbjct: 301 YKTKNVVEFHSDHIKIRNATFPGVQMKFTLQKLLNAIPEVVKDYKPVAVPARVPINKATP 360

Query: 361 PATPLKQEWMWNQVSKFLQEGDVVITETGTSAFGINQTPFPNNAYGISQVLWGSIGFTTG 420
             T +KQEWMWNQ+  FLQEGD+VI ETGTSAFGINQT FP + Y I QVLWGSIGFT G
Sbjct: 361 ANTSMKQEWMWNQLGNFLQEGDIVIAETGTSAFGINQTTFPTDVYAIVQVLWGSIGFTVG 420

Query: 421 ACLGAAFAAEEIDPKKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNDGYTIERLI 480
           A LGA  AAEE+DPKKRVILFIGDGSLQLTVQEISTMIRWGLKPY+FVLNN+GYTIE+LI
Sbjct: 421 ALLGATMAAEELDPKKRVILFIGDGSLQLTVQEISTMIRWGLKPYIFVLNNNGYTIEKLI 480

Query: 481 HGEKAGYNDIQNWDHLALLPTFGAKDYENHRVATTGEWDKLTQDKEFNKNSKIRMIEVML 540
           HG  A YN++Q+WDHL+LLPTFGA+DYE HR+ TTGEWDKLTQDK+F  NS+IRMIEVML
Sbjct: 481 HGPHAEYNEVQSWDHLSLLPTFGARDYETHRITTTGEWDKLTQDKDFQDNSRIRMIEVML 540

Query: 541 PVMDAPTSLIEQAKLTASINAKQ 563
           PV DAP +L++QA+LTA+ NAKQ
Sbjct: 541 PVFDAPQNLVKQAQLTAATNAKQ 563

>KLTH0B01188g Chr2 complement(104224..106005) [1782 bp, 593 aa] {ON}
           highly similar to uniprot|P06169 Saccharomyces
           cerevisiae YLR044C PDC1 Major of three pyruvate
           decarboxylase isozymes key enzyme in alcoholic
           fermentation decarboxylates pyruvate to acetaldehyde
           subject to glucose- ethanol- and autoregulation involved
           in amino acid catabolism and to YLR134W uniprot|P16467
           Saccharomyces cerevisiae YLR134W PDC5 Minor isoform of
           pyruvate decarboxylase, key enzyme in alcoholic
           fermentation, decarboxylates pyruvate to acetaldehyde,
           regulation is glucose- and ethanol-dependent, repressed
           by thiamine, involved in amino acid catabolism
          Length = 593

 Score =  988 bits (2554), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 463/562 (82%), Positives = 510/562 (90%)

Query: 1   MSEITLGRYLFERLNQVDVKTIFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADG 60
           MSEITLGRY+FERL QVDV T+FGLPGDFNL LLD+IYEVEGMRWAGN NELNA+YAAD 
Sbjct: 30  MSEITLGRYVFERLKQVDVTTVFGLPGDFNLRLLDEIYEVEGMRWAGNCNELNASYAADA 89

Query: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNG 120
           YARIKGMSC+ITTFGVGELSALNGIAGSYAEHVGVLH+VGVPS+S+QAKQLLLHHTLGNG
Sbjct: 90  YARIKGMSCLITTFGVGELSALNGIAGSYAEHVGVLHIVGVPSVSAQAKQLLLHHTLGNG 149

Query: 121 DFTVFHRMSANISETTAMVTDIATAPAEIDRCIRTTYITQRPVYLGLPANLVDLKVPAKL 180
           DFTVFHRMSANISETTAM+TD+ATAP+EIDRCIRTTYI QRPVYLGLP+N VD  VPA L
Sbjct: 150 DFTVFHRMSANISETTAMITDLATAPSEIDRCIRTTYIRQRPVYLGLPSNFVDQMVPASL 209

Query: 181 LETPIDLSLKPNDPEAETEVVDTVLELIKAAKNPVILADACASRHDVKAETKKLIDATQF 240
           L+TPIDL+LKPND +AE EV+ T+LE+IK AKNPVILADACASRHDVKAETKKLID TQF
Sbjct: 210 LDTPIDLALKPNDQQAEEEVISTLLEMIKDAKNPVILADACASRHDVKAETKKLIDITQF 269

Query: 241 PSFVTPMGKGSIDEQHPRFGGVYVGTLSRPEVKEAVESADLILSVGALLSDFNTGSFSYS 300
           PSFVTPMGKGSIDE+HPRFGGVYVGTLS P VKEAVESADL+LSVGALLSDFNTGSFSYS
Sbjct: 270 PSFVTPMGKGSIDEKHPRFGGVYVGTLSSPAVKEAVESADLVLSVGALLSDFNTGSFSYS 329

Query: 301 YKTKNIVEFHSDYIKIRNATFPGVQMKFALQKLLNAVPEAIKGYKPVPVPARVPENKSCD 360
           YKTKN+VEFHSD+IKIRNATFPGVQMKF LQ LLN V   +K YKPVPVP     N + D
Sbjct: 330 YKTKNVVEFHSDHIKIRNATFPGVQMKFVLQSLLNKVGAVVKDYKPVPVPELPAPNAAVD 389

Query: 361 PATPLKQEWMWNQVSKFLQEGDVVITETGTSAFGINQTPFPNNAYGISQVLWGSIGFTTG 420
           P+TPLKQ+W+WNQV +FLQEGD+V+TETGTSAFGINQT FPNN YGISQVLWGSIG+ TG
Sbjct: 390 PSTPLKQQWLWNQVGQFLQEGDIVLTETGTSAFGINQTHFPNNTYGISQVLWGSIGYATG 449

Query: 421 ACLGAAFAAEEIDPKKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNDGYTIERLI 480
           ACLGA  AAEE+D  KRVILF G+GSLQLT QEISTM+RW LKPYLFVLNN GYTIE+LI
Sbjct: 450 ACLGAVMAAEELDKSKRVILFTGEGSLQLTAQEISTMVRWNLKPYLFVLNNKGYTIEKLI 509

Query: 481 HGEKAGYNDIQNWDHLALLPTFGAKDYENHRVATTGEWDKLTQDKEFNKNSKIRMIEVML 540
           HG  A YN+IQNW+HL LLPTFGAKDYE  RV+TTGEW+KL +DK+FNKNSKIR+IE+ML
Sbjct: 510 HGPTAEYNEIQNWNHLDLLPTFGAKDYEAIRVSTTGEWNKLAEDKDFNKNSKIRLIELML 569

Query: 541 PVMDAPTSLIEQAKLTASINAK 562
           PVMDAP SL++QA+LTA+ NAK
Sbjct: 570 PVMDAPESLVKQAQLTAATNAK 591

>SAKL0G10164g Chr7 complement(867445..869139) [1695 bp, 564 aa] {ON}
           uniprot|Q6W9G6 Saccharomyces kluyveri PDC11 Pyruvate
           decarboxylase
          Length = 564

 Score =  988 bits (2554), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 495/564 (87%), Positives = 528/564 (93%)

Query: 1   MSEITLGRYLFERLNQVDVKTIFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADG 60
           MSEITLG YLFERLNQVDVKTIFGLPGDFNLSLLDKIYEV GMRWAGNANELNAAYAADG
Sbjct: 1   MSEITLGLYLFERLNQVDVKTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADG 60

Query: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNG 120
           YAR+KGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPS+SSQAKQLLLHHTLGNG
Sbjct: 61  YARVKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSVSSQAKQLLLHHTLGNG 120

Query: 121 DFTVFHRMSANISETTAMVTDIATAPAEIDRCIRTTYITQRPVYLGLPANLVDLKVPAKL 180
           DFTVFHRMSANISETTA VTDIATAPAEIDRCIRTTY+TQRPVYLGLPANLVDL VPA L
Sbjct: 121 DFTVFHRMSANISETTAWVTDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLMVPASL 180

Query: 181 LETPIDLSLKPNDPEAETEVVDTVLELIKAAKNPVILADACASRHDVKAETKKLIDATQF 240
           L+TPIDLSLKPNDPEAE EVV++VLELIK AKNP+ILADACASRHDVK ETK+LID TQF
Sbjct: 181 LDTPIDLSLKPNDPEAEAEVVNSVLELIKDAKNPIILADACASRHDVKPETKQLIDITQF 240

Query: 241 PSFVTPMGKGSIDEQHPRFGGVYVGTLSRPEVKEAVESADLILSVGALLSDFNTGSFSYS 300
           P+FVTP+GKGSIDEQHPRFGGVYVGTLS  +VKEAVESADLILSVGALLSDFNTGSFSYS
Sbjct: 241 PAFVTPLGKGSIDEQHPRFGGVYVGTLSNDDVKEAVESADLILSVGALLSDFNTGSFSYS 300

Query: 301 YKTKNIVEFHSDYIKIRNATFPGVQMKFALQKLLNAVPEAIKGYKPVPVPARVPENKSCD 360
           YKTKNIVEFHSDYIKIRNATFPGVQMKFALQKLL+ +   +K YKPV VP +   N +CD
Sbjct: 301 YKTKNIVEFHSDYIKIRNATFPGVQMKFALQKLLSEIGAVVKDYKPVAVPPKPTPNPACD 360

Query: 361 PATPLKQEWMWNQVSKFLQEGDVVITETGTSAFGINQTPFPNNAYGISQVLWGSIGFTTG 420
           P+TPLKQEW+WNQV +FLQEGDVVITETGTSAFGINQT FPNN YGISQVLWGSIGFTTG
Sbjct: 361 PSTPLKQEWVWNQVGRFLQEGDVVITETGTSAFGINQTHFPNNTYGISQVLWGSIGFTTG 420

Query: 421 ACLGAAFAAEEIDPKKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNDGYTIERLI 480
           ACLGAA AAEE+D  KRVILFIGDGSLQLTVQEISTMIRWGL+PYLFVLNNDGYTIERLI
Sbjct: 421 ACLGAACAAEELDKNKRVILFIGDGSLQLTVQEISTMIRWGLRPYLFVLNNDGYTIERLI 480

Query: 481 HGEKAGYNDIQNWDHLALLPTFGAKDYENHRVATTGEWDKLTQDKEFNKNSKIRMIEVML 540
           HGE A YN+IQ W +L LLPTFGAKDYE +RVATTGEWDKL QD+ FNKNS+IRM+EVML
Sbjct: 481 HGENAQYNEIQPWKNLDLLPTFGAKDYETYRVATTGEWDKLAQDEAFNKNSRIRMVEVML 540

Query: 541 PVMDAPTSLIEQAKLTASINAKQE 564
           PVMDAP++L++QA+LTASINAKQ+
Sbjct: 541 PVMDAPSNLVKQAQLTASINAKQD 564

>KLLA0E16303g Chr5 complement(1457903..1459594) [1692 bp, 563 aa]
           {ON} highly similar to uniprot|P06169 Saccharomyces
           cerevisiae YLR044C PDC1 Major of three pyruvate
           decarboxylase isozymes key enzyme in alcoholic
           fermentation decarboxylates pyruvate to acetaldehyde
           subject to glucose- ethanol- and autoregulation involved
           in amino acid catabolism
          Length = 563

 Score =  987 bits (2552), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 482/562 (85%), Positives = 519/562 (92%)

Query: 1   MSEITLGRYLFERLNQVDVKTIFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADG 60
           MSEITLGRYLFERL QV+V+TIFGLPGDFNLSLLD IYEV GMRWAGNANELNAAYAADG
Sbjct: 1   MSEITLGRYLFERLKQVEVQTIFGLPGDFNLSLLDNIYEVPGMRWAGNANELNAAYAADG 60

Query: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNG 120
           YAR+KGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPS+SSQAKQLLLHHTLGNG
Sbjct: 61  YARLKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSVSSQAKQLLLHHTLGNG 120

Query: 121 DFTVFHRMSANISETTAMVTDIATAPAEIDRCIRTTYITQRPVYLGLPANLVDLKVPAKL 180
           DFTVFHRMS+NISETTAM+TDI TAPAEIDRCIRTTY++QRPVYLGLPANLVDL VPA L
Sbjct: 121 DFTVFHRMSSNISETTAMITDINTAPAEIDRCIRTTYVSQRPVYLGLPANLVDLTVPASL 180

Query: 181 LETPIDLSLKPNDPEAETEVVDTVLELIKAAKNPVILADACASRHDVKAETKKLIDATQF 240
           L+TPIDLSLKPNDPEAE EV++ VL+LIK AKNPVILADAC SRHD KAETKKLID TQF
Sbjct: 181 LDTPIDLSLKPNDPEAEEEVIENVLQLIKEAKNPVILADACCSRHDAKAETKKLIDLTQF 240

Query: 241 PSFVTPMGKGSIDEQHPRFGGVYVGTLSRPEVKEAVESADLILSVGALLSDFNTGSFSYS 300
           P+FVTPMGKGSIDE+HPRFGGVYVGTLS P VKEAVESADL+LSVGALLSDFNTGSFSYS
Sbjct: 241 PAFVTPMGKGSIDEKHPRFGGVYVGTLSSPAVKEAVESADLVLSVGALLSDFNTGSFSYS 300

Query: 301 YKTKNIVEFHSDYIKIRNATFPGVQMKFALQKLLNAVPEAIKGYKPVPVPARVPENKSCD 360
           YKTKNIVEFHSDY KIR+ATFPGVQMKFALQKLL  V +A KGYKPVPVP+    N++  
Sbjct: 301 YKTKNIVEFHSDYTKIRSATFPGVQMKFALQKLLTKVADAAKGYKPVPVPSEPEHNEAVA 360

Query: 361 PATPLKQEWMWNQVSKFLQEGDVVITETGTSAFGINQTPFPNNAYGISQVLWGSIGFTTG 420
            +TPLKQEW+W QV +FL+EGDVVITETGTSAFGINQT FPNN YGISQVLWGSIGFTTG
Sbjct: 361 DSTPLKQEWVWTQVGEFLREGDVVITETGTSAFGINQTHFPNNTYGISQVLWGSIGFTTG 420

Query: 421 ACLGAAFAAEEIDPKKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNDGYTIERLI 480
           A LGAAFAAEEIDPKKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNDGYTIERLI
Sbjct: 421 ATLGAAFAAEEIDPKKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNDGYTIERLI 480

Query: 481 HGEKAGYNDIQNWDHLALLPTFGAKDYENHRVATTGEWDKLTQDKEFNKNSKIRMIEVML 540
           HGE A YN IQNW HL LLPTFGAKDYE  RV+TTGEW+KLT D++F  N++IR+IEVML
Sbjct: 481 HGETAQYNCIQNWQHLELLPTFGAKDYEAVRVSTTGEWNKLTTDEKFQDNTRIRLIEVML 540

Query: 541 PVMDAPTSLIEQAKLTASINAK 562
           P MDAP++L++QA+LTA+ NAK
Sbjct: 541 PTMDAPSNLVKQAQLTAATNAK 562

>Kpol_1010.48 s1010 (110999..112690) [1692 bp, 563 aa] {ON}
           (110999..112690) [1692 nt, 564 aa]
          Length = 563

 Score =  978 bits (2529), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 477/563 (84%), Positives = 515/563 (91%)

Query: 1   MSEITLGRYLFERLNQVDVKTIFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADG 60
           MSEITLGRYLFERL QV V+TIFGLPGDFNLSLLDKIYEV GMRWAGNANELNAAYAADG
Sbjct: 1   MSEITLGRYLFERLKQVQVQTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADG 60

Query: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNG 120
           YARIKGM+C+ITTFGVGELSALNGIAGSYAEHVGVLHVVGVPS+SSQAKQLLLHHTLGNG
Sbjct: 61  YARIKGMACLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSLSSQAKQLLLHHTLGNG 120

Query: 121 DFTVFHRMSANISETTAMVTDIATAPAEIDRCIRTTYITQRPVYLGLPANLVDLKVPAKL 180
           DFTVFHRMSA ISETTAM+TDIA APAEIDRCIRTTYITQR VYLGLPAN+VDL VPA L
Sbjct: 121 DFTVFHRMSACISETTAMITDIANAPAEIDRCIRTTYITQRTVYLGLPANMVDLMVPADL 180

Query: 181 LETPIDLSLKPNDPEAETEVVDTVLELIKAAKNPVILADACASRHDVKAETKKLIDATQF 240
           L+TPIDLSLKPNDPEAETEV+DT+L ++K AKNP+ILADACASRHDVKAETK+LID TQF
Sbjct: 181 LKTPIDLSLKPNDPEAETEVLDTILAMVKEAKNPIILADACASRHDVKAETKQLIDTTQF 240

Query: 241 PSFVTPMGKGSIDEQHPRFGGVYVGTLSRPEVKEAVESADLILSVGALLSDFNTGSFSYS 300
           P FVTPMGKGSIDEQHPRFGGVYVGTLSRPEVK AVESADLILSVGALLSDFNTGSFSYS
Sbjct: 241 PCFVTPMGKGSIDEQHPRFGGVYVGTLSRPEVKAAVESADLILSVGALLSDFNTGSFSYS 300

Query: 301 YKTKNIVEFHSDYIKIRNATFPGVQMKFALQKLLNAVPEAIKGYKPVPVPARVPENKSCD 360
           Y+TKN+VEFHSD+ KI+ A+FPGVQMKF LQKL+  +  A+K YKPV  PA    N  C 
Sbjct: 301 YQTKNVVEFHSDHTKIKKASFPGVQMKFVLQKLVAQIGAAVKDYKPVAAPALPASNAECP 360

Query: 361 PATPLKQEWMWNQVSKFLQEGDVVITETGTSAFGINQTPFPNNAYGISQVLWGSIGFTTG 420
            +TPLKQEW+WNQV KFLQEGD+V+TETGTSAFGINQT FPNN YGISQVLWGSIGFT G
Sbjct: 361 ASTPLKQEWLWNQVGKFLQEGDIVLTETGTSAFGINQTHFPNNTYGISQVLWGSIGFTGG 420

Query: 421 ACLGAAFAAEEIDPKKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNDGYTIERLI 480
           A LGAAFAAEEIDPKKR I+FIGDGSLQLTVQEISTMIRW LKPY+FVLNNDGYTIE+LI
Sbjct: 421 ATLGAAFAAEEIDPKKRTIVFIGDGSLQLTVQEISTMIRWNLKPYIFVLNNDGYTIEKLI 480

Query: 481 HGEKAGYNDIQNWDHLALLPTFGAKDYENHRVATTGEWDKLTQDKEFNKNSKIRMIEVML 540
           HG  A YN+IQNW HL +LPTFGAKDYE  RVATTGE++KL +DK FN+NSKIRMIE+ML
Sbjct: 481 HGPTAQYNEIQNWKHLDILPTFGAKDYEAIRVATTGEFNKLCEDKAFNENSKIRMIEIML 540

Query: 541 PVMDAPTSLIEQAKLTASINAKQ 563
           PVMDAP++L+ QAKLTASINAKQ
Sbjct: 541 PVMDAPSNLVAQAKLTASINAKQ 563

>Suva_7.369 Chr7 complement(627739..629430) [1692 bp, 563 aa] {ON}
           YLR134W (REAL)
          Length = 563

 Score =  978 bits (2529), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 470/563 (83%), Positives = 519/563 (92%)

Query: 1   MSEITLGRYLFERLNQVDVKTIFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADG 60
           MSEITLGRYLFERL QV+V TIFGLPGDFNLSLLDKIYEV+G+RWAGNANELNAAYAADG
Sbjct: 1   MSEITLGRYLFERLKQVNVNTIFGLPGDFNLSLLDKIYEVDGLRWAGNANELNAAYAADG 60

Query: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNG 120
           YARIKG+S +ITTFGVGELSALNGIAGSYAEHVGVLHVVGVPS+S+QAKQLLLHHTLGNG
Sbjct: 61  YARIKGLSALITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSVSAQAKQLLLHHTLGNG 120

Query: 121 DFTVFHRMSANISETTAMVTDIATAPAEIDRCIRTTYITQRPVYLGLPANLVDLKVPAKL 180
           DFTVFHRMS NISETT+M+TDIATAP+EIDR IRTT++TQRP YLGLPANLVDLKVPA L
Sbjct: 121 DFTVFHRMSTNISETTSMITDIATAPSEIDRLIRTTFVTQRPSYLGLPANLVDLKVPASL 180

Query: 181 LETPIDLSLKPNDPEAETEVVDTVLELIKAAKNPVILADACASRHDVKAETKKLIDATQF 240
           L  PIDLSLKPNDPEAE EV+DTVLELI+ +KNP+IL+DACASRH VK ET+KLID TQF
Sbjct: 181 LNKPIDLSLKPNDPEAEKEVIDTVLELIQKSKNPIILSDACASRHHVKKETQKLIDLTQF 240

Query: 241 PSFVTPMGKGSIDEQHPRFGGVYVGTLSRPEVKEAVESADLILSVGALLSDFNTGSFSYS 300
           P+FVTP+GKGSIDEQHPR+GGVYVGTLS+P+VK+AVESADLILSVGALLSDFNTGSFSYS
Sbjct: 241 PAFVTPLGKGSIDEQHPRYGGVYVGTLSKPDVKQAVESADLILSVGALLSDFNTGSFSYS 300

Query: 301 YKTKNIVEFHSDYIKIRNATFPGVQMKFALQKLLNAVPEAIKGYKPVPVPARVPENKSCD 360
           YKTKN+VEFHSDYIK++NATFPGVQMKFALQKLL+ +P  IK YK VPVP +   NK   
Sbjct: 301 YKTKNVVEFHSDYIKVKNATFPGVQMKFALQKLLSVIPSVIKSYKAVPVPTKTAPNKEVA 360

Query: 361 PATPLKQEWMWNQVSKFLQEGDVVITETGTSAFGINQTPFPNNAYGISQVLWGSIGFTTG 420
            +TPLKQEW+WN++SKFLQEGDV+++ETGTSAFGINQT FP +AYGISQVLWGSIGFTTG
Sbjct: 361 ASTPLKQEWLWNELSKFLQEGDVIVSETGTSAFGINQTSFPKDAYGISQVLWGSIGFTTG 420

Query: 421 ACLGAAFAAEEIDPKKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNDGYTIERLI 480
           A LGAAFAAEE+DP +RVILFIGDGSLQLTVQEISTM+RWGLKPYLFVLNNDGYTIE+LI
Sbjct: 421 ATLGAAFAAEELDPNRRVILFIGDGSLQLTVQEISTMVRWGLKPYLFVLNNDGYTIEKLI 480

Query: 481 HGEKAGYNDIQNWDHLALLPTFGAKDYENHRVATTGEWDKLTQDKEFNKNSKIRMIEVML 540
           HG  A YN+IQ WDHLALLPTFGAK YENH+VATTGEWDKLT D EF KNS IR+IE+ L
Sbjct: 481 HGPYAEYNEIQTWDHLALLPTFGAKKYENHKVATTGEWDKLTHDPEFQKNSVIRLIELKL 540

Query: 541 PVMDAPTSLIEQAKLTASINAKQ 563
           PV DAP SLI+QA+LTA+ NAKQ
Sbjct: 541 PVFDAPESLIKQAELTAATNAKQ 563

>YGR087C Chr7 complement(651290..652981) [1692 bp, 563 aa] {ON}
           PDC6Minor isoform of pyruvate decarboxylase,
           decarboxylates pyruvate to acetaldehyde, involved in
           amino acid catabolism; transcription is glucose- and
           ethanol-dependent, and is strongly induced during sulfur
           limitation
          Length = 563

 Score =  974 bits (2519), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 470/563 (83%), Positives = 518/563 (92%)

Query: 1   MSEITLGRYLFERLNQVDVKTIFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADG 60
           MSEITLG+YLFERL QV+V TIFGLPGDFNLSLLDKIYEV+G+RWAGNANELNAAYAADG
Sbjct: 1   MSEITLGKYLFERLKQVNVNTIFGLPGDFNLSLLDKIYEVDGLRWAGNANELNAAYAADG 60

Query: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNG 120
           YARIKG+S ++TTFGVGELSALNGIAGSYAEHVGVLHVVGVPSIS+QAKQLLLHHTLGNG
Sbjct: 61  YARIKGLSVLVTTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTLGNG 120

Query: 121 DFTVFHRMSANISETTAMVTDIATAPAEIDRCIRTTYITQRPVYLGLPANLVDLKVPAKL 180
           DFTVFHRMSANISETT+M+TDIATAP+EIDR IRTT+ITQRP YLGLPANLVDLKVP  L
Sbjct: 121 DFTVFHRMSANISETTSMITDIATAPSEIDRLIRTTFITQRPSYLGLPANLVDLKVPGSL 180

Query: 181 LETPIDLSLKPNDPEAETEVVDTVLELIKAAKNPVILADACASRHDVKAETKKLIDATQF 240
           LE PIDLSLKPNDPEAE EV+DTVLELI+ +KNPVIL+DACASRH+VK ET+KLID TQF
Sbjct: 181 LEKPIDLSLKPNDPEAEKEVIDTVLELIQNSKNPVILSDACASRHNVKKETQKLIDLTQF 240

Query: 241 PSFVTPMGKGSIDEQHPRFGGVYVGTLSRPEVKEAVESADLILSVGALLSDFNTGSFSYS 300
           P+FVTP+GKGSIDEQHPR+GGVYVGTLS+ +VK+AVESADLILSVGALLSDFNTGSFSYS
Sbjct: 241 PAFVTPLGKGSIDEQHPRYGGVYVGTLSKQDVKQAVESADLILSVGALLSDFNTGSFSYS 300

Query: 301 YKTKNIVEFHSDYIKIRNATFPGVQMKFALQKLLNAVPEAIKGYKPVPVPARVPENKSCD 360
           YKTKN+VEFHSDY+K++NATF GVQMKFALQ LL  +P+ +KGYK VPVP + P NK   
Sbjct: 301 YKTKNVVEFHSDYVKVKNATFLGVQMKFALQNLLKVIPDVVKGYKSVPVPTKTPANKGVP 360

Query: 361 PATPLKQEWMWNQVSKFLQEGDVVITETGTSAFGINQTPFPNNAYGISQVLWGSIGFTTG 420
            +TPLKQEW+WN++SKFLQEGDV+I+ETGTSAFGINQT FP +AYGISQVLWGSIGFTTG
Sbjct: 361 ASTPLKQEWLWNELSKFLQEGDVIISETGTSAFGINQTIFPKDAYGISQVLWGSIGFTTG 420

Query: 421 ACLGAAFAAEEIDPKKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNDGYTIERLI 480
           A LGAAFAAEEIDP KRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNDGYTIE+LI
Sbjct: 421 ATLGAAFAAEEIDPNKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNDGYTIEKLI 480

Query: 481 HGEKAGYNDIQNWDHLALLPTFGAKDYENHRVATTGEWDKLTQDKEFNKNSKIRMIEVML 540
           HG  A YN+IQ WDHLALLP FGAK YENH++ATTGEWD LT D EF KNS IR+IE+ L
Sbjct: 481 HGPHAEYNEIQTWDHLALLPAFGAKKYENHKIATTGEWDALTTDSEFQKNSVIRLIELKL 540

Query: 541 PVMDAPTSLIEQAKLTASINAKQ 563
           PV DAP SLI+QA+LTA+ NAKQ
Sbjct: 541 PVFDAPESLIKQAQLTAATNAKQ 563

>NCAS0A14630 Chr1 complement(2878338..2880029) [1692 bp, 563 aa]
           {ON} 
          Length = 563

 Score =  969 bits (2506), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 469/563 (83%), Positives = 514/563 (91%)

Query: 1   MSEITLGRYLFERLNQVDVKTIFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADG 60
           MSEITLGRYLFERL QV+V TIFGLPGDFNL+LLDKIYEV GMRWAGNANELNA+YAADG
Sbjct: 1   MSEITLGRYLFERLKQVNVNTIFGLPGDFNLALLDKIYEVPGMRWAGNANELNASYAADG 60

Query: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNG 120
           YAR+KGM+C+ITTFGVGELSALNGIAGSYAEHVGVLHVVGVPS SSQAKQLLLHHTLGNG
Sbjct: 61  YARVKGMACLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSTSSQAKQLLLHHTLGNG 120

Query: 121 DFTVFHRMSANISETTAMVTDIATAPAEIDRCIRTTYITQRPVYLGLPANLVDLKVPAKL 180
           DFTVFHRMS+NISETTAMVTD+A A +EIDRCIRTTY+TQR VYLGLPAN+ DLKV A L
Sbjct: 121 DFTVFHRMSSNISETTAMVTDLANATSEIDRCIRTTYVTQRTVYLGLPANMFDLKVKASL 180

Query: 181 LETPIDLSLKPNDPEAETEVVDTVLELIKAAKNPVILADACASRHDVKAETKKLIDATQF 240
           L+TPIDLSLKPND  AE EVV+T+L L+K AKNP+ILADAC SRHDVKAETKKLID TQF
Sbjct: 181 LDTPIDLSLKPNDAAAENEVVETILSLVKDAKNPIILADACCSRHDVKAETKKLIDITQF 240

Query: 241 PSFVTPMGKGSIDEQHPRFGGVYVGTLSRPEVKEAVESADLILSVGALLSDFNTGSFSYS 300
           PSFVTPMGKGSIDEQ+PR+GGVYVGTLS P+VK+AVESADLILSVGALLSDFNTGSFSYS
Sbjct: 241 PSFVTPMGKGSIDEQNPRYGGVYVGTLSNPDVKQAVESADLILSVGALLSDFNTGSFSYS 300

Query: 301 YKTKNIVEFHSDYIKIRNATFPGVQMKFALQKLLNAVPEAIKGYKPVPVPARVPENKSCD 360
           YKTKN+VEFHSD+IKI++ATFPGVQMKF LQKLL  +P   KGYKPV VP R   NK   
Sbjct: 301 YKTKNVVEFHSDHIKIKSATFPGVQMKFVLQKLLKVIPSVAKGYKPVAVPGRPAPNKPSP 360

Query: 361 PATPLKQEWMWNQVSKFLQEGDVVITETGTSAFGINQTPFPNNAYGISQVLWGSIGFTTG 420
             TP+KQEWMWN+++KF QEGDV+ITETGTSAFGINQTPFP NAYGISQVLWGSIGF TG
Sbjct: 361 ANTPMKQEWMWNELAKFFQEGDVIITETGTSAFGINQTPFPKNAYGISQVLWGSIGFATG 420

Query: 421 ACLGAAFAAEEIDPKKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNDGYTIERLI 480
             LGAAFAAEEIDPKKRVILF G+GSLQLTVQEISTM+RW LKPYLFVLNN GYTIERLI
Sbjct: 421 CTLGAAFAAEEIDPKKRVILFTGEGSLQLTVQEISTMVRWNLKPYLFVLNNAGYTIERLI 480

Query: 481 HGEKAGYNDIQNWDHLALLPTFGAKDYENHRVATTGEWDKLTQDKEFNKNSKIRMIEVML 540
           HGEKAGYNDIQ W+HL LL TFGAKDYENHRV+TTGEW+KLT +K+FN+NS+IR+IE+ML
Sbjct: 481 HGEKAGYNDIQPWNHLNLLETFGAKDYENHRVSTTGEWEKLTTNKDFNQNSRIRLIEIML 540

Query: 541 PVMDAPTSLIEQAKLTASINAKQ 563
            VMDAP++L+ QA+LTASINAK 
Sbjct: 541 EVMDAPSNLVAQAQLTASINAKN 563

>Ecym_2479 Chr2 (938295..939989) [1695 bp, 564 aa] {ON} similar to
           Ashbya gossypii ACL134C
          Length = 564

 Score =  968 bits (2502), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 476/564 (84%), Positives = 518/564 (91%)

Query: 1   MSEITLGRYLFERLNQVDVKTIFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADG 60
           MSEIT+G YLF+RL QV+V+TIFGLPGDFNL+LLDKIYEV GMRWAGNANELNAAYAADG
Sbjct: 1   MSEITIGHYLFQRLKQVEVQTIFGLPGDFNLTLLDKIYEVPGMRWAGNANELNAAYAADG 60

Query: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNG 120
           YAR+KGMSC+ITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSIS+QAKQLLLHHTLGNG
Sbjct: 61  YARLKGMSCVITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTLGNG 120

Query: 121 DFTVFHRMSANISETTAMVTDIATAPAEIDRCIRTTYITQRPVYLGLPANLVDLKVPAKL 180
           DFTVFHRMSANISE+TAM+TD+ATA  EIDRCIRT YI+QRPVYLGLPANLVD KVPA L
Sbjct: 121 DFTVFHRMSANISESTAMITDVATAAREIDRCIRTCYISQRPVYLGLPANLVDAKVPASL 180

Query: 181 LETPIDLSLKPNDPEAETEVVDTVLELIKAAKNPVILADACASRHDVKAETKKLIDATQF 240
           LETPID SLKPND EAE EVV TVLE+I  +KNPVIL+DACASRHDVK ETK+LID TQF
Sbjct: 181 LETPIDFSLKPNDAEAENEVVGTVLEMIANSKNPVILSDACASRHDVKEETKRLIDVTQF 240

Query: 241 PSFVTPMGKGSIDEQHPRFGGVYVGTLSRPEVKEAVESADLILSVGALLSDFNTGSFSYS 300
           P+FVTPMGKGSIDEQHPRFGGVYVGTLS PEVKEAVESADLILSVGALLSDFNTGSFSYS
Sbjct: 241 PAFVTPMGKGSIDEQHPRFGGVYVGTLSSPEVKEAVESADLILSVGALLSDFNTGSFSYS 300

Query: 301 YKTKNIVEFHSDYIKIRNATFPGVQMKFALQKLLNAVPEAIKGYKPVPVPARVPENKSCD 360
           YKTKNIVEFHSD+ K+RNATFPGVQMKF L+KL++ V +  K Y PVPVP +       D
Sbjct: 301 YKTKNIVEFHSDHTKVRNATFPGVQMKFVLKKLVDVVGDVAKNYVPVPVPTQPVHGSDVD 360

Query: 361 PATPLKQEWMWNQVSKFLQEGDVVITETGTSAFGINQTPFPNNAYGISQVLWGSIGFTTG 420
           PATPL+QEW+W +V++FL+EGDVVITETGTSAFGINQT FPN+ YGISQVLWGSIGFTTG
Sbjct: 361 PATPLRQEWIWREVARFLREGDVVITETGTSAFGINQTHFPNDTYGISQVLWGSIGFTTG 420

Query: 421 ACLGAAFAAEEIDPKKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNDGYTIERLI 480
           ACLGAAFAAEEIDPKKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNDGYTIERLI
Sbjct: 421 ACLGAAFAAEEIDPKKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNDGYTIERLI 480

Query: 481 HGEKAGYNDIQNWDHLALLPTFGAKDYENHRVATTGEWDKLTQDKEFNKNSKIRMIEVML 540
           HGE A YNDIQ WDHL LLPTFGAKDYE  RV+T GEW +LTQDK F++NSKIRMIEVML
Sbjct: 481 HGETAQYNDIQPWDHLKLLPTFGAKDYEAVRVSTAGEWQQLTQDKAFSENSKIRMIEVML 540

Query: 541 PVMDAPTSLIEQAKLTASINAKQE 564
           PVMDAP++L++QA+LTA+ NAKQ+
Sbjct: 541 PVMDAPSNLVKQAQLTAATNAKQD 564

>TBLA0B07520 Chr2 complement(1789035..1790726) [1692 bp, 563 aa]
           {ON} Anc_5.122 YLR044C
          Length = 563

 Score =  966 bits (2497), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 468/563 (83%), Positives = 514/563 (91%)

Query: 1   MSEITLGRYLFERLNQVDVKTIFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADG 60
           M+EITLG+YLFERLNQV V+TIFGLPGDFNLSLLDKIYEV GMRWAGNANELNAAYAADG
Sbjct: 1   MAEITLGKYLFERLNQVKVQTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADG 60

Query: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNG 120
           YARIKGM+C+ITTFGVGELSALNGIAGSYAEHVGVLHVVGVPS+SSQAKQLLLHHTLGNG
Sbjct: 61  YARIKGMACLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSLSSQAKQLLLHHTLGNG 120

Query: 121 DFTVFHRMSANISETTAMVTDIATAPAEIDRCIRTTYITQRPVYLGLPANLVDLKVPAKL 180
           DFTVFHRMSA ISETTAM+TDIATAPAEIDRCIRTTY+ QR VYLGLPANLVDL VPA L
Sbjct: 121 DFTVFHRMSAEISETTAMITDIATAPAEIDRCIRTTYVKQRTVYLGLPANLVDLTVPASL 180

Query: 181 LETPIDLSLKPNDPEAETEVVDTVLELIKAAKNPVILADACASRHDVKAETKKLIDATQF 240
           LETPIDLSLKPND EAE EV++TVLEL++ AKNP+I+ADAC SRHDVK+ET++LI+ATQF
Sbjct: 181 LETPIDLSLKPNDAEAENEVIETVLELVREAKNPIIIADACCSRHDVKSETEELINATQF 240

Query: 241 PSFVTPMGKGSIDEQHPRFGGVYVGTLSRPEVKEAVESADLILSVGALLSDFNTGSFSYS 300
           PSF TPMGKGSI+E+HPRFGGVYVGTLSRPEVK AVESADL+LSVGALLSDFNTGSFSY+
Sbjct: 241 PSFTTPMGKGSINERHPRFGGVYVGTLSRPEVKAAVESADLVLSVGALLSDFNTGSFSYA 300

Query: 301 YKTKNIVEFHSDYIKIRNATFPGVQMKFALQKLLNAVPEAIKGYKPVPVPARVPENKSCD 360
           YKTKNIVEFHSD+IK++NATFPGVQMKF LQKL++ +  AIKGYKPV VPA +P NK   
Sbjct: 301 YKTKNIVEFHSDHIKVKNATFPGVQMKFVLQKLVSKIGAAIKGYKPVAVPAGIPANKEVP 360

Query: 361 PATPLKQEWMWNQVSKFLQEGDVVITETGTSAFGINQTPFPNNAYGISQVLWGSIGFTTG 420
             TPLKQEW+WNQ+  FLQEGD+V+TETGTSAFGINQT FP + YGISQVLWGSIGFT G
Sbjct: 361 ANTPLKQEWLWNQLGNFLQEGDIVLTETGTSAFGINQTTFPKDTYGISQVLWGSIGFTGG 420

Query: 421 ACLGAAFAAEEIDPKKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNDGYTIERLI 480
             LGAAFAAEEI+P KR ILFIGDGSLQLTVQEIST+IRW LKPYLFVLNN+GYTIE+LI
Sbjct: 421 CVLGAAFAAEEINPNKRTILFIGDGSLQLTVQEISTLIRWNLKPYLFVLNNNGYTIEKLI 480

Query: 481 HGEKAGYNDIQNWDHLALLPTFGAKDYENHRVATTGEWDKLTQDKEFNKNSKIRMIEVML 540
           HG  A YN+IQ W+HL +LPTFGAKDYE  RVATTGEW KLT DK F KNSKIRMIE+ML
Sbjct: 481 HGPTAQYNEIQGWNHLQILPTFGAKDYEALRVATTGEWIKLTTDKAFQKNSKIRMIEIML 540

Query: 541 PVMDAPTSLIEQAKLTASINAKQ 563
           PVMDAP++L+ QAKLTA+ NAKQ
Sbjct: 541 PVMDAPSNLVAQAKLTAATNAKQ 563

>TPHA0H00950 Chr8 (199181..200872) [1692 bp, 563 aa] {ON} Anc_5.122
           YLR044C
          Length = 563

 Score =  960 bits (2481), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 469/563 (83%), Positives = 510/563 (90%)

Query: 1   MSEITLGRYLFERLNQVDVKTIFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADG 60
           MS+ITLG+YLFERL QV  +TIFGLPGDFNLSLLDKIYEV GMRWAGN NELNAAYAADG
Sbjct: 1   MSQITLGKYLFERLKQVQCQTIFGLPGDFNLSLLDKIYEVPGMRWAGNCNELNAAYAADG 60

Query: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNG 120
           YARIKGM+C+ITTFGVGELSALNGIAGSYAEHVGVLHVVGVPS+S+QAKQLLLHHTLGNG
Sbjct: 61  YARIKGMACLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSLSAQAKQLLLHHTLGNG 120

Query: 121 DFTVFHRMSANISETTAMVTDIATAPAEIDRCIRTTYITQRPVYLGLPANLVDLKVPAKL 180
           DFTVFHRMSA ISETT+M+TDIA+A AEIDRCI+ TYI+QR VYLGLPAN+VDL VPA +
Sbjct: 121 DFTVFHRMSACISETTSMITDIASAQAEIDRCIKATYISQRTVYLGLPANMVDLMVPADV 180

Query: 181 LETPIDLSLKPNDPEAETEVVDTVLELIKAAKNPVILADACASRHDVKAETKKLIDATQF 240
           L TPIDLSLKPND +AETEV+  +LELIK AKNP+ILADACASRHDVKAETK LIDATQF
Sbjct: 181 LNTPIDLSLKPNDVDAETEVLGAILELIKDAKNPIILADACASRHDVKAETKALIDATQF 240

Query: 241 PSFVTPMGKGSIDEQHPRFGGVYVGTLSRPEVKEAVESADLILSVGALLSDFNTGSFSYS 300
           PSFVTPMGKGSIDEQHPRFGGVYVGTLSRPEVK+AVESADLILSVGALLSDFNTGSFSYS
Sbjct: 241 PSFVTPMGKGSIDEQHPRFGGVYVGTLSRPEVKKAVESADLILSVGALLSDFNTGSFSYS 300

Query: 301 YKTKNIVEFHSDYIKIRNATFPGVQMKFALQKLLNAVPEAIKGYKPVPVPARVPENKSCD 360
           Y TKNIVEFHSD+IKIR A+FPGVQMKF L+KL+  V   +KGYKPV +PA VP N +  
Sbjct: 301 YNTKNIVEFHSDHIKIRKASFPGVQMKFVLEKLVAQVGSVVKGYKPVAIPAPVPANPATP 360

Query: 361 PATPLKQEWMWNQVSKFLQEGDVVITETGTSAFGINQTPFPNNAYGISQVLWGSIGFTTG 420
             TPLKQEW+WNQV KFL+EGD+V+TETGTSAFGINQT FP N YGISQVLWGSIGFT G
Sbjct: 361 AETPLKQEWLWNQVGKFLKEGDIVLTETGTSAFGINQTHFPTNTYGISQVLWGSIGFTGG 420

Query: 421 ACLGAAFAAEEIDPKKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNDGYTIERLI 480
           A LGAAFAAEEIDPKKR I+FIGDGSLQLTVQEISTMIRW LKPY+FVLNN+GYTIE+LI
Sbjct: 421 ATLGAAFAAEEIDPKKRTIVFIGDGSLQLTVQEISTMIRWNLKPYIFVLNNNGYTIEKLI 480

Query: 481 HGEKAGYNDIQNWDHLALLPTFGAKDYENHRVATTGEWDKLTQDKEFNKNSKIRMIEVML 540
           HG  A YN+IQNW HL +LPTFGAKDYE  RVATTGEWDKL  DK FN+NSKIRMIE+ML
Sbjct: 481 HGPTAQYNEIQNWKHLDILPTFGAKDYETIRVATTGEWDKLASDKAFNENSKIRMIEIML 540

Query: 541 PVMDAPTSLIEQAKLTASINAKQ 563
           PVMDAP++LI QAKLTA+ NAKQ
Sbjct: 541 PVMDAPSNLIAQAKLTAATNAKQ 563

>AAL073W Chr1 (216809..218500) [1692 bp, 563 aa] {ON} Non-syntenic
           homolog of Saccharomyces cerevisiae YGR087C (PDC6) and
           YLR134W (PDC5)
          Length = 563

 Score =  958 bits (2476), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 464/562 (82%), Positives = 510/562 (90%)

Query: 1   MSEITLGRYLFERLNQVDVKTIFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADG 60
           MSEITLGRYLFERL QV+V+TIFG+PGDFNLSLLDK+YEV+GMRWAGNANELNA+YAADG
Sbjct: 1   MSEITLGRYLFERLKQVEVRTIFGVPGDFNLSLLDKVYEVDGMRWAGNANELNASYAADG 60

Query: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNG 120
           YAR+K +SC++TTFGVGELSALNGIAGSYAEHVGVLHVVGVPS S+QAKQLLLHHTLGNG
Sbjct: 61  YARVKKISCLVTTFGVGELSALNGIAGSYAEHVGVLHVVGVPSTSAQAKQLLLHHTLGNG 120

Query: 121 DFTVFHRMSANISETTAMVTDIATAPAEIDRCIRTTYITQRPVYLGLPANLVDLKVPAKL 180
           DFTVFHRMSANIS+TTA++TDI++APAEIDRCIR  Y+ QRPVYLGLPAN+VDL VPA L
Sbjct: 121 DFTVFHRMSANISDTTAVITDISSAPAEIDRCIRACYVHQRPVYLGLPANMVDLTVPASL 180

Query: 181 LETPIDLSLKPNDPEAETEVVDTVLELIKAAKNPVILADACASRHDVKAETKKLIDATQF 240
           L T IDLSLKPNDPEAE EVV TVLEL+  AK+PVIL+DACASRHDVK ETK+LID TQF
Sbjct: 181 LNTEIDLSLKPNDPEAEEEVVSTVLELVANAKHPVILSDACASRHDVKQETKQLIDVTQF 240

Query: 241 PSFVTPMGKGSIDEQHPRFGGVYVGTLSRPEVKEAVESADLILSVGALLSDFNTGSFSYS 300
           P+FVTPMGKGSIDEQHPRFGGVYVGTLS P+VKEAVESADLILSVGALLSDFNTGSFSYS
Sbjct: 241 PAFVTPMGKGSIDEQHPRFGGVYVGTLSAPDVKEAVESADLILSVGALLSDFNTGSFSYS 300

Query: 301 YKTKNIVEFHSDYIKIRNATFPGVQMKFALQKLLNAVPEAIKGYKPVPVPARVPENKSCD 360
           YKTKNIVEFHSD+ KIR+ATFPG++MK  LQ L+  + EA KGY+P PVP     N+  D
Sbjct: 301 YKTKNIVEFHSDHTKIRSATFPGIKMKTVLQNLVKRIGEAAKGYQPSPVPTYAAPNEDAD 360

Query: 361 PATPLKQEWMWNQVSKFLQEGDVVITETGTSAFGINQTPFPNNAYGISQVLWGSIGFTTG 420
           P TPLKQEW+WNQVS FL+EGD+VITETGT+AFGINQT FP++  GISQVLWGSIGFTTG
Sbjct: 361 PKTPLKQEWLWNQVSSFLKEGDIVITETGTAAFGINQTRFPSSTIGISQVLWGSIGFTTG 420

Query: 421 ACLGAAFAAEEIDPKKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNDGYTIERLI 480
           ACLGAAFAAEEIDP KRVILFIGDGSLQLTVQEISTM+RWGLKPYLFVLNNDGYTIERLI
Sbjct: 421 ACLGAAFAAEEIDPNKRVILFIGDGSLQLTVQEISTMVRWGLKPYLFVLNNDGYTIERLI 480

Query: 481 HGEKAGYNDIQNWDHLALLPTFGAKDYENHRVATTGEWDKLTQDKEFNKNSKIRMIEVML 540
           HGE A YN IQ W HL LLPTFGAKDYE HRVATTGEW  LT+ +EFNKNS IRMIE+ML
Sbjct: 481 HGETAQYNCIQPWKHLDLLPTFGAKDYETHRVATTGEWRALTEKQEFNKNSSIRMIEIML 540

Query: 541 PVMDAPTSLIEQAKLTASINAK 562
            VMDAP+SLI+QAKLTA+ NA+
Sbjct: 541 DVMDAPSSLIKQAKLTAATNAQ 562

>Kwal_33.15540 s33 (1147974..1149668) [1695 bp, 564 aa] {ON} YLR044C
           (PDC1) - pyruvate decarboxylase [contig 290] FULL
          Length = 564

 Score =  957 bits (2473), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 481/562 (85%), Positives = 513/562 (91%)

Query: 1   MSEITLGRYLFERLNQVDVKTIFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADG 60
           MSEITLGRYLFERL QV+  TIFGLPGDFNL LLD+IYE EGMRWAGNANELNAAYAAD 
Sbjct: 1   MSEITLGRYLFERLRQVECNTIFGLPGDFNLRLLDEIYETEGMRWAGNANELNAAYAADA 60

Query: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNG 120
           YARIKGMSC+ITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSIS+QAKQLLLHHTLGNG
Sbjct: 61  YARIKGMSCLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTLGNG 120

Query: 121 DFTVFHRMSANISETTAMVTDIATAPAEIDRCIRTTYITQRPVYLGLPANLVDLKVPAKL 180
           DFTVFHRMSANISETTAM++D+ATAPAEIDRCIRTTY+ QRPVYLGLP+N VD  VPA L
Sbjct: 121 DFTVFHRMSANISETTAMISDLATAPAEIDRCIRTTYVRQRPVYLGLPSNFVDQMVPASL 180

Query: 181 LETPIDLSLKPNDPEAETEVVDTVLELIKAAKNPVILADACASRHDVKAETKKLIDATQF 240
           LETPIDLSLKPND  AE EVV TVL+LIK AKNPVILADACASRHDVKAETKKLID TQF
Sbjct: 181 LETPIDLSLKPNDAAAEQEVVSTVLDLIKNAKNPVILADACASRHDVKAETKKLIDVTQF 240

Query: 241 PSFVTPMGKGSIDEQHPRFGGVYVGTLSRPEVKEAVESADLILSVGALLSDFNTGSFSYS 300
           PSFVTPMGKGSIDE+HPRFGGVYVGTLS P VKEAVES+DLILSVGALLSDFNTGSFSYS
Sbjct: 241 PSFVTPMGKGSIDEKHPRFGGVYVGTLSSPAVKEAVESSDLILSVGALLSDFNTGSFSYS 300

Query: 301 YKTKNIVEFHSDYIKIRNATFPGVQMKFALQKLLNAVPEAIKGYKPVPVPARVPENKSCD 360
           YKTKNIVEFHSD+IKIRNATFPGVQMKF LQKLL  V + +K YKPV +P     N + D
Sbjct: 301 YKTKNIVEFHSDHIKIRNATFPGVQMKFVLQKLLTQVGDVVKDYKPVAIPEIPGPNAAVD 360

Query: 361 PATPLKQEWMWNQVSKFLQEGDVVITETGTSAFGINQTPFPNNAYGISQVLWGSIGFTTG 420
            +TPLKQ+W+WNQV KFLQEGDVVITETGTSAFGINQT FPNN YGISQVLWGSIGFTTG
Sbjct: 361 DSTPLKQQWLWNQVGKFLQEGDVVITETGTSAFGINQTHFPNNTYGISQVLWGSIGFTTG 420

Query: 421 ACLGAAFAAEEIDPKKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNDGYTIERLI 480
           A LGAAFAAEE+D  KRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNN+GYTIE+LI
Sbjct: 421 ATLGAAFAAEELDKNKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNNGYTIEKLI 480

Query: 481 HGEKAGYNDIQNWDHLALLPTFGAKDYENHRVATTGEWDKLTQDKEFNKNSKIRMIEVML 540
           HGE A YN+IQ W+HL LLPTFGAKDYE  RVATTGEW+KL +D+EFNKNSKIRMIEVML
Sbjct: 481 HGEFAQYNEIQPWNHLDLLPTFGAKDYETVRVATTGEWNKLAEDQEFNKNSKIRMIEVML 540

Query: 541 PVMDAPTSLIEQAKLTASINAK 562
           PVMDAP SL++QA+LTA+ NAK
Sbjct: 541 PVMDAPESLVKQAQLTAATNAK 562

>TPHA0Q00120 Chr17 complement(8844..10535) [1692 bp, 563 aa] {ON} 
          Length = 563

 Score =  957 bits (2473), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 467/563 (82%), Positives = 508/563 (90%)

Query: 1   MSEITLGRYLFERLNQVDVKTIFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADG 60
           MS+ITLG+YLFERL QV   TIFGLPGDFNLSLLDKIYEV GMRWAGN NELNAAYAADG
Sbjct: 1   MSQITLGKYLFERLKQVQCNTIFGLPGDFNLSLLDKIYEVPGMRWAGNCNELNAAYAADG 60

Query: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNG 120
           YARIKGM+C+ITTFGVGELSALNGIAGSYAEHVGVLHVVGVPS+S+QAKQLLLHHTLGNG
Sbjct: 61  YARIKGMACLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSLSAQAKQLLLHHTLGNG 120

Query: 121 DFTVFHRMSANISETTAMVTDIATAPAEIDRCIRTTYITQRPVYLGLPANLVDLKVPAKL 180
           DFTVFHRMSA ISETT+M+TDIA+A AEIDRCI+ TYI+QR VYLGLPAN+VDL VPA +
Sbjct: 121 DFTVFHRMSACISETTSMITDIASAQAEIDRCIKATYISQRTVYLGLPANMVDLMVPADV 180

Query: 181 LETPIDLSLKPNDPEAETEVVDTVLELIKAAKNPVILADACASRHDVKAETKKLIDATQF 240
           L TPIDLSLKPND +AETEV+  +LELIK AKNP+ILADACASRHDVKAETK LID TQF
Sbjct: 181 LNTPIDLSLKPNDVDAETEVLGAILELIKDAKNPIILADACASRHDVKAETKALIDTTQF 240

Query: 241 PSFVTPMGKGSIDEQHPRFGGVYVGTLSRPEVKEAVESADLILSVGALLSDFNTGSFSYS 300
           PSFVTPMGKGSIDEQHPRFGGVYVGTLSRPEVK+AVESADLILSVGALLSDFNTGSFSYS
Sbjct: 241 PSFVTPMGKGSIDEQHPRFGGVYVGTLSRPEVKKAVESADLILSVGALLSDFNTGSFSYS 300

Query: 301 YKTKNIVEFHSDYIKIRNATFPGVQMKFALQKLLNAVPEAIKGYKPVPVPARVPENKSCD 360
           Y TKNIVEFHSD+IKIR A+FPGVQMKF L+KL+  V   IKGYKPV +PA VP N +  
Sbjct: 301 YNTKNIVEFHSDHIKIRKASFPGVQMKFVLEKLVAQVGSVIKGYKPVAIPAPVPANPATP 360

Query: 361 PATPLKQEWMWNQVSKFLQEGDVVITETGTSAFGINQTPFPNNAYGISQVLWGSIGFTTG 420
             TPLKQEW+WNQV KFL+EGD+V+TETGTSAFGINQT FP N YGISQVLWGSIGFT G
Sbjct: 361 AETPLKQEWLWNQVGKFLKEGDIVLTETGTSAFGINQTHFPTNTYGISQVLWGSIGFTGG 420

Query: 421 ACLGAAFAAEEIDPKKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNDGYTIERLI 480
           A LGAAFAAEEIDPKKR I+FIGDGSLQLTVQEISTMIRW LKPY+FVLNN+GYTIE+LI
Sbjct: 421 ATLGAAFAAEEIDPKKRTIVFIGDGSLQLTVQEISTMIRWNLKPYIFVLNNNGYTIEKLI 480

Query: 481 HGEKAGYNDIQNWDHLALLPTFGAKDYENHRVATTGEWDKLTQDKEFNKNSKIRMIEVML 540
           HG  A YN+IQNW HL +L TFGAKDYENHRVATTGEWDKL  D+ FN+NSKIR+IE+ML
Sbjct: 481 HGPTAEYNEIQNWKHLDILSTFGAKDYENHRVATTGEWDKLASDRAFNENSKIRLIEIML 540

Query: 541 PVMDAPTSLIEQAKLTASINAKQ 563
           PVMDAP++LI QAKLT + NAKQ
Sbjct: 541 PVMDAPSNLIAQAKLTEATNAKQ 563

>KNAG0M01250 Chr13 complement(229749..231440) [1692 bp, 563 aa] {ON}
           Anc_5.122 YLR044C
          Length = 563

 Score =  951 bits (2457), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 467/563 (82%), Positives = 505/563 (89%)

Query: 1   MSEITLGRYLFERLNQVDVKTIFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADG 60
           M ++TLGRYLFERL QVDVKTIFGLPGDFNLSLLDKIYEV GMRWAGNANELNAAYAADG
Sbjct: 1   MPDLTLGRYLFERLYQVDVKTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADG 60

Query: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNG 120
           YAR+KGM+CIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNG
Sbjct: 61  YARVKGMACIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNG 120

Query: 121 DFTVFHRMSANISETTAMVTDIATAPAEIDRCIRTTYITQRPVYLGLPANLVDLKVPAKL 180
           DFTVFHRMSANISETTAMVTDI TAPAEIDRCIRTTY+TQRPVYLGLPANLVDL VP  L
Sbjct: 121 DFTVFHRMSANISETTAMVTDIGTAPAEIDRCIRTTYVTQRPVYLGLPANLVDLPVPTHL 180

Query: 181 LETPIDLSLKPNDPEAETEVVDTVLELIKAAKNPVILADACASRHDVKAETKKLIDATQF 240
           LETPIDL+LKPND EAE EV++TVLELI+ A NPVILADACA RHDVK ET KLID TQF
Sbjct: 181 LETPIDLTLKPNDQEAENEVIETVLELIEEASNPVILADACAGRHDVKVETNKLIDMTQF 240

Query: 241 PSFVTPMGKGSIDEQHPRFGGVYVGTLSRPEVKEAVESADLILSVGALLSDFNTGSFSYS 300
           P+FVTPMGKG+IDE++PRFGGVYVGTLS   V+ AVESADLILSVGALLSDFNTGSFSYS
Sbjct: 241 PAFVTPMGKGTIDERNPRFGGVYVGTLSNENVRNAVESADLILSVGALLSDFNTGSFSYS 300

Query: 301 YKTKNIVEFHSDYIKIRNATFPGVQMKFALQKLLNAVPEAIKGYKPVPVPARVPENKSCD 360
           YKTKNIVEFHSDYIKIRNATFPGVQMKF L KLL  V  A+KGY PVP+P R+  N+ C 
Sbjct: 301 YKTKNIVEFHSDYIKIRNATFPGVQMKFVLNKLLAVVGSAVKGYTPVPLPPRLTPNEPCP 360

Query: 361 PATPLKQEWMWNQVSKFLQEGDVVITETGTSAFGINQTPFPNNAYGISQVLWGSIGFTTG 420
           P T L+QEWMWN+VSKF ++GD+++TETGT+AFGINQ+ FPNN  GISQVLWGSIGFT G
Sbjct: 361 PDTILRQEWMWNEVSKFFRDGDIILTETGTAAFGINQSLFPNNTIGISQVLWGSIGFTGG 420

Query: 421 ACLGAAFAAEEIDPKKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNDGYTIERLI 480
           A LGA+FAAEEIDP KRVILFIGDGSLQLTVQEIST+IRW LKPYLFVLNN+GYTIERLI
Sbjct: 421 AVLGASFAAEEIDPSKRVILFIGDGSLQLTVQEISTLIRWDLKPYLFVLNNNGYTIERLI 480

Query: 481 HGEKAGYNDIQNWDHLALLPTFGAKDYENHRVATTGEWDKLTQDKEFNKNSKIRMIEVML 540
           HG  AGYN IQ W H  LL  FGA DYEN ++ TTGEW  LTQDK+FN+ SKIRMIEVML
Sbjct: 481 HGPNAGYNAIQPWRHTKLLEAFGANDYENVKITTTGEWQTLTQDKQFNEPSKIRMIEVML 540

Query: 541 PVMDAPTSLIEQAKLTASINAKQ 563
           PVMDAP++LI QAKLTA IN+K+
Sbjct: 541 PVMDAPSNLIAQAKLTACINSKK 563

>NDAI0A02510 Chr1 complement(562483..564174) [1692 bp, 563 aa] {ON} 
          Length = 563

 Score =  948 bits (2451), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 445/563 (79%), Positives = 496/563 (88%)

Query: 1   MSEITLGRYLFERLNQVDVKTIFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADG 60
           MSEITLGRYLFERL+QV V TIFGLPGDFNL+LLDK+YEV GMRWAGNANELNAAYAADG
Sbjct: 1   MSEITLGRYLFERLHQVSVDTIFGLPGDFNLTLLDKVYEVAGMRWAGNANELNAAYAADG 60

Query: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNG 120
           YARIKGMSC+ITTFGVGELSALNGIAGSYAEHVGVLHVVG PS +SQAK LLLHHTLGNG
Sbjct: 61  YARIKGMSCLITTFGVGELSALNGIAGSYAEHVGVLHVVGTPSTTSQAKGLLLHHTLGNG 120

Query: 121 DFTVFHRMSANISETTAMVTDIATAPAEIDRCIRTTYITQRPVYLGLPANLVDLKVPAKL 180
           DFTVFHRMS+NISETTAM+TDI  APAEIDRCIRTTYI QRPVYLG+PAN  DLKVPA L
Sbjct: 121 DFTVFHRMSSNISETTAMLTDITAAPAEIDRCIRTTYIAQRPVYLGIPANFFDLKVPANL 180

Query: 181 LETPIDLSLKPNDPEAETEVVDTVLELIKAAKNPVILADACASRHDVKAETKKLIDATQF 240
           L TPIDLSL  N+PEAE E +  VLEL+K +KNP+I+ DACASRHDVKAET KLI+ TQF
Sbjct: 181 LNTPIDLSLHENEPEAEKEALGMVLELVKKSKNPIIVVDACASRHDVKAETNKLIELTQF 240

Query: 241 PSFVTPMGKGSIDEQHPRFGGVYVGTLSRPEVKEAVESADLILSVGALLSDFNTGSFSYS 300
           P+FVTPMGKG+I+EQHPR+GGVYVGTLSRPEVKEAVESADLILS+GALLSDFNTGSFSYS
Sbjct: 241 PTFVTPMGKGAINEQHPRYGGVYVGTLSRPEVKEAVESADLILSIGALLSDFNTGSFSYS 300

Query: 301 YKTKNIVEFHSDYIKIRNATFPGVQMKFALQKLLNAVPEAIKGYKPVPVPARVPENKSCD 360
           Y TK++VEFHSDY++I+ ATFPGVQMKF L KL   +P  ++ YKP PVP RVP+N    
Sbjct: 301 YDTKSVVEFHSDYVRIKKATFPGVQMKFLLDKLNYIIPNYVQSYKPRPVPTRVPDNAPIG 360

Query: 361 PATPLKQEWMWNQVSKFLQEGDVVITETGTSAFGINQTPFPNNAYGISQVLWGSIGFTTG 420
           P+T LKQ W+WNQ+SKFL+EGD+VI ETGTS FGIN+T FP N   ISQVLWGSIGF TG
Sbjct: 361 PSTSLKQAWLWNQLSKFLKEGDIVIVETGTSGFGINETTFPKNVTCISQVLWGSIGFATG 420

Query: 421 ACLGAAFAAEEIDPKKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNDGYTIERLI 480
             LGA  AAEE+DPK+RVILF GDGSLQLTVQEISTMIRW LKPYLFVLNN GYTIE+LI
Sbjct: 421 CTLGATMAAEELDPKRRVILFTGDGSLQLTVQEISTMIRWNLKPYLFVLNNKGYTIEKLI 480

Query: 481 HGEKAGYNDIQNWDHLALLPTFGAKDYENHRVATTGEWDKLTQDKEFNKNSKIRMIEVML 540
           HG  A YN+IQ+W+HL LL TFGAKDYEN+RV+TTG W+++T DK+FN+NSKIRMIEVML
Sbjct: 481 HGPTAAYNEIQHWEHLKLLETFGAKDYENYRVSTTGAWNEMTGDKKFNENSKIRMIEVML 540

Query: 541 PVMDAPTSLIEQAKLTASINAKQ 563
           PVMDAP SLI+Q +LTA IN+K 
Sbjct: 541 PVMDAPESLIKQGELTAQINSKH 563

>SAKL0F04334g Chr6 complement(347639..349333) [1695 bp, 564 aa] {ON}
           uniprot|Q6XAE9 Saccharomyces kluyveri PDC13 Pyruvate
           decarboxylase
          Length = 564

 Score =  942 bits (2436), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 454/563 (80%), Positives = 508/563 (90%)

Query: 1   MSEITLGRYLFERLNQVDVKTIFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADG 60
           MSEITLGRYLFERL QV V+TIFGLPGDFNLSLLDKIYEV G+RWAGNANELNAAYAADG
Sbjct: 1   MSEITLGRYLFERLKQVQVQTIFGLPGDFNLSLLDKIYEVPGLRWAGNANELNAAYAADG 60

Query: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNG 120
           YAR+KGMSCI+TTFGVGELSALNGIAGSYAEHVGVLHVVGVPS+SSQA+QLLLHHTLGNG
Sbjct: 61  YARVKGMSCIVTTFGVGELSALNGIAGSYAEHVGVLHVVGVPSVSSQAQQLLLHHTLGNG 120

Query: 121 DFTVFHRMSANISETTAMVTDIATAPAEIDRCIRTTYITQRPVYLGLPANLVDLKVPAKL 180
           DFTVFHRMS+ ISETTA++TDI  AP EIDRCI+ TY  QRPVYLGLPANLVDLKV A L
Sbjct: 121 DFTVFHRMSSEISETTAVITDIKDAPKEIDRCIKVTYSKQRPVYLGLPANLVDLKVSASL 180

Query: 181 LETPIDLSLKPNDPEAETEVVDTVLELIKAAKNPVILADACASRHDVKAETKKLIDATQF 240
           L+TPIDLS+ PND +AE EVV+TVL ++  AKNPVILADAC +RHDVK ETKKLID TQF
Sbjct: 181 LDTPIDLSMTPNDADAEDEVVETVLAMVSKAKNPVILADACCTRHDVKRETKKLIDLTQF 240

Query: 241 PSFVTPMGKGSIDEQHPRFGGVYVGTLSRPEVKEAVESADLILSVGALLSDFNTGSFSYS 300
           P+FVTPMGKGSIDE HPRFGGVYVGTLS PEVKEAVESADL+LSVGALLSDFNTGSFSYS
Sbjct: 241 PAFVTPMGKGSIDEDHPRFGGVYVGTLSDPEVKEAVESADLVLSVGALLSDFNTGSFSYS 300

Query: 301 YKTKNIVEFHSDYIKIRNATFPGVQMKFALQKLLNAVPEAIKGYKPVPVPARVPENKSCD 360
           YKTKNIVEFHSDY K+RNATFPGVQMK  LQKLL+ V +A  GYKPVPVP     N   +
Sbjct: 301 YKTKNIVEFHSDYTKVRNATFPGVQMKLVLQKLLSKVSDAASGYKPVPVPKGTRSNPGVE 360

Query: 361 PATPLKQEWMWNQVSKFLQEGDVVITETGTSAFGINQTPFPNNAYGISQVLWGSIGFTTG 420
            +TPLKQEW+WN +S +L+EGDVVITETGTSAFGINQ+ FPN+ YGISQVLWGSIG++ G
Sbjct: 361 SSTPLKQEWIWNHISDWLEEGDVVITETGTSAFGINQSRFPNSTYGISQVLWGSIGYSVG 420

Query: 421 ACLGAAFAAEEIDPKKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNDGYTIERLI 480
           +CLGAAFAAEE+D  +RVILF+GDGSLQLTVQEISTM+RWGLKPYLFVLNNDGYTIERLI
Sbjct: 421 SCLGAAFAAEELDKNRRVILFVGDGSLQLTVQEISTMVRWGLKPYLFVLNNDGYTIERLI 480

Query: 481 HGEKAGYNDIQNWDHLALLPTFGAKDYENHRVATTGEWDKLTQDKEFNKNSKIRMIEVML 540
           HGE A YND+Q W HL LLPTFGAKDY++ R++TTGE+ KLT+D+ F++NSKIR+IEVML
Sbjct: 481 HGETAQYNDVQPWLHLNLLPTFGAKDYDSIRISTTGEFLKLTEDQAFSRNSKIRLIEVML 540

Query: 541 PVMDAPTSLIEQAKLTASINAKQ 563
           PVMDAP++L++QA+LTA+ NAKQ
Sbjct: 541 PVMDAPSTLVKQAQLTAATNAKQ 563

>TBLA0B10060 Chr2 complement(2418979..2420673) [1695 bp, 564 aa]
           {ON} 
          Length = 564

 Score =  931 bits (2407), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 457/564 (81%), Positives = 514/564 (91%)

Query: 1   MSEITLGRYLFERLNQVDVKTIFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADG 60
           MS+ITLG+YLFERLNQV V+TIFGLPGDFNLSLLDKIYEV GMRWAGNANELNAAYAADG
Sbjct: 1   MSQITLGKYLFERLNQVKVQTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADG 60

Query: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNG 120
           YARIKGM+C+ITTFGVGELSALNGIAGSYAEHVGVLHVVGVPS++SQAK+LLLHHTLGNG
Sbjct: 61  YARIKGMACLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSVASQAKKLLLHHTLGNG 120

Query: 121 DFTVFHRMSANISETTAMVTDIATAPAEIDRCIRTTYITQRPVYLGLPANLVDLKVPAKL 180
           DF  FHRMSA ISETTAM+TDIA APAEIDRCIRTTY+TQR VYLGLPANLVDL VPA L
Sbjct: 121 DFDAFHRMSAEISETTAMITDIANAPAEIDRCIRTTYVTQRTVYLGLPANLVDLMVPASL 180

Query: 181 LETPIDLSLKPNDPEAETEVVDTVLELIKAAKNPVILADACASRHDVKAETKKLIDATQF 240
           LETPIDL+LKPN PE+E+EV++T+L+++K AKNP+I+ADACASRH+VK ET++LID TQF
Sbjct: 181 LETPIDLALKPNCPESESEVIETILDMVKNAKNPIIIADACASRHNVKKETEQLIDITQF 240

Query: 241 PSFVTPMGKGSIDEQHPRFGGVYVGTLSRPEVKEAVESADLILSVGALLSDFNTGSFSYS 300
           P+F TPMGKGSI+E+HPRFGGVYVGTLSRPE+K+AVESADLILSVGALLSDFNTGSFSY+
Sbjct: 241 PAFTTPMGKGSINEKHPRFGGVYVGTLSRPEIKQAVESADLILSVGALLSDFNTGSFSYA 300

Query: 301 YKTKNIVEFHSDYIKIRNATFPGVQMKFALQKLLNAVPEAIKGYKPVPVPARVPENKSCD 360
           Y+TKNIVEFHSD++KI+NATF GVQMKF L+KL+  + + IK YKPV VPA VP NK   
Sbjct: 301 YQTKNIVEFHSDHMKIKNATFQGVQMKFVLEKLIAKIGDYIKDYKPVAVPAAVPANKPVP 360

Query: 361 PATPLKQEWMWNQVSKFLQEGDVVITETGTSAFGINQTPFPNNAYGISQVLWGSIGFTTG 420
             TPLKQEW+WNQ+  FLQEGD+V+TETGTSAFGINQT FP + YGISQVLWGSIGFT G
Sbjct: 361 AETPLKQEWLWNQLGNFLQEGDIVLTETGTSAFGINQTTFPKDTYGISQVLWGSIGFTGG 420

Query: 421 ACLGAAFAAEEIDPKKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNDGYTIERLI 480
             LGAAFAAEEI+P KR ILFIGDGSLQLTVQEIST+IRW LKPYLFVLNN+GYTIE+LI
Sbjct: 421 CVLGAAFAAEEINPDKRTILFIGDGSLQLTVQEISTLIRWNLKPYLFVLNNNGYTIEKLI 480

Query: 481 HGEKAGYNDIQNWDHLALLPTFGAKDYENHRVATTGEWDKLTQDKEFNKNSKIRMIEVML 540
           HG  A YN+IQ W+HL +LPTFGAKDYE  RVATTGEWDKLT DK FNKNSKIRMIE+ML
Sbjct: 481 HGPTAQYNEIQGWNHLQILPTFGAKDYEAVRVATTGEWDKLTTDKAFNKNSKIRMIEIML 540

Query: 541 PVMDAPTSLIEQAKLTASINAKQE 564
           PVMDAP++L+ QA+LTA+INAKQ+
Sbjct: 541 PVMDAPSNLVAQAQLTAAINAKQD 564

>NCAS0A14240 Chr1 (2804135..2805832) [1698 bp, 565 aa] {ON} 
          Length = 565

 Score =  926 bits (2392), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 449/564 (79%), Positives = 497/564 (88%), Gaps = 2/564 (0%)

Query: 1   MSEITLGRYLFERLNQVDVKTIFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADG 60
           MS I+LGRYLFERL+QV V TIFGLPGDFNL+LLDKIYEV GMRWAGNANELNAAYAADG
Sbjct: 1   MSTISLGRYLFERLHQVSVDTIFGLPGDFNLTLLDKIYEVPGMRWAGNANELNAAYAADG 60

Query: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNG 120
           YAR+KGM+C++TTFGVGELSALNGIAGSYAEHVGVLHVVGVPS SSQAK LLLHHTLGNG
Sbjct: 61  YARVKGMACLLTTFGVGELSALNGIAGSYAEHVGVLHVVGVPSTSSQAKNLLLHHTLGNG 120

Query: 121 DFTVFHRMSANISETTAMVTDIATAPAEIDRCIRTTYITQRPVYLGLPANLVDLKVPAKL 180
           DFTVFHRMS+NISETT++VTD+A APAEIDRCIR TYI QRPVYLG+PAN  DL + AKL
Sbjct: 121 DFTVFHRMSSNISETTSIVTDVAQAPAEIDRCIRETYIKQRPVYLGIPANFFDLPISAKL 180

Query: 181 LETPIDLSLKPNDPEAETEVVDTVLELIKAAKNPVILADACASRHDVKAETKKLIDATQF 240
           L TPIDLSL  ND EAETE +D VL L+K A NP+IL DACASRHDVK ETKKLID TQ+
Sbjct: 181 LNTPIDLSLHENDEEAETEAIDLVLGLVKDAVNPIILVDACASRHDVKEETKKLIDITQY 240

Query: 241 PSFVTPMGKGSIDEQHPRFGGVYVGTLSRPEVKEAVESADLILSVGALLSDFNTGSFSYS 300
           P+FVTPMGKG+I+EQHPR+GGVYVG L+ P +KEAVESADLILSVGALLSDFNTGSFSY 
Sbjct: 241 PTFVTPMGKGAINEQHPRYGGVYVGNLTDPAIKEAVESADLILSVGALLSDFNTGSFSYG 300

Query: 301 YKTKNIVEFHSDYIKIRNATFPGVQMKFALQKLLNAVPEAIKGYKPVPVPARVPENKSCD 360
            KTKN+VEFHSDY+KIRNA+FPGVQMKF LQKL   +P   K YKPVPVP +   NK+  
Sbjct: 301 LKTKNVVEFHSDYVKIRNASFPGVQMKFVLQKLNRQLPPYTKNYKPVPVPTKTASNKNVA 360

Query: 361 PATPLKQEWMWNQVSKFLQEGDVVITETGTSAFGINQTPFPNNAYGISQVLWGSIGFTTG 420
            +TP+KQEWMWNQ++KFLQEGD+VI+ETGTS FGINQT FPNN  GISQVLWGSIGF TG
Sbjct: 361 ASTPMKQEWMWNQLAKFLQEGDIVISETGTSGFGINQTSFPNNTTGISQVLWGSIGFATG 420

Query: 421 ACLGAAFAAEEIDPKKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNDGYTIERLI 480
             LGA  AAEEIDPKKRVILF GDGSLQLTVQEISTM+RW LKPYLFVLNN+GYTIE+LI
Sbjct: 421 CTLGATMAAEEIDPKKRVILFTGDGSLQLTVQEISTMVRWNLKPYLFVLNNNGYTIEKLI 480

Query: 481 HGEKAGYNDIQNWDHLALLPTFGAKD--YENHRVATTGEWDKLTQDKEFNKNSKIRMIEV 538
           HGE AGYN+IQ W+HL L   FGAK+  +ENHRV+TTGEW+KLT+ K+F  N+KIRMIEV
Sbjct: 481 HGEHAGYNEIQPWNHLELFHAFGAKEGTFENHRVSTTGEWNKLTESKQFQDNTKIRMIEV 540

Query: 539 MLPVMDAPTSLIEQAKLTASINAK 562
           MLPVMDAPTSLI+QAKLTASINAK
Sbjct: 541 MLPVMDAPTSLIKQAKLTASINAK 564

>TBLA0E03070 Chr5 (771183..772874) [1692 bp, 563 aa] {ON} 
          Length = 563

 Score =  922 bits (2382), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 443/563 (78%), Positives = 500/563 (88%)

Query: 1   MSEITLGRYLFERLNQVDVKTIFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADG 60
           MSEITLG+YLFERL QV+V TIFGLPGDFNL+LLDKIYEV GMRWAGNANELNAAYAADG
Sbjct: 1   MSEITLGKYLFERLKQVNVNTIFGLPGDFNLALLDKIYEVPGMRWAGNANELNAAYAADG 60

Query: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNG 120
           YARIKGMSC+ITTFGVGELSALNGIAGSYAEHVGVLHVVGVPS +SQAK+LLLHHTLGNG
Sbjct: 61  YARIKGMSCLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSTTSQAKKLLLHHTLGNG 120

Query: 121 DFTVFHRMSANISETTAMVTDIATAPAEIDRCIRTTYITQRPVYLGLPANLVDLKVPAKL 180
           DF VFHRMS  ISETTAM+TD++ A ++ID CIR TY TQRPVYLG+PAN+ D  +PAKL
Sbjct: 121 DFDVFHRMSTEISETTAMITDLSKAASQIDNCIRVTYTTQRPVYLGIPANMFDFTLPAKL 180

Query: 181 LETPIDLSLKPNDPEAETEVVDTVLELIKAAKNPVILADACASRHDVKAETKKLIDATQF 240
           LETPI++ L PN+ E+E EVV+T+L ++K AKNPVI+ADAC SRH+VKAET+KLIDATQF
Sbjct: 181 LETPINMKLSPNNQESEDEVVETILRMVKGAKNPVIIADACCSRHNVKAETEKLIDATQF 240

Query: 241 PSFVTPMGKGSIDEQHPRFGGVYVGTLSRPEVKEAVESADLILSVGALLSDFNTGSFSYS 300
           P+F TPMGKGSI+E HPRFGGVYVGTL+RPEVK+AVESADLILSVGALLSDFNTG+FSY 
Sbjct: 241 PAFTTPMGKGSINEHHPRFGGVYVGTLTRPEVKKAVESADLILSVGALLSDFNTGTFSYD 300

Query: 301 YKTKNIVEFHSDYIKIRNATFPGVQMKFALQKLLNAVPEAIKGYKPVPVPARVPENKSCD 360
           Y+TKNIVEFHSD+IKI+NATF GVQMKF L +L+  + + +K YKPVPVPA +P+NK C 
Sbjct: 301 YETKNIVEFHSDHIKIKNATFQGVQMKFVLDRLIKEIGDYVKDYKPVPVPAGIPDNKPCP 360

Query: 361 PATPLKQEWMWNQVSKFLQEGDVVITETGTSAFGINQTPFPNNAYGISQVLWGSIGFTTG 420
             TPL+QEW+WNQ+  FLQEGD+V+TETGTSAFGIN T FP N YGI+QVLWGSIGFT G
Sbjct: 361 DETPLQQEWLWNQLGNFLQEGDIVLTETGTSAFGINHTKFPKNTYGINQVLWGSIGFTGG 420

Query: 421 ACLGAAFAAEEIDPKKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNDGYTIERLI 480
             LGAAFAAEEIDPKKRV LFIGDGSLQLTVQEISTMIRW LKPYLFVLNN+GYTIE+LI
Sbjct: 421 CVLGAAFAAEEIDPKKRVHLFIGDGSLQLTVQEISTMIRWNLKPYLFVLNNNGYTIEKLI 480

Query: 481 HGEKAGYNDIQNWDHLALLPTFGAKDYENHRVATTGEWDKLTQDKEFNKNSKIRMIEVML 540
           HG  A YN+IQ WDHL++LPTFGA DYE  RVAT GEW+KLT D +FNKNSKIRMIE+ML
Sbjct: 481 HGPTAQYNEIQGWDHLSILPTFGATDYEAIRVATIGEWNKLTTDDKFNKNSKIRMIEIML 540

Query: 541 PVMDAPTSLIEQAKLTASINAKQ 563
           PVMDAP++LI Q KLT +INA Q
Sbjct: 541 PVMDAPSNLIAQGKLTEAINAAQ 563

>TBLA0D02840 Chr4 complement(694649..696340) [1692 bp, 563 aa] {ON}
           Anc_2.390 YDL080C
          Length = 563

 Score =  917 bits (2370), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 436/563 (77%), Positives = 499/563 (88%)

Query: 1   MSEITLGRYLFERLNQVDVKTIFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADG 60
           MS++TLGRYLFERLNQ+ ++TIFGLPGDFNL LLDKIYE+ GMRW GNANELNAAYAADG
Sbjct: 1   MSQVTLGRYLFERLNQIKIQTIFGLPGDFNLPLLDKIYEIPGMRWVGNANELNAAYAADG 60

Query: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNG 120
           YARIKGMSC+ITTFGVGELSALNGIAGSYAEHVGVLHVVGVPS+ +QAK+LLLHHTLG+G
Sbjct: 61  YARIKGMSCMITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSLEAQAKKLLLHHTLGDG 120

Query: 121 DFTVFHRMSANISETTAMVTDIATAPAEIDRCIRTTYITQRPVYLGLPANLVDLKVPAKL 180
           DF  F+RMS+ ISET  M+ D+ TAPAEIDRCI+T Y+ QRPVYLGLP NLV+  VP  L
Sbjct: 121 DFNAFYRMSSEISETAVMIKDVTTAPAEIDRCIKTAYVMQRPVYLGLPVNLVNAMVPVSL 180

Query: 181 LETPIDLSLKPNDPEAETEVVDTVLELIKAAKNPVILADACASRHDVKAETKKLIDATQF 240
           L+TPIDLSL+PND ++E+EV+ T+LE++K AKNP+I+ADACASRHDVKAET+KLID TQF
Sbjct: 181 LQTPIDLSLRPNDADSESEVIQTILEMVKQAKNPIIIADACASRHDVKAETEKLIDITQF 240

Query: 241 PSFVTPMGKGSIDEQHPRFGGVYVGTLSRPEVKEAVESADLILSVGALLSDFNTGSFSYS 300
           PSFVTPMGKGSI+EQHPRFGGVYVGTL+RPEVK+AVESADLILS+GALLSDFNTGSFSY+
Sbjct: 241 PSFVTPMGKGSINEQHPRFGGVYVGTLTRPEVKKAVESADLILSIGALLSDFNTGSFSYN 300

Query: 301 YKTKNIVEFHSDYIKIRNATFPGVQMKFALQKLLNAVPEAIKGYKPVPVPARVPENKSCD 360
           Y+TKN++EFHSD+ KI+NA + G+QMKF L KL+  + E +K YKPV VPA +  N    
Sbjct: 301 YETKNVIEFHSDHTKIKNAVYEGIQMKFVLSKLITKIGEVVKNYKPVAVPAPILANPKTS 360

Query: 361 PATPLKQEWMWNQVSKFLQEGDVVITETGTSAFGINQTPFPNNAYGISQVLWGSIGFTTG 420
           P TPL+QEW+WNQ+  FLQEGD+V+TETGTSAFGINQT FP N YGISQVLWGSIGFT G
Sbjct: 361 PETPLRQEWLWNQLGNFLQEGDIVLTETGTSAFGINQTYFPKNTYGISQVLWGSIGFTGG 420

Query: 421 ACLGAAFAAEEIDPKKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNDGYTIERLI 480
             LGAAFAAEEIDPKKRV+LFIGDGSLQLTVQEISTM+ W LKPYLFVLNNDGYTIERLI
Sbjct: 421 CVLGAAFAAEEIDPKKRVVLFIGDGSLQLTVQEISTMVNWNLKPYLFVLNNDGYTIERLI 480

Query: 481 HGEKAGYNDIQNWDHLALLPTFGAKDYENHRVATTGEWDKLTQDKEFNKNSKIRMIEVML 540
           HG  A YN+IQ W++L LL TFGAKDY+  RVATTGEW+ LTQ+ EFN+NSKIRMIEVML
Sbjct: 481 HGPTAQYNEIQPWNNLELLSTFGAKDYQAVRVATTGEWNILTQNPEFNQNSKIRMIEVML 540

Query: 541 PVMDAPTSLIEQAKLTASINAKQ 563
           P MDAP++LI QA+LTASINAKQ
Sbjct: 541 PTMDAPSNLISQAELTASINAKQ 563

>KNAG0J01330 Chr10 complement(240650..242344) [1695 bp, 564 aa] {ON}
           
          Length = 564

 Score =  909 bits (2348), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 436/564 (77%), Positives = 497/564 (88%)

Query: 1   MSEITLGRYLFERLNQVDVKTIFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADG 60
           MS ++LG YLFERL QV V TIFGLPGDFNL LLDKIY++ GMRW GNANELNA+YAADG
Sbjct: 1   MSTVSLGHYLFERLKQVGVNTIFGLPGDFNLVLLDKIYDIPGMRWVGNANELNASYAADG 60

Query: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNG 120
           YARIKGM+C++TTFGVGELSALNGIAGSYAEHVGVLHVVGVPS  SQAK LLLHHTLGNG
Sbjct: 61  YARIKGMACLLTTFGVGELSALNGIAGSYAEHVGVLHVVGVPSTLSQAKGLLLHHTLGNG 120

Query: 121 DFTVFHRMSANISETTAMVTDIATAPAEIDRCIRTTYITQRPVYLGLPANLVDLKVPAKL 180
           DF VFHRMSA ISETTA++TD++ A +EIDRCIRTTY+ QR VYLG+PAN+ D ++P  L
Sbjct: 121 DFDVFHRMSAEISETTAVITDLSKAASEIDRCIRTTYVKQRTVYLGIPANMFDYEMPRSL 180

Query: 181 LETPIDLSLKPNDPEAETEVVDTVLELIKAAKNPVILADACASRHDVKAETKKLIDATQF 240
           L+TPIDLSLK N+PE+E+EV+DT+L+L+  AKNP+ILADACASRHDVK ET++LIDATQF
Sbjct: 181 LDTPIDLSLKANNPESESEVLDTILDLVSKAKNPIILADACASRHDVKKETQQLIDATQF 240

Query: 241 PSFVTPMGKGSIDEQHPRFGGVYVGTLSRPEVKEAVESADLILSVGALLSDFNTGSFSYS 300
           P+FVTPMGKGSIDE HPR+GG+YVGTLS P VK+AVESADL+LSVGALLSDFNTGSFSYS
Sbjct: 241 PAFVTPMGKGSIDETHPRYGGIYVGTLSSPAVKKAVESADLVLSVGALLSDFNTGSFSYS 300

Query: 301 YKTKNIVEFHSDYIKIRNATFPGVQMKFALQKLLNAVPEAIKGYKPVPVPARVPENKSCD 360
           Y+TKNIVEFHSD+IKIRNA FP +QMK  LQKL+  +   I  Y PV VPAR P N + D
Sbjct: 301 YQTKNIVEFHSDHIKIRNALFPDMQMKSILQKLITQIKPVIANYSPVAVPARAPANAAVD 360

Query: 361 PATPLKQEWMWNQVSKFLQEGDVVITETGTSAFGINQTPFPNNAYGISQVLWGSIGFTTG 420
           P+TPLKQEWMW ++  FLQEGD+VITETGTSAFGIN T FP N  GISQVLWGSIGFT G
Sbjct: 361 PSTPLKQEWMWKELGNFLQEGDIVITETGTSAFGINGTTFPKNTVGISQVLWGSIGFTGG 420

Query: 421 ACLGAAFAAEEIDPKKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNDGYTIERLI 480
           A LGAAFAAEEIDP +RVILFIGDGSLQLTVQEIST I+W LKPYLF+LNN+GYTIE+LI
Sbjct: 421 AVLGAAFAAEEIDPNRRVILFIGDGSLQLTVQEISTCIKWNLKPYLFILNNNGYTIEKLI 480

Query: 481 HGEKAGYNDIQNWDHLALLPTFGAKDYENHRVATTGEWDKLTQDKEFNKNSKIRMIEVML 540
           HG  A YN+IQ+W+HL LLPTFGAKDYE  R+AT GEW+KLTQDKEFNKNS+IR+IEVML
Sbjct: 481 HGPTAQYNEIQSWEHLQLLPTFGAKDYEAVRIATVGEWNKLTQDKEFNKNSRIRLIEVML 540

Query: 541 PVMDAPTSLIEQAKLTASINAKQE 564
           PVMDAP SLI+Q +LTA+INAK++
Sbjct: 541 PVMDAPESLIKQGQLTAAINAKKD 564

>KNAG0J01340 Chr10 complement(243186..244883) [1698 bp, 565 aa] {ON}
           
          Length = 565

 Score =  905 bits (2339), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 437/562 (77%), Positives = 493/562 (87%), Gaps = 1/562 (0%)

Query: 1   MSEITLGRYLFERLNQVDVKTIFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADG 60
           MS I+LG YLFERL QV V TIFGLPGDFNL LLDKIY+V G+RWAGNANELNAAYAADG
Sbjct: 1   MSTISLGHYLFERLKQVGVNTIFGLPGDFNLVLLDKIYDVPGIRWAGNANELNAAYAADG 60

Query: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNG 120
           YARIKGM+C++TTFGVGELSALNGIAGSYAEHVGVLHVVG PS  SQA  LLLHHTLGNG
Sbjct: 61  YARIKGMACLLTTFGVGELSALNGIAGSYAEHVGVLHVVGTPSTHSQANGLLLHHTLGNG 120

Query: 121 DFTVFHRMSANISETTAMVTDIATAPAEIDRCIRTTYITQRPVYLGLPANLVDLKVPAKL 180
           DF VFHRMSA ISETT M+TD   A  +IDRCIRTTY+ QR VYLG+PAN+ D ++P  L
Sbjct: 121 DFDVFHRMSAQISETTEMITDPHKAADQIDRCIRTTYVKQRTVYLGIPANMFDYEMPRSL 180

Query: 181 LETPIDLSLKPNDPEAETEVVDTVLELIKAAKNPVILADACASRHDVKAETKKLIDATQF 240
           L+TPIDLSLK N+P +E +V+DT+L+ +K AKNP+I++DACASRHDVK ET++LI+ TQF
Sbjct: 181 LDTPIDLSLKANNPTSERQVLDTILQSVKDAKNPIIISDACASRHDVKEETQQLINITQF 240

Query: 241 PSFVTPMGKGSIDEQHPRFGGVYVGTLSRPEVKEAVESADLILSVGALLSDFNTGSFSYS 300
           P+FVTP+GKGSIDE HPR+GG+YVGTLSRPEVKEAVESADLILSVGALLSDFNTGSFSYS
Sbjct: 241 PAFVTPLGKGSIDETHPRYGGIYVGTLSRPEVKEAVESADLILSVGALLSDFNTGSFSYS 300

Query: 301 YKTKNIVEFHSDYIKIRNATFPGVQMKFALQKLLNAVPEAIKGYKPVPVPARVPEN-KSC 359
           Y+TKN+VEFHSD++KI+NA FPGVQM+  L+KLL  +P  +KGY PV VPA++P N KS 
Sbjct: 301 YETKNVVEFHSDHMKIKNAVFPGVQMEPLLRKLLKEIPAVVKGYNPVAVPAKIPANDKSI 360

Query: 360 DPATPLKQEWMWNQVSKFLQEGDVVITETGTSAFGINQTPFPNNAYGISQVLWGSIGFTT 419
               PL+QEWMWNQ+S+FLQEGD++ITETGTSAFGIN T FP NA GISQVLWGSIGFT 
Sbjct: 361 SATAPLRQEWMWNQLSEFLQEGDIIITETGTSAFGINGTTFPKNAVGISQVLWGSIGFTV 420

Query: 420 GACLGAAFAAEEIDPKKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNDGYTIERL 479
           GA LGAAFAAEEIDPKKRVILFIGDGSLQLTVQEISTMI+W LKPYLF+LNN+GYTIE+L
Sbjct: 421 GALLGAAFAAEEIDPKKRVILFIGDGSLQLTVQEISTMIKWNLKPYLFILNNNGYTIEKL 480

Query: 480 IHGEKAGYNDIQNWDHLALLPTFGAKDYENHRVATTGEWDKLTQDKEFNKNSKIRMIEVM 539
           IHG  A YN+IQ+WDHL LLPT GAKDYE  RVAT GEW+KLTQDKEFNKNS+IR+IEVM
Sbjct: 481 IHGPTAEYNEIQSWDHLKLLPTLGAKDYEAVRVATVGEWNKLTQDKEFNKNSRIRVIEVM 540

Query: 540 LPVMDAPTSLIEQAKLTASINA 561
           LPVMDAP SLIEQ KLT  INA
Sbjct: 541 LPVMDAPQSLIEQGKLTEKINA 562

>NDAI0D03270 Chr4 (778452..780017) [1566 bp, 521 aa] {ON} 
          Length = 521

 Score =  898 bits (2321), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 422/521 (80%), Positives = 460/521 (88%)

Query: 43  MRWAGNANELNAAYAADGYARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVP 102
           MRWAGNANELNAAYAADGYAR+KGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVG P
Sbjct: 1   MRWAGNANELNAAYAADGYARVKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGTP 60

Query: 103 SISSQAKQLLLHHTLGNGDFTVFHRMSANISETTAMVTDIATAPAEIDRCIRTTYITQRP 162
           S +SQAK LLLHHTLGNGDFTVFHRMS+N+SETTAM+TD+ TAPAEIDRCIRTTYI QRP
Sbjct: 61  STTSQAKNLLLHHTLGNGDFTVFHRMSSNLSETTAMITDVTTAPAEIDRCIRTTYIAQRP 120

Query: 163 VYLGLPANLVDLKVPAKLLETPIDLSLKPNDPEAETEVVDTVLELIKAAKNPVILADACA 222
           VYLG+PAN  DLKVPA LL TPIDL L PN+PEAE E +D +LELIK +KNP IL DACA
Sbjct: 121 VYLGIPANYFDLKVPAALLNTPIDLELHPNEPEAEKEALDMILELIKDSKNPAILVDACA 180

Query: 223 SRHDVKAETKKLIDATQFPSFVTPMGKGSIDEQHPRFGGVYVGTLSRPEVKEAVESADLI 282
           SRHDVKAET KLI+ TQFP FVTPMGKG+I+EQHPR+GGVYVGTLS+PEVK+AVESADLI
Sbjct: 181 SRHDVKAETNKLIELTQFPHFVTPMGKGAINEQHPRYGGVYVGTLSKPEVKKAVESADLI 240

Query: 283 LSVGALLSDFNTGSFSYSYKTKNIVEFHSDYIKIRNATFPGVQMKFALQKLLNAVPEAIK 342
           LSVGALLSDFNTGSFSYSYKTKNIVEFHSDYIKIRNATFPGVQMKF L KL   +PE + 
Sbjct: 241 LSVGALLSDFNTGSFSYSYKTKNIVEFHSDYIKIRNATFPGVQMKFVLDKLNAIIPEVVT 300

Query: 343 GYKPVPVPARVPENKSCDPATPLKQEWMWNQVSKFLQEGDVVITETGTSAFGINQTPFPN 402
           GYKP  VPAR P NK+    TPLKQ WMWNQ+SKFL+EGDVVI ETGT  FGIN+T FP 
Sbjct: 301 GYKPTAVPARAPANKAVSGTTPLKQAWMWNQLSKFLKEGDVVIVETGTPGFGINETTFPK 360

Query: 403 NAYGISQVLWGSIGFTTGACLGAAFAAEEIDPKKRVILFIGDGSLQLTVQEISTMIRWGL 462
           N  GISQVLWGSIG+ TG  LGA  AAEE+DP KRVILF GDGSLQLTVQEISTMIRW L
Sbjct: 361 NVIGISQVLWGSIGYATGCTLGATMAAEELDPHKRVILFTGDGSLQLTVQEISTMIRWNL 420

Query: 463 KPYLFVLNNDGYTIERLIHGEKAGYNDIQNWDHLALLPTFGAKDYENHRVATTGEWDKLT 522
           +PYLF+LNN+GYTIE+LIHG  A YN+IQ+WDHL LL TFGAKDYENHRVATTGEW KLT
Sbjct: 421 RPYLFILNNNGYTIEKLIHGPTAQYNEIQSWDHLKLLETFGAKDYENHRVATTGEWTKLT 480

Query: 523 QDKEFNKNSKIRMIEVMLPVMDAPTSLIEQAKLTASINAKQ 563
           ++K+FNKNS+IR+IEVMLPVMDAP SLI+Q +LTA INAK 
Sbjct: 481 ENKDFNKNSRIRVIEVMLPVMDAPESLIKQGELTAKINAKN 521

>KLTH0D08272g Chr4 complement(695296..696987) [1692 bp, 563 aa] {ON}
           highly similar to uniprot|P06169 Saccharomyces
           cerevisiae YLR044C PDC1 Major of three pyruvate
           decarboxylase isozymes key enzyme in alcoholic
           fermentation decarboxylates pyruvate to acetaldehyde
           subject to glucose- ethanol- and autoregulation involved
           in amino acid catabolism and to YLR134W uniprot|P16467
           Saccharomyces cerevisiae YLR134W PDC5 Minor isoform of
           pyruvate decarboxylase, key enzyme in alcoholic
           fermentation, decarboxylates pyruvate to acetaldehyde,
           regulation is glucose- and ethanol-dependent, repressed
           by thiamine, involved in amino acid catabolism
          Length = 563

 Score =  885 bits (2288), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 427/562 (75%), Positives = 484/562 (86%)

Query: 1   MSEITLGRYLFERLNQVDVKTIFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADG 60
           MS ITLGRYLFERL QV+  TIFGLPGDFNL LLD+IYEVEGMRWAGN NELNAAYAADG
Sbjct: 1   MSSITLGRYLFERLRQVECFTIFGLPGDFNLRLLDEIYEVEGMRWAGNTNELNAAYAADG 60

Query: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNG 120
           YAR+KG++C+ITTFGVGELSALNG+ GSYAEHVGVLHVVGVPS++SQAKQ LLHHTLG+G
Sbjct: 61  YARLKGIACLITTFGVGELSALNGVVGSYAEHVGVLHVVGVPSLASQAKQQLLHHTLGDG 120

Query: 121 DFTVFHRMSANISETTAMVTDIATAPAEIDRCIRTTYITQRPVYLGLPANLVDLKVPAKL 180
           DF VFHRMSANIS+TTAMVTD+ATAP EIDRCIRTTY+TQRPVYLGLPAN+V+  V  +L
Sbjct: 121 DFAVFHRMSANISQTTAMVTDLATAPQEIDRCIRTTYVTQRPVYLGLPANIVNQMVDRRL 180

Query: 181 LETPIDLSLKPNDPEAETEVVDTVLELIKAAKNPVILADACASRHDVKAETKKLIDATQF 240
           L+TPIDLSL+PND + E EV+  VL L++ A+NP+ILADAC SRHD K E  +L DATQF
Sbjct: 181 LDTPIDLSLEPNDEDTEEEVLTQVLALVQKAQNPIILADACCSRHDAKKEAWQLTDATQF 240

Query: 241 PSFVTPMGKGSIDEQHPRFGGVYVGTLSRPEVKEAVESADLILSVGALLSDFNTGSFSYS 300
           P FVTPMGKGS+ E+HPRFGGVYVGTLS P+VK AVE+ADLILS+GALLSDFNTGSFSYS
Sbjct: 241 PCFVTPMGKGSVPEKHPRFGGVYVGTLSSPDVKSAVEAADLILSLGALLSDFNTGSFSYS 300

Query: 301 YKTKNIVEFHSDYIKIRNATFPGVQMKFALQKLLNAVPEAIKGYKPVPVPARVPENKSCD 360
           Y T+N+VEFHSD+ K+RNA FP V MKF LQKL+  +P AI+ Y P PVP R   N    
Sbjct: 301 YGTRNVVEFHSDHTKVRNAIFPRVGMKFVLQKLIQRIPAAIQHYSPRPVPTRPARNAPTP 360

Query: 361 PATPLKQEWMWNQVSKFLQEGDVVITETGTSAFGINQTPFPNNAYGISQVLWGSIGFTTG 420
             TPL QEW+W Q+ +FL+EGDVV+TETGTSAFGINQT FPNN YGISQVLWGSIGFTTG
Sbjct: 361 RDTPLTQEWLWTQIGEFLREGDVVVTETGTSAFGINQTRFPNNTYGISQVLWGSIGFTTG 420

Query: 421 ACLGAAFAAEEIDPKKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNDGYTIERLI 480
           A LGAA AAEE+D  KRVILFIGDGSLQLTVQEIS+M+RWGL+PYLFV NNDGYTIE+LI
Sbjct: 421 ATLGAAMAAEELDKNKRVILFIGDGSLQLTVQEISSMVRWGLRPYLFVPNNDGYTIEKLI 480

Query: 481 HGEKAGYNDIQNWDHLALLPTFGAKDYENHRVATTGEWDKLTQDKEFNKNSKIRMIEVML 540
           HG  A YN+IQNW HL LLPTFGA DYE  RVATTGEWD LT D  FN+NS+IR++EVML
Sbjct: 481 HGPTAQYNEIQNWHHLRLLPTFGATDYEAVRVATTGEWDALTNDPAFNRNSRIRLVEVML 540

Query: 541 PVMDAPTSLIEQAKLTASINAK 562
            VMDAP+SL+ QA+LTA+ NA+
Sbjct: 541 EVMDAPSSLVRQAQLTAATNAQ 562

>CAGL0G02937g Chr7 complement(268985..270679) [1695 bp, 564 aa] {ON}
           highly similar to uniprot|P06169 Saccharomyces
           cerevisiae YLR044c PDC1 or uniprot|P16467 Saccharomyces
           cerevisiae YLR134w PDC5 or uniprot|P26263 Saccharomyces
           cerevisiae YGR087c PDC6
          Length = 564

 Score =  859 bits (2220), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 416/563 (73%), Positives = 479/563 (85%), Gaps = 1/563 (0%)

Query: 1   MSEITLGRYLFERLNQVDVKTIFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADG 60
           M+EITLGRYLFERL+Q+ + TIFGLPGDFNL+LLDKIYEVEG+RWAGNANELNAAYAADG
Sbjct: 1   MTEITLGRYLFERLHQIHIDTIFGLPGDFNLTLLDKIYEVEGLRWAGNANELNAAYAADG 60

Query: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNG 120
           YAR+KGM+C++TTFGVGELSALNGIAGSYAEHVGVLHVVGVPS  S+AKQLLLHHTLGNG
Sbjct: 61  YARLKGMACLLTTFGVGELSALNGIAGSYAEHVGVLHVVGVPSTVSRAKQLLLHHTLGNG 120

Query: 121 DFTVFHRMSANISETTAMVTDIATAPAEIDRCIRTTYITQRPVYLGLPANLVDLKVPAKL 180
           DF  FHRMS+ ISETT +V+D  TAPAEIDRCIR  Y+TQRPVYLG+PAN+ D KV +KL
Sbjct: 121 DFDAFHRMSSVISETTFIVSDPQTAPAEIDRCIRVCYLTQRPVYLGIPANMFDSKVSSKL 180

Query: 181 LETPIDLSLKPNDPEAETEVVDTVLELIKAAKNPVILADACASRHDVKAETKKLIDATQF 240
           L+TPIDL+L+PN P+AE EV+D ++ +IKA+K P+ILADAC SRHDVK ETK+LI+ TQF
Sbjct: 181 LDTPIDLALRPNLPDAEREVLDEIITMIKASKRPIILADACTSRHDVKKETKRLIEVTQF 240

Query: 241 PSFVTPMGKGSIDEQHPRFGGVYVGTLSRPEVKEAVESADLILSVGALLSDFNTGSFSYS 300
           PSF TPMGKGSIDE  PRFGGVYVG LS PEVK  VE +DL+LSVGALLSDFNTGSFSYS
Sbjct: 241 PSFTTPMGKGSIDEDTPRFGGVYVGNLSDPEVKTFVEESDLVLSVGALLSDFNTGSFSYS 300

Query: 301 YKTKNIVEFHSDYIKIRNATFPGVQMKFALQKLLNAVPEAIKGYKPVPVPARVPE-NKSC 359
             T+N++EFHSD++KIRNATFPGVQMKF L+KLL  +P  +KG     V  R  E + + 
Sbjct: 301 LNTRNVIEFHSDHMKIRNATFPGVQMKFVLEKLLEELPAVVKGRTDNRVVPRQKEPSTTL 360

Query: 360 DPATPLKQEWMWNQVSKFLQEGDVVITETGTSAFGINQTPFPNNAYGISQVLWGSIGFTT 419
           +    +KQEWMW  V KFLQEGDVV+TETGTS FGI ++ FP N  GISQVLWGSIG+  
Sbjct: 361 NGKDAIKQEWMWKHVGKFLQEGDVVVTETGTSGFGIVESKFPRNTVGISQVLWGSIGYAL 420

Query: 420 GACLGAAFAAEEIDPKKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNDGYTIERL 479
           G+ +GAAFAA+EIDPKKRVILFIGDGSLQLTVQE+ST  RWGL PY+FVLNN+GYTIERL
Sbjct: 421 GSTVGAAFAAQEIDPKKRVILFIGDGSLQLTVQELSTAARWGLTPYIFVLNNNGYTIERL 480

Query: 480 IHGEKAGYNDIQNWDHLALLPTFGAKDYENHRVATTGEWDKLTQDKEFNKNSKIRMIEVM 539
           IHGE  GYNDIQ+WDH  +LP FGAK+YEN RVAT GEW+ +  DK+FNKN K+RMIEVM
Sbjct: 481 IHGETQGYNDIQSWDHSLILPAFGAKNYENKRVATYGEWNDMVNDKQFNKNDKLRMIEVM 540

Query: 540 LPVMDAPTSLIEQAKLTASINAK 562
           LP MD P +L +QAKLTASINAK
Sbjct: 541 LPTMDGPENLKKQAKLTASINAK 563

>Ecym_3185 Chr3 (352629..354320) [1692 bp, 563 aa] {ON} similar to
           Ashbya gossypii AAL073W
          Length = 563

 Score =  826 bits (2134), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 382/563 (67%), Positives = 466/563 (82%)

Query: 1   MSEITLGRYLFERLNQVDVKTIFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADG 60
           MSEI++GRYLFERLNQV VKTIFGLPGDFNLSLLDK+YEV G+RWAGNANELNAAYAADG
Sbjct: 1   MSEISIGRYLFERLNQVGVKTIFGLPGDFNLSLLDKLYEVPGLRWAGNANELNAAYAADG 60

Query: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNG 120
           YAR+ GM C++TTFGVGELSA+NGIAGSYAE + VLHVVGVPS   QAK+LLLHHTLG+G
Sbjct: 61  YARVNGMGCLVTTFGVGELSAINGIAGSYAECISVLHVVGVPSTMVQAKRLLLHHTLGDG 120

Query: 121 DFTVFHRMSANISETTAMVTDIATAPAEIDRCIRTTYITQRPVYLGLPANLVDLKVPAKL 180
           DFT FHRM   I++TTA+++D ATA +EIDRCI+T  +T  PVYLG+PAN+    + A L
Sbjct: 121 DFTAFHRMYQRITKTTAILSDDATAASEIDRCIKTCIMTHGPVYLGVPANMATATIDASL 180

Query: 181 LETPIDLSLKPNDPEAETEVVDTVLELIKAAKNPVILADACASRHDVKAETKKLIDATQF 240
           LETPIDLS + ND +AE EV+D VL LI+ A+NP+IL+DACASR+D+K E K LID TQF
Sbjct: 181 LETPIDLSPELNDQDAENEVIDAVLHLIQNARNPIILSDACASRYDIKEEIKTLIDITQF 240

Query: 241 PSFVTPMGKGSIDEQHPRFGGVYVGTLSRPEVKEAVESADLILSVGALLSDFNTGSFSYS 300
           P++VTPMGK S++EQHPR+GGVY G++S+PEVK+AVESADLILS+G+LL+D NTG+FS S
Sbjct: 241 PTYVTPMGKSSVNEQHPRYGGVYAGSISKPEVKKAVESADLILSIGSLLADMNTGNFSQS 300

Query: 301 YKTKNIVEFHSDYIKIRNATFPGVQMKFALQKLLNAVPEAIKGYKPVPVPARVPENKSCD 360
           Y TK+IVEFHS +  I+NATF GVQMKF LQKL   V + ++ Y PVP+ ++   NK  D
Sbjct: 301 YSTKDIVEFHSTFTMIKNATFNGVQMKFVLQKLAEKVGDVVQNYVPVPIASKPSPNKPLD 360

Query: 361 PATPLKQEWMWNQVSKFLQEGDVVITETGTSAFGINQTPFPNNAYGISQVLWGSIGFTTG 420
           P TPL Q+W+W +VS FL+EGD+VI E+GT AFGIN+   P     ISQ+LWGSIG+T G
Sbjct: 361 PLTPLAQQWLWKEVSTFLKEGDIVIAESGTPAFGINEVTLPTGTRCISQLLWGSIGYTVG 420

Query: 421 ACLGAAFAAEEIDPKKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNDGYTIERLI 480
           ACLG   A +EIDP +RVILFIGDGSLQL VQE+STMIRWGLKPYLFVLNNDGYTIERLI
Sbjct: 421 ACLGICLATQEIDPSRRVILFIGDGSLQLAVQELSTMIRWGLKPYLFVLNNDGYTIERLI 480

Query: 481 HGEKAGYNDIQNWDHLALLPTFGAKDYENHRVATTGEWDKLTQDKEFNKNSKIRMIEVML 540
           HG +A YNDIQ W+HL LLP FGAK+YE  R++T G W +LTQD EFN++SKIR+IE++L
Sbjct: 481 HGPEAQYNDIQPWNHLQLLPDFGAKNYEAVRISTVGGWSQLTQDPEFNESSKIRLIELIL 540

Query: 541 PVMDAPTSLIEQAKLTASINAKQ 563
           P +D+  +L++QAK+   IN+K+
Sbjct: 541 PRLDSTDALVKQAKMITDINSKR 563

>SAKL0E04972g Chr5 (403578..405413) [1836 bp, 611 aa] {ON} similar
           to uniprot|Q07471 Saccharomyces cerevisiae YDL080C THI3
           Probable decarboxylase required for expression of
           enzymes involved in thiamine biosynthesis may have a
           role in catabolism of amino acids to long-chain and
           complex alcohols
          Length = 611

 Score =  757 bits (1955), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 344/550 (62%), Positives = 441/550 (80%), Gaps = 1/550 (0%)

Query: 4   ITLGRYLFERLNQVDVKTIFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADGYAR 63
           I+LG YLF+RL Q+ V+TIFGLPGDFN++LLDKIYEV G+RWAGN NELNAAYAADGYAR
Sbjct: 14  ISLGHYLFQRLRQLQVQTIFGLPGDFNMALLDKIYEVPGLRWAGNTNELNAAYAADGYAR 73

Query: 64  IKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNGDFT 123
           IKG+ C++TTFGVGELSA+NGIAGS+AEHV VLHVVG+P+  +Q K+LLLHHTLGNGD+ 
Sbjct: 74  IKGLGCLVTTFGVGELSAINGIAGSFAEHVAVLHVVGMPASHAQVKKLLLHHTLGNGDYA 133

Query: 124 VFHRMSANISETTAMVTDIATAPAEIDRCIRTTYITQRPVYLGLPANLVDLKVPAKLLET 183
           VFHRM+AN++  T +++D  TA  EID+C++  +  QRPVYLG+P NL ++ V   +L+ 
Sbjct: 134 VFHRMAANMAAYTTVLSDSETATKEIDKCLKIAWKRQRPVYLGIPMNLANMIVDGSMLQI 193

Query: 184 PIDLSLKPNDPEAETEVVDTVLELIKAAKNPVILADACASRHDVKAETKKLIDATQFPSF 243
           P+DLSLK NDPE E +VV+++++ +K AKNPVI+ADAC +RHDV  ET++L+D TQFP F
Sbjct: 194 PLDLSLKRNDPEVEKDVVNSIVQEMKRAKNPVIIADACVTRHDVIQETRRLVDLTQFPVF 253

Query: 244 VTPMGKGSIDEQHPRFGGVYVGTLSRPEVKEAVESADLILSVGALLSDFNTGSFSYSYKT 303
           VTPMGKG+IDEQHPRFGGVYVG++S PEV+E V+ AD IL  G +LSDFNT SF++SYK 
Sbjct: 254 VTPMGKGAIDEQHPRFGGVYVGSMSSPEVREVVDFADFILVAGTVLSDFNTSSFNFSYKA 313

Query: 304 KNIVEFHSDYIKIRNATFPGVQMKFALQKLLNAVPEAIKGYKPVPVPARVPENKSCDPAT 363
           KN+V  ++++ K++NA +P +++KF LQ LL ++      YKP PVP  +    +     
Sbjct: 314 KNVVLLYANHAKLKNAMYPDMKLKFVLQSLLQSLSNITLPYKPQPVPEMIKPRVTLQDNV 373

Query: 364 PLKQEWMWNQVSKFLQEGDVVITETGTSAFGINQTPFPNNAYGISQVLWGSIGFTTGACL 423
           PL+QEW+WNQ+S +  EGD+VITETGTSAFGINQT FPNN   ISQVLWGSIG++ GACL
Sbjct: 374 PLRQEWVWNQISHWFHEGDIVITETGTSAFGINQTRFPNNTRAISQVLWGSIGYSLGACL 433

Query: 424 GAAFAAEEIDPKKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNDGYTIERLIH-G 482
           GA+FA EE+  K RVILF+GDG+LQLTVQEISTMIRWGLKPYLFV+NN GYTI+RL+H  
Sbjct: 434 GASFAVEELGTKNRVILFVGDGALQLTVQEISTMIRWGLKPYLFVMNNKGYTIDRLLHKS 493

Query: 483 EKAGYNDIQNWDHLALLPTFGAKDYENHRVATTGEWDKLTQDKEFNKNSKIRMIEVMLPV 542
             AGY+DIQ WD+L LLP FGA +Y+  +V T G++ KL  D +F  + K++MIEV+LP 
Sbjct: 494 STAGYHDIQPWDNLKLLPAFGAVNYDARKVTTVGDFLKLVHDPQFAIDDKLKMIEVVLPS 553

Query: 543 MDAPTSLIEQ 552
           MDAP +L+ +
Sbjct: 554 MDAPPALLNK 563

>ZYRO0A08426g Chr1 complement(675104..676858) [1755 bp, 584 aa] {ON}
           similar to uniprot|Q07471 Saccharomyces cerevisiae
           YDL080C THI3 Probable decarboxylase required for
           expression of enzymes involved in thiamine biosynthesis
           may have a role in catabolism of amino acids to
           long-chain and complex alcohols
          Length = 584

 Score =  652 bits (1682), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 297/549 (54%), Positives = 397/549 (72%), Gaps = 1/549 (0%)

Query: 4   ITLGRYLFERLNQVDVKTIFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADGYAR 63
           IT+  Y F RL Q++V TIFGLPG+FN  L+DK+Y +EG+RWAGN NELNAAYAADGYAR
Sbjct: 12  ITIADYFFHRLKQLEVLTIFGLPGEFNAPLIDKLYGIEGLRWAGNTNELNAAYAADGYAR 71

Query: 64  IKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNGDFT 123
           +KG+ CII+TFGVGELSA+NGIAGSYAEHVG+LHVVG+P  S+Q +QLLLHHTLGNGD+T
Sbjct: 72  LKGLGCIISTFGVGELSAINGIAGSYAEHVGLLHVVGMPPTSAQTRQLLLHHTLGNGDYT 131

Query: 124 VFHRMSANISETTAMVTDIATAPAEIDRCIRTTYITQRPVYLGLPANLVDLKVPAKLLET 183
           VFHRM+  +S  +A++ D      E+D CIR  YI QRPVY+G+P NLV + V +  L  
Sbjct: 132 VFHRMATEVSCHSAVIIDTELCAQEVDECIRNAYIFQRPVYMGIPVNLVSMPVDSDRLNE 191

Query: 184 PIDLSLKPNDPEAETEVVDTVLELIKAAKNPVILADACASRHDVKAETKKLIDATQFPSF 243
           PIDLS+ PND   E EV+D +L     A NPVI+ADAC +RH ++AET++L   T+FP F
Sbjct: 192 PIDLSVPPNDTSKENEVIDQILTHFYKATNPVIVADACVTRHRIEAETEELCRRTKFPLF 251

Query: 244 VTPMGKGSIDEQHPRFGGVYVGTLSRPEVKEAVESADLILSVGALLSDFNTGSFSYSYKT 303
           VTPMGKGS+DE  P+FGGVY G++S P V+E V+ AD ++ +G +L+DF T +F ++Y+ 
Sbjct: 252 VTPMGKGSVDEGLPQFGGVYTGSISSPSVREVVDFADCLIVIGCMLADFETTTFHFNYRA 311

Query: 304 KNIVEFHSDYIKIRNATFPGVQMKFALQKLLNAVPEAIKGYKPVPVPARVPENKSCDPAT 363
             +V  +   +K ++AT+P + +K  L  LL  + E    Y+  P P  V          
Sbjct: 312 NELVLLYPTSVKFKHATYPDLSIKPLLHSLLANLQERQLSYQWQPRPRMVIPKLELPTTH 371

Query: 364 PLKQEWMWNQVSKFLQEGDVVITETGTSAFGINQTPFPNNAYGISQVLWGSIGFTTGACL 423
           PL+QEW+WNQ+S++  EGDV+ITETGTSAFGINQT FP +  GISQ LWGS+G++ GACL
Sbjct: 372 PLRQEWVWNQISQWFMEGDVIITETGTSAFGINQTNFPPHTLGISQALWGSVGYSLGACL 431

Query: 424 GAAFAAEEIDPKKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNDGYTIERLIHGE 483
           GAA A +E     RV+LF+GDG+ QLT QE+ST+IRWGL PY+F++NN GY+++R +H  
Sbjct: 432 GAAMAVDEKPRTHRVVLFVGDGAFQLTAQELSTVIRWGLTPYIFIMNNQGYSVDRFLHS- 490

Query: 484 KAGYNDIQNWDHLALLPTFGAKDYENHRVATTGEWDKLTQDKEFNKNSKIRMIEVMLPVM 543
            A Y DIQ W++  L   FGAKDYE+ ++ T G++  +  D  F+   +IR++E+MLP M
Sbjct: 491 NASYYDIQQWNYSTLPSVFGAKDYESRKIITVGDFQSMVNDPAFSVGDRIRILEIMLPPM 550

Query: 544 DAPTSLIEQ 552
           D P +L E+
Sbjct: 551 DVPQALREK 559

>KLTH0E09702g Chr5 (874177..876000) [1824 bp, 607 aa] {ON} similar
           to uniprot|Q07471 Saccharomyces cerevisiae YDL080C THI3
           Probable decarboxylase required for expression of
           enzymes involved in thiamine biosynthesis may have a
           role in catabolism of amino acids to long-chain and
           complex alcohols
          Length = 607

 Score =  652 bits (1683), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 295/551 (53%), Positives = 409/551 (74%), Gaps = 1/551 (0%)

Query: 3   EITLGRYLFERLNQVDVKTIFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADGYA 62
           EI L +Y+  RL Q+ + TIFG+PG FN+ LL +I  V  M+WAGN NELNAAYAADGY+
Sbjct: 14  EIPLAQYMLHRLRQLGIATIFGVPGGFNVPLLREICNVPQMKWAGNTNELNAAYAADGYS 73

Query: 63  RIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNGDF 122
           RIK ++C++TTFGVGELSA+NG+AGS+AEHVG+LH VG+P +++Q ++LLLHHTLGNG++
Sbjct: 74  RIKHLACLVTTFGVGELSAVNGVAGSFAEHVGLLHFVGMPPLAAQRRRLLLHHTLGNGNY 133

Query: 123 TVFHRMSANISETTAMVTDIATAPAEIDRCIRTTYITQRPVYLGLPANLVDLKVPAKLLE 182
            VFHR+ +++++ T+++TD  T   E+D+CI   +  QRPVYLG+P N+ D  V + LL 
Sbjct: 134 KVFHRLGSDVTQYTSVLTDTETCSKEVDKCISIAFTKQRPVYLGVPTNISDTLVSSALLN 193

Query: 183 TPIDLSLKPNDPEAETEVVDTVLELIKAAKNPVILADACASRHDVKAETKKLIDATQFPS 242
            P+DLS    + E + + V+ +L  +   ++P I+ DAC SRH+V AE ++L++ TQFP 
Sbjct: 194 IPLDLSAHEGNTEVQEDFVNAILSAMYKCRSPAIVVDACVSRHNVVAEVRQLVELTQFPV 253

Query: 243 FVTPMGKGSIDEQHPRFGGVYVGTLSRPEVKEAVESADLILSVGALLSDFNTGSFSYSYK 302
           F TPMGKG+I+E HPRFGG +VG++S P+V+E V+ +D +L VGALLSDFN+ SF ++YK
Sbjct: 254 FCTPMGKGAINEHHPRFGGTFVGSISPPQVREVVDFSDFVLVVGALLSDFNSSSFHFAYK 313

Query: 303 TKNIVEFHSDYIKIRNATFPGVQMKFALQKLLNAVPEAIKGYKPVPVPARVPENKSCDPA 362
            KN     S Y +++NA +P +++K AL+ LL  +  +   Y+P  VP  +         
Sbjct: 314 AKNTALLFSSYARLKNAMYPDLELKTALRVLLTKLDPSKLRYRPEEVPEVIRPKIKLMSN 373

Query: 363 TPLKQEWMWNQVSKFLQEGDVVITETGTSAFGINQTPFPNNAYGISQVLWGSIGFTTGAC 422
            PL+QEW+WNQ+S + +EGD+VITETGTSAFG+NQ+ FPNN   I+Q LWGS+G++ GAC
Sbjct: 374 VPLRQEWVWNQISNWFREGDIVITETGTSAFGVNQSKFPNNTRCITQALWGSVGYSVGAC 433

Query: 423 LGAAFAAEEIDPKKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNDGYTIERLIHG 482
           LGA+FAA E     RVILF+GDG+LQLTVQE+STMIRWGLKP +FV+NN GYTI+RL+H 
Sbjct: 434 LGASFAAREEGNNSRVILFVGDGALQLTVQELSTMIRWGLKPIIFVMNNSGYTIDRLLHR 493

Query: 483 E-KAGYNDIQNWDHLALLPTFGAKDYENHRVATTGEWDKLTQDKEFNKNSKIRMIEVMLP 541
           +  AGY+DIQ WD+L LLP FGA DY+   V T G++  L  D  F  N+KI+M+EV+LP
Sbjct: 494 KSNAGYHDIQAWDNLKLLPLFGALDYDTRVVKTVGDFLGLVSDPGFALNNKIKMVEVVLP 553

Query: 542 VMDAPTSLIEQ 552
            MDAP +L+++
Sbjct: 554 PMDAPPALMDK 564

>Suva_4.167 Chr4 complement(300197..302059) [1863 bp, 620 aa] {ON}
           YDL080C (REAL)
          Length = 620

 Score =  650 bits (1677), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 291/556 (52%), Positives = 406/556 (73%), Gaps = 7/556 (1%)

Query: 4   ITLGRYLFERLNQVDVKTIFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADGYAR 63
           I +  YLF RLNQ+++ TIFGL G+F++ LLDK+Y++  +RWAGN+NELNAAYAADGY+R
Sbjct: 15  IAISDYLFHRLNQLNIHTIFGLSGEFSMPLLDKLYDIPNLRWAGNSNELNAAYAADGYSR 74

Query: 64  IKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNGDFT 123
           +KG+ C+ITTFGVGELSA+NG+AGSYAEHVG+LH+VG+P  S+Q KQLLLHHTLGNGDFT
Sbjct: 75  LKGLGCLITTFGVGELSAINGVAGSYAEHVGILHIVGMPPTSAQTKQLLLHHTLGNGDFT 134

Query: 124 VFHRMSANISETTAMVTDIATAPAEIDRCIRTTYITQRPVYLGLPANLVDLKVPAKLLET 183
           VFHR++++++  T ++ D      E+D+CI+  +I QRPVY+G+P N V+L + ++ L T
Sbjct: 135 VFHRIASDVACYTTLIVDSDLCADEVDKCIQKAWIEQRPVYMGMPVNQVNLPIESERLNT 194

Query: 184 PIDLSLKPNDPEAETEVVDTVLELIKAAKNPVILADACASRHDVKAETKKLIDATQFPSF 243
           P+DL L  NDP+ E EV+  +L  I  +KNP I+ DAC SR ++  E K+L    +FP F
Sbjct: 195 PLDLQLHKNDPDVEKEVITRILSFIYKSKNPAIIVDACTSRQNLIEEAKELCSRLKFPIF 254

Query: 244 VTPMGKGSIDEQHPRFGGVYVGTLSRPEVKEAVESADLILSVGALLSDFNTGSFSYSYKT 303
           VTPMGKG+++E  P+FGGV+ G++S PEV+E V+ AD I+ +G +LS+F+T +F + YKT
Sbjct: 255 VTPMGKGTVNETDPQFGGVFTGSISAPEVREVVDFADFIIVIGCMLSEFSTSTFHFQYKT 314

Query: 304 KNIVEFHSDYIKIRNATFPGVQMKFALQKLLNAVPEAIKGYKPVPVPARVPENKSCDPAT 363
           KN    +S  +K++NAT+P + +K  LQKLL  + E+   Y+P   P+ +          
Sbjct: 315 KNCALLYSTSVKLKNATYPDLSVKILLQKLLATLDESKLSYRPDEQPSMMVPRPYPAGNV 374

Query: 364 PLKQEWMWNQVSKFLQEGDVVITETGTSAFGINQTPFPNNAYGISQVLWGSIGFTTGACL 423
            L+QEW+WN++S++ Q GD++ITETG SAFG+NQT FP N  GISQ LWGS+G+T GACL
Sbjct: 375 LLRQEWVWNEISRWFQPGDIIITETGASAFGVNQTRFPVNTLGISQALWGSVGYTMGACL 434

Query: 424 GAAFAAEEIDP------KKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNDGYTIE 477
           GA FA +EI+       K RVILF+GDG+ QLTVQE+ST+++WGL PY+FV+NN GY+++
Sbjct: 435 GAEFAVQEINKDKFPATKHRVILFMGDGAFQLTVQELSTIVKWGLTPYIFVMNNQGYSVD 494

Query: 478 RLIHGEK-AGYNDIQNWDHLALLPTFGAKDYENHRVATTGEWDKLTQDKEFNKNSKIRMI 536
           R +H    A Y DIQ W++L LL  FG  +YE  ++ T GE+  +  D  F  N KIRMI
Sbjct: 495 RFLHHRSDASYYDIQPWNYLGLLRVFGCTNYETKKIITVGEFRSMINDANFAVNDKIRMI 554

Query: 537 EVMLPVMDAPTSLIEQ 552
           E+MLP  D P +L+++
Sbjct: 555 EIMLPPRDVPQALLDR 570

>YDL080C Chr4 complement(310642..312471) [1830 bp, 609 aa] {ON}
           THI3Probable alpha-ketoisocaproate decarboxylase, may
           have a role in catabolism of amino acids to long-chain
           and complex alcohols; required for expression of enzymes
           involved in thiamine biosynthesis
          Length = 609

 Score =  649 bits (1675), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 290/556 (52%), Positives = 405/556 (72%), Gaps = 7/556 (1%)

Query: 4   ITLGRYLFERLNQVDVKTIFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADGYAR 63
           I +  YLF RLNQ+++ TIFGL G+F++ LLDK+Y +  +RWAGN+NELNAAYAADGY+R
Sbjct: 15  IAISDYLFHRLNQLNIHTIFGLSGEFSMPLLDKLYNIPNLRWAGNSNELNAAYAADGYSR 74

Query: 64  IKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNGDFT 123
           +KG+ C+ITTFGVGELSA+NG+AGSYAEHVG+LH+VG+P  S+Q KQLLLHHTLGNGDFT
Sbjct: 75  LKGLGCLITTFGVGELSAINGVAGSYAEHVGILHIVGMPPTSAQTKQLLLHHTLGNGDFT 134

Query: 124 VFHRMSANISETTAMVTDIATAPAEIDRCIRTTYITQRPVYLGLPANLVDLKVPAKLLET 183
           VFHR++++++  T ++ D      E+D+CI+  +I QRPVY+G+P N V+L + +  L T
Sbjct: 135 VFHRIASDVACYTTLIIDSELCADEVDKCIKKAWIEQRPVYMGMPVNQVNLPIESARLNT 194

Query: 184 PIDLSLKPNDPEAETEVVDTVLELIKAAKNPVILADACASRHDVKAETKKLIDATQFPSF 243
           P+DL L  NDP+ E EV+  +L  I  ++NP I+ DAC SR ++  ETK+L +  +FP F
Sbjct: 195 PLDLQLHKNDPDVEKEVISRILSFIYKSQNPAIIVDACTSRQNLIEETKELCNRLKFPVF 254

Query: 244 VTPMGKGSIDEQHPRFGGVYVGTLSRPEVKEAVESADLILSVGALLSDFNTGSFSYSYKT 303
           VTPMGKG+++E  P+FGGV+ G++S PEV+E V+ AD I+ +G +LS+F+T +F + YKT
Sbjct: 255 VTPMGKGTVNETDPQFGGVFTGSISAPEVREVVDFADFIIVIGCMLSEFSTSTFHFQYKT 314

Query: 304 KNIVEFHSDYIKIRNATFPGVQMKFALQKLLNAVPEAIKGYKPVPVPARVPENKSCDPAT 363
           KN    +S  +K++NAT+P + +K  LQK+L  + E+   Y+P   P+ +          
Sbjct: 315 KNCALLYSTSVKLKNATYPDLSIKLLLQKILANLDESKLSYQPSEQPSMMVPRPYPAGNV 374

Query: 364 PLKQEWMWNQVSKFLQEGDVVITETGTSAFGINQTPFPNNAYGISQVLWGSIGFTTGACL 423
            L+QEW+WN++S + Q GD++ITETG SAFG+NQT FP N  GISQ LWGS+G+T GACL
Sbjct: 375 LLRQEWVWNEISHWFQPGDIIITETGASAFGVNQTRFPVNTLGISQALWGSVGYTMGACL 434

Query: 424 GAAFAAEEIDP------KKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNDGYTIE 477
           GA FA +EI+       K RVILF+GDG+ QLTVQE+ST+++WGL PY+FV+NN GY+++
Sbjct: 435 GAEFAVQEINKDKFPATKHRVILFMGDGAFQLTVQELSTIVKWGLTPYIFVMNNQGYSVD 494

Query: 478 RLIHGEK-AGYNDIQNWDHLALLPTFGAKDYENHRVATTGEWDKLTQDKEFNKNSKIRMI 536
           R +H    A Y DIQ W++L LL  FG  +YE  ++ T GE+  +  D  F  N KIRMI
Sbjct: 495 RFLHHRSDASYYDIQPWNYLGLLRVFGCTNYETKKIITVGEFRSMISDPNFATNDKIRMI 554

Query: 537 EVMLPVMDAPTSLIEQ 552
           E+MLP  D P +L+++
Sbjct: 555 EIMLPPRDVPQALLDR 570

>Kwal_47.17878 s47 (590664..592496) [1833 bp, 610 aa] {ON} YDL080C
           (THI3) - alpha-ketoisocaproate decarboxylase [contig
           204] FULL
          Length = 610

 Score =  648 bits (1671), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 295/551 (53%), Positives = 403/551 (73%), Gaps = 1/551 (0%)

Query: 3   EITLGRYLFERLNQVDVKTIFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADGYA 62
           +ITL ++L  RL Q+ + TIF +PG F++  + +IY+   M+WAGN NELNAAYAADGY+
Sbjct: 14  DITLAQFLVHRLRQLGITTIFAVPGGFSMPFIMQIYQTPQMQWAGNTNELNAAYAADGYS 73

Query: 63  RIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNGDF 122
           RIK + C+ TTFGVGELSA+NG+AG++AEHVG+LHVVG+P +++Q KQLL HHTLGNGD+
Sbjct: 74  RIKRLGCLATTFGVGELSAVNGVAGAFAEHVGLLHVVGMPPVAAQVKQLLWHHTLGNGDY 133

Query: 123 TVFHRMSANISETTAMVTDIATAPAEIDRCIRTTYITQRPVYLGLPANLVDLKVPAKLLE 182
            VFHR+ +++++   ++ D      E+D+CI      QRPVYLG+P N+ ++ V + LL 
Sbjct: 134 QVFHRLGSDVAQYATVLRDAEACAQEVDKCIIIALTKQRPVYLGVPVNMNNVLVSSVLLN 193

Query: 183 TPIDLSLKPNDPEAETEVVDTVLELIKAAKNPVILADACASRHDVKAETKKLIDATQFPS 242
            P+DL     +P+ E   V+TVL  I    NP I+ADAC SRH+V+AE K L+D TQFP 
Sbjct: 194 VPLDLEPHATNPDTERRFVNTVLNAIYKCSNPAIIADACVSRHEVEAELKHLVDLTQFPV 253

Query: 243 FVTPMGKGSIDEQHPRFGGVYVGTLSRPEVKEAVESADLILSVGALLSDFNTGSFSYSYK 302
           F TPMGKGSIDEQHPRFGG +VG++S P+V+E V+ +D +L VGALLS+FNT SF ++Y+
Sbjct: 254 FCTPMGKGSIDEQHPRFGGTFVGSISSPQVREVVDFSDFVLVVGALLSEFNTSSFHFAYR 313

Query: 303 TKNIVEFHSDYIKIRNATFPGVQMKFALQKLLNAVPEAIKGYKPVPVPARVPENKSCDPA 362
           TKN V   SDY K++NA +P + +K  L+ +L  +  +   Y+P  VP  +         
Sbjct: 314 TKNSVLLFSDYAKLKNAIYPDLNLKTVLRAILAKLDPSKITYRPEQVPDVIKPRIKLMSN 373

Query: 363 TPLKQEWMWNQVSKFLQEGDVVITETGTSAFGINQTPFPNNAYGISQVLWGSIGFTTGAC 422
            PL+QEW+W Q+S++ +EGD+VITETGTSAFG+NQ  FP++   I+Q LWGS+G++ GAC
Sbjct: 374 VPLRQEWVWGQISRWFREGDIVITETGTSAFGVNQAKFPSHTRCIAQALWGSVGYSVGAC 433

Query: 423 LGAAFAAEEIDPKKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNDGYTIERLIHG 482
           LGA+FAA E     RVILF+GDG+LQLTVQEISTMIRWGL P +F++NN GYTI+RL+H 
Sbjct: 434 LGASFAAREEGCNSRVILFVGDGALQLTVQEISTMIRWGLTPIIFLMNNSGYTIDRLLHK 493

Query: 483 EK-AGYNDIQNWDHLALLPTFGAKDYENHRVATTGEWDKLTQDKEFNKNSKIRMIEVMLP 541
           +  A Y+DIQ WD+L +LPTFGA +YE   V T G++  L  D +F  N KI+M+EV+LP
Sbjct: 494 KSNAAYHDIQTWDNLRILPTFGALNYEARAVRTVGDFLHLIHDTQFAVNDKIKMVEVVLP 553

Query: 542 VMDAPTSLIEQ 552
            MDAP +L+++
Sbjct: 554 PMDAPPALMDK 564

>TDEL0G03210 Chr7 complement(597217..599037) [1821 bp, 606 aa] {ON}
           Anc_2.390 YDL080C
          Length = 606

 Score =  639 bits (1648), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 294/567 (51%), Positives = 406/567 (71%), Gaps = 8/567 (1%)

Query: 4   ITLGRYLFERLNQVDVKTIFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADGYAR 63
           I++  YLF RL Q+ ++TIFGLPG FN +LLDK+ E+ G+RWAGN NELNAAYAADGY+R
Sbjct: 13  ISIAEYLFHRLKQLHIETIFGLPGAFNATLLDKLNEIPGLRWAGNTNELNAAYAADGYSR 72

Query: 64  IKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNGDFT 123
           +KG+ CIITTFGVGELSA+NG+AGS+AEHVG+LHVVG+P  S+Q KQLLLHHTLGNGD+ 
Sbjct: 73  LKGLGCIITTFGVGELSAINGVAGSFAEHVGLLHVVGMPPTSAQTKQLLLHHTLGNGDYK 132

Query: 124 VFHRMSANISETTAMVTDIATAPAEIDRCIRTTYITQRPVYLGLPANLVDLKVPAKLLET 183
           VFHRM++ ++  + ++ D      E+D CI   +  Q+PVY+G+P NLVD  V ++ L T
Sbjct: 133 VFHRMASEVTCYSTVINDKDLCGDEVDDCIAKAWTLQKPVYMGIPVNLVDTSVNSQRLNT 192

Query: 184 PIDLSLKPNDPEAETEVVDTVLELIKAAKNPVILADACASRHDVKAETKKLIDATQFPSF 243
            ++L+L  ND + E E+V  +L+ +  +KNPVI+ADAC +RH +  ET +L   T FP F
Sbjct: 193 ALNLNLPSNDEQTENELVKQILQQLYKSKNPVIIADACVTRHRIVPETVELCQRTNFPIF 252

Query: 244 VTPMGKGSIDEQHPRFGGVYVGTLSRPEVKEAVESADLILSVGALLSDFNTGSFSYSYKT 303
            TPM KG+IDE  P FGGV++G++S PEV+E V  AD ++ +G +LSDF+T SF ++YKT
Sbjct: 253 ATPMSKGAIDETLPNFGGVFMGSISSPEVREVVNFADFLIVIGCMLSDFSTSSFHFNYKT 312

Query: 304 KNIVEFHSDYIKIRNATFPGVQMKFALQKLLNAVPEAIKGYKPVPVPARVPENKSCDPAT 363
           K  V  +   +K ++A +P +++K  +  LL  + E+   Y+  P P  +          
Sbjct: 313 KECVLLYPTSVKFKHAIYPDLRIKSLMANLLRNLNESKIKYQSQPTPQMIIPRSELPSRH 372

Query: 364 PLKQEWMWNQVSKFLQEGDVVITETGTSAFGINQTPFPNNAYGISQVLWGSIGFTTGACL 423
            L+ EW+WNQ+S + QEGD++ITETGTSAFGINQT FP+++ GISQ LWGS+G+T GACL
Sbjct: 373 SLRHEWVWNQMSHWFQEGDIIITETGTSAFGINQTHFPHSSRGISQALWGSVGYTLGACL 432

Query: 424 GAAFAAEEIDPKK------RVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNDGYTIE 477
           GA+FAA E+   +      RVILF+GDG+ QLTVQE+STMIRWGL PY+FV+NN GY+++
Sbjct: 433 GASFAANEMARDQVTAVPHRVILFVGDGAFQLTVQEVSTMIRWGLTPYIFVMNNQGYSVD 492

Query: 478 RLIHGE-KAGYNDIQNWDHLALLPTFGAKDYENHRVATTGEWDKLTQDKEFNKNSKIRMI 536
           R +H    A Y DIQ W++L L+P FGA+ YE  ++ T G++ ++  D  F  N KIRM+
Sbjct: 493 RFLHHRSNASYYDIQTWEYLRLIPLFGARHYETRKIVTVGDFLEMIHDPLFATNDKIRML 552

Query: 537 EVMLPVMDAPTSLIEQAKLTASINAKQ 563
           E+MLP MD P +L+++  LT   N K+
Sbjct: 553 EIMLPPMDVPQALMDRW-LTEQENKKR 578

>Skud_4.175 Chr4 complement(306124..307986) [1863 bp, 620 aa] {ON}
           YDL080C (REAL)
          Length = 620

 Score =  634 bits (1634), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 291/556 (52%), Positives = 407/556 (73%), Gaps = 7/556 (1%)

Query: 4   ITLGRYLFERLNQVDVKTIFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADGYAR 63
           I +  YLF RLNQ+++ TIFGL G+F++ LLDK+Y++  +RWAGN+NELNAAYAADGY+R
Sbjct: 15  IAISDYLFHRLNQLNIHTIFGLSGEFSMPLLDKLYDIPNLRWAGNSNELNAAYAADGYSR 74

Query: 64  IKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNGDFT 123
           +KG+ C+ITTFGVGELSA+NG+AGSYAEHVG+LH+VG+P  S+Q KQLLLHHTLGNGDFT
Sbjct: 75  LKGLGCLITTFGVGELSAINGVAGSYAEHVGILHIVGMPPTSAQTKQLLLHHTLGNGDFT 134

Query: 124 VFHRMSANISETTAMVTDIATAPAEIDRCIRTTYITQRPVYLGLPANLVDLKVPAKLLET 183
           VFHR++++++  T ++ D      E+D+CI+  +I QRPVY+G+P N V+L + +  L T
Sbjct: 135 VFHRIASDVACYTTLIVDSELCADEVDKCIKMAWIEQRPVYMGMPVNQVNLPIESARLNT 194

Query: 184 PIDLSLKPNDPEAETEVVDTVLELIKAAKNPVILADACASRHDVKAETKKLIDATQFPSF 243
           P+DL L  NDP+ E EV+  +L ++  ++NP I+ DAC SR ++  ETK+L    +FP F
Sbjct: 195 PLDLQLHKNDPDVEKEVITRILSIMYKSQNPAIIVDACTSRQNLIEETKELCSRLKFPIF 254

Query: 244 VTPMGKGSIDEQHPRFGGVYVGTLSRPEVKEAVESADLILSVGALLSDFNTGSFSYSYKT 303
           VTPMGKG+++E  P+FGGV+ G++S PEV+E V+ AD I+ +G +LS+F+T +F + YKT
Sbjct: 255 VTPMGKGTVNETDPQFGGVFTGSISAPEVREVVDFADFIIVIGCMLSEFSTSTFHFQYKT 314

Query: 304 KNIVEFHSDYIKIRNATFPGVQMKFALQKLLNAVPEAIKGYKPVPVPARVPENKSCDPAT 363
           KN    +S  +K++NAT+P + +K  LQKLL ++ E+   Y+P   P  +          
Sbjct: 315 KNCALLYSTSVKLKNATYPDLSVKLLLQKLLASLDESKLSYRPSEQPNMMVPRPYPAGNV 374

Query: 364 PLKQEWMWNQVSKFLQEGDVVITETGTSAFGINQTPFPNNAYGISQVLWGSIGFTTGACL 423
            L+QEW+WN++S++ Q GD++ITETG SAFG+NQT FP N  GISQ LWGS+G+T GACL
Sbjct: 375 LLRQEWVWNEISRWFQPGDIIITETGASAFGVNQTRFPVNTLGISQALWGSVGYTMGACL 434

Query: 424 GAAFAAEEIDP------KKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNDGYTIE 477
           GA FA +EI+       K RVILF+GDG+ QLTVQE+ST+++WGL PY+FV+NN GY+++
Sbjct: 435 GAEFAVQEINKNEFPPTKHRVILFMGDGAFQLTVQELSTIVKWGLTPYIFVMNNQGYSVD 494

Query: 478 RLIHGEK-AGYNDIQNWDHLALLPTFGAKDYENHRVATTGEWDKLTQDKEFNKNSKIRMI 536
           R +H    A Y DIQ W++L LL  FG  +YE  ++ T GE+  L  D  F  N KIRMI
Sbjct: 495 RFLHHRSDASYYDIQPWNYLGLLRVFGCANYETKKIITVGEFRSLINDPNFAINDKIRMI 554

Query: 537 EVMLPVMDAPTSLIEQ 552
           E+MLP  D P +L+++
Sbjct: 555 EIMLPPRDVPQALLDR 570

>Smik_4.156 Chr4 complement(287087..288952) [1866 bp, 621 aa] {ON}
           YDL080C (REAL)
          Length = 621

 Score =  632 bits (1629), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 291/556 (52%), Positives = 405/556 (72%), Gaps = 7/556 (1%)

Query: 4   ITLGRYLFERLNQVDVKTIFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADGYAR 63
           I++  YLF RLNQ+++ TIFGL G+F++ LLDK+Y +  +RWAGN+NELNAAYAADGY+R
Sbjct: 15  ISISDYLFHRLNQLNIHTIFGLSGEFSMPLLDKLYNIPNLRWAGNSNELNAAYAADGYSR 74

Query: 64  IKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNGDFT 123
           +KG+ C+ITTFGVGELSA+NG+AGSYAEHVG+LH+VG+P  S+Q KQLLLHHTLGNGDFT
Sbjct: 75  LKGLGCLITTFGVGELSAINGVAGSYAEHVGILHIVGMPPTSAQTKQLLLHHTLGNGDFT 134

Query: 124 VFHRMSANISETTAMVTDIATAPAEIDRCIRTTYITQRPVYLGLPANLVDLKVPAKLLET 183
           VFHR++++++  T ++ D      E+D+CIR  +I QRPVY+G+P N V+L + +  L T
Sbjct: 135 VFHRIASDVACYTTLIVDSELCADEVDKCIRKAWIEQRPVYMGMPVNQVNLPIESARLNT 194

Query: 184 PIDLSLKPNDPEAETEVVDTVLELIKAAKNPVILADACASRHDVKAETKKLIDATQFPSF 243
           P+DL L  NDP+ E EV+  +L  +  ++NP I+ DAC SR ++  E+K+L    +FP F
Sbjct: 195 PLDLQLPKNDPDVEKEVISRILSFMYKSQNPAIIVDACTSRQNLIEESKELCSRLKFPVF 254

Query: 244 VTPMGKGSIDEQHPRFGGVYVGTLSRPEVKEAVESADLILSVGALLSDFNTGSFSYSYKT 303
           VTPMGKG+++E  P+FGGV+ G++S PEV+E V+ AD I+ +G +LS+F+T +F + YKT
Sbjct: 255 VTPMGKGTVNETIPQFGGVFTGSISAPEVREVVDFADFIIVIGCMLSEFSTSTFHFQYKT 314

Query: 304 KNIVEFHSDYIKIRNATFPGVQMKFALQKLLNAVPEAIKGYKPVPVPARVPENKSCDPAT 363
           KN    +S  +K++NAT+P + +K  LQKLL ++ E+   Y+P   P+ +          
Sbjct: 315 KNCALLYSTSVKLKNATYPDLSIKLLLQKLLASLDESKLSYRPNEQPSMMVPRPYPAGNV 374

Query: 364 PLKQEWMWNQVSKFLQEGDVVITETGTSAFGINQTPFPNNAYGISQVLWGSIGFTTGACL 423
            L+QEW+WN++S + Q GD++ITETG SAFG+NQT FP N  GISQ LWGS+G+T GACL
Sbjct: 375 LLRQEWVWNEISHWFQPGDIIITETGASAFGVNQTRFPVNTLGISQALWGSVGYTMGACL 434

Query: 424 GAAFAAEEIDP------KKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNDGYTIE 477
           GA FA +EI        K RVILF+GDG+ QLTVQE+ST+++WGL PY+FV+NN GY+++
Sbjct: 435 GAEFAVQEIKKDKFPVTKHRVILFMGDGAFQLTVQELSTIVKWGLTPYIFVMNNQGYSVD 494

Query: 478 RLIHGEK-AGYNDIQNWDHLALLPTFGAKDYENHRVATTGEWDKLTQDKEFNKNSKIRMI 536
           R +H    A Y DIQ W++L LL  FG  +YE  ++ T GE+  +  D EF  N KIRMI
Sbjct: 495 RFLHHRSDASYYDIQPWNYLGLLRVFGCTNYETKKIITVGEFRSMIDDPEFAINDKIRMI 554

Query: 537 EVMLPVMDAPTSLIEQ 552
           E+MLP  D P  L+++
Sbjct: 555 EIMLPPRDVPQVLLDR 570

>TPHA0G02620 Chr7 complement(547384..549450) [2067 bp, 688 aa] {ON}
           Anc_2.390 YDL080C
          Length = 688

 Score =  626 bits (1614), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 298/593 (50%), Positives = 411/593 (69%), Gaps = 43/593 (7%)

Query: 3   EITLGRYLFERLNQVDVKTIFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADGYA 62
           E+T+  YLF RL Q++V TIFGLPG+FN+SLLDK+Y VEGMRWAGNANELNA+YAADGY+
Sbjct: 18  ELTVSEYLFHRLKQLNVNTIFGLPGEFNMSLLDKLYNVEGMRWAGNANELNASYAADGYS 77

Query: 63  RIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNGDF 122
           R+K + C++TTFGVGELS +NGIAGS++E+VG++H+VG+P I  Q  QLL+HHTLGNGD+
Sbjct: 78  RLKKLGCLMTTFGVGELSVINGIAGSFSENVGIIHIVGMPPIQIQRSQLLMHHTLGNGDY 137

Query: 123 TVFHRMSANISETTAMVTDIATAPAEIDRCIRTTYITQRPVYLGLPANLVDLKVPAKLLE 182
            +FHR+S +I   +A+VT       EID+C+   +++Q+PVYLGLP NLV +KV + LL 
Sbjct: 138 NIFHRLSDDIYCYSAVVTHPNLCIQEIDKCLSKAWLSQKPVYLGLPENLVSVKVKSTLLN 197

Query: 183 TPIDLSLKPNDPEAETEVVDTVLELIKAAKNPVILADACASRHDVKAETKKLIDATQFPS 242
           TP+DL L  ND + E   +D +L+ I +AKNP I+ADAC +RH V+ ET+ LI+ T+FP 
Sbjct: 198 TPLDLKLPNNDKDNENIAIDQILKKIYSAKNPAIIADACVTRHSVEKETQMLIEKTKFPY 257

Query: 243 FVTPMGKGSIDEQHPRFGGVYVGTLSRPEVKEAVESADLILSVGALLSDFNTGSFSYSYK 302
           FVTPMGKG +DE   +FGGV+VG++S  +V+E V+ ADLI+ +G L SDF T SF ++YK
Sbjct: 258 FVTPMGKGGVDEYSKQFGGVFVGSISSAKVREIVDFADLIIVIGNLQSDFKTTSFHFTYK 317

Query: 303 TKNIVEFHSDYIKIRNATFPGVQMKFALQKLLNAVPEAIKGYKPVPVP-ARVPENKSCDP 361
           TK+IV   S  +K++N  +P + +K  L KL++ +      YKP+  P   +P N + + 
Sbjct: 318 TKDIVMISSSCVKLKNGLYPELHIKEFLGKLVDNIVTTKITYKPIISPIMNIPNNITSEE 377

Query: 362 A--------------------TPLKQEWMWNQVSKFLQEGDVVITETGTSAFGINQTPFP 401
           +                    T LKQEW+WN+ S + +EGD++ITETGTSAFGINQT FP
Sbjct: 378 SFESLTNYSKTPDKNDSNVNKTLLKQEWVWNEFSLWFREGDIIITETGTSAFGINQTKFP 437

Query: 402 NNAYGISQVLWGSIGFTTGACLGAAFAAEEI---DP---KKRVILFIGDGSLQLTVQEIS 455
           N   GISQ LWGS G++ GACLGA+FAAEEI   +P   K RVILF+GDG+ QLT+QE+S
Sbjct: 438 NRTIGISQTLWGSTGYSVGACLGASFAAEEIHQSNPNIEKPRVILFVGDGAFQLTMQELS 497

Query: 456 TMIRWGLKPYLFVLNNDGYTIERLIHGE----------------KAGYNDIQNWDHLALL 499
           TM++W L PY+F++NN GY+++R +  +                   Y DIQ WD+L L 
Sbjct: 498 TMVKWNLDPYIFLMNNQGYSVDRFLTHQSRRNNSNANNILKSNNNNDYFDIQLWDYLNLF 557

Query: 500 PTFGAKDYENHRVATTGEWDKLTQDKEFNKNSKIRMIEVMLPVMDAPTSLIEQ 552
             F A +YE ++V +  +  K+   K F+   +IRM+E++LP MD P SL+E+
Sbjct: 558 NLFNAMNYETYKVLSCNDLLKILNSKSFSNEHRIRMVEIILPPMDVPKSLMER 610

>KNAG0A05900 Chr1 complement(880996..882858) [1863 bp, 620 aa] {ON} 
          Length = 620

 Score =  621 bits (1602), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 291/560 (51%), Positives = 395/560 (70%), Gaps = 13/560 (2%)

Query: 3   EITLGRYLFERLNQVDVKTIFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADGYA 62
           +IT+  YLF RL Q+ VKTIFGLPG+FN+ LLDKIY +  MRWAGNANELNAAYAADGY+
Sbjct: 16  QITITDYLFHRLRQLKVKTIFGLPGEFNMPLLDKIYRIPDMRWAGNANELNAAYAADGYS 75

Query: 63  RIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNGDF 122
           RIK + C++TTFGVGELSA+NG+AGS+AEHVG+LHVVG+P  S+Q KQLLLHHTLGNGD+
Sbjct: 76  RIKRLGCLVTTFGVGELSAINGVAGSFAEHVGLLHVVGMPPTSAQTKQLLLHHTLGNGDY 135

Query: 123 TVFHRMSANISETTAMVTDIATAPAEIDRCIRTTYITQRPVYLGLPANLVDLKVPAKLLE 182
            VF+RM+ +++  T +V D      E+D+C+   +  Q+P YLG+P N VDL V +  L+
Sbjct: 136 NVFYRMANDVTCHTGLVADSDLCCMEVDKCVEMAWREQKPAYLGIPVNQVDLTVDSVRLD 195

Query: 183 TPIDLSLKPNDPEAETEVVDTVLELIKAAKNPVILADACASRHDVKAETKKLIDATQFPS 242
           TP++L  +PN+ E E +VV T+L+ +   +NP I+ DAC  RHD+  ETK+    T FP+
Sbjct: 196 TPLNLESEPNNQEIENDVVKTILKKLYTCENPAIIVDACVIRHDLVEETKQFRQMTNFPT 255

Query: 243 FVTPMGKGSIDEQHPRFGGVYVGTLSRPEVKEAVESADLILSVGALLSDFNTGSFSYSYK 302
           FVTPMGKG++DE    FGGV+ G+LS P V+E V+ AD I+ +G+LL++F+T +F + YK
Sbjct: 256 FVTPMGKGAVDESLSNFGGVFTGSLSSPSVREVVDFADFIIVIGSLLAEFSTPTFHFFYK 315

Query: 303 TKNIVEFHSDYIKIRNATFPGVQMKFALQKLLNAVPEAIKG--YKPVPVPARVPENKSCD 360
           TKN    HS  +K++NAT+P + +K  +Q LL+ +  +     ++  P P  V   K   
Sbjct: 316 TKNYALIHSSSVKLKNATYPDIHIKHLMQVLLSRLDTSKISCTFRNTP-PINVSRPKLSG 374

Query: 361 PATPLKQEWMWNQVSKFLQEGDVVITETGTSAFGINQTPFPNNAYGISQVLWGSIGFTTG 420
               LKQEW+WN++S + Q+GD++ITE GTSAFGINQT FP    GISQ LW S G++ G
Sbjct: 375 NQL-LKQEWVWNELSHWFQQGDIIITEIGTSAFGINQTRFPPRTKGISQALWASSGYSVG 433

Query: 421 ACLGAAFAAEEIDP--------KKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNND 472
           ACLGA+FAA+E+          + RV+LF+GDG+ Q+T+QEISTMIRW L PY+F+LNN 
Sbjct: 434 ACLGASFAAQELQEENPGDASLQHRVLLFVGDGAFQITMQEISTMIRWKLTPYIFLLNNQ 493

Query: 473 GYTIERLIHGE-KAGYNDIQNWDHLALLPTFGAKDYENHRVATTGEWDKLTQDKEFNKNS 531
           GY+++R +H   KA Y D+Q W +L     FGA DYE  ++ T G+   +  DK F K+ 
Sbjct: 494 GYSVDRFLHHRSKASYYDVQPWHYLKFFDAFGADDYETRKIVTLGDLRDVMNDKHFCKDD 553

Query: 532 KIRMIEVMLPVMDAPTSLIE 551
           KIRM+E+MLP  D P  L+E
Sbjct: 554 KIRMLEIMLPSTDVPQVLVE 573

>NCAS0A04000 Chr1 complement(806883..808760) [1878 bp, 625 aa] {ON}
           Anc_2.390
          Length = 625

 Score =  616 bits (1589), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 283/569 (49%), Positives = 406/569 (71%), Gaps = 17/569 (2%)

Query: 3   EITLGRYLFERLNQVDVKTIFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADGYA 62
           +IT+  YLF RL Q+ ++TIFGL G++N+ L+DK+Y+V  +RWAGNANELNAAYAADGYA
Sbjct: 12  QITISEYLFHRLKQLHIETIFGLSGEYNMPLIDKLYQVHNLRWAGNANELNAAYAADGYA 71

Query: 63  RIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNGDF 122
           R+KG+  +ITTFGVGELSALNG+AGS+AEHVG+LH+VG+P  S+Q KQLLLHHTLGNGD+
Sbjct: 72  RLKGLGVLITTFGVGELSALNGVAGSFAEHVGLLHIVGMPPTSAQTKQLLLHHTLGNGDY 131

Query: 123 TVFHRMSANISETTAMVTDIATAPAEIDRCIRTTYITQRPVYLGLPANLVDLKVPAKLLE 182
           +VFHR++++I+    ++ D      E+D+CI   ++ QRPVY+G+P N V+L V +K L+
Sbjct: 132 SVFHRIASDIAVYNTVIDDTDLCFQEVDKCITLAWMEQRPVYMGMPVNQVNLLVDSKFLD 191

Query: 183 TPIDLSLKPNDPEAETEVVDTVLELIKAAKNPVILADACASRHDVKAETKKLIDATQFPS 242
            P+DL +  N  E  +E+ + +L+ I   K+P I+ DAC  RH+   E ++    T+FP 
Sbjct: 192 IPLDLDMFENATEVNSEITNKILQKIYKCKHPAIVVDACTIRHECIDEVEEFCRRTKFPV 251

Query: 243 FVTPMGKGSIDEQHPRFGGVYVGTLSRPEVKEAVESADLILSVGALLSDFNTGSFSYSYK 302
           FVTPMGKG+I+E  P FGGV++G+LS P V+E V+ AD I+ +G++LS+F+T +F + +K
Sbjct: 252 FVTPMGKGAINENTPHFGGVFMGSLSSPSVREVVDFADFIIVIGSMLSEFSTSTFHFVFK 311

Query: 303 TKNIVEFHSDYIKIRNATFPGVQMKFALQKLLNAVPEAIKGYKPVPVPARV-PENKSCDP 361
            K+ V   SD +KI+N+ +  + +K  ++ LL+++ E+   Y     P+ + P+ K  D 
Sbjct: 312 VKDSVLLFSDLVKIKNSVYANIHIKPLMKSLLHSLDESKIKYIFEEAPSMILPKTKIPDD 371

Query: 362 ATPLKQEWMWNQVSKFLQEGDVVITETGTSAFGINQTPFPNNAYGISQVLWGSIGFTTGA 421
              L+QEW+WN++S + +EGD++ITE GTSAFGINQT FPN A GISQ LWGS G++ GA
Sbjct: 372 VL-LRQEWVWNEISHWFREGDIIITEIGTSAFGINQTRFPNEAQGISQSLWGSSGYSLGA 430

Query: 422 CLGAAFAAEEID--------------PKKRVILFIGDGSLQLTVQEISTMIRWGLKPYLF 467
           CLG +FA +E +               K RVILF+GDG+ QLT+QE+ST+IRW L PY+F
Sbjct: 431 CLGTSFAIQEFEREHNHNFHRHTQNVEKHRVILFVGDGAFQLTMQELSTIIRWNLTPYIF 490

Query: 468 VLNNDGYTIERLIHGE-KAGYNDIQNWDHLALLPTFGAKDYENHRVATTGEWDKLTQDKE 526
           VLNN+GY+++R +H E  A Y DIQ W++L L+ TF AK+YE  ++ T G++  + QD  
Sbjct: 491 VLNNEGYSVDRFLHPEANASYYDIQPWNYLDLMATFNAKNYETKKIVTVGDFRDMVQDPL 550

Query: 527 FNKNSKIRMIEVMLPVMDAPTSLIEQAKL 555
           F  N KIRM+E++LP  D P +L++  KL
Sbjct: 551 FAINDKIRMVEILLPSTDVPQALVDTWKL 579

>CAGL0L06842g Chr12 (771870..773786) [1917 bp, 638 aa] {ON} similar
           to uniprot|Q07471 Saccharomyces cerevisiae YDL080c THI3
           or uniprot|P06169 Saccharomyces cerevisiae YLR044c PDC1
           or uniprot|P16467 Saccharomyces cerevisiae YLR134w PDC5
           or uniprot|P26263 Saccharomyces cerevisiae YGR087c PDC6
          Length = 638

 Score =  611 bits (1575), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 287/582 (49%), Positives = 396/582 (68%), Gaps = 21/582 (3%)

Query: 2   SEITLGRYLFERLNQVDVKTIFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADGY 61
           S+I++  YLF RLNQ+ + TIFGLPGDFN+ LLDK+Y +  MRWAGN NELNAAYAADGY
Sbjct: 11  SQISISEYLFHRLNQLKIWTIFGLPGDFNMPLLDKLYSIPTMRWAGNTNELNAAYAADGY 70

Query: 62  ARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNGD 121
           +R+K + C+ITTFGVGELSA+NG+AGSYAEHVG+LH+VG+P  S+Q KQLLLHHTLGNGD
Sbjct: 71  SRLKHLGCLITTFGVGELSAINGVAGSYAEHVGILHIVGMPPTSAQTKQLLLHHTLGNGD 130

Query: 122 FTVFHRMSANISETTAMVTDIATAPAEIDRCIRTTYITQRPVYLGLPANLVDLKVPAKLL 181
           ++VF+R++ +I+  TA++ D      E+D CIR  +  Q+PVYLG+P N VD+ V +  L
Sbjct: 131 YSVFYRIANDIACHTAIINDTDLCADEVDNCIRAAWGYQKPVYLGVPVNQVDIPVDSSRL 190

Query: 182 ETPIDLSLKPNDPEAETEVVDTVLELIKAAKNPVILADACASRHDVKAETKKLIDATQFP 241
             PIDLS+     E + +V+D +L+ + +A  P+I+ DAC  RHD   ET  L + T FP
Sbjct: 191 NNPIDLSILKKTKETDAQVIDLLLKQMYSASKPIIVVDACVRRHDALKETHALCELTNFP 250

Query: 242 SFVTPMGKGSIDEQHPRFGGVYVGTLSRPEVKEAVESADLILSVGALLSDFNTGSFSYSY 301
            FVTPMGKG+IDE +  FGGVY G+LS PEV+E  + AD +L +GA+L +F+T +F + +
Sbjct: 251 VFVTPMGKGTIDESYKNFGGVYSGSLSSPEVREVTDFADFVLFIGAILPEFSTSTFHFGF 310

Query: 302 KTKNIVEFHSDYIKIRNATFPGVQMKFALQKLLNAV-PEAIKGYKPVPVPARVPENKSCD 360
           K KN        +KI+ ATFP + +K  LQ L++ + P  I       V    P+ +  D
Sbjct: 311 KKKNCCILFPTSVKIKKATFPDMLLKGTLQSLVDTIEPSKITYKHQAKVDIIAPKMEPSD 370

Query: 361 PATPLKQEWMWNQVSKFLQEGDVVITETGTSAFGINQTPFPNNAYGISQVLWGSIGFTTG 420
            +  L+QEW+WN++S + +E D++ITETG+SAFGINQT FP N  GI+Q LWGS+GF   
Sbjct: 371 -SNLLRQEWVWNEISHWFKENDIIITETGSSAFGINQTRFPTNTIGINQALWGSVGFALC 429

Query: 421 ACLGAAFAAEE------------------IDPKKRVILFIGDGSLQLTVQEISTMIRWGL 462
           +CLGA FA EE                  I  + R ILF+GDG+ QLTVQE+ST+IRW L
Sbjct: 430 SCLGALFAVEEKTVVKHNLEIKLRNYNRNIFTENRTILFVGDGAFQLTVQELSTIIRWKL 489

Query: 463 KPYLFVLNNDGYTIERLIHGEK-AGYNDIQNWDHLALLPTFGAKDYENHRVATTGEWDKL 521
           KPY+F++NN+GY+++R +H    A Y D+Q W++L LL  FG   +E  ++ T  ++ +L
Sbjct: 490 KPYIFIMNNNGYSVDRFLHHRSDASYYDVQPWNYLYLLELFGCTSFETRKIVTVSDFKEL 549

Query: 522 TQDKEFNKNSKIRMIEVMLPVMDAPTSLIEQAKLTASINAKQ 563
             D+ F K  KIRMIE+MLP  D P +LI + +    ++ K+
Sbjct: 550 LADESFAKPDKIRMIEIMLPQSDVPKTLIARWQAEKELSNKR 591

>TBLA0B08820 Chr2 (2097075..2098982) [1908 bp, 635 aa] {ON}
           Anc_2.390 YDL080C
          Length = 635

 Score =  610 bits (1573), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 289/583 (49%), Positives = 405/583 (69%), Gaps = 34/583 (5%)

Query: 2   SEITLGRYLFERLNQVDVKTIFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADGY 61
           ++ITL  YLF RLNQ  + T+FGLPG+FN+ L+DK+  +  ++WAGNANELNAAYAADGY
Sbjct: 11  NDITLADYLFHRLNQFKIHTVFGLPGEFNMPLIDKLLTIPDLKWAGNANELNAAYAADGY 70

Query: 62  ARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNGD 121
           ARIKG+ C++TTFGVGELS++NGIAGSYAEHVGVLH++G+P  S Q  QLLLHHTLGNGD
Sbjct: 71  ARIKGIGCLLTTFGVGELSSINGIAGSYAEHVGVLHIIGMPPSSIQTSQLLLHHTLGNGD 130

Query: 122 FTVFHRMSANISETTAMVTDIATAPAEIDRCIRTTYITQRPVYLGLPANLVDLKVPAKLL 181
           +TVFHR+++ ++  + ++ D      EID  I   +  QRPVYLG+P N +   + + LL
Sbjct: 131 YTVFHRIASELACYSTVLNDTDYLTKEIDLSIVKAWTLQRPVYLGIPMNFISYPIKSNLL 190

Query: 182 ETPIDLSLKPNDPEAETEVVDTVLELIKAAKNPVILADACASRHDVKAETKKLIDATQFP 241
              +D +L+ N+  ++ +V++ +L+ I   K PVI+ DAC +RH+++ ET++L   T+FP
Sbjct: 191 NKDLDFTLESNNEISQDDVIELILKNIYRCKKPVIVVDACVTRHNIEKETEELFRRTKFP 250

Query: 242 SFVTPMGKGSIDEQHPRFGGVYVGTLSRPEVKEAVESADLILSVGALLSDFNTGSFSYSY 301
             VTPM KGS+DE  P F GV+ G++S P+V+E ++S DL+L +G  L +F T SF +SY
Sbjct: 251 VLVTPMAKGSVDESLPEFAGVFCGSISSPQVREVLDSVDLLLVIGCTLPEFTTSSFHFSY 310

Query: 302 KTKNIVEFHSDYIKIRNATFPGVQMKFALQKLLNAVP-EAIKGYK-------PVPVPARV 353
           K+K+ +   SDYIK RN TF  + +K  ++KLL A+    IK ++        + +P   
Sbjct: 311 KSKHCIFIFSDYIKYRNTTFADLNIKQLIKKLLLALDVSKIKNFQLQENNNGNIYIP--- 367

Query: 354 PENKSCDPATPLKQEWMWNQVSKFLQEGDVVITETGTSAFGINQTPFPNNAYGISQVLWG 413
             N   +P   L+QEW+WNQ+S + Q+GD++ITETGT+AFGINQT FP+NA GISQ LWG
Sbjct: 368 --NIKLNPTLLLRQEWVWNQLSHWFQDGDIIITETGTTAFGINQTKFPHNARGISQSLWG 425

Query: 414 SIGFTTGACLGAAFAAEEID--------------------PKKRVILFIGDGSLQLTVQE 453
           S G++ GACLGA+FA  EI                     PK RVILFIGDG+ QLTVQE
Sbjct: 426 STGYSLGACLGASFALSEIRKEQQVINNITQNVFPLFKDPPKHRVILFIGDGAFQLTVQE 485

Query: 454 ISTMIRWGLKPYLFVLNNDGYTIERLIHGEK-AGYNDIQNWDHLALLPTFGAKDYENHRV 512
           +ST+IRWGL PY+F++NN GY+ +R +H    AGY DI  WD+L LL  FGAK YE+ ++
Sbjct: 486 LSTIIRWGLTPYIFIMNNHGYSGDRFLHHRSDAGYYDIPQWDYLGLLEVFGAKIYESKKI 545

Query: 513 ATTGEWDKLTQDKEFNKNSKIRMIEVMLPVMDAPTSLIEQAKL 555
            T G+++K+  +  F  +S +RMIE++LP MD P +L+++ +L
Sbjct: 546 ITVGDFEKMVNNPNFAIDSVLRMIEIVLPPMDVPQALMDKWRL 588

>KAFR0F02990 Chr6 complement(589562..591388) [1827 bp, 608 aa] {ON}
           Anc_2.390 YDL080C
          Length = 608

 Score =  601 bits (1550), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 274/559 (49%), Positives = 394/559 (70%), Gaps = 10/559 (1%)

Query: 3   EITLGRYLFERLNQVDVKTIFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADGYA 62
           EIT+  YLF RL Q+ V+TIFGLPG+FN+ LLD++Y + G++WAGNANELNA YAADGYA
Sbjct: 12  EITIADYLFHRLKQLHVETIFGLPGEFNMPLLDRLYNIPGLKWAGNANELNATYAADGYA 71

Query: 63  RIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNGDF 122
           R+KG+ CIITTFGVGELSA+NGIAG++AEHVGVLHVVG+P  S+Q KQLLLHHTLGNGD+
Sbjct: 72  RLKGLGCIITTFGVGELSAINGIAGAFAEHVGVLHVVGMPPTSAQTKQLLLHHTLGNGDY 131

Query: 123 TVFHRMSANISETTAMVTDIATAPAEIDRCIRTTYITQRPVYLGLPANLVDLKVPAKLLE 182
            VFHRM+ ++S  + ++ D      E+D+CI   Y+ Q+PVYLG+P N V+LKV +  L 
Sbjct: 132 RVFHRMANDVSFYSRIINDTDLCSNEVDKCIELAYLKQKPVYLGVPVNQVNLKVNSAKLN 191

Query: 183 TPIDLSLKPNDPEAETEVVDTVLELIKAAKNPVILADACASRHDVKAETKKLIDATQFPS 242
             +   +  N+ + E E ++ +L+ I   ++P I+ DAC +R D   ET++ I  T FP 
Sbjct: 192 KELRFRVLKNNLDMENEAINLILKKIYTCESPAIVVDACVNRQDTVKETEQFIRLTNFPV 251

Query: 243 FVTPMGKGSIDEQHPRFGGVYVGTLSRPEVKEAVESADLILSVGALLSDFNTGSFSYSYK 302
           FVTPMGKGSIDE  P FGGV+ G++S P V+E V+ AD ++ +G+LL++F+T +F + YK
Sbjct: 252 FVTPMGKGSIDENIPTFGGVFSGSISSPNVREVVDFADFVIVIGSLLTEFSTSAFHFFYK 311

Query: 303 TKNIVEFHSDYIKIRNATFPGVQMKFALQKLLNAVPEAIKGYKPVP---VPARVPENKSC 359
           +KN V    D ++ + + +P + +K  ++ +L+ +      ++P      P  VP++K  
Sbjct: 312 SKNCVLLFDDCVRFKGSIYPDLFLKPLMKNILSRLDPGKISFRPTSDCNNPMIVPKSKPS 371

Query: 360 DPATPLKQEWMWNQVSKFLQEGDVVITETGTSAFGINQTPFPNNAYGISQVLWGSIGFTT 419
           D    L+QEW+W++ S + QEGD++ITE GTS+FGINQ  FP++  GISQ LWGS G++ 
Sbjct: 372 DDQL-LRQEWVWHEFSHWFQEGDIIITELGTSSFGINQIRFPSHTKGISQALWGSSGYSM 430

Query: 420 GACLGAAFAAEE-----IDPKKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNDGY 474
           G+CLGA FA  E        ++RVILFIGDG+ Q+T+QEISTMIRW L PY+F+LNN GY
Sbjct: 431 GSCLGACFATLESQSASTSTRQRVILFIGDGAFQITMQEISTMIRWNLTPYIFLLNNQGY 490

Query: 475 TIERLIHGEK-AGYNDIQNWDHLALLPTFGAKDYENHRVATTGEWDKLTQDKEFNKNSKI 533
           +I+R +H  K     D+Q W++L+    FGA DYE  ++ T G+  ++  +++F++  +I
Sbjct: 491 SIDRFLHHRKNTTLYDVQQWNYLSFFKVFGATDYETRKIVTLGDLRQMLGNEDFSRADRI 550

Query: 534 RMIEVMLPVMDAPTSLIEQ 552
           RM E+MLP MD P +++++
Sbjct: 551 RMAEIMLPSMDVPKAIVDK 569

>NDAI0E01700 Chr5 (337856..339721) [1866 bp, 621 aa] {ON} Anc_2.390
          Length = 621

 Score =  601 bits (1550), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 279/568 (49%), Positives = 392/568 (69%), Gaps = 15/568 (2%)

Query: 2   SEITLGRYLFERLNQVDVKTIFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADGY 61
           S IT+  Y+F RL Q+ ++TIFGLPG+FN+ L+DK+Y++  +RWAG+ANELNAAYAADGY
Sbjct: 11  SYITIAEYIFHRLKQLKIETIFGLPGEFNMPLIDKLYKIPQLRWAGDANELNAAYAADGY 70

Query: 62  ARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNGD 121
           +R+KG+  ++TTFGVGELSA+NG+AGS+AEHVG+LH+VG+P  S+Q KQLLLHHTLGNGD
Sbjct: 71  SRLKGLGVLVTTFGVGELSAINGVAGSFAEHVGLLHIVGMPPTSAQTKQLLLHHTLGNGD 130

Query: 122 FTVFHRMSANISETTAMVTDIATAPAEIDRCIRTTYITQRPVYLGLPANLVDLKVPAKLL 181
           + VF R+++ ++  T ++ D      E+D+CI   +  Q+PVY+G+P N VD+ V +  L
Sbjct: 131 YNVFWRIASEVACHTVIINDTDLCFMEVDKCIEIAWKRQKPVYIGIPVNQVDIPVRSLHL 190

Query: 182 ETPIDLSLKPNDPEAETEVVDTVLELIKAAKNPVILADACASRHDVKAETKKLIDATQFP 241
             P+ LS   N  +   +VV  +L+ I  + +PVI+ D C  RH    E ++ I  T+FP
Sbjct: 191 NVPLTLSPDMNLNDIGNDVVQLLLQKIYKSTHPVIIVDGCIIRHGCIDEMEEFIQRTKFP 250

Query: 242 SFVTPMGKGSIDEQHPRFGGVYVGTLSRPEVKEAVESADLILSVGALLSDFNTGSFSYSY 301
            FVTPMGKG+IDE +P F GV+ G++S P V+E V+ AD ++ +G +L+ FNT +F + Y
Sbjct: 251 VFVTPMGKGAIDENNPNFKGVFTGSISSPSVREVVDFADFLMVMGCMLAAFNTSTFHFGY 310

Query: 302 KTKNIVEFHSDYIKIRNATFPGVQMKFALQKLLNAVPEAIKGYKPVPVPARVPENKSCDP 361
           K+KN    +SD IK  NAT+P V +K  LQ LL  + E+   Y P   P  +   +    
Sbjct: 311 KSKNRALLYSDSIKFNNATYPDVYLKPLLQSLLQNLDESQINYVPKETPKMIIPKRELPD 370

Query: 362 ATPLKQEWMWNQVSKFLQEGDVVITETGTSAFGINQTPFPNNAYGISQVLWGSIGFTTGA 421
              L+QEW+WN++S + QEGD++ITETGTSAFGINQT FPN A GISQ LWGS+G++ GA
Sbjct: 371 DELLRQEWVWNEISHWFQEGDIIITETGTSAFGINQTRFPNEAQGISQALWGSVGYSLGA 430

Query: 422 CLGAAFAAEEID--------------PKKRVILFIGDGSLQLTVQEISTMIRWGLKPYLF 467
           CLG+ FA +E                 K RVILF+GDG+ QLT+QE+ST++RW L PY+F
Sbjct: 431 CLGSLFAVQEFQRDHNHDFHHHTQKSEKHRVILFVGDGAFQLTMQELSTIVRWKLTPYIF 490

Query: 468 VLNNDGYTIERLIHGEK-AGYNDIQNWDHLALLPTFGAKDYENHRVATTGEWDKLTQDKE 526
           +LNN GY+++R++H    A Y DIQ WD+L L+ TF A D +  ++ T G+   + +D E
Sbjct: 491 ILNNHGYSVDRILHHRSDASYYDIQQWDYLNLMNTFNATDADTRKIITVGDMKDMLRDPE 550

Query: 527 FNKNSKIRMIEVMLPVMDAPTSLIEQAK 554
           F  +++IRMIEVMLP MD P +L++  K
Sbjct: 551 FAVDNRIRMIEVMLPSMDVPKALVDTWK 578

>Ecym_6055 Chr6 complement(105018..106796) [1779 bp, 592 aa] {ON}
           similar to Ashbya gossypii ADR254W
          Length = 592

 Score =  553 bits (1425), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 279/566 (49%), Positives = 386/566 (68%), Gaps = 22/566 (3%)

Query: 3   EITLGRYLFERLNQVDVKTIFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADGYA 62
           +I LG+YLF RLNQ++V TIFGLP +FN  LLD+IY++  MRW GNANELNA+YAADGY+
Sbjct: 13  QIPLGKYLFHRLNQLNVTTIFGLPSEFNSPLLDQIYQIPSMRWCGNANELNASYAADGYS 72

Query: 63  RIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNGDF 122
           RIK +SC++TTFGVGE+S LNGIAGS++EHV VLHVVG+P  S+Q K+LLLHHTLGN D+
Sbjct: 73  RIKRLSCLVTTFGVGEMSVLNGIAGSFSEHVAVLHVVGMPPSSAQLKKLLLHHTLGNSDY 132

Query: 123 TVFHRMSANISETTAMVTDIATAPAEIDRCIRTTYITQRPVYLGLPANLVDLKVPAKLLE 182
            +FHR++++I   TA++ +       ID CI   Y  Q+PVY G+P NL    V +K L+
Sbjct: 133 DIFHRLASDICVHTAVLKESDNICDVIDNCIVRCYNQQQPVYCGIPVNLAGHLVDSKSLD 192

Query: 183 TPIDLSLKPNDP--EAETEVVDTVLELIKAAKNPVILADACASRHDVKAETKKLIDATQF 240
           +P+ L    N P  +A  E+VD +LE I +A++PVI+AD CASRHD   E  ++   T F
Sbjct: 193 SPLHLMRGFNQPISDAVEELVDILLEKIYSAQHPVIVADGCASRHDCIEELTEIAQKTGF 252

Query: 241 PSFVTPMGKGSIDEQHPRFGGVYVGTLSRPEVKEAVESADLILSVGALLSDFNTGSFSYS 300
           P   TPMGKGS DEQ  R+ GVY+G++S P+V+E V+ AD +L  GAL +D+ T S+ + 
Sbjct: 253 PLCCTPMGKGSFDEQSKRYVGVYMGSISSPQVREVVDFADFVLVAGALTADYATSSYHFC 312

Query: 301 YKTKNIVEFHSDYIKIRNA-TFPGVQMKFALQKLLNAVPEAIKGYKPVPVPARVPENKSC 359
           YK KNIV     Y K+    T+P V++K  LQ L   +      Y    +   +PE+ SC
Sbjct: 313 YKPKNIVLLFDKYAKVSGTKTYPDVRLKDVLQLLARCLDPTKLQY----IQEEIPES-SC 367

Query: 360 -----DPATPLKQEWMWNQVSKFLQEGDVVITETGTSAFGINQTPFPNNAYGISQVLWGS 414
                D  TPL+QEWMW ++S + + GDV++TE GTS  G+NQ  FP+    +SQ LWGS
Sbjct: 368 LRVKPDANTPLRQEWMWARLSHWFRPGDVIVTEMGTSGLGVNQIKFPSGTKVVSQPLWGS 427

Query: 415 IGFTTGACLGAAFAAEEID-----PKKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVL 469
           +G++ GACLG   A +E          R+ILF+GDG+LQLTVQEIST+I+WGL PY+FV+
Sbjct: 428 LGYSVGACLGVLIAVQEESRGNRLKDNRIILFVGDGALQLTVQEISTIIKWGLAPYIFVI 487

Query: 470 NNDGYTIERLI----HGEKAGYNDIQNWDHLALLPTFGAKDYENHRVATTGEWDKLTQDK 525
           NN GYTI+RL+    H   A Y +IQ W++L+++P FG  +Y+  +V   G+ D+L +D+
Sbjct: 488 NNQGYTIDRLLSRDTHHATADYYNIQPWNNLSIIPAFGGTNYDVRKVVKVGQLDQLLKDQ 547

Query: 526 EFNKNSKIRMIEVMLPVMDAPTSLIE 551
            F+    ++M+E++LP MDAP +L+E
Sbjct: 548 RFSNQDILKMVEIILPSMDAPQALLE 573

>ADR254W Chr4 (1143623..1145368) [1746 bp, 581 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDL080C (THI3)
          Length = 581

 Score =  536 bits (1380), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 266/558 (47%), Positives = 365/558 (65%), Gaps = 14/558 (2%)

Query: 2   SEITLGRYLFERLNQVDVKTIFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADGY 61
           S I L  YLF RL Q+ V T FGLP D+N+ LLD +  V  M    N NELNA+YAADGY
Sbjct: 12  SSIPLAEYLFHRLRQLGVTTGFGLPSDYNMFLLDGLENVADMHLCCNTNELNASYAADGY 71

Query: 62  ARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNGD 121
           AR++ +SC+++TFGVGELS +NGIAGS+AEHV VL +VG+P  S+Q ++LLLHHTLGNGD
Sbjct: 72  ARMQRLSCLVSTFGVGELSVVNGIAGSFAEHVAVLLIVGMPPASAQRRKLLLHHTLGNGD 131

Query: 122 FTVFHRMSANISETTAMVTDIATAPAEIDRCIRTTYITQRPVYLGLPANLVDLKVPAKLL 181
           + VF R++++I   + +V    TA   +D CI   Y  Q+PVY G+P NL +  +P+  L
Sbjct: 132 YDVFRRLASDICTYSTVVRSAHTAAEVLDHCIARCYRDQKPVYCGVPINLAEAMLPSAPL 191

Query: 182 ETPIDLSLKPNDPEAETEVVDTVLELIKAAKNPVILADACASRHDVKAETKKLIDATQFP 241
           + P+ L  +P  P    E+V  +L+ I AAK+PV++ DAC +RH    + ++L  AT FP
Sbjct: 192 DVPLPLLDEPCAPL--DELVALLLDKIYAAKHPVLVVDACVARHGCMQQLQRLAQATDFP 249

Query: 242 SFVTPMGKGSIDEQHPRFGGVYVGTLSRPEVKEAVESADLILSVGALLSDFNTGSFSYSY 301
              TPMGKG +DEQ  RF GVYVG+LS P+V+E V+ AD +L VGAL ++F T +F ++Y
Sbjct: 250 VCCTPMGKGIVDEQGARFAGVYVGSLSAPQVREVVDFADFVLVVGALTAEFCTFAFHFAY 309

Query: 302 KTKNIVEFHSDYIKIRNATFPGVQMKFALQKLLNA-VPEA-IKGYKPVPVPA--RVPENK 357
           K KNI   H+ + ++    FP   ++  L  L+    P A     +PVP P+  RV  N 
Sbjct: 310 KPKNIGLVHARHARVGARGFPDAPLRALLGLLVQRWTPRASANAREPVPEPSALRVAPN- 368

Query: 358 SCDPATPLKQEWMWNQVSKFLQEGDVVITETGTSAFGINQTPFPNNAYGISQVLWGSIGF 417
              PATPL+ EW+W ++S++   GD++++ETGTSAFG+ QT  P     +SQ LWGS+G+
Sbjct: 369 ---PATPLRHEWLWARLSRWFAPGDILVSETGTSAFGVLQTRLPPGVCVVSQPLWGSVGY 425

Query: 418 TTGACLGAAFAAEEIDPKKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNDGYTIE 477
           + GACLG   A     P +RV+LF+GDG+LQLTVQE+STM+R  L P +FVLNN GY+ +
Sbjct: 426 SVGACLGVLVATRAAAPPRRVVLFVGDGALQLTVQELSTMVRLRLAPLIFVLNNRGYSAD 485

Query: 478 RLI----HGEKAGYNDIQNWDHLALLPTFGAKDYENHRVATTGEWDKLTQDKEFNKNSKI 533
           RL+    H   A Y D+Q W +LAL P FGA  Y+   V T GE D L  D  F + S +
Sbjct: 486 RLLNRARHRANARYYDVQPWHNLALAPAFGASAYDPRAVTTVGELDALLSDPAFAQPSVL 545

Query: 534 RMIEVMLPVMDAPTSLIE 551
           +M+EV LP MD P +L++
Sbjct: 546 KMVEVALPSMDGPPALLD 563

>Kpol_1046.9 s1046
           (18301..18855,18984..18992,19556..19693,19697..19987,
           19994..20797) [1797 bp, 598 aa] {ON}
           (18301..18855,18984..18992,19556..19693,19697..19987,
           19994..20797) [1797 nt, 599 aa]
          Length = 598

 Score =  465 bits (1197), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 245/562 (43%), Positives = 342/562 (60%), Gaps = 44/562 (7%)

Query: 2   SEITLGRYLFERLNQVDVKTIFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADGY 61
           S IT+  YLF RL Q+D++TIFGLPG+FN+ L+DK+Y++  +RWAGNANELNAAYAADGY
Sbjct: 12  SSITVAEYLFHRLKQMDIRTIFGLPGEFNMPLIDKLYKIPSLRWAGNANELNAAYAADGY 71

Query: 62  ARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNGD 121
           AR+K + C+ITTFGVGELSALNGIAGS++EH+G+LHVV +P +      +L+     NGD
Sbjct: 72  ARLKRLGCLITTFGVGELSALNGIAGSFSEHLGILHVVRMPPLRLNHSIVLI--LFRNGD 129

Query: 122 FTVFHRMSANISETTAMVTDIATAPAEIDRCIRTTYITQRPVYLGLPANLVDLKVPAKLL 181
           +           +      DI   P    R +    I     ++     L         +
Sbjct: 130 Y-----------KFPMKARDILVTPRISHRNLWDEMIKPNQAWISSAGILAYRYWRGSKI 178

Query: 182 ETPIDLSLKPNDPEAETEVVDTVLELIKAAKNPVILADACASRHDVKAETKKLIDATQFP 241
                      + +  T  + +     K           C S + V+ +        +FP
Sbjct: 179 PKGKGADXXXKNLQCRTSYLSSRSLRFKEQ------CRRCNSDYSVRKQ--------KFP 224

Query: 242 SFVTPMGKGSIDEQHPRFGGVYVGTLSRPEVKEAVESADLILSVGALLSDFNTGSFSYSY 301
            FV P  +    E + +FGGV+ G++S P V+E V+ ADL++ +G  L DF+T SF +SY
Sbjct: 225 YFV-PQWERVQHENNDQFGGVFSGSISSPHVREVVDFADLVIVIGCTLPDFHTSSFHFSY 283

Query: 302 KTKNIVEFHSDYIKIRNATFPGVQMKFALQKLLNAVPEAIKGY---KPVPVPARVPENKS 358
           + K++V   S Y+KIRN  +P + +K  L  LL+ V  ++  Y   KP+ VP     +KS
Sbjct: 284 RAKDVVLITSTYVKIRNRLYPDLNIKPLLNTLLSRVDSSLIKYDSIKPMVVPTSKLPSKS 343

Query: 359 CDPATPLKQEWMWNQVSKFLQEGDVVITETGTSAFGINQTPFPNNAYGISQVLWGSIGFT 418
                 L+QEW+WN++S + QE DV+ITETGTSAFGINQT FP  ++GISQ LWGS+G++
Sbjct: 344 V-----LRQEWVWNEISHWFQEKDVIITETGTSAFGINQTRFPKQSHGISQCLWGSVGYS 398

Query: 419 TGACLGAAFAAEEIDPK-------KRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNN 471
            GACLGA+FA +E+           RVILF+GDG+ QLT+QE+STMI+W LKPY+F++NN
Sbjct: 399 LGACLGASFAVDELYESGKTNGIMPRVILFVGDGAFQLTMQEVSTMIKWNLKPYIFLMNN 458

Query: 472 DGYTIERLI-HGEKAGYNDIQNWDHLALLPTFGAKDYENHRVATTGEWDKLTQDKEFNKN 530
            GY+I+R + H   A Y DIQ W++L LL  FGA DYE  ++ T  ++  + +D  F +N
Sbjct: 459 QGYSIDRFLSHRSNAKYYDIQQWEYLNLLQVFGAIDYEAKKIVTVEDFQNILKDANFARN 518

Query: 531 SKIRMIEVMLPVMDAPTSLIEQ 552
            KIRMIE+MLP MD P SL+EQ
Sbjct: 519 DKIRMIEIMLPPMDVPQSLMEQ 540

>KLLA0F16962g Chr6 complement(1559454..1561190) [1737 bp, 578 aa]
           {ON} uniprot|O74722 Kluyveromyces lactis PDC Pyruvate
           decarboxylase
          Length = 578

 Score =  365 bits (938), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 201/557 (36%), Positives = 322/557 (57%), Gaps = 36/557 (6%)

Query: 4   ITLGRYLFERLNQVDVKTIFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADGYAR 63
           I L  YLF RL Q++ +T+FG+  +++ + L +     G++W    N+LN ++A D Y R
Sbjct: 27  IPLPEYLFHRLFQLNCRTVFGV-ANYSTAKLYQAIAASGIQWIQTINQLNTSFAVDAYGR 85

Query: 64  IKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNGDFT 123
             G+SC +T+    EL  +NG  GS+ E+V +L VV V   S   ++L+       GD +
Sbjct: 86  AIGVSCYVTSES-AELGHVNGFFGSFCEYVPILQVV-VLEQSHDLERLI-------GDVS 136

Query: 124 VFHRMSANISETTAMVTDIATAPAEIDRCIRTTYITQRPVYLGLPANLVDLKVPAKLLET 183
           +FH              D+   P+EID C+RT +  +RPVY+GL +      VP+  L  
Sbjct: 137 IFH--------------DVVDDPSEIDSCVRTLFWGKRPVYMGLRSKDATKLVPSSSLNG 182

Query: 184 PI--DLSLKPNDPEAET--EVVDTVLELIKAAKNPVILADACASRHDVKAETKKLIDATQ 239
            I   + +K    + +T   V+D ++  + A+  P+I+ DA   R++  +  +  +  T 
Sbjct: 183 NIADKMGIKNTFFQTDTIKRVIDKIIAEVYASSRPLIVVDALIDRYNYNSTIQNFLTETG 242

Query: 240 FPSFVTPMGKGSIDEQHPRFGGVYVGTLSRPEVKEAVESADLILSVGALLSDFNTGSFSY 299
            P   T M KGSIDE  P F G ++GT+S+P V+E + +AD  L +G ++ +F      +
Sbjct: 243 IPFVTTLMSKGSIDESLPNFVGTFLGTMSQPIVREYMNNADCTLILGCMIENFKNSYCRF 302

Query: 300 SYKTKNIVEFHSDYIKIRNATFPGVQMKFALQKLLNAVPEA-IKGYKPVPVPARVPENKS 358
           +YK+KN +   +D +KI N   P + +   L +L+ ++    I   +PV +P  +P  + 
Sbjct: 303 NYKSKNQILLWNDRVKIENNIIPDILLHELLPQLIASLDTTKIVNSRPVTIPNMIPRVEP 362

Query: 359 CDPATPLKQEWMWNQVSKFLQEGDVVITETGTSAFGINQTPFPNNAYGISQVLWGSIGFT 418
             P T L+QE++W ++S +L++GDV+I+E+GTSA G+ Q  FP+N   +SQ +W S G++
Sbjct: 363 -QPVTFLRQEYLWFKMSTWLKQGDVIISESGTSAIGLLQQKFPDNTRLVSQAIWNSSGYS 421

Query: 419 TGACLG--AAFAAEEIDPKKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNDGYTI 476
            GACLG  AA+       K R+IL +GDGSLQ T QE+ST++  G KPY+FV+NN GYT+
Sbjct: 422 IGACLGILAAYRDMGTLDKHRIILMVGDGSLQFTFQELSTILTHGFKPYIFVINNQGYTV 481

Query: 477 ERLIHGEK----AGYNDIQNWDHLALLPTFGAKDYENHRVATTGEWDKLTQDKEFNKNSK 532
           +R ++ EK    A Y DIQ W+ L L   F +++Y   R  + GE + L  DKEFNK+ +
Sbjct: 482 DRTLNREKTHLNATYFDIQPWELLKLPSLFYSQEYFKRRCMSVGELNSLLSDKEFNKSDQ 541

Query: 533 IRMIEVMLPVMDAPTSL 549
           ++++E++LP MD P  L
Sbjct: 542 LKIVELILPSMDVPVLL 558

>Kpol_1062.12 s1062 complement(31361..33253) [1893 bp, 630 aa] {ON}
           complement(31361..33253) [1893 nt, 631 aa]
          Length = 630

 Score =  341 bits (875), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 207/595 (34%), Positives = 311/595 (52%), Gaps = 47/595 (7%)

Query: 4   ITLGRYLFERLNQVDVKTIFGLPGDFNLSLLDKIY------EVEGMRWAGNANELNAAYA 57
           +  G Y+F+RLN    K+IFG+PGD+NL+LL+ +Y      +   + W G  NELNAAYA
Sbjct: 24  LRFGDYIFKRLNSCGTKSIFGVPGDYNLNLLELMYPNGTANKTSEINWIGCCNELNAAYA 83

Query: 58  ADGYARIKG-MSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHT 116
           ADGY+R    + CI+TT GVGELSA+NGI+GS+AEHV VLH+VG+PS          HH 
Sbjct: 84  ADGYSRYTNKLGCIVTTCGVGELSAMNGISGSFAEHVKVLHIVGIPSTEKFKTGGNFHHL 143

Query: 117 LGN--------GDFTVFHRM-SANISETTAMVTDIATAPAEIDRCIRTTYITQRPVYLGL 167
           L N         ++ VF  M   ++S +T  + ++ TA  E D  IR  Y   +P Y+ +
Sbjct: 144 LPNFKESNLNKPNYKVFAEMVQGSVSCSTKFIENLDTACQEFDDLIRDIYKYSKPGYMFV 203

Query: 168 PANLVDLKV-PAKLLETPI-----DLSLKPNDPEAETEVVDTVLELIKAAKNPVILADAC 221
           P N   L V P  L ETP       +++ P+  E    + D +   +  A+ P I+AD  
Sbjct: 204 PENYFKLYVNPKNLYETPSITLQDCITMSPDKMEMADGLTDFIFSYLYHAEKPAIIADTL 263

Query: 222 ASRHDVKAETKKLIDATQFPSFVTPMGKGSIDEQHPRFGGVYVGTLSRPEVKEAVESADL 281
             R+   +   + I  T   +F T MGK  +DE    + GVY G     +V++A+ + DL
Sbjct: 264 TDRYSGSSLLNEFIQKTNIWNFSTLMGKSILDESTETYKGVYNGKDGCEKVQKAISTCDL 323

Query: 282 ILSVGALLSDFNTGSFS---YSYKTKNIVEFHSDYIKI------RNATFPGVQMKFALQK 332
           IL  G   ++ N+G+++   Y  K   I+EFH  YI++          F GV+  + L++
Sbjct: 324 ILHFGVEKNEVNSGTYTFEDYYSKVSFIIEFHPQYIRMIDMQSKSTQLFGGVEFTYILKR 383

Query: 333 LLNAV-PEAIKGYKPVPVPARVPENKSCDPATPLKQEWMWNQVSKFLQEGDVVITETGTS 391
           +L  V P  +    P    +    ++       + Q+ +   +  +++ GDVV+ +TGT 
Sbjct: 384 MLKMVNPSNLHLNYPTSDESSTKTDQEAVANNQITQDHISTTMESYIKPGDVVLCDTGTF 443

Query: 392 AFGINQTPFPNNAYGISQVLWGSIGFTTGACLGAAFAAEEI------------DPKKRVI 439
            F +    F +    +SQ  + SIG+   + LG   A  +             + K R+I
Sbjct: 444 QFSLRDFKFSSQVKLVSQFFYLSIGYALPSALGVGIAMRDYPNSHIKDEQLKENTKPRLI 503

Query: 440 LFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNDGYTIERLIHGEKAGYNDIQNWDHLALL 499
           LF GDG+ Q+TVQE+STM+R+ +   +F+ NNDGYTIER I G    YNDIQ W+   L 
Sbjct: 504 LFEGDGAAQMTVQELSTMLRYEVPMDIFLWNNDGYTIERAIQGPTRSYNDIQPWNWTYLF 563

Query: 500 PTFG-AKDY--ENHRVATTGEWDKLTQDKEFNKNSKIRMIEVMLPVMDAPTSLIE 551
             FG AK+   +NH+V TT E D +  +      + I  +EV L +MD P  L +
Sbjct: 564 KAFGDAKENFAKNHKVETTKELDNILTELRSKDQNNINFVEVTLGIMDMPKILTD 618

>CAGL0A03102g Chr1 (317961..319910) [1950 bp, 649 aa] {ON} similar
           to uniprot|Q06408 Saccharomyces cerevisiae YDR380w
          Length = 649

 Score =  339 bits (869), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 218/618 (35%), Positives = 324/618 (52%), Gaps = 59/618 (9%)

Query: 3   EITLGRYLFERLNQVDVKTIFGLPGDFNLSLLDKIYE---VEGMRWAGNANELNAAYAAD 59
           EIT G Y+F RL     K++FG+PGDFNL+LL+ +Y+    + +RW GN NELNAAYAAD
Sbjct: 30  EITFGEYVFRRLLSCGTKSVFGVPGDFNLALLEHLYDDSVADALRWVGNCNELNAAYAAD 89

Query: 60  GYARIKG-MSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQL---LLHH 115
           GY+R    + C+ITT+GVGELSALNG+AGS+AE V VLH+VGV S  +  K      +HH
Sbjct: 90  GYSRYTNKIGCLITTYGVGELSALNGVAGSFAEDVKVLHIVGVASSQTSCKNTDNKNVHH 149

Query: 116 ---TLGNGDF------TVFHRMSANISETTAMVTDIATAPAEIDRCIRTTYITQRPVYLG 166
               L + +F      T +  +   +      + DI  A   +D+ I   Y   +P YL 
Sbjct: 150 LIPALNDSNFVSPNHKTYYEMVKDRVCCAAEYLEDIDVACDMLDKVIEDMYRYSKPGYLF 209

Query: 167 LPANLVDLKVPAK-LLETP---IDLSLKPNDPEAETE---VVDTVLELIKAAKNPVILAD 219
           +PA+  D+ V  + L+  P   ++ ++ P     E++   +V  V +LI  + NP IL D
Sbjct: 210 IPADFADMMVSTRNLVARPTITLEQAIAPLVGCGESQLEAIVAKVAQLIYNSSNPCILGD 269

Query: 220 ACASRHDVKAETKKLIDATQFPSFVTPMGKGSIDEQHPRFGGVYVGTLSRPEVKEAVESA 279
               R+ V  +   LI   Q  +F T MGK  IDE +P + G+Y G      V E     
Sbjct: 270 VLTDRYGVSQQLNSLISHCQMWNFSTVMGKSVIDESNPYYKGLYNGRECSSSVIEDFSKC 329

Query: 280 DLILSVGALLSDFNTGSFSYSYKTK---NIVEFHSDYIKIRNA------TFPGVQMKFAL 330
           DLIL  G   ++ N G ++  Y      N+VEFHSDYI+  N+         GV     L
Sbjct: 330 DLILHFGIERNEINNGHYTIDYNEHIGANVVEFHSDYIRFFNSKTKEEDMIRGVNFVHVL 389

Query: 331 QKLLNAVPEAIK---GYKPVPVPARVPENKSCDPATPLKQEWMWNQVSKFLQEGDVVITE 387
            +L  A+ +A K    Y+     +          +  + QE++ + + ++L  GDV++ E
Sbjct: 390 NRLQPAI-QADKLSFNYQECSTTSNADSKIDSQSSNEITQEFLQDIMPQYLNPGDVLVCE 448

Query: 388 TGTSAFGINQTPFPNNAYGISQVLWGSIGFTTGACLGAAFAA-----------EEIDPKK 436
           TG+  FG+    FP+N   +SQ  + SIG    A LG                EEI+ + 
Sbjct: 449 TGSVQFGVRDYRFPSNVKYVSQGFYLSIGMALPASLGVGIGMQDYPMSHIPNPEEIEYEP 508

Query: 437 RVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNDGYTIERLIHGEKAGYNDIQNWDHL 496
           ++ILF GDGS Q+T+QE+STM+   +K  +F+ NNDGYTIER I G    YNDI  W+  
Sbjct: 509 KLILFEGDGSAQMTIQELSTMLHNNVKMEIFLWNNDGYTIERAIKGPTRSYNDIAPWNWT 568

Query: 497 ALLPTF----GAKDYENHRVATTGE--WDKLTQDKEFNKN---SKIRMIEVMLPVMDAPT 547
            +   F    G+K    ++V +T E    +L + K+   N    +I ++EV + V+D P 
Sbjct: 569 KMFEAFGDGLGSKHKTRNQVYSTREEFLTRLREKKDTKHNDPACQIELLEVKMGVLDFPE 628

Query: 548 SLIEQAKLTASI-NAKQE 564
            L  +  ++A++ N K+E
Sbjct: 629 QL--KCMVSAAMYNKKKE 644

>NCAS0A11830 Chr1 (2347016..2348929) [1914 bp, 637 aa] {ON}
           Anc_5.456
          Length = 637

 Score =  335 bits (860), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 220/599 (36%), Positives = 323/599 (53%), Gaps = 56/599 (9%)

Query: 4   ITLGRYLFERLNQVDVKTIFGLPGDFNLSLLDKIYE----VEGMRWAGNANELNAAYAAD 59
           I  G YL +R+     K+IFG+PGDFNLSLL+ +Y      +G+RW G  NELNAAYAAD
Sbjct: 28  IPFGEYLLQRILTAGTKSIFGVPGDFNLSLLEYLYTPSLISQGLRWIGTCNELNAAYAAD 87

Query: 60  GYARIKG-MSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVP-SISSQAKQLL---LH 114
           GY+R    MSC+ITT+GVGELSA+NG+AG++AE V VLH+VGV  S+ S++       +H
Sbjct: 88  GYSRYSNKMSCLITTYGVGELSAMNGVAGAFAEDVKVLHIVGVTRSVDSRSDDYHTRNIH 147

Query: 115 H---TLGNGDFT-----VFHRMSAN-ISETTAMVTDIATAPAEIDRCIRTTYITQRPVYL 165
           H    L + +F      V+  M  + ++ + A + +I TA  E+D+ I   Y   +P Y+
Sbjct: 148 HLVPKLKDSNFIGPNHRVYSEMVRDKLACSVAYLDNIETACDEVDKVIFDIYKYSKPGYI 207

Query: 166 GLPANLVDLKV-PAKLLETPIDLSLKPNDPEAET----EVVDTVLELIKAAKNPVILADA 220
            +PA+  D+ V P+ L+  P+ ++L+   PE  +    EV   +L+ I  +K P I+ D 
Sbjct: 208 FVPADFSDMLVNPSNLVSNPV-ITLENAIPEVPSLELEEVTQLLLQCIYDSKTPAIIGDV 266

Query: 221 CASRHDVKAETKKLIDATQFPSFVTPMGKGSIDEQHPRFGGVYVGTLSRPEVKEAVESAD 280
              R     E  KLI  T   +F T MGK  IDE +P++ G+Y G      V E     D
Sbjct: 267 LTDRFGCAPELNKLIKMTSMWNFSTVMGKSVIDESNPKYMGLYNGNEGICSVTERFLQCD 326

Query: 281 LILSVGALLSDFNTGSFSYSY-KTKNIVEFHSDYIKI------RNATFPGVQMKFALQKL 333
           L+L  G  +++ N G ++Y Y +   IVE H +Y++           F GV     L++L
Sbjct: 327 LVLHFGINVNEINNGHYTYKYNENAKIVELHPEYVRFFDFKINEEKLFKGVHFVPILKRL 386

Query: 334 LNAV-PEAIKGYKPVPVPARVPENKSCDP---ATPLK--QEWMWNQVSKFLQEGDVVITE 387
           L  + P  +    P  V AR  + + C P   ++ LK  Q  + N++  +  +GDVV+ E
Sbjct: 387 LEKLEPTNLNFNYPTNV-ARFSQEEICLPQESSSELKVTQTHLQNKIPSYFNDGDVVVCE 445

Query: 388 TGTSAFGINQTPFPNNAYGISQVLWGSIGFTTGACLGAAFAAEEIDPKK----------- 436
           TG+  F +    FP+    ISQ  + SIG    A +G   A ++  PK            
Sbjct: 446 TGSFQFALRDFIFPSQLKYISQGFFLSIGMALPASMGVGIAMQDF-PKSHLIANGKEHSY 504

Query: 437 --RVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNDGYTIERLIHGEKAGYNDIQNWD 494
             R+ILF GDG+ Q+TVQE++TM+R  +   + +LNN+GYTIER I G    YNDI  W 
Sbjct: 505 QPRLILFEGDGAAQMTVQELTTMLRNKIPIEIILLNNNGYTIERAIKGPTRSYNDIMPWK 564

Query: 495 HLALLPTFGAKDYE---NHRVATTGEWDKLTQDKEFNK-NSKIRMIEVMLPVMDAPTSL 549
              L   FG  D +   N  V T  E D++ +D ++ K ++ I ++EV L VMD P  L
Sbjct: 565 WTKLFEAFGDFDNKYTMNTLVETRSELDRILEDLKYKKRDNLIELLEVKLDVMDFPKQL 623

>SAKL0G03036g Chr7 (250012..251925) [1914 bp, 637 aa] {ON} similar
           to uniprot|Q06408 Saccharomyces cerevisiae YDR380W ARO10
           Phenylpyruvate decarboxylase catalyzes decarboxylation
           of phenylpyruvate to phenylacetaldehyde which is the
           first specific step in the Ehrlich pathway
          Length = 637

 Score =  335 bits (858), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 206/601 (34%), Positives = 317/601 (52%), Gaps = 52/601 (8%)

Query: 4   ITLGRYLFERLNQVDVKTIFGLPGDFNLSLLDKIY----EVEGMRWAGNANELNAAYAAD 59
           I  G+Y+FERL     K++FG+PGDFNLSLL+ +Y    + + ++W G  NELNAAYAAD
Sbjct: 32  IPFGQYVFERLISAGTKSVFGVPGDFNLSLLEHMYSRTVQRKDLKWFGTCNELNAAYAAD 91

Query: 60  GYARIKG-MSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHT-- 116
           GY+R    + C+ITT+GVGELSA+NG+AG++AE+V VLH+VGV     +  +  +HH   
Sbjct: 92  GYSRYTNKIGCVITTYGVGELSAINGVAGAFAENVKVLHIVGVTPSKFRNDETFIHHNVH 151

Query: 117 -----LGNGDFT-----VFHRM-SANISETTAMVTDIATAPAEIDRCIRTTYITQRPVYL 165
                + N +F       +H M    IS +T  V ++  A  ++D+ +   Y   +P Y+
Sbjct: 152 HLIPAMDNPNFRGPNHRSYHDMIDGRISCSTEFVDNVDQACDQLDKVVNDIYKYSKPGYI 211

Query: 166 GLPANLVDLKVPAKLLETPIDLSLKPNDPEA-ETEVVDT----VLELIKAAKNPVILADA 220
            +PA+  D  V A+ L T   ++L+    +    EVVD+    +++L+  +K P ++ D 
Sbjct: 212 FIPADFADKMVNAQNLITTPTITLENVISQGFNQEVVDSMATKIIDLLYKSKTPAVIGDV 271

Query: 221 CASRHDVKAETKKLIDATQFPSFVTPMGKGSIDEQHPRFGGVYVGTLSRPEVKEAVESAD 280
              R     E +  +  T+  +F + MG+  +DE  P F GVY G  S P + +A+ S D
Sbjct: 272 LCDRFGCVNEIRNFVRITKMWAFSSFMGRSILDESEPNFHGVYNGAESSPHIIQAIGSCD 331

Query: 281 LILSVGALLSDFNTGSFSYSYKTKNI-VEFHSDYIKI------RNATFPGVQMKFALQKL 333
           LIL  G L ++ N G +S+S+      VE HSDY+              GV     L ++
Sbjct: 332 LILHFGVLKNEINNGHYSFSFNANATEVELHSDYLNFVDYKSGNEVLVKGVHFVSVLNRI 391

Query: 334 LNAVPEAIKGYKPVPVPARVPENKS----CDPATPLKQEWMWNQVSKFLQEGDVVITETG 389
           +  + +  K     P     PE  +      P + + Q+++ N +S++L  GDV + ETG
Sbjct: 392 IQLI-DVTKINLKYPDLTVNPEMATPAGIHSPESQITQKFLQNAMSEYLSPGDVFVVETG 450

Query: 390 TSAFGINQTPFPNNAYGISQVLWGSIGFTTGACLGAAFAAEE-------------IDPKK 436
           +  F +    FP N   ISQ  + SIG    +CLG   A ++             +D   
Sbjct: 451 SFQFVVRDFQFPTNVKYISQGFYLSIGMALPSCLGIGCAMKDYPGSHICDAGVSTLDYTP 510

Query: 437 RVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNDGYTIERLIHGEKAGYNDIQNWDHL 496
           ++IL  GDG+ Q+T+QE+++ +R+ +   +F+ NN GYT+ER I G    YNDI  W   
Sbjct: 511 KLILCEGDGAAQMTIQELTSFLRYQIPVEIFLWNNHGYTVERAIRGPTRSYNDIMEWKWT 570

Query: 497 ALLPTFGAKD---YENHRVATTGEW-DKLTQDKEFNKNSKIRMIEVMLPVMDAPTSLIEQ 552
            LL  FG  D    E  +V   GE+ D +   K   + SK+R+IEVML +MD P  L+  
Sbjct: 571 KLLEAFGDFDGSISEACKVKNVGEFKDVVGSLKHSKERSKVRLIEVMLGMMDIPKQLLAM 630

Query: 553 A 553
           A
Sbjct: 631 A 631

>Suva_2.554 Chr2 (984966..986873) [1908 bp, 635 aa] {ON} YDR380W
           (REAL)
          Length = 635

 Score =  333 bits (855), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 219/605 (36%), Positives = 320/605 (52%), Gaps = 56/605 (9%)

Query: 6   LGRYLFERLNQVDVKTIFGLPGDFNLSLLDKIY----EVEGMRWAGNANELNAAYAADGY 61
            G Y+F RL  +  K++FG+PGDFNLSLL+ +Y    E +G++W G  NELNAAYAADGY
Sbjct: 27  FGEYIFRRLFSIGTKSVFGVPGDFNLSLLEYLYAPSVESDGLQWVGTCNELNAAYAADGY 86

Query: 62  ARIKG-MSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVP----SISSQAKQLLLHH- 115
           +R    + C+ITT+GVGELSALNGIAGS+AE+V VLH+VGV     S S+  K+  LHH 
Sbjct: 87  SRYSNKIGCLITTYGVGELSALNGIAGSFAENVKVLHIVGVAKSTDSRSNNFKERNLHHL 146

Query: 116 --TLGNGDFT-----VFHRM-SANISETTAMVTDIATAPAEIDRCIRTTYITQRPVYLGL 167
              L + +F      V+H M   N++ + A + DI TA  ++D  IR  Y   +P Y+ +
Sbjct: 147 VPRLHDSNFKGPNHKVYHDMIKDNVACSVAYLEDIETACDQVDAVIRDIYRYSKPGYVFV 206

Query: 168 PANLVDLKVPA-KLLETPIDLSLKPNDPEAETE---VVDTVLELIKAAKNPVILADACAS 223
           PA+  D+ V    L+  P           +ET+   ++D +   + +++ P IL D    
Sbjct: 207 PADFPDMSVRLDNLINVPHISQQDCITSSSETQLFNIIDKITTWMYSSRTPAILGDVLTD 266

Query: 224 RHDVKAETKKLIDATQFPSFVTPMGKGSIDEQHPRFGGVYVGTLSRPEVKEAVESADLIL 283
           R+ V     KLI A++  +F T MGK  IDE +P + G+Y G     +V E  ES DLIL
Sbjct: 267 RYGVSDILNKLIYASKIWNFTTVMGKSVIDESNPSYMGLYNGKEGLKQVYEHFESCDLIL 326

Query: 284 SVGALLSDFNTGSFSYSYK-TKNIVEFHSDYIKIRNA------TFPGVQMKFALQKLLNA 336
             G  +++ N G +S++YK    I++FH +YI+  +        F GV     LQ+L   
Sbjct: 327 HFGVDINEINNGHYSFTYKPNAKIIQFHPNYIRFVDTRYGEEQIFEGVNFVPVLQELYQC 386

Query: 337 VPEAIKGYK------PVPVPARVPENKSCDPATPLKQEWMWNQVSKFLQEGDVVITETGT 390
           +  +    +      P        E+ + D +T + Q  +   + KFL  GDVV+ ETG+
Sbjct: 387 IDVSKLSLQYDSRVTPYTNETMKLEDPTNDQSTDITQIHLQKVIPKFLNPGDVVVCETGS 446

Query: 391 SAFGINQTPFPNNAYGISQVLWGSIGFTTGACLGAAFAAEEIDP-------------KKR 437
             F +    FP     ISQ  + SIG    A LG   A ++  P             K R
Sbjct: 447 FQFSVRDFAFPTQLKYISQGFFLSIGMALPAALGVGIAMQD-HPNTHINGGNINEGYKPR 505

Query: 438 VILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNDGYTIERLIHGEKAGYNDIQNWDHLA 497
           +ILF GDG+ Q+T+QE+ST++++ +   + + NN+GYTIER I G    YNDI +W    
Sbjct: 506 LILFEGDGAAQMTIQELSTILKFHIPIEIVIWNNNGYTIERAIMGPTRSYNDIMSWKWTK 565

Query: 498 LLPTFGAKD--YENHRVATTGEWDKLTQDKEFNKNS--KIRMIEVMLPVMDAPTSL---I 550
           L   FG  D  Y N+ +  T     L      N ++  +I ++EV L V+D P  L   +
Sbjct: 566 LFEAFGDFDGKYTNNTIIETTSKLALKLKDLKNSSTRDRIELLEVKLGVLDFPEQLRCMV 625

Query: 551 EQAKL 555
           E A L
Sbjct: 626 EAAAL 630

>Skud_4.651 Chr4 (1157087..1158994) [1908 bp, 635 aa] {ON} YDR380W
           (REAL)
          Length = 635

 Score =  333 bits (853), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 216/607 (35%), Positives = 322/607 (53%), Gaps = 65/607 (10%)

Query: 1   MSEITLGRYLFERLNQVDVKTIFGLPGDFNLSLLDKIY----EVEGMRWAGNANELNAAY 56
           ++ I+ G Y+F RL     K++FG+PGDFNLSLL+ +Y    E  G++W G  NELNAAY
Sbjct: 22  LATISFGEYIFRRLLSTGTKSVFGVPGDFNLSLLEYLYAPSVESAGLKWIGTCNELNAAY 81

Query: 57  AADGYARI-KGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVP-SISSQAKQLL-- 112
           AADGY+R    + C++TTFGVGELSALNG+AGS+AE+V VLH+VGV  SI S++      
Sbjct: 82  AADGYSRYSNNIGCLVTTFGVGELSALNGVAGSFAENVKVLHIVGVAKSIDSRSDNFRDR 141

Query: 113 -LHH---TLGNGDFT-----VFHRMSAN-ISETTAMVTDIATAPAEIDRCIRTTYITQRP 162
            +HH    L   +F      V+H M  + ++ + A + DI TA  ++D  IR  Y   +P
Sbjct: 142 NMHHLVPQLHGSNFKGPNHKVYHDMVKDRVACSVAYLEDIETACDQVDNVIRDIYKYSKP 201

Query: 163 VYLGLPANLVDLKVPAK-LLETP----IDLSLKPNDPEAETEVVDTVLELIKAAKNPVIL 217
            Y+ +PA+  D+ V  + L+  P     D    P+  +   +++D +   + ++K P IL
Sbjct: 202 GYIFVPADFADMSVTCENLINVPHISQQDCITYPSQIQL-FDILDRITSWMYSSKTPAIL 260

Query: 218 ADACASRHDVKAETKKLIDATQFPSFVTPMGKGSIDEQHPRFGGVYVGTLSRPEVKEAVE 277
            D    R+ V     KLI AT   +F T MGK  IDE +P++ G Y G     +V E  E
Sbjct: 261 GDVLTDRYGVSEILNKLIYATGIWNFSTVMGKSVIDEANPKYMGQYNGKEGLRQVYEHFE 320

Query: 278 SADLILSVGALLSDFNTGSFSYSYK-TKNIVEFHSDYIKIRNATFPGVQMKFALQKLLNA 336
           S DL+L  G  +++ N G ++++YK    I++FH +YI+  +  +   QM     + +N 
Sbjct: 321 SCDLVLHFGVDINEINNGHYTFTYKPNAKIIQFHPNYIRFVDTKYGHEQMF----EGINF 376

Query: 337 VPEAIKGYKPVPVPARVP-----------------ENKSCDPATPLKQEWMWNQVSKFLQ 379
            P  ++ YK + V +R+                  E+ + D +  + Q  +   + KFL 
Sbjct: 377 APVLMELYKGIDV-SRLSLQYDSGVTSYTNETMQLEDPTNDQSNNITQVHLQKVMPKFLS 435

Query: 380 EGDVVITETGTSAFGINQTPFPNNAYGISQVLWGSIGFTTGACLGAAFAAEEI------- 432
            GDVV+ ETG+  F +    FP     ISQ  + SIG    A LG   A ++        
Sbjct: 436 PGDVVVCETGSFQFSVRDFAFPTQLKYISQGFFLSIGMALPAALGVGIAMQDFPNAHISD 495

Query: 433 -----DPKKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNDGYTIERLIHGEKAGY 487
                  K R+ILF GDG+ Q+T+QE+ST+++  +   +F+ NN+GYTIER I G    Y
Sbjct: 496 ENIGEGYKPRLILFEGDGAAQMTIQELSTILKCHITIDIFIWNNNGYTIERAIMGPTRAY 555

Query: 488 NDIQNWDHLALLPTFGAKDYENHRVATTGEWD-----KLTQDKEFNKNSKIRMIEVMLPV 542
           ND+ +W    LL  FG  D   H  +T  E+      KL + K  N    I ++EV L V
Sbjct: 556 NDVMSWKWTKLLEAFGDFD-RKHTNSTVIEYPSKLAMKLEELKSSNTRDGIELVEVKLGV 614

Query: 543 MDAPTSL 549
           +D P  L
Sbjct: 615 LDFPEQL 621

>KLTH0F15510g Chr6 complement(1265767..1267644) [1878 bp, 625 aa]
           {ON} similar to uniprot|Q06408 Saccharomyces cerevisiae
           YDR380W ARO10 Phenylpyruvate decarboxylase catalyzes
           decarboxylation of phenylpyruvate to phenylacetaldehyde
           which is the first specific step in the Ehrlich pathway
          Length = 625

 Score =  330 bits (846), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 210/600 (35%), Positives = 326/600 (54%), Gaps = 57/600 (9%)

Query: 3   EITLGRYLFERLNQVDVKTIFGLPGDFNLSLLDKIYEVE----GMRWAGNANELNAAYAA 58
            I LG+Y+FER+     +TIFG+PGDFNLSLL+ IY  E    G++W G  NELNAAYAA
Sbjct: 21  RIPLGQYIFERIVSSGTRTIFGVPGDFNLSLLEHIYNPEVALKGIKWIGTCNELNAAYAA 80

Query: 59  DGYARIKG-MSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGV-PSI----SSQAKQLL 112
           DGY+R    + C+ITT GVGELSALNGIAG++AE V +LH+VGV PS     S+Q+   +
Sbjct: 81  DGYSRYTNKIGCLITTLGVGELSALNGIAGAFAEDVKILHIVGVAPSQFYEGSAQSSHNV 140

Query: 113 LHHTLGNGDFTVF---HRM-----SANISETTAMVTDIATAPAEIDRCIRTTYITQRPVY 164
            H      D  +    HR+        +S ++  + DI++A  +ID  I   Y   +P Y
Sbjct: 141 HHLVPAVFDSNIHAPNHRVYRDMVDKRVSCSSLFLDDISSACDQIDTVISDIYRYSKPGY 200

Query: 165 LGLPANLVDLKVPAKLLETPIDLSLKP-------NDPEAETEVVDTVLELIKAAKNPVIL 217
           + +PA+  D  V A+ LE    + L+        ND + + E+ + +LE + ++  P I+
Sbjct: 201 IFIPADFTDKLVDARNLEKRPAILLRDVVSGFCINDHKCQ-ELAEYILESMYSSSRPAII 259

Query: 218 ADACASRHDVKAETKKLIDATQFPSFVTPMGKGSIDEQHPRFGGVYVGTLSRPEVKEAVE 277
           AD    R+D+ +  ++L++ T   +F + MGK  +DE +  F GVY G+ S+ +V +  +
Sbjct: 260 ADILCDRYDLTSSLRELVNKTHVWNFASSMGKSILDENNLGFRGVYNGSESQDQVLKDFQ 319

Query: 278 SADLILSVGALLSDFNTGSFSYSYKT-KNIVEFHSDYIKIRNA-----TFPGVQMKFALQ 331
           + D +L VG + ++ NTG +SY +    NIVE H  Y+   +A      +   Q  F + 
Sbjct: 320 TCDFLLHVGVVKNEMNTGHYSYKFSNHSNIVELHPSYVNFIDADTGKNRYVTGQYFFKVL 379

Query: 332 KLLNAVPEAIK---GYKPVPVPARVPENKSCD-PATPLKQEWMWNQVSKFLQEGDVVITE 387
            ++  + +  K   GY+   +P+R  E   C  P + +   ++     KFL  GDV + +
Sbjct: 380 DMMTQMIDPTKLHLGYQE-SIPSRTQE--YCGPPHSSVTHSYLQTHFPKFLSSGDVFVVD 436

Query: 388 TGTSAFGINQTPFPNNAYGISQVLWGSIGFTTGACLGAAFAAEEI-------------DP 434
           TG+  FG+    FP++   ISQ  + SIG      LG     ++              + 
Sbjct: 437 TGSFQFGVRDYRFPSDLKYISQSFYLSIGMALPCALGVGLGMQDYPSNHIISSALVQRNY 496

Query: 435 KKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNDGYTIERLIHGEKAGYNDIQNWD 494
           + R+IL  GDG+ Q+T+QE+++ +R+ +   LF+ NN GYT+ER I G    YNDI  W+
Sbjct: 497 QPRLILCEGDGAAQMTIQELTSFLRYKVPIDLFIWNNGGYTVERAIKGPNRPYNDIMAWE 556

Query: 495 HLALLPTFGAKDYEN---HRVATTGEWDKLTQD-KEFNKNSK-IRMIEVMLPVMDAPTSL 549
              LL  FG    EN    +V++  +  +L +  +  +K SK +R++EVML VMD P  L
Sbjct: 557 WTELLRVFGDPKLENSVSQKVSSADQMSELLKTFRSSDKRSKLVRLVEVMLGVMDFPEQL 616

>ACR211W Chr3 (716693..718582) [1890 bp, 629 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR380W (ARO10)
          Length = 629

 Score =  328 bits (842), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 208/596 (34%), Positives = 316/596 (53%), Gaps = 44/596 (7%)

Query: 2   SEITLGRYLFERLNQVDVKTIFGLPGDFNLSLLDKIYE----VEGMRWAGNANELNAAYA 57
           +E+ LG Y+F RL     KT+FG+PGDFN+ LL+ +Y      EG++W G  NELNAAYA
Sbjct: 28  AEMPLGEYMFRRLMSAGTKTVFGVPGDFNMGLLEHMYGEAVCAEGLQWIGTCNELNAAYA 87

Query: 58  ADGYAR-IKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLL---L 113
           ADGY+R    + C++TT GVGELSALNG+AG++AEHV VLH+VGV   ++Q    L   +
Sbjct: 88  ADGYSRYCNKIGCVVTTLGVGELSALNGVAGAFAEHVKVLHIVGVSMRAAQTHPELHGNV 147

Query: 114 HH---TLGNGDFT-----VFHRM-SANISETTAMVTDIATAPAEIDRCIRTTYITQRPVY 164
           HH    L N +F      V+  M S  +S     + D+ TA  +ID  IR  +   +P Y
Sbjct: 148 HHLVPRLRNSNFKAPNHKVYSEMVSGRVSCCCEFLEDLETACDQIDHVIREIWRHGKPGY 207

Query: 165 LGLPANLVDLKVPAK-LLETPIDL----SLKPNDPEAETEVVDTVLELIKAAKNPVILAD 219
           L +PA++ ++KV ++ L++ P  +     L+  +  A   +   +L+ +  +  P IL D
Sbjct: 208 LFVPADMPNMKVSSRNLVQAPTIMLESAVLERTNLAACDRIGIEILQHLYQSSTPAILCD 267

Query: 220 ACASRHDVKAETKKLIDATQFPSFVTPMGKGSIDEQHPRFGGVYVGTLSRPEVKEAVESA 279
               R  +  + ++L++ T   +F T MGK  +DE  P + GVY G  S+ E    ++  
Sbjct: 268 GLCDRFGLTGDVRRLVELTGMWNFSTIMGKSILDETQPHYKGVYYGAGSK-ERNALLQEC 326

Query: 280 DLILSVGALLSDFNTGSFSYSYKTKN-IVEFHSDYIKI-RNA---TFPGVQMKFALQKLL 334
           DLIL +G +  + NT  +++ +  ++ I+E H +Y+ + RN          +   L+ +L
Sbjct: 327 DLILYLGPVKDEVNTWKYTFQFNPQSMIIELHPEYVSLTRNGEQTILNSGHLLPVLRSIL 386

Query: 335 NAVPEAIKGYKPVPVPARVPENKSCDPATPLKQEWMWNQVSKFLQEGDVVITETGTSAFG 394
             +  A   +       RVP         P+ Q  + + + + L  GDV++ +TGT  F 
Sbjct: 387 AHLNVANLSFNYPTAKKRVPREHQYAADEPITQGMLQHMIPECLNPGDVMVVDTGTFQFS 446

Query: 395 INQTPFPNNAYGISQVLWGSIGFTTGACLGAAFAAEE-----IDPK-------KRVILFI 442
           +    FP +   ISQ  + SIG    A LG A A  E     + PK        R++L  
Sbjct: 447 VFDMKFPTDLKCISQSFYLSIGMALPAALGVACAMREFPRLHLGPKLANEGYTPRLVLCE 506

Query: 443 GDGSLQLTVQEISTMIRWGLKPYLFVLNNDGYTIERLIHGEKAGYNDIQNWDHLALLPTF 502
           GDG+ Q+T+QE+ST IR+ L   + + NNDGYT+ER+I G    YNDI +WD   LL  F
Sbjct: 507 GDGAAQMTIQELSTFIRYELPVEVLLWNNDGYTVERVIKGPTRSYNDIMSWDWTKLLRVF 566

Query: 503 GAKDYENHRVATTGEWDKLTQD----KEFNKNSKIRMIEVMLPVMDAPTSLIEQAK 554
           G  D          +++ L +     K   K SKIR++EV+L  MD   +L E AK
Sbjct: 567 GDFDGTRSESVRVKDFNSLIEHLSSWKSDKKRSKIRLMEVILDKMDISATLKELAK 622

>YDR380W Chr4 (1234218..1236125) [1908 bp, 635 aa] {ON}
           ARO10Phenylpyruvate decarboxylase, catalyzes
           decarboxylation of phenylpyruvate to phenylacetaldehyde,
           which is the first specific step in the Ehrlich pathway
          Length = 635

 Score =  328 bits (841), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 222/611 (36%), Positives = 325/611 (53%), Gaps = 64/611 (10%)

Query: 4   ITLGRYLFERLNQVDVKTIFGLPGDFNLSLLDKIY----EVEGMRWAGNANELNAAYAAD 59
           I  G Y+F+RL  +D K++FG+PGDFNLSLL+ +Y    E  G+RW G  NELNAAYAAD
Sbjct: 25  IPFGEYIFKRLLSIDTKSVFGVPGDFNLSLLEYLYSPSVESAGLRWVGTCNELNAAYAAD 84

Query: 60  GYARIKG-MSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVP-SISSQAKQLL---LH 114
           GY+R    + C+ITT+GVGELSALNGIAGS+AE+V VLH+VGV  SI S++       LH
Sbjct: 85  GYSRYSNKIGCLITTYGVGELSALNGIAGSFAENVKVLHIVGVAKSIDSRSSNFSDRNLH 144

Query: 115 H---TLGNGDFT-----VFHRMSAN-ISETTAMVTDIATAPAEIDRCIRTTYITQRPVYL 165
           H    L + +F      V+H M  + ++ + A + DI TA  ++D  IR  Y   +P Y+
Sbjct: 145 HLVPQLHDSNFKGPNHKVYHDMVKDRVACSVAYLEDIETACDQVDNVIRDIYKYSKPGYI 204

Query: 166 GLPANLVDLKVPA-KLLETPI----DLSLKPNDPEAETEVVDTVLELIKAAKNPVILADA 220
            +PA+  D+ V    L+  P     D  + P++ +  +++++ +   I ++K P IL D 
Sbjct: 205 FVPADFADMSVTCDNLVNVPRISQQDCIVYPSENQL-SDIINKITSWIYSSKTPAILGDV 263

Query: 221 CASRHDVKAETKKLIDATQFPSFVTPMGKGSIDEQHPRFGGVYVGTLSRPEVKEAVESAD 280
              R+ V     KLI  T   +F T MGK  IDE +P + G Y G     +V E  E  D
Sbjct: 264 LTDRYGVSNFLNKLICKTGIWNFSTVMGKSVIDESNPTYMGQYNGKEGLKQVYEHFELCD 323

Query: 281 LILSVGALLSDFNTGSFSYSYK-TKNIVEFHSDYIKIRNATFPGVQMKFALQKLLNAVPE 339
           L+L  G  +++ N G ++++YK    I++FH +YI++ + T  G +  F   K +N  P 
Sbjct: 324 LVLHFGVDINEINNGHYTFTYKPNAKIIQFHPNYIRLVD-TRQGNEQMF---KGINFAPI 379

Query: 340 AIKGYKPVPVPARVPENKSC------------DP----ATPLKQEWMWNQVSKFLQEGDV 383
             + YK + V     +  S             DP    ++ + Q  +   + KFL  GDV
Sbjct: 380 LKELYKRIDVSKLSLQYDSNVTQYTNETMRLEDPTNGQSSIITQVHLQKTMPKFLNPGDV 439

Query: 384 VITETGTSAFGINQTPFPNNAYGISQVLWGSIGFTTGACLGAAFAAEEI----------- 432
           V+ ETG+  F +    FP+    ISQ  + SIG    A LG   A ++            
Sbjct: 440 VVCETGSFQFSVRDFAFPSQLKYISQGFFLSIGMALPAALGVGIAMQDHSNAHINGGNVK 499

Query: 433 -DPKKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNDGYTIERLIHGEKAGYNDIQ 491
            D K R+ILF GDG+ Q+T+QE+ST+++  +   + + NN+GYTIER I G    YND+ 
Sbjct: 500 EDYKPRLILFEGDGAAQMTIQELSTILKCNIPLEVIIWNNNGYTIERAIMGPTRSYNDVM 559

Query: 492 NWDHLALLPTFGAKD--YENHRV--ATTGEWDKLTQDKEFNKNSKIRMIEVMLPVMDAPT 547
           +W    L   FG  D  Y N  +    +    KL + K  NK S I ++EV L  +D P 
Sbjct: 560 SWKWTKLFEAFGDFDGKYTNSTLIQCPSKLALKLEELKNSNKRSGIELLEVKLGELDFPE 619

Query: 548 SL---IEQAKL 555
            L   +E A L
Sbjct: 620 QLKCMVEAAAL 630

>Smik_4.649 Chr4 (1154670..1156577) [1908 bp, 635 aa] {ON} YDR380W
           (REAL)
          Length = 635

 Score =  327 bits (838), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 219/617 (35%), Positives = 326/617 (52%), Gaps = 70/617 (11%)

Query: 1   MSEITLGRYLFERLNQVDVKTIFGLPGDFNLSLLDKIY----EVEGMRWAGNANELNAAY 56
           ++ I  G Y+F RL  +  K++FG+PGDFNLSLL+ +Y    E  G+RW G  NELNAAY
Sbjct: 22  LATIPFGEYIFRRLLSIGTKSVFGVPGDFNLSLLEYLYSPNVESAGLRWVGTCNELNAAY 81

Query: 57  AADGYARIKG-MSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVP----SISSQAKQL 111
           AADGY+R    + C+ITT+GVGELSALNGIAGS+AE+V VLH+VGV     S S+  K+ 
Sbjct: 82  AADGYSRYSNKIGCLITTYGVGELSALNGIAGSFAENVKVLHIVGVAKSIDSRSNNFKER 141

Query: 112 LLHH---TLGNGDFT-----VFHRMSAN-ISETTAMVTDIATAPAEIDRCIRTTYITQRP 162
            LHH    + N +F      V+H M  + ++ + A + DI TA  ++D  IR  +   +P
Sbjct: 142 NLHHLVPQVHNSNFKGPNHKVYHDMVKDRVACSVAYLEDIETACVQVDNVIRDIFKYSKP 201

Query: 163 VYLGLPANLVDLKVPA-KLLETP----IDLSLKPNDPEAET-EVVDTVLELIKAAKNPVI 216
            Y+ +PA+  D+ V A  L++ P     D    P  PE +  +++D +   + ++K P I
Sbjct: 202 GYIFVPADFADMSVAADNLVKVPHISQQDCITYP--PEVQLLDIIDKITSWMYSSKTPAI 259

Query: 217 LADACASRHDVKAETKKLIDATQFPSFVTPMGKGSIDEQHPRFGGVYVGTLSRPEVKEAV 276
           L D    R+ V     +LI  T+  +F T MGK  IDE +P + G Y G     +V +  
Sbjct: 260 LGDVLTDRYGVSNILNELIYTTKIWNFSTVMGKSVIDESNPTYMGQYNGKEGLKQVYKHF 319

Query: 277 ESADLILSVGALLSDFNTGSFSYSYK-TKNIVEFHSDYIKIRNATFPGVQMKFALQKLLN 335
           ES DL+L  G  +++ N G ++++YK    I++FH +YI+  +  +   QM     + +N
Sbjct: 320 ESCDLVLHFGVDINEINNGHYTFTYKPNAKIIQFHPEYIRFVDTKYGDEQMF----EGVN 375

Query: 336 AVPEAIKGYKPVPVPARVP-----------------ENKSCDPATPLKQEWMWNQVSKFL 378
            VP   + YK + V AR+                  E+ + D ++ + Q  +   +  FL
Sbjct: 376 FVPVLKELYKLIDV-ARLSLQYDSNVTSYTNETMQIEDLTDDQSSIITQAHLQKVMPGFL 434

Query: 379 QEGDVVITETGTSAFGINQTPFPNNAYGISQVLWGSIGFTTGACLGAAFAAEEI------ 432
             GDVV+ ETG+  F +    FP     ISQ  + SIG    A LG   A ++       
Sbjct: 435 NPGDVVVCETGSFQFSVRDFAFPTQLKYISQGFFLSIGMALPAALGVGIAMQDYSNAHIN 494

Query: 433 ------DPKKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNDGYTIERLIHGEKAG 486
                 D K R+ILF GDG+ Q+T+QE+ST+++  +   + + NN+GYTIER I G    
Sbjct: 495 GSNVKEDYKPRLILFEGDGAAQMTIQELSTILKCNVPLEIIIWNNNGYTIERAIMGPTRS 554

Query: 487 YNDIQNWDHLALLPTFGAKDYENHRVATTGEWDKLTQDKEFN-----KNSKIRMIEVMLP 541
           YNDI +W    L   FG  D   H  +T  E+      K        + ++I ++EV L 
Sbjct: 555 YNDIMSWKWTKLFEAFGDFD-GKHTSSTLIEFPSKLALKLKELKNSARRNQIELLEVKLG 613

Query: 542 VMDAPTSL---IEQAKL 555
           V+D P  L   +E A L
Sbjct: 614 VLDFPEQLKCMVEAAAL 630

>ZYRO0G04378g Chr7 complement(350070..351911) [1842 bp, 613 aa] {ON}
           similar to uniprot|Q06408 Saccharomyces cerevisiae
           YDR380W ARO10 Phenylpyruvate decarboxylase catalyzes
           decarboxylation of phenylpyruvate to phenylacetaldehyde
           which is the first specific step in the Ehrlich pathway
          Length = 613

 Score =  318 bits (814), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 215/611 (35%), Positives = 318/611 (52%), Gaps = 62/611 (10%)

Query: 3   EITLGRYLFERLNQVDVKTIFGLPGDFNLSLLDKIYEVE----GMRWAGNANELNAAYAA 58
            I  G YLF++L Q   K+IFG+PGD+NL LL+ +Y+      G RW    NELNAAYAA
Sbjct: 15  RIPFGEYLFKKLVQSGSKSIFGVPGDYNLPLLEHLYDDSVKDIGCRWIACCNELNAAYAA 74

Query: 59  DGYARIKG-MSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHH-- 115
           DGY+R    ++ +ITT+GVGELSA+NG+AGS AE+V VLH+VGV  + S A +   HH  
Sbjct: 75  DGYSRYTNKLATLITTYGVGELSAINGVAGSSAENVKVLHIVGV--VKSDAPECNYHHLI 132

Query: 116 -TLGNGDFT------VFHRMSANISETTAMVTDIATAPAEIDRCIRTTYITQRPVYLGLP 168
             L + +F        +  +   ++ +   + DI TAP ++D+ I   Y   +P YL +P
Sbjct: 133 PQLQHSNFIGPNRKICYDMVKDRVACSAEYLEDIETAPEKVDKVITEIYKHSKPGYLFVP 192

Query: 169 ANLVDLKVPAKLLETPIDL--SLKPNDPEAETEVVDTVLELIKAAKNPVILADACASRHD 226
           A+  D  V    L   I+L  S++    E    +VD VL+ I  ++ P ILAD    R  
Sbjct: 193 ADFADKLVDTTCLNNEINLCNSIERTPSEKLDSIVDGVLQWIYQSQTPAILADGNVDRFG 252

Query: 227 VKAETKKLIDATQFPSFVTPMGKGSIDEQHPRFGGVYVGTLSRPEVKEAVESADLILSVG 286
           + ++  + I+ TQ  +F T MGK  IDE +PR+ G+Y G      V+    S DLIL  G
Sbjct: 253 LISQLNQFIERTQMVNFTTIMGKSIIDETNPRYQGLYAGKSCTDLVRSKFLSCDLILHFG 312

Query: 287 ALLSDFNTGSFSYSYKTK-NIVEFHSDYIKI-----------RNATFPGV----QMKFAL 330
              ++ N  +  + Y  +  ++EFH  YI++            N  F  V      +  +
Sbjct: 313 VEKNEVNYCAQGFPYGPQAKVIEFHQSYIRLFDTLNGDEQLFENVNFVDVLTALHQRIDI 372

Query: 331 QKLLNAVPEAI-KGYKPVPVPARVPENKSCDPATPLKQEWMWNQVSKFLQEGDVVITETG 389
            KL     +AI   Y+P  +   +PE  + D    + Q ++  +  + L  GD+++++TG
Sbjct: 373 SKLNLQYDKAIFTTYEPSQL--NLPEEDTSD----VTQIYLQKKFPEILAPGDILVSDTG 426

Query: 390 TSAFGINQTPFPNNAYGISQVLWGSIGFTTGACLGAAFAAEE------IDPKK------- 436
           +  FG+     P  +  ++Q  W SIG    A LG     ++       D  K       
Sbjct: 427 SFQFGVRDYKLPTQSKFMAQSTWLSIGMGLPAALGVGIGMQDYPRIHICDQSKVPAGYKP 486

Query: 437 RVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNDGYTIERLIHGEKAGYNDIQNWDHL 496
           +++L +GDG+ Q+TVQE++TM+R+ +   +FV NN+GYTIER I GE + YNDI  W   
Sbjct: 487 KLVLGVGDGAAQMTVQELTTMLRYHVDINVFVWNNNGYTIERAIMGENSDYNDIMPWRWT 546

Query: 497 ALLPTFGAKD--YENHR-VATTGEWDKLTQDKEFNKNSK-IRMIEVMLPVMDAPTSLIEQ 552
            L   FG  D  Y N   V T  E D+  +D   NK  K I ++EV L VMD P  L  Q
Sbjct: 547 KLFEAFGDFDGKYSNSSLVKTRQELDQKIED--INKGGKGIELVEVKLGVMDYPAQL--Q 602

Query: 553 AKLTASINAKQ 563
             L+   NAK+
Sbjct: 603 MMLSNMKNAKK 613

>KAFR0E03730 Chr5 complement(746616..748523) [1908 bp, 635 aa] {ON}
           Anc_5.456 YDR380W
          Length = 635

 Score =  315 bits (806), Expect = 5e-99,   Method: Compositional matrix adjust.
 Identities = 206/614 (33%), Positives = 328/614 (53%), Gaps = 68/614 (11%)

Query: 3   EITLGRYLFERLNQVDVKTIFGLPGDFNLSLLDKIYE----VEGMRWAGNANELNAAYAA 58
           +I  G Y+F+R+     K++FG+PGDFNL LL+ +Y+     +G+RW G  NELNAAYAA
Sbjct: 24  QIRFGEYIFQRILSCGTKSVFGVPGDFNLPLLEYLYDDSIINQGLRWIGTCNELNAAYAA 83

Query: 59  DGYARI-KGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVP-SISSQA---KQLLL 113
           DGY+R  +G+ C+ITT+GVGELSA+NGIAG++AE+V +LH+VGV  SI SQ    KQ  L
Sbjct: 84  DGYSRYSQGIGCLITTYGVGELSAMNGIAGAFAENVKLLHIVGVARSIDSQHDDFKQRNL 143

Query: 114 HH---TLGNGDFT-----VFHRMSAN-ISETTAMVTDIATAPAEIDRCIRTTYITQRPVY 164
           HH    L + +F+     +++ M  + IS +T  + +I TA  ++D+ I   Y   +P Y
Sbjct: 144 HHLVPQLNDSNFSGPNHKIYYEMVKDRISCSTEYLENIDTACDQVDKVIMDIYRYSKPGY 203

Query: 165 LGLPANLVDLKVPAK-LLETPI----DLSLKPNDPEAETEVVDTVLELIKAAKNPVILAD 219
           + +P + V++ V  K LL+ P     D  L+ +      ++ + +L+ I ++K+P I+ D
Sbjct: 204 IFVPCDFVNMMVDTKNLLQRPKITFQDCILQDDKLNQIDQITNLILDQIYSSKSPAIIGD 263

Query: 220 ACASRHDVKAETKKLIDATQFPSFVTPMGKGSIDEQHPRFGGVYVGTLSRPEVKEAVESA 279
               R+       + I  T+  +F T  GK  I+EQ+P + G+Y G      V +     
Sbjct: 264 VLTDRYHGNKLLNEFITLTKIWNFTTFNGKSIINEQNPYYMGLYNGNEGAETVIDRFLKC 323

Query: 280 DLILSVGALLSDFNTGSFSYSYKTK-NIVEFHSDYIKIRNA------TFPGVQMKFALQK 332
           DLI++VG  +++ N G +++SY+    ++E H  YI++ +        F G+     L++
Sbjct: 324 DLIINVGIDINEINHGHYTFSYRQNAKLIEMHPTYIRLYDTGSHEETLFKGINFIHVLKR 383

Query: 333 LLNAVP---------EAIKGYKPVPVPARVPENKSCDP-ATPLKQEWMWNQVSKFLQEGD 382
           +L  +           ++  + P  +  + P   S DP +  + Q ++   V  +L +GD
Sbjct: 384 MLIKIDIKRFDFDYDPSVTKFDPT-IELKFP---SADPDSNKITQNFLAQNVPDYLNDGD 439

Query: 383 VVITETGTSAFGINQTPFPNNAYGISQVLWGSIGFTTGACLGAAFAAEEIDPK------- 435
           V++ ETG   F       P+    I+Q  + SIG    A LG   A ++  P+       
Sbjct: 440 VLVVETGAFQFATRDFLLPDQLKYITQGFYLSIGTALPAALGVGIAMQDY-PRCHLYGKI 498

Query: 436 -----KRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNDGYTIERLIHGEKAGYNDI 490
                 R+IL  GDG+ Q+TVQE+S+ IR+ +   + +LNNDGYTIER I G    YNDI
Sbjct: 499 PETYNPRLILMEGDGAAQMTVQELSSFIRYNIPIEIILLNNDGYTIERAILGPTRSYNDI 558

Query: 491 QNWDHLALLPTFGAKDYENHRVATT------GEWDKLTQDKEFNKNSKIRMIEVMLPVMD 544
             W+   +    G  D++N     T         +K  Q K   + +KI  IEV+L V+D
Sbjct: 559 MAWNWTKIFEALG--DFDNKATVNTTIKSPSKLLNKFKQLKNETERNKIEFIEVILGVLD 616

Query: 545 AP---TSLIEQAKL 555
            P    S++E AK+
Sbjct: 617 YPEQLKSMVEAAKV 630

>TPHA0J02680 Chr10 (593893..595839) [1947 bp, 648 aa] {ON} Anc_5.456
           YDR380W
          Length = 648

 Score =  315 bits (807), Expect = 6e-99,   Method: Compositional matrix adjust.
 Identities = 213/628 (33%), Positives = 325/628 (51%), Gaps = 77/628 (12%)

Query: 2   SEITLGRYLFERLNQVDVKTIFGLPGDFNLSLLDKIY-------EVEGMRWAGNANELNA 54
           + ITL  Y+F RL      ++FG+PGDFNL LL+ +Y       EVE + W G  NELNA
Sbjct: 15  NSITLAEYIFRRLRSSGTYSLFGVPGDFNLPLLESLYHKTADGKEVELLNWIGCCNELNA 74

Query: 55  AYAADGYARIKG-MSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISS-QAKQLL 112
           AYAADGY+R    + C++TTFGVGE+SALNGI G+  E+V VL++VG+P      + Q  
Sbjct: 75  AYAADGYSRYTNKIGCLVTTFGVGEISALNGIVGAAVENVKVLNIVGIPPTHILNSSQYN 134

Query: 113 LHHTLGN--------GDFTVFHRMSAN-ISETTAMV--TDIATAPA-----EIDRCIRTT 156
           +HH++ N         ++  +  M  N I+     +  +DI    +     +ID+ I+  
Sbjct: 135 IHHSIPNLKNSNSGVPNYKTYCDMVLNNITNNVEFLELSDIKNQNSNQVCNKIDQLIKNI 194

Query: 157 YITQRPVYLGLPANLVDLKVPAKLL----ETPIDLSLKPNDPE----AETEVVDTVLELI 208
           +I+ +P YL +P+N+ ++ V +  L    +  +D +LK          E ++++ + +L+
Sbjct: 195 FISSKPGYLFVPSNMTNMMVSSANLTLLPQINLDWALKSTRSNLSETIENDIIEEISQLL 254

Query: 209 KAAKNPVILADACASRHDVKAETKKLIDATQFPSFVTPMGKGSIDEQHPRFGGVYVGTLS 268
             +K P IL D    R D + +  +LI      +F T +GK  IDE + RF G Y G  S
Sbjct: 255 YKSKKPCILCDVFIDRFDCRIQVNQLISKLNIWNFSTMLGKSIIDEDNDRFMGTYNGVTS 314

Query: 269 RPEVKEAVESADLILSVGALLSDFNTGSFSYSYKTKN-IVEFHSDYIKIR------NATF 321
              VK+  ES DLIL +G   ++ NTG +S+SY     I+E   DYIKI       +   
Sbjct: 315 DSYVKDNFESCDLILHLGIETNEMNTGCYSFSYLPDAVIIEVGKDYIKISKHDGKISKII 374

Query: 322 PGVQMKFALQKLLNAVP------------EAIKGYKPVPVPARVPENKSCDPA-TPLKQE 368
             + ++  +QKLL+ +             E+   YK   +  +  EN     A   + Q+
Sbjct: 375 NDIMLRDVIQKLLHFIDDSKCTYSFDNNVESFPTYKNKLISKKSLENNVESKAQQTVTQD 434

Query: 369 WMWNQVSKFLQEGDVVITETGTSAFGINQTPFPNNAYGISQVLWGSIGFTTGACLGAAFA 428
            +  ++     +GDVV+ ETG+  F I    FP     I+Q  + SIG    A LG    
Sbjct: 435 DLQVEIQTLFDKGDVVVVETGSFQFAIPDMIFPKETKLINQGFYLSIGMALPASLGVGIG 494

Query: 429 ------------AEEIDPKKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNDGYTI 476
                       +E+  PKK +ILF GDG+ Q+T+QE+S+++R+ +   +F+ NN+GYT+
Sbjct: 495 MRDYPNCHINDNSEDATPKK-LILFEGDGAAQMTIQELSSLLRYRIPIDIFIWNNNGYTV 553

Query: 477 ERLIHGEKAGYNDIQNWDHLALLPTFGAKDYE-----NHRVATTGEWD-KLTQDKEFNKN 530
           ER+  GEK  YNDI  W  + LL  FG  D+E     +  ++T  E   K+ + K  N  
Sbjct: 554 ERIFEGEKRSYNDIMPWKWVNLLKVFG--DHEKTFSKSTTISTVQELRCKIDELKNANPQ 611

Query: 531 SKIRMIEVMLPVMDAPTSL---IEQAKL 555
             I +IEV L  MD P +L   +EQ KL
Sbjct: 612 KIIELIEVKLGEMDIPKNLKHIVEQMKL 639

>TBLA0A06420 Chr1 complement(1577160..1579076) [1917 bp, 638 aa]
           {ON} Anc_5.456 YDR380W
          Length = 638

 Score =  310 bits (793), Expect = 6e-97,   Method: Compositional matrix adjust.
 Identities = 196/606 (32%), Positives = 317/606 (52%), Gaps = 58/606 (9%)

Query: 4   ITLGRYLFERLNQVDVKTIFGLPGDFNLSLLDKIYEVE----GMRWAGNANELNAAYAAD 59
           + LG YL+ +L Q+  KTIFG+PGDFNLSLL+ +Y  +    G++W G  NELNAAYAAD
Sbjct: 26  LPLGEYLYLKLAQIGTKTIFGVPGDFNLSLLELLYTQKVKDSGLKWVGCCNELNAAYAAD 85

Query: 60  GYARIKG-MSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLG 118
           GY+R    + C++TT+GVGELSALNGIAG++AE++ +LHVVGVP          +HH + 
Sbjct: 86  GYSRYTNRVGCVVTTYGVGELSALNGIAGAFAENIKLLHVVGVPPTKYNTLNHNIHHLVP 145

Query: 119 NGDFT--------VFHRM-SANISETTAMVTDIATAPAEIDRCIRTTYITQRPVYLGLPA 169
              ++        V+  M +  +    A +TD+  A  +I+  I+  +    P Y+ +P 
Sbjct: 146 RLKYSNLLAPNKEVYMEMVNEKVCCFYANITDLNQARWQIEIAIKHIFQYNLPAYIFIPT 205

Query: 170 NLVDLKVPAKLLE-------TPIDLSLK-PNDPEAE-TEVVDTVLELIKAAKNPVILADA 220
           +  D  +P  + E        PI+  ++ P  P  E   V D +L L+ ++K P I+ D 
Sbjct: 206 DFQDALIPISVNEHLSREDIMPIEEIVEIPLLPSLEMVSVCDYILSLLYSSKTPCIIGDI 265

Query: 221 CASRHDVKAETKKLIDATQFPSFVTPMGKGSIDEQHPRFGGVYVGTLSRPEVKEAVESAD 280
              R  V  +   LI  T+  +F T M KG ++E +P + GVY G LS+  + + ++  D
Sbjct: 266 LVERFGVTKQINDLIHKTKLWNFSTFMSKGVLNESNPYYQGVYFGKLSQDHIVKKIQMCD 325

Query: 281 LILSVGALLSDFNTGSFSYSYKTKNI-VEFHSDYIKIRN------ATFPGVQMKFALQKL 333
           LI+  G + ++ NTG +S++YK  ++ ++ H DY++I          + G++ +  +  +
Sbjct: 326 LIIHFGVVENEINTGYYSFNYKPDSVLIQIHPDYVRITQFQHNIRTDYKGIEFRTFVDMV 385

Query: 334 LNAV-PEAI-----KGYKPVPVPARVPENKSCDPATPLKQEWMWNQVSKFLQEGDVVITE 387
              V P +I     + + P       P  +  D   P+  +++   + +++  GDVV+ E
Sbjct: 386 TKGVQPNSINTTYNRLFSPSSHAYLFPLEQEED--GPISHDYLETIIPRYINPGDVVVCE 443

Query: 388 TGTSAFGINQTPFPNNAYGISQVLWGSIGFTTGACLGAAFAAEEI--------------- 432
           TG+  F +  T   ++   I+Q  + SIG    A LG   A  +                
Sbjct: 444 TGSIQFTMVNTRLSSDVEYITQGFYLSIGMAIPASLGIGMAMRDYPNLHLSKKSSHSNVP 503

Query: 433 -DPKKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNDGYTIERLIHGEKAGYNDIQ 491
            + K R+IL  GDG+ Q+TVQEI+ +I++ +   + +LNN GYTIER I G    +NDI 
Sbjct: 504 PNYKPRLILLEGDGAAQMTVQEITNIIKYKIPIEILLLNNQGYTIERAIKGADKEFNDIC 563

Query: 492 NWDHLALLPTFGAKDYENHR----VATTGEWDKLTQDKEFNKNSKIRMIEVMLPVMDAPT 547
            W+   LL   G    E        +TT  ++KL Q K++        +EV+L  ++ PT
Sbjct: 564 EWNWPQLLNGLGGNLDETKNKYKFFSTTELYEKLKQLKDYPGKETFSFVEVILNKLNIPT 623

Query: 548 SLIEQA 553
           +LI+ A
Sbjct: 624 TLIKMA 629

>TBLA0A02670 Chr1 complement(648495..650417) [1923 bp, 640 aa] {ON}
           Anc_5.456 YDR380W
          Length = 640

 Score =  308 bits (790), Expect = 1e-96,   Method: Compositional matrix adjust.
 Identities = 203/605 (33%), Positives = 315/605 (52%), Gaps = 59/605 (9%)

Query: 4   ITLGRYLFERLNQVDVKTIFGLPGDFNLSLLDKIY---------EVEGMRWAGNANELNA 54
           IT G Y+F+RL  +  K++FG+PGDFNL LL+ +Y         E   +RW G  NELN+
Sbjct: 23  ITFGHYIFQRLLSLGTKSVFGVPGDFNLPLLEYLYDDFQSPDTKEKTSIRWVGGCNELNS 82

Query: 55  AYAADGYARIKG-MSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSI----SSQAK 109
           AY+ADGY+R    +SC+ITTFGVGELSA+NG++GS+AE++ VLH+VGVPS     S   K
Sbjct: 83  AYSADGYSRYTNKISCLITTFGVGELSAINGVSGSFAENIKVLHIVGVPSTKITESPVQK 142

Query: 110 QLLLHHTLGNGD--------FTVFHRMSAN-ISETTAMVTDIATAPAEIDRCIRTTYITQ 160
              LHH + + D          V+H M  + IS +T +++DI  A   +D+ I   Y   
Sbjct: 143 NWNLHHLVPSMDCPNFNPPNHNVYHDMIKDKISCSTHILSDITKAADMVDQVILDIYKYS 202

Query: 161 RPVYLGLPANLVDLKVPAK-LLETP---IDLSLKPNDPEAE------TEVVDTVLELIKA 210
           RP YL +P+N  D+ V  K L++ P   +D +L  N  ++        ++   +L+++  
Sbjct: 203 RPGYLFVPSNFPDMLVSTKNLIDRPTITMDDALALNSIDSNFSLSHMKDLTRRILKILYK 262

Query: 211 AKNPVILADACASRHDVKAETKKLIDATQFPSFVTPMGKGSIDEQHPRFGGVYVGTLSRP 270
           ++ P ++ D    R+  K    + I+ T+  +FVTP+ K +IDE +  + G+Y G  S  
Sbjct: 263 SETPAVVCDMLVDRYGGKKLINEFINRTKIRNFVTPLSKSTIDETNENYVGLYNGKQSNA 322

Query: 271 EVKEAVESADLILSVGALLSDFNTGSFSYSY-KTKNIVEFHSDYIKI--------RNATF 321
           +V E  E++DL+L  G   ++ NTG +S+SY     +++ +  Y+++            +
Sbjct: 323 KVIEHFENSDLVLHYGVFSNEVNTGVYSHSYGPNTTLIQLNPTYLRVVEYENGHHSELIY 382

Query: 322 PGVQMKFALQKLLNAVPEAIKGYKPVPVPARVPENKSCDPATPLKQEWMWNQVSKFLQEG 381
             V     L++LL  +  +   +K  P+  RV +    +    + Q  +          G
Sbjct: 383 RDVNFLHILKQLLKDIDLSKLNFKYQPLATRVKQETIENSDGKITQASLGQAFPSTFNPG 442

Query: 382 DVVITETGTSAFGINQTPFPNNAYGISQVLWGSIGFTTGACLGAAFAAEEID-------- 433
           D+++ +TG   F I    F +    I+Q  + SIG      LG   A ++          
Sbjct: 443 DILVADTGAFQFSIRDFVFHSQMKYITQGFYLSIGMALPCALGVGVAMQDYPLEHVYDKS 502

Query: 434 --PKK---RVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNDGYTIERLIHGEKAGYN 488
             PK    R+IL  GDG+ Q+TVQE+STMIR  +   +++ NNDGYTIER I G    YN
Sbjct: 503 KLPKNYTPRLILCEGDGAAQMTVQELSTMIREKISIEIYLWNNDGYTIERAIMGPTRSYN 562

Query: 489 DIQNWDHLALLPTFGAKDYE-NHRVATTGEWD---KLTQDKEFNKNSKIRMIEVMLPVMD 544
           DI  W+   LL +FG  + +  + V    + D   KL   KE + N  I  +EVML  +D
Sbjct: 563 DIAAWNWTTLLNSFGDINGKLTNSVTIETQSDLVAKLKDLKEGDNNKCIEFMEVMLGKVD 622

Query: 545 APTSL 549
            P  L
Sbjct: 623 YPPQL 627

>KNAG0C04790 Chr3 complement(932051..933964) [1914 bp, 637 aa] {ON}
           Anc_5.456 YDR380W
          Length = 637

 Score =  307 bits (786), Expect = 4e-96,   Method: Compositional matrix adjust.
 Identities = 207/609 (33%), Positives = 311/609 (51%), Gaps = 59/609 (9%)

Query: 3   EITLGRYLFERLNQVDVKTIFGLPGDFNLSLLDKIYEV----EGMRWAGNANELNAAYAA 58
           +I LG+YLF+R+     K+IFG+PGDFNL LL+ +YE     +G+RW G  NELNAAYAA
Sbjct: 27  KIPLGKYLFQRVLSAGTKSIFGVPGDFNLPLLEHLYERDLVEQGLRWIGTCNELNAAYAA 86

Query: 59  DGYARIKG-MSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTL 117
           DG++R    + C+ITT+GVGELSALNG+AG++AE+V +LH+VGV   S++ +   +HH +
Sbjct: 87  DGFSRYSNKIGCLITTYGVGELSALNGVAGAFAENVKMLHIVGVAKSSAKHENKNIHHLI 146

Query: 118 GNGDFTVFHR---------MSANISETTAMVTDIATAPAEIDRCIRTTYITQRPVYLGLP 168
            N   + F R         +   +  +   + +I  A  +ID+ IR  Y   +P Y+ +P
Sbjct: 147 PNLHDSNFKRPNHKVYYEMVKDRVCCSAEYLENIDQACDQIDKVIRDIYRYSKPGYIFIP 206

Query: 169 ANLV-DLKVPAKLLETP-IDL--SLKPNDPEAETEVVDTVLELIKAAKNPVILADACASR 224
            + V +L     LL TP IDL  SL   D     EV   + + I  + NP ++ D    R
Sbjct: 207 VDFVNELVETTNLLVTPVIDLESSLARPDEVTVIEVAQMIADWIYQSGNPGLVGDVLTDR 266

Query: 225 HDVKAETKKLIDATQFPSFVTPMGKGSIDEQHPRFGGVYVGTLSRPEVKEAVESADLILS 284
           +D        I  T+  +F T  GK  IDE +P + G+Y G      V +     DL+L+
Sbjct: 267 YDATKMLNDFIQLTKMWNFTTVNGKSIIDESNPWYMGLYNGDEGVSTVIDRFHKCDLVLN 326

Query: 285 VGALLSDFNTGSFSYSYK-TKNIVEFHSDYIKIRNAT------FPGVQMKFALQKLLNAV 337
            G  +++ N G +++ YK    IVE H  Y++  +        F G+   F L++L+N +
Sbjct: 327 FGLDINEINHGHYTFKYKPNSKIVELHPTYVRFLDTEYGTERLFKGLNFVFVLKELINRI 386

Query: 338 --PEAIKGY-----KPVPVPARVPENKSCDP-ATPLKQEWMWNQVSKFLQEGDVVITETG 389
              E +  Y     K      + PE+ + D  A+ + Q  +   +  +L  GD+V+ ETG
Sbjct: 387 NPKECMFSYDLSVRKFCSEEIKTPEDGNDDAEASTITQNKLSKMIPDYLNPGDIVVCETG 446

Query: 390 TSAFGINQTPFPNNAYGISQVLWGSIGFTTGACLGAA-------------FAAEEIDPKK 436
           +  F +     P     +SQ  + SIG    A +G               F A + + K 
Sbjct: 447 SFQFAMRDIVLPPQVKYMSQGFFLSIGTALPAAVGVGIALQDYPNQHINNFGAVDHNYKP 506

Query: 437 RVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNDGYTIERLIHGEKAGYNDIQNWDHL 496
           R+IL  GDG+ Q+TVQE+++MIR+ +   + + NN+GYT+ER I G    YNDI  WD  
Sbjct: 507 RLILLEGDGAAQMTVQELTSMIRFQIPIEIMLWNNNGYTVERAILGPTRSYNDIMPWDWT 566

Query: 497 ALLPTFGAKDYENHRVATTG-------EWDKLTQDKEFNKNSKIRMIEVMLPVMDAPTSL 549
            L   FG  D+E     +T                 E N++  I M+EV L VMD P  L
Sbjct: 567 KLFAAFG--DFEGKYTRSTAIETTSKLLLKLNQLKNEGNRDI-IEMVEVKLGVMDYPHQL 623

Query: 550 ---IEQAKL 555
              +E AK+
Sbjct: 624 KHMVEAAKV 632

>KLLA0E02707g Chr5 (251220..253115) [1896 bp, 631 aa] {ON} similar
           to uniprot|Q06408 Saccharomyces cerevisiae YDR380W ARO10
           Phenylpyruvate decarboxylase catalyzes decarboxylation
           of phenylpyruvate to phenylacetaldehyde which is the
           first specific step in the Ehrlich pathway
          Length = 631

 Score =  302 bits (773), Expect = 4e-94,   Method: Compositional matrix adjust.
 Identities = 203/602 (33%), Positives = 315/602 (52%), Gaps = 62/602 (10%)

Query: 1   MSEITLGRYLFERLNQVDVKTIFGLPGDFNLSLLDKIYE----VEGMRWAGNANELNAAY 56
           +  I  G Y+FERL     K+IFG+PGDFNL LL+ +Y+      G++W G  NELN AY
Sbjct: 29  VKNIPFGHYVFERLLNSGAKSIFGVPGDFNLPLLEYLYDEDLVANGLQWIGTCNELNGAY 88

Query: 57  AADGYARIKG-MSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGV-PSISSQAKQLL-- 112
           AADGY+R    + C+ITT+GVGELSALNG+AG++AE V VLH++GV PS   + +Q    
Sbjct: 89  AADGYSRYTNKLGCVITTYGVGELSALNGVAGAFAEDVKVLHIIGVSPSRFRENEQFRSH 148

Query: 113 -LHHTLGNGDF-------TVFHRMSANISETTAMVTDIATAPAEIDRCIRTTYITQRPVY 164
            +HH +   D          F  +   +  ++A + DI TA   +D+ I       +P Y
Sbjct: 149 NVHHLVPAIDSQQPPNHQVYFDMVKDRVCCSSAFLDDINTAADRLDQVIVDICKNSKPGY 208

Query: 165 LGLPANLVDLKVPAK-LLETPI---DLSLKPNDPEAETEVV-DTVLELIKAAKNPVILAD 219
           + +P +  D  V  K L++ PI   D  ++    E  T++  D +L+ I  +  P + +D
Sbjct: 209 VFIPVDFADKLVSNKNLIQNPIIDMDTVIESYKDENATKIAGDRLLQWIYESNAPSVFSD 268

Query: 220 ACASRHDVKAETKKLIDATQFPSFVTPMGKGSIDEQHPRFGGVYVGTLSRPEVKEAVESA 279
               R +++ E ++ I+     ++ T MGK ++DE++P++ G+Y G  +  E++  V+S+
Sbjct: 269 LLVDRFNLRKELRQFIETADVWNYNTAMGKSTLDERNPKYLGLYKGAETGKEMQATVDSS 328

Query: 280 DLILSVGALLSDFNTGSFSYSYK--------TKNIVEFHSDYIKIRNATFPGVQMKFALQ 331
           DLIL  G   ++ N G +S+ +         + NI++F    IK +NA+        ++ 
Sbjct: 329 DLILHFGPAKNEINCGYYSFHFNENARIIELSNNIIQFID--IKDKNASTVEEANFVSVL 386

Query: 332 KLLNAVPEAIK---GYKPVPVPARVPENKSC--DPATPLKQEWMWNQVSKFLQEGDVVIT 386
           K +N   +  K    Y PVP       N SC  D    + Q+ +   +  +  +GDV+I 
Sbjct: 387 KYVNDNLDKSKLSFSYPPVP-----KSNHSCEYDNNDSITQKSLKEIIPNYFNDGDVLIV 441

Query: 387 ETGTSAFGINQTPFPNNAYGISQVLWGSIGFTTGACLGAAFAAEE----------IDPKK 436
           ETG+  FG+    F      I+Q  + SIG    A LG      +          + PK 
Sbjct: 442 ETGSFQFGVPNMQFAREMKYITQSFYLSIGMALPAALGVGCGMRDYPRSHIVDQALVPKD 501

Query: 437 ---RVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNDGYTIERLIHGEKAGYNDIQNW 493
              R+IL  GDG+ Q+T+QE ++ IR+ +   + V NN+GYT+ER I+G    YNDI  +
Sbjct: 502 YIPRLILCEGDGAAQMTIQEFASYIRYKIPMEILVWNNNGYTVERAINGPTRSYNDIAPF 561

Query: 494 DHLALLPTFGAKDYEN--HRVATTGEWDKLTQD----KEFNKNSKIRMIEVMLPVMDAPT 547
              ALL  FG  D+EN  +   T  + D+L Q     K   + + I++ EVMLPVMD P 
Sbjct: 562 KWTALLNVFG--DFENKFNESVTVEKNDELVQLLNKWKSCKERANIKLAEVMLPVMDIPQ 619

Query: 548 SL 549
            L
Sbjct: 620 EL 621

>Kpol_440.4 s440 (9465..11375) [1911 bp, 636 aa] {ON} (9465..11375)
           [1911 nt, 637 aa]
          Length = 636

 Score =  301 bits (770), Expect = 1e-93,   Method: Compositional matrix adjust.
 Identities = 204/605 (33%), Positives = 313/605 (51%), Gaps = 64/605 (10%)

Query: 3   EITLGRYLFERLNQVDVKTIFGLPGDFNLSLLDKIYEVEG---MRWAGNANELNAAYAAD 59
           +I LG YL  RL  +  K+ FG+PGDFNL LL+ +Y  +G   + W G  NELNA+YAAD
Sbjct: 16  KIPLGEYLVRRLLSIGSKSAFGVPGDFNLPLLEFLYNKDGDEIINWIGCCNELNASYAAD 75

Query: 60  GYARIKG-MSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGV-PSISSQAKQLL---LH 114
           GY+R    + C+ITT+GVGELSA+NGI GSYAE++ +LH+VGV P+  S+ + L    LH
Sbjct: 76  GYSRYTNKIGCLITTYGVGELSAINGITGSYAENIKILHIVGVAPTFISEDENLKYKNLH 135

Query: 115 H--------TLGNGDFTVFHRMSAN-ISETTAMVTDIATAPAEIDRCIRTTYITQRPVYL 165
           H         + + +F ++++M  + IS  +  +TDI T+  +ID  I   +   +P Y+
Sbjct: 136 HLIPDKEFPNINSPNFKIYYQMVKDKISCASEYLTDIETSCDKIDDVIVQIFKHSKPGYI 195

Query: 166 GLPANLVDLKVPAK-LLETP-IDLS--LKPNDPEAETEVVDTVLELIKAAKNPVILADAC 221
            +P++  +  V +K L+  P I+LS  L     E    + + +++LI  +++P I+ D  
Sbjct: 196 FIPSDFSNKLVSSKNLINVPSINLSDCLNKTPMEKIDNLTNEIIDLIGNSQSPAIIGDVL 255

Query: 222 ASRHDVKAETKKLIDATQFPSFVTPMGKGSIDEQHPRFGGVYVGTLSRPEVKEAVESADL 281
             R          I  T+F +F T MGK  IDE    + G Y+G      V   +   D+
Sbjct: 256 TDRFGCTKLLNDFIQMTKFWNFSTMMGKSVIDESGQAYMGTYIGLGGLTTVYNKILKCDI 315

Query: 282 ILSVGALLSDFNTGSFSYSY-KTKNIVEFHSDYIKIRNAT---------FPGVQMKFALQ 331
            L  G  +++ N+G++S+ + K   I+E + +Y+KI             +P V M   L+
Sbjct: 316 FLIFGLEMNEMNSGNYSFKFPKGSQIIEINPNYLKITKCHDTENQIVDFYPNVSMTHILE 375

Query: 332 KLLNAV--PEAIKGYKPVPVPARVPENKSCDPATPLKQE--------WMWNQVSKFLQEG 381
            L+  V   +A   Y        V    + +   PL+QE         +  ++  FL  G
Sbjct: 376 GLIAKVNIHDANTNYD-----KSVKSYDTSELVLPLQQEDEEKITQVHLQRELPNFLNPG 430

Query: 382 DVVITETGTSAFGINQTPFPNNAYGISQVLWGSIGFTTGACLGAAFAAEEIDPK------ 435
           DV++ ETG+  F +    FP+N   ISQ  + SIG    A LG   A ++  PK      
Sbjct: 431 DVLVCETGSFQFAVQDFKFPSNLKYISQGFYLSIGMALPAALGVGIAMKDY-PKFHLNDH 489

Query: 436 -------KRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNDGYTIERLIHGEKAGYN 488
                   R+IL  GDG+ Q+TVQE++TM+R  +   +F+ NN+GYT+ER I G    YN
Sbjct: 490 SLARNYTPRLILLEGDGAAQMTVQELTTMLRHKIPMEIFLWNNNGYTVERAIEGPFRSYN 549

Query: 489 DIQNWDHLALLPTFGAKDYENHRVATTGEWDKLTQD----KEFNKNSKIRMIEVMLPVMD 544
           DI  W+   LL   G  + E +R  T  +  +L++     KE   N+ I++IEV L   D
Sbjct: 550 DIMPWNWTKLLNVLGDPNNEFNRCVTIDKKSQLSEKFKELKEGKDNNCIQLIEVQLDTHD 609

Query: 545 APTSL 549
            P  L
Sbjct: 610 IPRQL 614

>TDEL0D02450 Chr4 complement(477063..479090) [2028 bp, 675 aa] {ON}
           Anc_5.456 YDR380W
          Length = 675

 Score =  300 bits (769), Expect = 5e-93,   Method: Compositional matrix adjust.
 Identities = 210/612 (34%), Positives = 315/612 (51%), Gaps = 70/612 (11%)

Query: 2   SEITLGRYLFERLNQVDVKTIFGLPGDFNLSLLDKIYEV-------EGMRWAGNANELNA 54
           ++I  G Y+F+RL  V VK+IFG+PGD+N+ LL+ +Y+        + + W G  NELNA
Sbjct: 60  AQIPFGLYVFKRLLSVGVKSIFGVPGDYNMRLLEHMYDESLVDTAGDKLEWVGCCNELNA 119

Query: 55  AYAADGYARIKG-MSCIITTFGVGELSALNGIAGSYAEHVGVLHVVG-----VPSISSQA 108
           AYAADGY+R    + C+ITT+GVGEL A++G+AG++AE V VLH+VG     V  +  + 
Sbjct: 120 AYAADGYSRYSNEIGCVITTYGVGELGAISGLAGAFAESVKVLHIVGIVDYEVNDLGPEM 179

Query: 109 KQLLLHHTLGN--------GDFTVFHRMSAN-ISETTAMVTDIATAPAEIDRCIRTTYIT 159
           +   LHH L           D+ V+  M  + ++ +   + D+ TA  ++D+ I   Y  
Sbjct: 180 RSHNLHHLLPRLNDSNFVGPDYRVYAEMVKDKVACSVEYLDDLETACDKVDKVIEDIYKY 239

Query: 160 QRPVYLGLPANLVDLKVPAK-LLETPIDLSLKP---NDPEAETEVV-DTVLELIKAAKNP 214
            +P YL +P + VD  V  K L+E P  ++L+      P  E ++V + +L L+  + +P
Sbjct: 240 SKPGYLFVPRSFVDELVSTKNLIEKPT-ITLRECIEKSPVDEAKIVTEKILRLLNQSASP 298

Query: 215 VILADACASRHDVKAETKKLIDATQFPSFVTPMGKGSIDEQHPRFGGVYVGTLSRPEVKE 274
            ++ D    R+ ++ E    I+      F T  GK  IDE  P + G Y G  S P V E
Sbjct: 299 AVIGDMFTDRYGLRVELNDFINKANIVGFSTVQGKSIIDESSPLYMGAYNGMTSAPTVSE 358

Query: 275 AVESADLILSVGALLSDFNTGSFSYSYKTK-NIVEFHSDYIKIRNAT------FPGVQMK 327
            + + DL+L  G   ++ N G++++ +K+   IVE H  YI+  + T      + GV   
Sbjct: 359 KLLACDLVLHFGIEKNEVNYGNYNFPHKSDAKIVELHPQYIRFYDNTTKKEEIYKGVSFV 418

Query: 328 FALQKLLNAVPE----------AIKGY--KPVPVPARVPENKSCDPATPLKQEWMWNQVS 375
             L  LLN  PE            K Y  + + +  R   N   D  + + Q  +   + 
Sbjct: 419 DILD-LLNQSPELSELSFQYNSKFKAYTIEELNLDERDFGN---DETSDITQGTLQKSMP 474

Query: 376 KFLQEGDVVITETGTSAFGINQTPFPNNAYGISQVLWGSIGFTTGACLGAAFAAEEI--- 432
            +L  GDV+I++TGT  F I     P+    I+Q  + SIG    A LG   A  +    
Sbjct: 475 NYLNPGDVLISDTGTFQFAIRDFSLPSQVKYITQGFYLSIGMALPAALGVGIAMRDYPMH 534

Query: 433 ---DPKK-------RVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNDGYTIERLIHG 482
              D +K       +VILF GDG+ Q+TVQE+STMIR  +   +F+ NN+GYTIER+I G
Sbjct: 535 HVWDVEKIPFGYEPKVILFEGDGAAQMTVQELSTMIRHQVPIEIFLWNNNGYTIERVIEG 594

Query: 483 EKAGYNDIQNWDHLALLPTFGAKDYENHRVATTGEW-----DKLTQDKEFNKNSKIRMIE 537
               YNDIQ W    LL  FG  D ++ R AT  E      +KL++ K  +    I  +E
Sbjct: 595 PTRPYNDIQPWKWTKLLEAFGDFDGKHSR-ATVLETRSQLENKLSELKYKDHRRGIDFME 653

Query: 538 VMLPVMDAPTSL 549
           V L  MD P+ L
Sbjct: 654 VKLATMDVPSQL 665

>SAKL0D00220g Chr4 complement(18466..20199) [1734 bp, 577 aa] {ON}
           uniprot|Q6XAE8 Saccharomyces kluyveri Pyruvate
           decarboxylase-like protein
          Length = 577

 Score =  295 bits (754), Expect = 5e-92,   Method: Compositional matrix adjust.
 Identities = 195/581 (33%), Positives = 305/581 (52%), Gaps = 49/581 (8%)

Query: 1   MSEITLGRYLFERLNQVDVKTIFGLPGDFNLSLLDKIYEVE--GMRWAGNANELNAAYAA 58
           MS + LG YLF RL+QV  KT+FG+PGDFNL+LL+ +Y  +   ++W GNANELNA YAA
Sbjct: 1   MSTMQLGTYLFYRLSQV-TKTVFGVPGDFNLNLLEHVYNFDESQIKWCGNANELNAGYAA 59

Query: 59  DGYARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLL---HH 115
           DGY+RI    C ITT+GVGELSALN ++G++AE+  VLH+VG  S+ ++     L   HH
Sbjct: 60  DGYSRINKFGCFITTYGVGELSALNAVSGAFAENAPVLHIVGTSSMLAKRGACPLNQIHH 119

Query: 116 ------TLGNGDFTVFHRMSANISETTAMVTD--IATAPAEIDRCIRTTYITQRPVYLGL 167
                 T    D  V+ +++   S  T  ++D  +     +ID  I + +   +P YL +
Sbjct: 120 LIPPKKTYEAPDHKVYEKLAEPFSIHTESLSDENLEKIQDQIDSVIESIFCHMKPGYLFI 179

Query: 168 PANLVDLKVPAKL-LETPIDLSLKPN-DPEAETEVVDTVLELIKAAKNPVILADACASRH 225
           P+NL D ++P  L  +   D   K   DP A +E+V   L+ I +++NP  + D    R 
Sbjct: 180 PSNLPDAEIPVDLNKQLNFDFITKLRVDPHATSEMVSLTLKRIYSSRNPGFIVDQFM-RF 238

Query: 226 DVKAETKKLIDATQFPSFVTPMGKGSIDEQHPRFGGVYVGTLSRPEVKEAVESADLILSV 285
           D++ +    ++   F  + T   +G  DE  P F GV+   LS     E ++  D IL +
Sbjct: 239 DLE-KLNLFLEKFNFYCYNTTTARGFADESLPNFHGVFNNELSTNGTLEILDQNDFILHL 297

Query: 286 GALLSDFNTGSF----SYSYKTKNIVEFHSDYIKI--RNATFPGVQMKFALQKLLNAVPE 339
           G   ++ N  S+    S     K+++    DY ++        G+      ++LL  +  
Sbjct: 298 G---TNINEVSYFVGGSTPLDKKDVIFIGKDYAQVGTNGHIITGINCHVFFEELLQRMNS 354

Query: 340 AIKGYKPVPVPARVPENKSC----------DPATPLKQEWMWNQVSKFLQEGDVVITETG 389
                K +P   +V   KS           D +  + Q  +   VS  L+E DV+I E  
Sbjct: 355 -----KTMP---KVKTRKSTALYNNGYTVDDDSKTVTQANLSQVVSAQLRENDVIINEMC 406

Query: 390 TSAFGINQTPFPNNAYGISQVLWGSIGFTTGACLGAAFAAEEIDPKKRVILFIGDGSLQL 449
           +  F +    +      + Q  +GSIG+   A LGA+ A ++     RVILF GDGS Q+
Sbjct: 407 SFMFEMPNIKYSKGCQFVGQPFYGSIGYALPATLGASLAIKDYKKSGRVILFQGDGSAQM 466

Query: 450 TVQEISTMIRWGLKPYLFVLNNDGYTIERLIHGEKAGYND-IQNWDHLALLPTFGAKDYE 508
           T+QE+++ IR+ + P +F+LNN GY++ER+I G    YND I +WD   +L  FG ++ +
Sbjct: 467 TLQELASYIRFEIDPIIFMLNNSGYSVERVIKGPTRSYNDIIVDWDWCNILSVFGDRNGD 526

Query: 509 ---NHRVATTGEWDKLTQDKEFNKNSKIRMIEVMLPVMDAP 546
              +++V   GE   +   +    + KI+M+E++L  MD P
Sbjct: 527 RSTSYKVEKLGELKNVLTKRLDYSDGKIKMVEIILDRMDVP 567

>TPHA0E01600 Chr5 complement(325811..327766) [1956 bp, 651 aa] {ON}
           Anc_5.456 YDR380W
          Length = 651

 Score =  295 bits (755), Expect = 3e-91,   Method: Compositional matrix adjust.
 Identities = 197/599 (32%), Positives = 309/599 (51%), Gaps = 52/599 (8%)

Query: 2   SEITLGRYLFERLNQVDVKTIFGLPGDFNLSLLDKIYEVEG------MRWAGNANELNAA 55
           + I  G+Y+F RL     K++FG+PGD+NL+LL+++Y+ E       ++W G  NELNAA
Sbjct: 36  NRIPFGKYIFRRLQSCGTKSVFGVPGDYNLNLLEQMYDEEDSITPNEIQWIGCCNELNAA 95

Query: 56  YAADGYARIKG-MSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLH 114
           YAADGY+R    + C+ITT+GVGELSA+NGIAG++ E+V +LH+VGV S          H
Sbjct: 96  YAADGYSRYTNKIGCLITTYGVGELSAINGIAGAFTENVKLLHIVGVVSQDKMKSGRNFH 155

Query: 115 HTLGNGD--------FTVFHRMSAN-ISETTAMVTDIATAPAEIDRCIRTTYITQRPVYL 165
           H + N +        + +   M  N IS +T  + +IATA  + D  +R  +   +P +L
Sbjct: 156 HLIPNKENANLQAPNYQICKDMIDNKISCSTKFLDNIATACDDFDDLLRDIFKNSKPGFL 215

Query: 166 GLPANLVDLKVP-AKLLETP---IDLSLKPNDPEAET--EVVDTVLELIKAAKNPVILAD 219
            +P    +L V  A L   P   ++ S+ P+    ++   +     +LI  +K P I+ D
Sbjct: 216 FIPEEFSNLMVSDANLFLVPKITLEDSIIPSPISYDSIDRLTQITKDLIYQSKRPAIIGD 275

Query: 220 ACASRHDVKAETKKLIDATQFPSFVTPMGKGSIDEQHPRFGGVYVGTLSRPEVKEAVESA 279
               R        +LI  T   +F T MGK  I+E +  + G++ G   + EV + +   
Sbjct: 276 ILVDRFGGTTILNELIQNTGIWNFSTIMGKSIINEANENYIGLFSGDDGKQEVNDKIRQC 335

Query: 280 DLILSVGALLSDFNTGSFS---YSYKTKNIVEFHSDYIKIRNATFPGVQMKFALQ----- 331
           DLIL  G   ++ N+G ++   Y  K   I+EFHS+YIKI++ +   V +   L      
Sbjct: 336 DLILHFGIDTNEVNSGVYTLENYYPKNAKIIEFHSNYIKIKDNSTSRVDLYKNLNFIHVL 395

Query: 332 KLLNAVPEAIKGYKPVPVPARVPENKSCDPATPLK---QEWMWNQVSKFLQEGDVVITET 388
           K LN + +  K     P  ++  + +  D     K   Q+++ + + K L  GD+++ +T
Sbjct: 396 KRLNKILDTSKLLFDYPYISKNIQTECSDDEKSNKVITQDYIKDAILKLLNPGDILLCDT 455

Query: 389 GTSAFGINQTPFPNNAYGISQVLWGSIGFTTGACLGAAFAAEE------------IDPKK 436
           GT  F +     P     ISQ  + SIG    A LG     ++            I  + 
Sbjct: 456 GTFQFSVRDYQLPPQVKYISQSFYLSIGMALPASLGVGIGMKDYPNIHIKPDDSIIKTQP 515

Query: 437 RVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNDGYTIERLIHGEKAGYNDIQNWDHL 496
           ++IL  GDG+ Q+T+QEIST+IR+ +   +F+ NNDGYTIER I G    YNDIQ W+  
Sbjct: 516 KLILCEGDGAAQMTIQEISTLIRYKIPISIFLWNNDGYTIERAIRGPTRDYNDIQPWNWT 575

Query: 497 ALLPTF--GAKDY-ENHRVATTGEWDKL---TQDKEFNKNSKIRMIEVMLPVMDAPTSL 549
            L+ +F    K + + ++V    E+  L    +   FN++S +  IEV L  +D P  L
Sbjct: 576 MLIKSFETNIKSFIKTYKVTEQQEFKNLLTKIKQNNFNEDS-LNFIEVQLGRLDVPHIL 633

>TDEL0C07020 Chr3 complement(1283600..1285282) [1683 bp, 560 aa]
           {ON} 
          Length = 560

 Score =  273 bits (699), Expect = 6e-84,   Method: Compositional matrix adjust.
 Identities = 171/568 (30%), Positives = 280/568 (49%), Gaps = 25/568 (4%)

Query: 5   TLGRYLFERLNQVDVKTIFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADGYARI 64
           T+G YL  RL++V ++  F +PGD+NL+LLDK+     +     +NELN ++AA+GYAR 
Sbjct: 4   TVGSYLATRLSEVGIENHFVVPGDYNLALLDKLQAHPKLEEVNCSNELNCSFAAEGYARS 63

Query: 65  KGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNGDFTV 124
           KG++ ++ TF VG  SA NGI  +Y E++ V+ + G P+ +      LLHHT+G  +F  
Sbjct: 64  KGVAAVVVTFSVGAFSAFNGIGSAYGENLPVILIAGSPNTNDSIDHNLLHHTIGTHNFDY 123

Query: 125 FHRMSANISETTAMVTDIATAPAEIDRCIRTTYITQRPVYLGLPANLVDLKVPAKLLETP 184
              M+  I+     +     AP+ ID  IR     ++P Y+ +P N   +   +  L  P
Sbjct: 124 EFEMAKKITCAAVQIKHAKDAPSLIDFAIRECLAKKKPCYIEVPTN---MSTQSCALPGP 180

Query: 185 ID--LSLKPNDPEAETEVVDTVLELIKAAKNPVILADACASRHDVKAETKKLIDATQFPS 242
           I+  L   P++P+  T  VD   +LI +   P +LA         +    +L +A     
Sbjct: 181 IEGVLYQSPSEPKTLTAAVDAANKLIGSRLKPTLLAGPKLKSAGAEKAFLRLAEALGCAV 240

Query: 243 FVTPMGKGSIDEQHPRFGGVYVGTLSRPEVKEAVESADLILSVGALLSDFNTGSFSYSYK 302
            V P  K    E HP++ GVY G +S  +    ++ +DL +  G + +D++T  ++    
Sbjct: 241 AVLPAAKSLFPEDHPQYAGVYWGNVSTKKADAILQWSDLTICAGCVFTDYSTTGWTSLQP 300

Query: 303 TKNIVEFHSDYIKIRNATFPGVQMKFALQKLLNAVPEAIKG------YKPVPVPARVPEN 356
             + +E  SD +K  +  +  +++   L  L   V +  K        +PVP     P  
Sbjct: 301 ATHRIEVDSDNVKFPDHYYGHIKLADFLDALAKKVSKNDKSVVEYQRLRPVP-----PAI 355

Query: 357 KSCDPATPLKQEWMWNQVSKFLQEGDVVITETGTSAFGINQTPFPNNAYGISQVLWGSIG 416
           K+ +P+  + ++ M  Q+   +     +  ETG S F   Q   P  A    ++ WG IG
Sbjct: 356 KAAEPSAAITRQEMARQIQGIINSKTTLFAETGDSWFNGVQMDLPKGAKFEVEMQWGHIG 415

Query: 417 FTTGACLGAAFAAEEIDPKKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNDGYTI 476
           ++  AC G +  A    P + ++  +GDGS Q+TVQE++ MIR      +F++NN GYTI
Sbjct: 416 WSVPACFGYSVGA----PDREIVTMVGDGSFQMTVQEVAQMIRLKQPILIFLINNYGYTI 471

Query: 477 ERLIHGEKAGYNDIQNWDHLALLPTFGAKD--YENHRVATTGEWDKLTQDKEFNKNSKIR 534
           E  IH     YN+I+NW++ AL+  F A D   +  +V T  E  +  +  + N      
Sbjct: 472 EVEIH--DGPYNNIKNWNYAALMEAFNANDGHGKGFQVKTGAELSEAIKKAKSNTRGPT- 528

Query: 535 MIEVMLPVMDAPTSLIEQAKLTASINAK 562
           +IE+ +   D    LI      A  NA+
Sbjct: 529 LIEIQINRDDCTNELISWGHYVALANAR 556

>TDEL0F00150 Chr6 (12055..13737) [1683 bp, 560 aa] {ON} 
          Length = 560

 Score =  273 bits (697), Expect = 9e-84,   Method: Compositional matrix adjust.
 Identities = 171/568 (30%), Positives = 280/568 (49%), Gaps = 25/568 (4%)

Query: 5   TLGRYLFERLNQVDVKTIFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADGYARI 64
           T+G YL  RL++V ++  F +PGD+NL+LLDK+     +     +NELN ++AA+GYAR 
Sbjct: 4   TVGSYLATRLSEVGIENHFVVPGDYNLALLDKLQAHPKLEEVNCSNELNCSFAAEGYARS 63

Query: 65  KGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNGDFTV 124
           KG++ ++ TF VG  SA NGI  +Y E++ V+ + G P+ +      LLHHT+G  +F  
Sbjct: 64  KGVAAVVVTFSVGAFSAFNGIGSAYGENLPVILIAGSPNTNDSIDHNLLHHTIGTHNFDY 123

Query: 125 FHRMSANISETTAMVTDIATAPAEIDRCIRTTYITQRPVYLGLPANLVDLKVPAKLLETP 184
              M+  I+     +     AP+ ID  IR     ++P Y+ +P N   +   +  L  P
Sbjct: 124 EFEMAKKITCAAVQIKHAKDAPSLIDFAIRECLAKKKPCYIEVPTN---MSTQSCALPGP 180

Query: 185 ID--LSLKPNDPEAETEVVDTVLELIKAAKNPVILADACASRHDVKAETKKLIDATQFPS 242
           I+  L   P++P+  T  VD   +LI +   P +LA         +    +L +A     
Sbjct: 181 IEGVLYQSPSEPKTLTAAVDAANKLIGSRLKPTLLAGPKLKSAGAEKAFLRLAEALGCAV 240

Query: 243 FVTPMGKGSIDEQHPRFGGVYVGTLSRPEVKEAVESADLILSVGALLSDFNTGSFSYSYK 302
            V P  K    E HP++ GVY G +S  +    ++ +DL +  G + +D++T  ++    
Sbjct: 241 AVLPAAKSLFPEDHPQYAGVYWGNVSTKKADAILQWSDLTICAGCVFTDYSTTGWTSLQP 300

Query: 303 TKNIVEFHSDYIKIRNATFPGVQMKFALQKLLNAVPEAIKG------YKPVPVPARVPEN 356
             + +E  SD +K  +  +  +++   L  L   V +  K        +PVP     P  
Sbjct: 301 ATHRIEVDSDNVKFPDHYYGHIKLADFLDALAKKVSKNDKSVVEYQRLRPVP-----PAI 355

Query: 357 KSCDPATPLKQEWMWNQVSKFLQEGDVVITETGTSAFGINQTPFPNNAYGISQVLWGSIG 416
           K+ +P+  + ++ M  Q+   +     +  ETG S F   Q   P  A    ++ WG IG
Sbjct: 356 KAAEPSAAITRQEMARQIQGIINSKTTLFAETGDSWFNGVQMDLPKGAKFEVEMQWGHIG 415

Query: 417 FTTGACLGAAFAAEEIDPKKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNDGYTI 476
           ++  AC G +  A    P + ++  +GDGS Q+TVQE++ MIR      +F++NN GYTI
Sbjct: 416 WSVPACFGYSVGA----PDREIVTMVGDGSFQMTVQEVAQMIRLKQPILIFLINNYGYTI 471

Query: 477 ERLIHGEKAGYNDIQNWDHLALLPTFGAKD--YENHRVATTGEWDKLTQDKEFNKNSKIR 534
           E  IH     YN+I+NW++ AL+  F A D   +  +V T  E  +  +  + N      
Sbjct: 472 EVEIH--DGPYNNIKNWNYAALMEAFNANDGHGKGFQVKTGAELAEAIKKAKSNTRGPT- 528

Query: 535 MIEVMLPVMDAPTSLIEQAKLTASINAK 562
           +IE+ +   D    LI      A  NA+
Sbjct: 529 LIEIQINRDDCTNELISWGHYVALANAR 556

>KLTH0D00418g Chr4 complement(37778..39463) [1686 bp, 561 aa] {ON}
           similar to uniprot|P16467 Saccharomyces cerevisiae
           YLR134W PDC5 Minor isoform of pyruvate decarboxylase
          Length = 561

 Score =  268 bits (685), Expect = 5e-82,   Method: Compositional matrix adjust.
 Identities = 173/567 (30%), Positives = 280/567 (49%), Gaps = 23/567 (4%)

Query: 5   TLGRYLFERLNQVDVKTIFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADGYARI 64
           T+G YL  RL Q  +K  F +PGD+NL LLDK+ E   +      NELN ++AA+GYAR 
Sbjct: 3   TVGNYLATRLVQAGIKNHFTVPGDYNLVLLDKLQEHPELEEVNCCNELNCSFAAEGYART 62

Query: 65  KGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNGDFTV 124
           KG++ ++ TF VG  SA NGI  +Y E++ V+ + G P+ +  +   LLHHT+G  ++  
Sbjct: 63  KGIAAVVVTFSVGAFSAFNGIGSAYGENLPVILISGSPNTNDSSDHRLLHHTIGTHNYDY 122

Query: 125 FHRMSANISETTAMVTDIATAPAEIDRCIRTTYITQRPVYLGLPANLVD-LKVPAKLLET 183
            + M+  I+     +     AP+ ID  IR     ++P Y+ +P N+   +  P   + +
Sbjct: 123 QYEMAKQITCAAVQIKYPEDAPSLIDYAIRECLAKKKPCYIEVPTNMASAICAPPGPISS 182

Query: 184 PIDLSLKPNDPEAETEVVDTVLELIKAAKNPVILADACASRHDVKAETKKLIDATQFPSF 243
            ++    P D    ++ V+  ++ I +   P +LA       D +    +L +A +    
Sbjct: 183 LVNSVPTPKD--VLSQAVNASVDFINSHLKPTLLAGPKLKCADAQKAFLRLAEALKCAVA 240

Query: 244 VTPMGKGSIDEQHPRFGGVYVGTLSRPEVKEAVESADLILSVGALLSDFNTGSFSYSYKT 303
           V P  K    E HP+F GVY G +S  +    +E +DL +  G + +D++T  ++    +
Sbjct: 241 VQPAAKSMFPEDHPQFAGVYWGQVSTKKADAILEWSDLTICAGCIFTDYSTTGWTALQPS 300

Query: 304 KNIVEFHSDYIKIRNATFPGVQM-KFALQKLLNAVPEAI-KGYKPVPVPARV----PENK 357
            + +E  +D     N  FPG    +  L   LN + E + +  K +    R+    P  K
Sbjct: 301 SHRLEADAD-----NVRFPGHSFDQIGLANFLNVLAERVSENDKSLIEYNRLRQSPPLIK 355

Query: 358 SCDPATPLKQEWMWNQVSKFLQEGDVVITETGTSAFGINQTPFPNNAYGISQVLWGSIGF 417
           + DP   + ++ M  Q+ + +     +  ETG S F   Q   P  A    ++ WG IG+
Sbjct: 356 AADPKAAITRKEMARQIQQLITPKTTLFAETGDSWFNGVQMDLPKGALFEVEMQWGHIGW 415

Query: 418 TTGACLGAAFAAEEIDPKKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNDGYTIE 477
           +  A LG A  A    P +R+I  +GDGS Q+T QE+S M+R      +F++NN GYTIE
Sbjct: 416 SVPASLGYAVGA----PDRRIITMVGDGSFQMTAQEVSLMVRLRKPIIIFLINNYGYTIE 471

Query: 478 RLIHGEKAGYNDIQNWDHLALLPTFGAKD--YENHRVATTGEWDKLTQDKEFNKNSKIRM 535
             IH     YN+I+NW++ AL+  F A +   +  +  T GE     +  + N  S   +
Sbjct: 472 VEIH--DGPYNNIKNWNYAALMEVFNANEGSGKGFKARTGGELADAIEKAQANV-SGPTL 528

Query: 536 IEVMLPVMDAPTSLIEQAKLTASINAK 562
           IE+ +   D    LI      A  NA+
Sbjct: 529 IEIQINRDDCTNELITWGHFVALANAR 555

>NDAI0A04450 Chr1 complement(1006559..1008244) [1686 bp, 561 aa]
           {ON} Anc_5.456
          Length = 561

 Score =  249 bits (635), Expect = 1e-74,   Method: Compositional matrix adjust.
 Identities = 177/552 (32%), Positives = 277/552 (50%), Gaps = 69/552 (12%)

Query: 58  ADGYARIKG-MSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVP-SISSQAKQLL--- 112
           ADG++R    + C+ITT+GVGELSALNGIAG+++E+V VLH+VGV  S+ S+++      
Sbjct: 3   ADGFSRYSNKIGCLITTYGVGELSALNGIAGAFSENVKVLHIVGVARSVHSRSQDYNNQN 62

Query: 113 LHH---TLGNGDFT-----VFHRMSAN-ISETTAMVTDIATAPAEIDRCIRTTYITQRPV 163
           LHH    L + +F      V+  M  + ++ +   + DI TA  E+D+ I   Y   +P 
Sbjct: 63  LHHLVPRLHDSNFVGPNHKVYLEMIKDRVACSVTYLEDINTACDEVDKVIMDIYRYSKPG 122

Query: 164 YLGLPANLVDLKV-PAKLLETPIDLSLKPNDPEAETEVVD----TVLELIKAAKNPVILA 218
           Y+ +P +  D+ V P+ L + P +++L+     A + VVD     VL+ I  +K P I+ 
Sbjct: 123 YVFVPVDFSDMLVDPSNLFKRP-EITLENCVSYAPSPVVDELVRMVLQYIYESKCPSIIG 181

Query: 219 DACASRHDVKAETKKLIDATQFPSFVTPMGKGSIDEQHPRFGGVYVGTLSRPEVKEAVES 278
           D    R    +    LI  T   +F T MGK  IDE +  + G+Y G  S   V E    
Sbjct: 182 DVLCDRFGASSMVNNLIQLTSMWNFATVMGKSIIDESNVMYMGLYNGNESIETVTERFLQ 241

Query: 279 ADLILSVGALLSDFNTGSFSYSYKTK-NIVEFHSDYIKIRNAT------FPGVQMKFALQ 331
           +DL+L  G  + + N G ++ +YK    ++EFHS+YI+  +A+      F GV     L+
Sbjct: 242 SDLVLHFGIQVHEINNGHYTINYKEDAKVIEFHSEYIRFFDASTGNEKVFKGVNFVQVLE 301

Query: 332 KLLNAV---------PEAIKGY--KPVPVPARVPENKSCDPATPLKQEWMWNQVSKFLQE 380
           +L+  +         P  I+ +    V +P    E       T + Q ++   V  +L  
Sbjct: 302 RLIQTINVNKLNFEYPSNIEKFATDEVNLPTEPTE------ITKVTQNYLQKSVPHYLNP 355

Query: 381 GDVVITETGTSAFGINQTPFPNNAYGISQVLWGSIGFTTGACLGAAFAAEEI-------- 432
           GDV++ ETG+  F I     P+    I+Q  + SIG    A  G   A ++         
Sbjct: 356 GDVLVCETGSFQFAIRDFVLPSQLKYITQGFFLSIGMALPAAFGVGIAMQDYPRCHISKD 415

Query: 433 ---------DPKKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNDGYTIERLIHGE 483
                    D + R+IL  GDG+ Q+T+QE+++M+R+ +   + +LNN+GYTIER I G 
Sbjct: 416 HPSHVEIPDDYEPRLILIEGDGAAQMTIQELTSMVRFQVPIEIMILNNNGYTIERAIRGP 475

Query: 484 KAGYNDIQNWDHLALLPTFGAKDYENHRVAT------TGEWDKLTQDKEFNKNSKIRMIE 537
              YND+ +WD   LL  FG  D++  R  +      +    KL Q K   K + I ++E
Sbjct: 476 TRSYNDVMSWDWTKLLEAFG--DFKKQRTVSAKIETRSKLAMKLKQLKNKGKLNLIELVE 533

Query: 538 VMLPVMDAPTSL 549
           + L  MD P  L
Sbjct: 534 IKLDTMDFPKQL 545

>Skud_7.383 Chr7
           complement(638760..638846,638850..638882,638886..638903,
           638917..639036) [258 bp, 86 aa] {ON} YGR087C (REAL)
          Length = 86

 Score = 87.4 bits (215), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 51/92 (55%), Positives = 57/92 (61%), Gaps = 6/92 (6%)

Query: 386 TETGTSAFGINQTPFPNNAYGISQVLWGSIGFTTGACLGAAFAAEEIDPKKRVILFIGDG 445
           TETG S    NQ     +A+ ISQVLW  I F  GA L    +AE+IDP  R ILF GD 
Sbjct: 1   TETGASTLASNQAILLKDAHDISQVLWRPIRFANGATL----SAEDIDPG-RAILFSGDR 55

Query: 446 SLQLTVQEISTMIRWGLKPYLFVLNNDGYTIE 477
            L LTVQE+ T IRW LKPYLFV NND   +E
Sbjct: 56  PL-LTVQEMPTTIRWRLKPYLFVPNNDKRHVE 86

>NDAI0H02380 Chr8 (578157..580214) [2058 bp, 685 aa] {ON} Anc_2.441
          Length = 685

 Score = 91.3 bits (225), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 136/560 (24%), Positives = 232/560 (41%), Gaps = 77/560 (13%)

Query: 7   GRYLFERLNQVDVKTIFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADGYARIKG 66
           G+   E + + +V T+FG PG   L + D IY  +  ++    +E  A + A+GYAR  G
Sbjct: 95  GQIFNEMMKRQNVDTVFGYPGGAILPVYDAIYNSDAFKFVLPKHEQGAGHMAEGYARASG 154

Query: 67  MS-CIITTFGVGELSALNGIAGSYAEHVGVLHVVG-VPSISSQAKQLLLHHTLGNGDFTV 124
            +  ++ T G G  + +  +A + A+ + ++   G VP+ +           +G      
Sbjct: 155 KTGVVLVTSGPGATNVVTPMADALADGIPMVVFTGQVPTSAIGTDAFQEADVVG------ 208

Query: 125 FHRMSANISETTAMVTDIATAPAEIDRCIRTTYITQR-PVYLGLPANLVD--LKVPAKLL 181
              +S + ++   MV  +A  P  I+         +  PV + LP ++    L+ P  + 
Sbjct: 209 ---ISRSCTKWNVMVRSVAELPLRINEAFEIANSGRPGPVLVDLPKDVTAAILRNPIPIK 265

Query: 182 ET-PIDLSLKPNDPEAET-EVVDTVLELIKAAKNPVI-LADACASRHDVKAETKKLIDAT 238
            T PI   LK    EA T E ++   +LI  AK PV+ + +   +  D     K+L D  
Sbjct: 266 STLPITSQLKSVAEEAYTMESINRAADLINLAKRPVLYVGNGIMNNPDGPRLLKELSDRA 325

Query: 239 QFPSFVTPMGKGSIDEQHPRFGGVYVGTLSRPEVKEAVESADLILSVGALLSDFNTGSFS 298
           Q P   T  G G+ D++ P+   + +G         A+++ADL++++GA   D  TG   
Sbjct: 326 QIPVTTTIQGLGAFDQEDPKSLDM-LGMHGCATANLAMQNADLVIALGARFDDRVTG--- 381

Query: 299 YSYKTKNIVEFHSDYIKIRNATFPGVQMKFALQ-KLLNAVPE---AIKG------YKPVP 348
                 NI +F  +  +       G+ + F +  K +N V E   A++G       K +P
Sbjct: 382 ------NIAKFAPEARRAALEERGGI-IHFEISPKNINKVVEAQVAVEGDAASNVSKLLP 434

Query: 349 VPARVPENKSCDPATPLKQ--EWMWNQVSKFLQEG-------DVVITETGTSAFGINQTP 399
           +   V E K        KQ  +W       +++E          VI++    A G  +  
Sbjct: 435 LVFPVKERKDW-----FKQINQWKKEYPYSYMKETAESKIKPQTVISKLSKIANGTGKPV 489

Query: 400 FPNNAYGISQVLW----------------GSIGFTTGACLGAAFAAEEIDPKKRVILFIG 443
                 G  Q +W                G +G T G  L AA  A+   P   VI   G
Sbjct: 490 VVTTGVGQHQ-MWAAQHWTWKHPRSFITSGGLG-TMGYGLPAAIGAQVARPDAIVIDIDG 547

Query: 444 DGSLQLTVQEISTMIRWGLKPYLFVLNNDGYTI----ERLIHGEKAGYNDIQNWDHLALL 499
           D S  +T+ E+S+ ++ G+   + +LNN+   +    + L +  +  +    N D + L 
Sbjct: 548 DASFNMTLTELSSAVQAGVPIKILLLNNEEQGMVTQWQSLFYEHRYSHTHQLNPDFMKLA 607

Query: 500 PTFGAKDYENHRVATTGEWD 519
              G K     RV   GE D
Sbjct: 608 DAMGLKGI---RVKNQGELD 624

>YMR108W Chr13 (484084..486147) [2064 bp, 687 aa] {ON}
           ILV2Acetolactate synthase, catalyses the first common
           step in isoleucine and valine biosynthesis and is the
           target of several classes of inhibitors, localizes to
           the mitochondria; expression of the gene is under
           general amino acid control
          Length = 687

 Score = 89.7 bits (221), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 139/582 (23%), Positives = 235/582 (40%), Gaps = 77/582 (13%)

Query: 4   ITLGRYLFERLNQVDVKTIFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADGYAR 63
           +T G+   E +++ +V T+FG PG   L + D I+  +   +    +E  A + A+GYAR
Sbjct: 92  LTGGQIFNEMMSRQNVDTVFGYPGGAILPVYDAIHNSDKFNFVLPKHEQGAGHMAEGYAR 151

Query: 64  IKGM-SCIITTFGVGELSALNGIAGSYAEHVGVLHVVG-VPSISSQAKQLLLHHTLGNGD 121
             G    ++ T G G  + +  +A ++A+ + ++   G VP+ +           +G   
Sbjct: 152 ASGKPGVVLVTSGPGATNVVTPMADAFADGIPMVVFTGQVPTSAIGTDAFQEADVVG--- 208

Query: 122 FTVFHRMSANISETTAMVTDIATAPAEIDRCIR-TTYITQRPVYLGLPANLVDLKVPAKL 180
                 +S + ++   MV  +   P  I+      T     PV + LP +     V A +
Sbjct: 209 ------ISRSCTKWNVMVKSVEELPLRINEAFEIATSGRPGPVLVDLPKD-----VTAAI 257

Query: 181 LETPI------------DLSLKPNDPEAETEVVDTVLELIKAAKNPVILADACASRH-DV 227
           L  PI             L+ +  D E   + ++   +LI  AK PV+   A    H D 
Sbjct: 258 LRNPIPTKTTLPSNALNQLTSRAQD-EFVMQSINKAADLINLAKKPVLYVGAGILNHADG 316

Query: 228 KAETKKLIDATQFPSFVTPMGKGSIDEQHPRFGGVYVGTLSRPEVKEAVESADLILSVGA 287
               K+L D  Q P   T  G GS D++ P+   + +G         AV++ADLI++VGA
Sbjct: 317 PRLLKELSDRAQIPVTTTLQGLGSFDQEDPKSLDM-LGMHGCATANLAVQNADLIIAVGA 375

Query: 288 LLSDFNTGSFS-------------------YSYKTKNIVEFHSDYIKIRN--ATFPGVQM 326
              D  TG+ S                   +    KNI +     I +     T  G  M
Sbjct: 376 RFDDRVTGNISKFAPEARRAAAEGRGGIIHFEVSPKNINKVVQTQIAVEGDATTNLGKMM 435

Query: 327 K--FALQKLLNAVPEAIKGYKPVPVPARVPENKSCDPATPLKQEWMWNQVSKFLQE-GDV 383
              F +++      +  K  K  P  A + E     P + +K + +  ++SK   + G  
Sbjct: 436 SKIFPVKERSEWFAQINKWKKEYPY-AYMEET----PGSKIKPQTVIKKLSKVANDTGRH 490

Query: 384 VITETGTSA---FGINQTPFPNNAYGISQVLWGSIGFTTGACLGAAFAAEEIDPKKRVIL 440
           VI  TG      +      + N    I+    G++G+   A +GA  A     P+  VI 
Sbjct: 491 VIVTTGVGQHQMWAAQHWTWRNPHTFITSGGLGTMGYGLPAAIGAQVA----KPESLVID 546

Query: 441 FIGDGSLQLTVQEISTMIRWGLKPYLFVLNNDGYTI----ERLIHGEKAGYNDIQNWDHL 496
             GD S  +T+ E+S+ ++ G    + +LNN+   +    + L +  +  +    N D +
Sbjct: 547 IDGDASFNMTLTELSSAVQAGTPVKILILNNEEQGMVTQWQSLFYEHRYSHTHQLNPDFI 606

Query: 497 ALLPTFGAKDYENHRVATTGEWDKLTQDKEFNKNSKIRMIEV 538
            L    G K     RV    E D   + KEF       ++EV
Sbjct: 607 KLAEAMGLKGL---RVKKQEELD--AKLKEFVSTKGPVLLEV 643

>KAFR0A00570 Chr1 complement(101898..103946) [2049 bp, 682 aa] {ON}
           Anc_2.441 YMR108W
          Length = 682

 Score = 85.9 bits (211), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 133/569 (23%), Positives = 236/569 (41%), Gaps = 77/569 (13%)

Query: 4   ITLGRYLFERLNQVDVKTIFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADGYAR 63
           +T G+   E + + +V T+FG PG   L + D IY+ +  ++    +E  A + A+GYAR
Sbjct: 87  LTGGQIFNEMMARHNVDTVFGYPGGAILPVYDAIYQSKNFKFVLPKHEQGAGHMAEGYAR 146

Query: 64  IKGMSCII-TTFGVGELSALNGIAGSYAEHVGVLHVVG-VPSISSQAKQLLLHHTLGNGD 121
             G   I+  T G G  + +  +A + A+ + ++   G VP+ +           +G   
Sbjct: 147 ASGKPGIVLVTSGPGATNVVTPMADALADGIPMVVFTGQVPTTAIGTDAFQEADVVG--- 203

Query: 122 FTVFHRMSANISETTAMVTDIATAPAEIDRCIR-TTYITQRPVYLGLPANLVDLKVPAKL 180
                 +S + ++   M+ ++A  P  I+      T     PV + LP +     V A +
Sbjct: 204 ------ISRSCTKWNVMIKNVAELPVRINEAFEIATSGRPGPVLVDLPKD-----VTAAI 252

Query: 181 LE--TPIDLSLKPN-----DPEAETEVV----DTVLELIKAAKNPVI-LADACASRHDVK 228
           L    P+  SL  N       +A+ E V    +   +LI  AKNPV+ +        D  
Sbjct: 253 LRDAIPVGSSLPSNALSQLTNKAQDEFVLDNINKAADLINLAKNPVLYVGGGILGNEDGP 312

Query: 229 AETKKLIDATQFPSFVTPMGKGSIDEQHPRFGGVYVGTLSRPEVKEAVESADLILSVGAL 288
              K+L +  Q P   + +G G+ D++ P+   + +G         A+++ADLI+++G  
Sbjct: 313 KLLKQLSERAQIPVTTSLLGLGAFDQEDPKSLDM-LGMHGCATANLAMQNADLIIAIGTR 371

Query: 289 LSDFNTGSFSYSYKTKNIVEFHSDYIKIRNATFPGVQMKFALQ-KLLNAVPEA------- 340
             D  TG         NI +F  +  +       G+ + F +  K +N V EA       
Sbjct: 372 FDDRVTG---------NIAKFAPEARRAALENRGGI-IHFEISPKNINKVVEAQIAVEGD 421

Query: 341 ----IKGYKPVPVP--------ARVPENKSC--------DPATPLKQEWMWNQVSKFLQE 380
               ++   P   P        A++ E K+          P + LK + + +++SK    
Sbjct: 422 ATANLQSILPKIFPVKERTEWFAKIKEWKTKYPYSYMKETPNSKLKPQTVISKLSKIANA 481

Query: 381 -GDVVITETGTSAFGINQTPFPNNAYGISQVLWGSIGFTTGACLGAAFAAEEIDPKKRVI 439
            G  VI  TG     +         +  + +  G +G T G  L AA  A+   P   VI
Sbjct: 482 TGKEVIVTTGVGQHQMWAAQHWTWKHPRTFITSGGLG-TMGYGLPAAIGAQVAKPDALVI 540

Query: 440 LFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNDGYTI----ERLIHGEKAGYNDIQNWDH 495
              GD S  +T+ E+S+ ++ G    + +LNN+   +    + L +  +  +    N D 
Sbjct: 541 DIDGDASFNMTLTELSSAVQAGAPVKILLLNNEEQGMVTQWQSLFYENRYSHTHQLNPDF 600

Query: 496 LALLPTFGAKDYENHRVATTGEWDKLTQD 524
           + L    G K     +V+   + DK  Q+
Sbjct: 601 IKLAEAMGLKAI---KVSKQNQLDKALQE 626

>Smik_13.297 Chr13 (467578..469641) [2064 bp, 687 aa] {ON} YMR108W
           (REAL)
          Length = 687

 Score = 85.9 bits (211), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 135/582 (23%), Positives = 232/582 (39%), Gaps = 77/582 (13%)

Query: 4   ITLGRYLFERLNQVDVKTIFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADGYAR 63
           +T G+   E +++ +V T+FG PG   L + D I+  +   +    +E  A + A+GYAR
Sbjct: 92  LTGGQIFNEMMSRQNVDTVFGYPGGAILPVYDAIHNSDKFNFVLPKHEQGAGHMAEGYAR 151

Query: 64  IKGM-SCIITTFGVGELSALNGIAGSYAEHVGVLHVVG-VPSISSQAKQLLLHHTLGNGD 121
             G    ++ T G G  + +  +A ++A+ + ++   G VP+ +           +G   
Sbjct: 152 ASGKPGVVLVTSGPGATNVVTPMADAFADGIPMVVFTGQVPTTAIGTDAFQEADVVG--- 208

Query: 122 FTVFHRMSANISETTAMVTDIATAPAEIDRCIR-TTYITQRPVYLGLPANLVDLKVPAKL 180
                 +S + ++   MV  +   P  I+      T     PV + LP +     V A +
Sbjct: 209 ------ISRSCTKWNVMVKSVEELPLRINEAFEIATSGRPGPVLVDLPKD-----VTAAI 257

Query: 181 LETPI------------DLSLKPNDPEAETEVVDTVLELIKAAKNPVILADACASRH-DV 227
           L  PI             L+    D E   + ++   +LI  AK PV+   A    H D 
Sbjct: 258 LRNPIPTKTTLPSNALNQLTSHTQD-EFVMQSINKAADLINLAKKPVLYVGAGILNHIDG 316

Query: 228 KAETKKLIDATQFPSFVTPMGKGSIDEQHPRFGGVYVGTLSRPEVKEAVESADLILSVGA 287
               K+L    Q P   T  G GS D++ P+   + +G         A+++ADLI++VGA
Sbjct: 317 PRLLKELSGRAQIPVTTTLQGLGSFDQEDPKSLDM-LGMHGCATANLAIQNADLIIAVGA 375

Query: 288 LLSDFNTGSFS-------------------YSYKTKNIVEFHSDYIKIRNATFPGVQMK- 327
              D  TG+ S                   +    KNI +     I +       ++   
Sbjct: 376 RFDDRVTGNISKFAPEARRAAAEGRGGIIHFEVSPKNINKVVQTQIAVEGDATTNIEKMM 435

Query: 328 ---FALQKLLNAVPEAIKGYKPVPVPARVPENKSCDPATPLKQEWMWNQVSKFLQE-GDV 383
              F +++      +  K  K  P  A + E     P + +K + +  ++SK   + G  
Sbjct: 436 SKIFPVKERSEWFDQINKWKKKYPY-AFMKET----PGSKIKPQTVIKKLSKIANDTGRH 490

Query: 384 VITETGTSA---FGINQTPFPNNAYGISQVLWGSIGFTTGACLGAAFAAEEIDPKKRVIL 440
           VI  TG      +      + N    I+    G++G+   A +GA  A     P+  VI 
Sbjct: 491 VIVTTGVGQHQMWAAQHWTWKNPRTFITSGGLGTMGYGLPAAIGAQVA----KPESLVID 546

Query: 441 FIGDGSLQLTVQEISTMIRWGLKPYLFVLNNDGYTI----ERLIHGEKAGYNDIQNWDHL 496
             GD S  +T+ E+S+ ++ G    + VLNN+   +    + L +  +  +    N D +
Sbjct: 547 IDGDASFNMTLTELSSAVQAGTPVKILVLNNEEQGMVTQWQSLFYEHRYSHTHQLNPDFV 606

Query: 497 ALLPTFGAKDYENHRVATTGEWDKLTQDKEFNKNSKIRMIEV 538
            L    G K     RV    E D   + KEF       ++EV
Sbjct: 607 KLADAMGLKGL---RVKKQEELD--AKLKEFVSTKGPVLLEV 643

>NCAS0F01500 Chr6 (299388..301442) [2055 bp, 684 aa] {ON} Anc_2.441
           YMR108W
          Length = 684

 Score = 85.9 bits (211), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 128/549 (23%), Positives = 224/549 (40%), Gaps = 78/549 (14%)

Query: 7   GRYLFERLNQVDVKTIFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADGYARIKG 66
           G+   E + + +V T+FG PG   L + D IY  E   +    +E  A + A+GYAR  G
Sbjct: 92  GQIFNEMMKRQNVDTVFGYPGGAILPVYDAIYNSEAFNFVLPKHEQGAGHMAEGYARASG 151

Query: 67  M-SCIITTFGVGELSALNGIAGSYAEHVGVLHVVG-VPSISSQAKQLLLHHTLGNGDFTV 124
               ++ T G G  + +  +A + A+ + ++   G VP+ +           +G      
Sbjct: 152 KPGVVLVTSGPGATNVVTPMADALADGIPMVVFTGQVPTSAIGTDAFQEADVVG------ 205

Query: 125 FHRMSANISETTAMVTDIATAPAEIDRCIRTTYITQR-PVYLGLPANLVDLKVPAKLLET 183
              +S + ++   MV  +A  P  I+         +  PV + LP +     V A +L  
Sbjct: 206 ---ISRSCTKWNVMVKSVAELPLRINEAFEIAMSGRPGPVLVDLPKD-----VTAAILRE 257

Query: 184 PIDL-------------SLKPNDPEAETEVVDTVLELIKAAKNPVI-LADACASRHDVKA 229
           PI +             S+   D  A++  ++   +LI  AK PV+ + +   +  D   
Sbjct: 258 PIPIKSTLPSGTLTQIKSIAQEDFLADS--INRAADLINLAKKPVLYVGNGIFNNEDGPR 315

Query: 230 ETKKLIDATQFPSFVTPMGKGSIDEQHPRFGGVYVGTLSRPEVKEAVESADLILSVGALL 289
             K+L +  Q P   T  G G+ D++ P+   + +G         A+++ADLI++VGA  
Sbjct: 316 LLKELSERAQIPVTTTIQGLGAFDQEDPKSLDM-LGMHGCATANLAMQNADLIIAVGARF 374

Query: 290 SDFNTGSFSYSYKTKNIVEFHSDYIKIRNATFPGVQMKFALQ-KLLNAVPE---AIKGYK 345
            D  TG         NI +F  +  +  N    G+ + F +  K +N V E   A++G  
Sbjct: 375 DDRVTG---------NIAKFAPEARRAANEGRGGI-IHFEISPKNINKVVEAQVAVEGDA 424

Query: 346 PVPV----PARVPENKSCD--------------------PATPLKQEWMWNQVSKFLQE- 380
              +    PA  P  +  +                    P   LK + + +++SK     
Sbjct: 425 AANIDKMLPAIFPIKERTEWFKEINQWKKDYPYDYMKEVPGGKLKPQTVISKLSKVANAT 484

Query: 381 GDVVITETGTSAFGINQTPFPNNAYGISQVLWGSIGFTTGACLGAAFAAEEIDPKKRVIL 440
           G  VI  TG     +         +  S +  G +G T G  L +A  A+   P+  VI 
Sbjct: 485 GRPVIVTTGVGQHQMWTAQHWTWKHPRSFITSGGLG-TMGYGLPSAIGAQVAHPEALVID 543

Query: 441 FIGDGSLQLTVQEISTMIRWGLKPYLFVLNNDGYTI----ERLIHGEKAGYNDIQNWDHL 496
             GD S  +T+ E+S+ ++ G    + +LNN+   +    + L +  +  +    N D +
Sbjct: 544 IDGDASFNMTLTELSSAVQAGTPVKIMILNNEEQGMVTQWQSLFYENRYSHTHQLNPDFM 603

Query: 497 ALLPTFGAK 505
            L    G K
Sbjct: 604 KLADAMGLK 612

>KNAG0E02360 Chr5 complement(470361..472442) [2082 bp, 693 aa] {ON}
           Anc_2.441 YMR108W
          Length = 693

 Score = 83.6 bits (205), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 131/561 (23%), Positives = 226/561 (40%), Gaps = 83/561 (14%)

Query: 4   ITLGRYLFERLNQVDVKTIFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADGYAR 63
           +T G+   E +++ +V T+FG PG   L + D IY  E  ++    +E  A + A+GYAR
Sbjct: 97  LTGGQIFNEMMSRHNVDTVFGYPGGAILPVYDAIYGSENFKFVLPKHEQGAGHMAEGYAR 156

Query: 64  IKGM-SCIITTFGVGELSALNGIAGSYAEHVGVLHVVG-VPSISSQAKQLLLHHTLGNGD 121
             G    ++ T G G  + +  +A + A+ V ++   G VP+ +           +G   
Sbjct: 157 ASGKPGVVLVTSGPGATNVVTPMADALADGVPMVVFTGQVPTNAIGTDAFQEADVVG--- 213

Query: 122 FTVFHRMSANISETTAMVTDIATAPAEIDRCIRTTYITQR-PVYLGLPANLVDLKVPAKL 180
                 +S + ++   MV ++A  P  I+         +  PV + LP ++      A L
Sbjct: 214 ------ISRSCTKWNVMVKNVAELPKRINEAFEIAMSGRPGPVLVDLPKDV----TAAVL 263

Query: 181 LET-PIDLSLKPNDPEAET----------EVVDTVLELIKAAKNPVI-LADACASRHDVK 228
            E  P + +L   +  A T            ++   +LI  AK PV+ + +   +  D  
Sbjct: 264 REAIPTESTLPSLNGGATTGATVFDEFLAPAINKAADLINLAKKPVLYVGNGILNNEDGP 323

Query: 229 AETKKLIDATQFPSFVTPMGKGSIDEQHPRFGGVYVGTLSRPEVKEAVESADLILSVGAL 288
              K+L D  Q P   T  G G+ D++ P+   + +G         A+++ADLI++VGA 
Sbjct: 324 RLLKELSDRAQIPVTTTLQGLGAFDQEDPKSLDM-LGMHGCATANLAIQNADLIIAVGAR 382

Query: 289 LSDFNTGSFSYSYKTKNIVEFHSDYIKIRNATFPGVQMKFALQ-KLLNAVPE---AIKGY 344
             D  TG         NI +F  +  KI      G  + F +  K +N V E   A++G 
Sbjct: 383 FDDRVTG---------NITKFAPE-AKIAAQENRGGIIHFEVSPKNINKVVEAQVAVEGD 432

Query: 345 KPVPVPARVPENKSCDPATPLKQEWMW-NQVSKFLQEGDVVITETGTSAFGINQTPFPN- 402
               +   +P+        P+K    W  Q+ ++ Q+      +    +  + QT     
Sbjct: 433 ATENIATMLPK------VFPVKHRAEWFKQIEQWKQKFPYAYMKETPGSKIMPQTVIAKL 486

Query: 403 ----NAYGISQVLWGSIG-----------------FTTGACLG-------AAFAAEEIDP 434
               NA G   V+   +G                 F T   LG       AA  A+   P
Sbjct: 487 SKLANASGRDVVVTTGVGQHQMWAAQHWTWKKPRTFVTSGGLGTMGFGLPAAIGAQVAKP 546

Query: 435 KKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNDGYTI----ERLIHGEKAGYNDI 490
              VI   GD S  +T+ E+S+ ++ G    + +LNN+   +    + L +  +  +   
Sbjct: 547 DAMVIDIDGDASFNMTLTELSSAVQAGTPVKILLLNNEEQGMVTQWQSLFYENRYSHTHQ 606

Query: 491 QNWDHLALLPTFGAKDYENHR 511
           +N D   L    G K  +  R
Sbjct: 607 RNPDFQKLCEAMGVKPLKASR 627

>TBLA0I01400 Chr9 (303028..305160) [2133 bp, 710 aa] {ON} Anc_2.441
           YMR108W
          Length = 710

 Score = 83.2 bits (204), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 118/509 (23%), Positives = 207/509 (40%), Gaps = 55/509 (10%)

Query: 1   MSEITLGRYLFERLNQVDVKTIFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADG 60
           M  +T G    E + + +V T+FG PG   L + D IY  E  ++    +E  A + A+G
Sbjct: 111 MIGMTGGEIFNEMMRRKNVDTVFGYPGGAILPVYDAIYNSENFKFVLPRHEQGAGHMAEG 170

Query: 61  YARIKGM-SCIITTFGVGELSALNGIAGSYAEHVGVLHVVG-VPSISSQAKQLLLHHTLG 118
           YAR  G    ++ T G G  + +  +A + A+ V ++   G VP+ +           +G
Sbjct: 171 YARASGKPGVVLVTSGPGATNVVTPMADALADGVPMVVFTGQVPTSAIGTDAFQEADVIG 230

Query: 119 NGDFTVFHRMSANISETTAMVTDIATAPAEIDRCIRTTYITQR-PVYLGLPANLVD--LK 175
                    +S + ++   MV  +   P  I+         +  PV + LP ++    LK
Sbjct: 231 ---------ISRSCTKWNVMVKSVDELPKRINEAFEIAMSGRPGPVLIDLPKDVTAAVLK 281

Query: 176 VPAKLLETPIDLSLKPN-----DPEAETEVVDTVLELIKAAKNPVILADA-CASRHDVKA 229
            P  +L   +  +   N       +  +E +    +LI  AK PVI A A   S  +   
Sbjct: 282 NPIPVLNNSLPYTAISNINQIIQRKFLSENIQETAKLINMAKKPVIYAGAGILSNLNGPT 341

Query: 230 ETKKLIDATQFPSFVTPMGKGSIDEQHPRFGGVYVGTLSRPEVKEAVESADLILSVGALL 289
             K+L + +Q P   T    G+ D+Q P+   + +G         A+++ADLI+++G   
Sbjct: 342 LLKELSERSQIPVTTTLQALGAFDQQDPKSLDM-LGMHGSAVANLAIQNADLIIALGGRF 400

Query: 290 SDFNTGSFS-------------------YSYKTKNIVEFHSDYIKIRNATFPGVQMKFAL 330
            D  TG+ S                   +    KNI +     I +       +++   L
Sbjct: 401 DDRVTGNISKFAPEARKAALEKRGGIVHFEISPKNINKVVETQIALEGDVTENLEILLPL 460

Query: 331 QKLLNAVPE---AIKGYKPVPVPARVPENKSCDPATPLKQEWMWNQVSKFLQE-GDVVIT 386
            K ++  PE    I  +K     A   E     P + +K + + +++S      G  VI 
Sbjct: 461 IKSVDERPEWFAQINQWK----KAYPYEYMRETPGSKIKPQTVISRLSDIANSTGKKVIV 516

Query: 387 ETGTSAFGI---NQTPFPNNAYGISQVLWGSIGFTTGACLGAAFAAEEIDPKKRVILFIG 443
            TG     +       + N    I+    G++G+   A +GA  A     P+  VI   G
Sbjct: 517 TTGVGQHQMWTAQHWTWRNPRTFITSGGLGTMGYGLPAAIGAQVAF----PEALVIDIDG 572

Query: 444 DGSLQLTVQEISTMIRWGLKPYLFVLNND 472
           D S  +T+ E+S+ ++      + +LNN+
Sbjct: 573 DASFNMTLTELSSAVQANTPIKIMLLNNE 601

>ZYRO0E03454g Chr5 complement(270926..272575) [1650 bp, 549 aa] {ON}
           similar to uniprot|P39994 Saccharomyces cerevisiae
           YEL020C Hypothetical ORF
          Length = 549

 Score = 81.3 bits (199), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 110/496 (22%), Positives = 201/496 (40%), Gaps = 56/496 (11%)

Query: 9   YLFERLNQVDVKTIFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADGYARIKGM- 67
           Y    L    V T+FG+ G   + L D + E  G+++    NE +A+YAA  Y  + G  
Sbjct: 6   YFTRVLQNYGVDTVFGIVGIPIVELADTMIE-HGIKFIACRNEQSASYAASAYGYLTGKP 64

Query: 68  SCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNGDFTVFHR 127
             ++   G G + AL GI  S +    +L + G    SS+A+          G F    +
Sbjct: 65  GVLLVVGGPGIIHALAGIYNSMSNKWPLLVLAG----SSEAQH--------RGGFQELDQ 112

Query: 128 MSANISETTAMVTDIATAPAEI---DRCIRTTYITQRPVYLGLPANLVDLKVPAKLLETP 184
           +S  +         + ++  ++   D      Y T    YL +P NL+   V    L  P
Sbjct: 113 VSL-LKPYVKFSGQLNSSNIDVLTYDALRLVQYTTAGATYLDIPGNLIGSTVKKDSLP-P 170

Query: 185 IDLSLKPN---DPEAETEVVDTVLELIKAAKNPVILADACASRHDVKAETKKLIDATQFP 241
           +     P    DP A  EV D    LI+     V++     + H    E ++ +D  Q P
Sbjct: 171 VKNIYVPKSSPDPSAVQEVTD----LIRKNPENVLVVVGKGAVH-ASQEIRQFVDRFQLP 225

Query: 242 SFVTPMGKGSIDEQHPRFGGVYVGTLSRPEVKEAVESADLILSVGALLSDFNTGSFSYSY 301
              TPMGKG + + HP         +S    + A++ A ++L +GA L+     + +  +
Sbjct: 226 FLPTPMGKGVVPDSHPL-------NVSSARSR-ALQEAKVVLVLGARLNWILHFASAPKW 277

Query: 302 KTKNI-VEFHSDYIKIRNATFPGVQMKF--ALQKLLNAVPEAIKGYKPVPVP-------- 350
               + ++  SD   + +  F    +     +   +  +  ++  Y    +         
Sbjct: 278 NPDALFIQVDSDTTTLGHNNFKSQHLSLWGDIGLTVRLITASLGDYHSQGLSPSLQSNIA 337

Query: 351 ---ARVPENKSCDPATPLKQEWMWNQVSKFLQEGDVVITETGTSAFGINQTPFPNNAYGI 407
              A++   +S   ++ L    ++  +   + +   +I   G +     +  FP + Y +
Sbjct: 338 RNAAKLKSQESQQVSSRLNYNVVYAHLRPLINDESTIIVSEGANTMDKARVSFPTD-YPL 396

Query: 408 SQVLWGSIGFTTGACLGAAFAAEEIDPKKRVILFIGDGSLQLTVQEISTMIRWGLKPYLF 467
            ++  G+   T G  +G A AA+  +P K V++  GD +   +  +I T  R GL   + 
Sbjct: 397 QRLDAGT-NATMGVGMGYALAAKVSNPDKTVLVIQGDSAFGFSAMDIETATRSGLALIVI 455

Query: 468 VLNNDGYTIERLIHGE 483
           V+NN G     + HG+
Sbjct: 456 VMNNGG-----IYHGQ 466

>Suva_13.287 Chr13 (465217..467280) [2064 bp, 687 aa] {ON} YMR108W
           (REAL)
          Length = 687

 Score = 80.9 bits (198), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 144/603 (23%), Positives = 240/603 (39%), Gaps = 86/603 (14%)

Query: 4   ITLGRYLFERLNQVDVKTIFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADGYAR 63
           +T G+   E +++ +V T+FG PG   L + D I+  +   +    +E  A + A+GYAR
Sbjct: 92  LTGGQIFNEMMSRHNVDTVFGYPGGAILPVYDAIHNSDKFTFVLPRHEQGAGHMAEGYAR 151

Query: 64  IKGM-SCIITTFGVGELSALNGIAGSYAEHVGVLHVVG-VPSISSQAKQLLLHHTLGNGD 121
             G    ++ T G G  + +  +A ++A+ + ++   G VP+ +           +G   
Sbjct: 152 ASGKPGVVLVTSGPGATNVVTPMADAFADGIPMVVFTGQVPTSAIGTDAFQEADVVG--- 208

Query: 122 FTVFHRMSANISETTAMVTDIATAPAEIDRCIR-TTYITQRPVYLGLPANLVDLKVPAKL 180
                 +S + ++   MV  +   P  I+      T     PV + LP +     V A +
Sbjct: 209 ------ISRSCTKWNVMVKSVEELPLRINEAFEIATSGRPGPVLVDLPKD-----VTAAI 257

Query: 181 LETPI------------DLSLKPNDPEAETEVVDTVLELIKAAKNPVILADACASRH-DV 227
           L  PI             L+ +  D E   + ++   +LI  AK PV+   A    H D 
Sbjct: 258 LRNPIPTKTTLPSNALNQLTSRTQD-EFVLQNINKAADLINLAKKPVLYVGAGILNHADG 316

Query: 228 KAETKKLIDATQFPSFVTPMGKGSIDEQHPRFGGVYVGTLSRPEVKEAVESADLILSVGA 287
               K+L D  Q P   T  G G+ D++ P+   + +G         AV++ADL+++VGA
Sbjct: 317 PRLLKELSDRAQIPVTTTLQGLGAFDQEDPKSLDM-LGMHGCATANLAVQNADLLIAVGA 375

Query: 288 LLSDFNTGSFSYSYKTKNIVEFHSDYIKIRNATFPGVQMKFALQKLLNAVPE---AIKG- 343
              D           T NI +F  +  +       G+       K +N V E   A++G 
Sbjct: 376 RFDD---------RVTLNIAKFAPEARRAAAEGRGGIIHFEVSPKNINKVVETQIAVEGD 426

Query: 344 ---------YKPVPVPAR------VPENKSC--------DPATPLKQEWMWNQVSKFLQE 380
                     K  PV  R      + E K           P + +K + +  ++SK   +
Sbjct: 427 ATGNLDKMMPKIFPVKERSEWFGQINEWKKKYPYAYMMETPGSKIKPQTVITKLSKIAND 486

Query: 381 -GDVVITETGTSAFGINQTPFPNNAYGISQVLWGSIGFTTGACLGAAFAAEEIDPKKRVI 439
            G  VI  TG     +            + +  G +G T G  L AA  A+   P   VI
Sbjct: 487 TGRHVIVTTGVGQHQMWAAQHWTWKTPRTFITSGGLG-TMGYGLPAAIGAQVAKPDSLVI 545

Query: 440 LFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNDGYTI----ERLIHGEKAGYNDIQNWDH 495
              GD S  +T+ E+S+ ++ G    + VLNN+   +    + L +  +  +    N D 
Sbjct: 546 DIDGDASFNMTLTELSSAVQAGTPVKILVLNNEEQGMVTQWQSLFYENRYSHTHQLNPDF 605

Query: 496 LALLPTFGAKDYENHRVATTGEWDKLTQDKEFNKNSKIRMIEV-------MLPVMDAPTS 548
           + L    G K     RV    E D   + KEF       ++EV       +LP++ A   
Sbjct: 606 IKLADAMGLKGL---RVKKQEELD--AKLKEFVSTKGPVLLEVEVDKKVPVLPMVPAGKG 660

Query: 549 LIE 551
           L E
Sbjct: 661 LDE 663

>NCAS0G03960 Chr7 (733213..734946) [1734 bp, 577 aa] {ON} Anc_1.450
           YEL020C
          Length = 577

 Score = 79.3 bits (194), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 123/508 (24%), Positives = 206/508 (40%), Gaps = 67/508 (13%)

Query: 4   ITLGRYLFERLNQVDVKTIFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADGYAR 63
           +T   Y    L Q ++ T+FG+ G   + L DK+ E  G+R+    NE  A+YAA GY  
Sbjct: 10  LTATEYFVSLLKQYEIDTVFGIVGIPIVELADKMIE-HGIRFISCRNEQAASYAASGYGY 68

Query: 64  IKGM-SCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNGDF 122
           + G  + ++   G G + AL GI  S +    ++ + G  S +S+  Q+        G F
Sbjct: 69  LTGKPAVLLVVGGPGLIHALAGIYNSMSNKWPLIVIAG--SSNSETDQV--------GGF 118

Query: 123 TVFHRMSA--NISETTAMVTDIATAPAEIDRCIRTTYITQRPV---YLGLPANLV--DLK 175
               ++S      + T  +  I    A  +      +  Q P+   Y+  P NL+  + K
Sbjct: 119 QDLDQVSLLNKYVKYTVKLNSINIPTALFNAY---NFAIQSPMGVTYIDFPGNLIEGNYK 175

Query: 176 VPAKLLETPIDLSLKPN---DPEAETEVVDTVLELIKAAKNP-VILADACASRHDVKAET 231
           V A+    P+ +  +     DP    EV   ++E   ++ N  VIL       H    + 
Sbjct: 176 VQAQPATNPVSIPRRVRCSPDPNTVNEVAKLIIE--NSSNNVLVILGKGAVEFHK---DI 230

Query: 232 KKLIDATQFPSFVTPMGKGSIDEQHPRFGGVYVGTLSRPEVKEAVESADLILSVGALLSD 291
            K I+    P   TPM KG + + H          +S    K A++ A+++L +GA L+ 
Sbjct: 231 NKFINTFNLPFLPTPMAKGILPDSHNL-------NVSSARSK-ALKDANIVLVLGARLNW 282

Query: 292 FNTGSFSYSYKTKNI-VEFHSD--YIKIRNATFPGVQMKFALQKLLNAVPEAI------- 341
                 S  +  K I ++  +D   + + N T   + +   L   +N++ +A        
Sbjct: 283 ILHFGESPKWNAKAIFIQCDNDPSNLGVNNGTNTNLSLLGDLGLTVNSLSDAFSQITLNW 342

Query: 342 KGYKPVPVPAR-----------VPENKSCDPATPLKQEWMWNQVSKFLQEGDVVITETGT 390
           K  K +    R             E +       L    ++  + K + E   V+   G 
Sbjct: 343 KYEKGISDEMRGIILKNQFKLQEKEQRLIKDKDLLNYNVVYGALRKLMDESKTVLVTEGA 402

Query: 391 SAFGINQTPFPNNAYGISQVLWGSIGFTTGACLGAAFAA--EEIDPKKR---VILFIGDG 445
           ++  I +  FP++     Q L      T G  LG   AA   E+   KR   VIL  GD 
Sbjct: 403 NSMDIARISFPSSVP--KQRLDAGTNATMGIGLGYGIAACLNELRNGKRGKDVILIQGDS 460

Query: 446 SLQLTVQEISTMIRWGLKPYLFVLNNDG 473
           +   +  EI T +R+ L   + V+NN G
Sbjct: 461 AFGFSGMEIETAVRFKLGLIIVVMNNSG 488

>Skud_13.267 Chr13 (459466..461529) [2064 bp, 687 aa] {ON} YMR108W
           (REAL)
          Length = 687

 Score = 79.3 bits (194), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 141/622 (22%), Positives = 243/622 (39%), Gaps = 100/622 (16%)

Query: 4   ITLGRYLFERLNQVDVKTIFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADGYAR 63
           +T G+   E +++ +V T+FG PG   L + D I+  +   +    +E  A + A+GYAR
Sbjct: 92  LTGGQIFNEMMSRQNVDTVFGYPGGAILPVYDAIHNSDKFNFVLPKHEQGAGHMAEGYAR 151

Query: 64  IKGM-SCIITTFGVGELSALNGIAGSYAEHVGVLHVVG-VPSISSQAKQLLLHHTLGNGD 121
             G    ++ T G G  + +  +A ++A+ + ++   G VP+ +           +G   
Sbjct: 152 ASGKPGVVLVTSGPGATNVVTPMADAFADGIPMVVFTGQVPTSAIGTDAFQEADVVG--- 208

Query: 122 FTVFHRMSANISETTAMVTDIATAPAEIDRCIR-TTYITQRPVYLGLPANLVDLKVPAKL 180
                 +S + ++   MV  +   P  I+      T     PV + LP +     V A +
Sbjct: 209 ------ISRSCTKWNVMVKTVEELPLRINEAFEIATSGRPGPVLVDLPKD-----VTAAI 257

Query: 181 LETPI------------DLSLKPNDPEAETEVVDTVLELIKAAKNPVILADA-CASRHDV 227
           L  PI             L+    D E   + +    +LI  AK PV+   A   +  D 
Sbjct: 258 LRNPIPTKTTLPSNALNQLTSHAQD-EFVMQSISKAADLINLAKKPVLYVGAGILNNADG 316

Query: 228 KAETKKLIDATQFPSFVTPMGKGSIDEQHPRFGGVYVGTLSRPEVKEAVESADLILSVGA 287
               K+L +  Q P   T  G GS D++ P+   + +G         AV++ADL+++VGA
Sbjct: 317 PRLLKELSERAQIPVTTTLQGLGSFDQEDPKSLDM-LGMHGCVTANLAVQNADLLIAVGA 375

Query: 288 LLSDFNTGSFSYSYKTKNIVEFHSDYIKIRNATFPGVQMKFALQKLLNAVPE---AIKGY 344
              D           T NI +F  +  +       G+     + K +N V E   A++G 
Sbjct: 376 RFDD---------RVTCNIAKFAPEARRAAAEGRGGIVHFEVVPKNINKVVETQIAVEGD 426

Query: 345 KPVPVPARVPENKSCDPATPLKQEWMW-NQVSKFLQE---------------GDVVITET 388
               +   +P+        P+K+   W  Q++K+ +E                  VIT+ 
Sbjct: 427 ATSNLDKMMPK------IFPVKERSEWFGQINKWKKEFPYAYMMETPGSKIKPQTVITKL 480

Query: 389 GTSAFGINQTPFPNNAYGISQVLW----------------GSIGFTTGACLGAAFAAEEI 432
              A    +        G  Q +W                G +G T G  L +A  A+  
Sbjct: 481 SKIANDTGRHVIVTTGVGQHQ-MWAAQHWTWKNPRTFITSGGLG-TMGYGLPSAIGAQVA 538

Query: 433 DPKKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNDGYTI----ERLIHGEKAGYN 488
            P+  VI   GD S  +T+ E+S+ ++ G    + +LNN+   +    + L +  +  + 
Sbjct: 539 KPESLVIDIDGDASFNMTLTELSSAVQAGTPVKILILNNEEQGMVTQWQSLFYEHRYSHT 598

Query: 489 DIQNWDHLALLPTFGAKDYENHRVATTGEWDKLTQDKEFNKNSKIRMIEV-------MLP 541
              N D + L    G K     RV    E D   + KEF       ++EV       +LP
Sbjct: 599 HQLNPDFIKLAEAMGLKGL---RVKKQEELD--AKLKEFVSTKGPVLLEVEVDKKVPVLP 653

Query: 542 VMDAPTSLIEQAKLTASINAKQ 563
           ++ A   L E       +  +Q
Sbjct: 654 MVPAGKGLDESINFDPEVEKQQ 675

>TDEL0B05520 Chr2 complement(980893..982560) [1668 bp, 555 aa] {ON}
           Anc_1.450 YEL020C
          Length = 555

 Score = 79.0 bits (193), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 113/494 (22%), Positives = 200/494 (40%), Gaps = 63/494 (12%)

Query: 9   YLFERLNQVDVKTIFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADGYARIKGM- 67
           Y  + L Q  V T+FG+ G   + L D +   +G+++    NE +A+YAA  Y  + G  
Sbjct: 8   YFTQLLQQYGVDTVFGIVGIPIVELADTMIG-KGIKFIACRNEQSASYAASAYGYLTGKP 66

Query: 68  SCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNGDFTVFHR 127
             ++   G G + AL GI  S +    ++ + G    SS+         L  G F    +
Sbjct: 67  GVLLVVGGPGLIHALAGIYNSMSNRWPLIVIAG----SSE--------DLHKGGFQELDQ 114

Query: 128 MSANISETTAMVTDIATAPAEIDRCIRTTYITQRPVYLGLPANLVDLKVPAKLLETPIDL 187
           +S  +S+       + T P  I+     TY   R    G P  +  +  P  L+   I+ 
Sbjct: 115 VSL-LSDHLKFTGKLTTDPDVIELV---TYNAMRLTTTGTPG-VTYIDFPGSLISESIER 169

Query: 188 SLKPNDPEA------ETEVVDTVLELIKAAKNPVILADACASRHDVKAETKKLIDATQFP 241
           S  P    +      +TE +  V++L+ + +N  IL        +   E +KLI+    P
Sbjct: 170 SPYPVQSISRIQYMPDTESLQRVVKLLSSDQNKRILVVIGKGAVNASNEVRKLINDYNLP 229

Query: 242 SFVTPMGKGSIDEQHPRFGGVYVGTLSRPEVK-EAVESADLILSVGALLS---------- 290
              TPM KG + + HP         L+    + +A++ A+++L +GA L+          
Sbjct: 230 FLSTPMAKGVVPDSHP---------LNASSARSKALKEAEIVLVLGARLNWILHFGAPPK 280

Query: 291 -DFNTGSFSYSYKTKNIVEFHSDYIKIRNATFPGVQMK----------FALQKLLNAVPE 339
            D NT         +++ + +   +        G+ +K          +A Q L   +  
Sbjct: 281 WDANTIFIQVDCDPESLGQNNQRGVGYSLCGDIGLTVKSLIEKLKLERWAYQGLSRELRS 340

Query: 340 AIKGYKPVPVPARVPENKSCDPATPLKQEWMWNQVSKFLQEGDVVITETGTSAFGINQTP 399
           AIK         ++ + +       L    ++  +  F+ +   +I   G +     +  
Sbjct: 341 AIKLNH-----EKLAKKEQIVHHGRLNYNKVYQCLRTFIDDSRTIIVSEGANTMDQARIS 395

Query: 400 FPNNAYGISQVLWGSIGFTTGACLGAAFAAEEIDPKKRVILFIGDGSLQLTVQEISTMIR 459
           FP + Y   ++  G+   T G  LG A AA+   P K ++L  GD +   +  EI T +R
Sbjct: 396 FPTD-YPKHRLDAGT-NATMGIGLGYAIAAKIARPDKSIVLLQGDSAFGFSAMEIETAVR 453

Query: 460 WGLKPYLFVLNNDG 473
             L   + V+NN G
Sbjct: 454 NRLGLVIIVMNNSG 467

>CAGL0K03465g Chr11 (320030..322063) [2034 bp, 677 aa] {ON} highly
           similar to uniprot|P07342 Saccharomyces cerevisiae
           YMR108w Acetolactate synthase
          Length = 677

 Score = 79.0 bits (193), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 133/574 (23%), Positives = 230/574 (40%), Gaps = 83/574 (14%)

Query: 4   ITLGRYLFERLNQVDVKTIFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADGYAR 63
           +T G+   E + + +V T+FG PG   L + D I+  +  ++    +E  A + A+GYAR
Sbjct: 82  LTGGQIFNEMMARNNVDTVFGYPGGAILPVYDAIHNSDKFKFVLPKHEQGAGHMAEGYAR 141

Query: 64  IKGM-SCIITTFGVGELSALNGIAGSYAEHVGVLHVVG-VPSISSQAKQLLLHHTLGNGD 121
             G    ++ T G G  + +  +A + A+ + ++   G VP+ +           +G   
Sbjct: 142 ASGKPGVVLVTSGPGATNVVTPMADALADGIPMVVFTGQVPTTAIGTDAFQEADIVG--- 198

Query: 122 FTVFHRMSANISETTAMVTDIATAPAEIDRCIR-TTYITQRPVYLGLPANLVDLKVPAKL 180
                 +S + ++   MV ++A  P  I+   +  T     PV + LP +     V A +
Sbjct: 199 ------ISRSCTKWNVMVKNVAELPLRINEAFQIATSGRPGPVLVDLPKD-----VTAAI 247

Query: 181 LETPIDL-SLKPNDPEAE----------TEVVDTVLELIKAAKNPVI-LADACASRHDVK 228
           L TPI + S  P+    +           E +    +LI  AKNPV+ +     +  D  
Sbjct: 248 LRTPIPVKSTLPSTALQQLTAGVQDQFVIENIKKSADLINIAKNPVLYVGGGILNNVDGP 307

Query: 229 AETKKLIDATQFPSFVTPMGKGSIDEQHPRFGGVYVGTLSRPEVKEAVESADLILSVGAL 288
              K+L +  Q P   T  G G+ D++ P+   + +G         AV+++DLI++VGA 
Sbjct: 308 RLVKELSERAQIPVTTTLQGLGAFDQEDPKSLDM-LGMHGCATANLAVQNSDLIIAVGAR 366

Query: 289 LSDFNTGSFSYSYKTKNIVEFHSDYIKIRNATFPGVQMKFALQKLLNAVPEA-------- 340
             D  TG         NI +F  +  K       G+       K +N V EA        
Sbjct: 367 FDDRVTG---------NITKFAPEARKAALEGRGGIIHFEITPKNINKVVEAQVAVEGDA 417

Query: 341 ---IKGYKPVPVPAR---------------VPENKSCD-PATPLKQEWMWNQVSKFLQE- 380
              +    P+  P +                P + S + P + +K +    ++SK     
Sbjct: 418 ASNLSKLIPLVFPVKERPEWFEKINKWKKEFPYSYSLETPGSRIKPQTAIAKLSKIANAT 477

Query: 381 GDVVITETGTSA---FGINQTPFPNNAYGISQVLWGSIGFTTGACLGAAFAAEEIDPKKR 437
              VI  TG      +      + N    I+    G++G+   + +GA  A     P   
Sbjct: 478 SKEVIVTTGVGQHQMWAAQHWTWKNPRTFITSGGLGTMGYGLPSAIGAQVA----KPDAL 533

Query: 438 VILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNDGYTI----ERLIHGEKAGYNDIQNW 493
           VI   GD S  +++QE+S+ ++      + VLNN+   +    + L +  +  +    N 
Sbjct: 534 VIDIDGDASFNMSLQELSSAVQANAPVKILVLNNEEQGMVTQWQSLFYEHRYSHTHQLNP 593

Query: 494 DHLALLPTFGAKDYENHRVATTGEWDKLTQDKEF 527
           D + L    G K     RV    E +K    KEF
Sbjct: 594 DFVKLAEAMGMKGM---RVKDQAELEKTL--KEF 622

>Kwal_26.7582 s26 (427437..429476) [2040 bp, 679 aa] {ON} YMR108W
           (ILV2) - acetolactate synthase [contig 54] FULL
          Length = 679

 Score = 78.6 bits (192), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 120/507 (23%), Positives = 203/507 (40%), Gaps = 64/507 (12%)

Query: 7   GRYLFERLNQVDVKTIFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADGYARIKG 66
           G+   E + +  V T+FG PG   L++ D IY  +   +    +E  A + A+GYAR  G
Sbjct: 87  GQIFHEMMRRHKVDTVFGYPGGAILAVYDAIYNSKYFNFVLPKHEQGAGHMAEGYARASG 146

Query: 67  M-SCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNGDFTVF 125
               ++ T G G  + +  +A + A+ V ++   G  + SS          +G   F   
Sbjct: 147 KPGVVLVTSGPGATNVVTPMADALADGVPMVVFTGQVATSS----------IGTDAFQEA 196

Query: 126 H--RMSANISETTAMVTDIATAPAEIDRCIRTTYITQR--PVYLGLPANLVD--LKVPAK 179
               +S + ++   MV  +   P  I+       ++ R  PV + LP ++    LK P  
Sbjct: 197 DVIGISRSCTKWNVMVKTVEELPRRINEAFEIA-VSGRPGPVLVDLPKDVTSAILKTPIP 255

Query: 180 LLET-PIDLSLKPNDPEAETEV---VDTVLELIKAAKNPVI-LADACASRHDVKAETKKL 234
           +  T P D   K     A+      +  V +LI  AK P++ +      R D     ++L
Sbjct: 256 VNSTLPFDALSKLTKATAQEFTKANIQKVADLINIAKKPLLYVGGGIFGREDGPKLLRQL 315

Query: 235 IDATQFPSFVTPMGKGSIDEQHPRFGGVYVGTLSRPEVKEAVESADLILSVGALLSD--- 291
            D  Q P   T  G G+ D++ P+   + +G         +V++ADLI+++GA   D   
Sbjct: 316 ADRAQIPVTTTIQGLGAFDQEDPKSLDM-LGMHGSAFANLSVQNADLIIALGARFDDRVT 374

Query: 292 FNTGSFSYSYKTK------NIVEFHSDYIKIRNATFPGVQMKFALQKLLNAVPEAIKGYK 345
            N   F+   +         IV F      I       V+ + A++  +    E +    
Sbjct: 375 LNVSKFAPEARQAALENRGGIVHFEISPKNINKV----VEAQVAVEGDVTDNLELL---- 426

Query: 346 PVPVPARVPENKS-CDPATPLKQEWMWN---QVSKFLQEGDVVITETGTSAFGINQTPFP 401
            +P+  +V E K         K+E+ ++   +    L +   VI      A G  +    
Sbjct: 427 -LPMVNKVEERKEWLGQIDAWKKEYPYDYQRETKGSLIKPQTVIARLSEIASGTGREVIV 485

Query: 402 NNAYGISQVLW----------------GSIGFTTGACLGAAFAAEEIDPKKRVILFIGDG 445
               G  Q +W                G +G T G  L AA  A+   P   VI   GD 
Sbjct: 486 TTGVGQHQ-MWAAQHWTWRHPRSFITSGGLG-TMGYGLPAAIGAQVAKPDALVIDIDGDA 543

Query: 446 SLQLTVQEISTMIRWGLKPYLFVLNND 472
           S  +T+ E+S+ ++ G    + VLNN+
Sbjct: 544 SFNMTLMELSSAVQAGAPVKILVLNNE 570

>NDAI0E02050 Chr5 complement(414418..416490) [2073 bp, 690 aa] {ON}
           Anc_2.441
          Length = 690

 Score = 77.4 bits (189), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 131/570 (22%), Positives = 219/570 (38%), Gaps = 75/570 (13%)

Query: 4   ITLGRYLFERLNQVDVKTIFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADGYAR 63
           +T G+   E + + +V T+FG PG   L + D I++     +    NE  A + A+GYAR
Sbjct: 95  LTGGQIFHEMILRNNVDTVFGYPGGAILPVYDAIHDSSAFNFVLPKNEQGAGHMAEGYAR 154

Query: 64  IKGM-SCIITTFGVGELSALNGIAGSYAEHVGVLHVVG-VPSISSQAKQLLLHHTLGNGD 121
             G    ++ T G    + +  +A + A+ V ++   G VP+ +           LG   
Sbjct: 155 ASGKPGVVLVTSGPAATNVITPMADALADGVPMVVFTGQVPTSAIGTDAFQEADVLG--- 211

Query: 122 FTVFHRMSANISETTAMVTDIATAPAEIDRCIRTTYITQR--PVYLGLPANLVDLKVPAK 179
                 +S + ++   MV  +   P  I+       +++R  PV + LP +     V A 
Sbjct: 212 ------ISRSCTKWNVMVRSVEEMPRRINEAFEIA-MSRRPGPVLVDLPKD-----VTAA 259

Query: 180 LLETPIDLS-----------LKPNDPEAETEVVDTVLELIKAAKNPVILADA-CASRHDV 227
           +L  PI +             K    E   E +    +LI  AK PV+   A   +  + 
Sbjct: 260 ILRNPIPVKTTLPSGALSQLTKLAHDEFILENIKKAADLINIAKKPVLYVGAGILNNMEG 319

Query: 228 KAETKKLIDATQFPSFVTPMGKGSIDEQHPRFGGVYVGTLSRPEVKEAVESADLILSVGA 287
               K L    + P   T  G G+ D++ P      +G         AV+++DLI++VG 
Sbjct: 320 PRILKDLSQRAKIPVTTTIQGLGAFDQEDP-LSLDMLGMHGCATANLAVQNSDLIIAVGT 378

Query: 288 LLSDFNTGSFS-------------------YSYKTKNIVEFHSDYIKIRNATFPGVQMKF 328
              D  TG+ S                   +    KNI +     + +       ++   
Sbjct: 379 RFDDRVTGNISKFAPEARRAALEGNGGIIHFEISPKNINKVVEAQVAVEGDAAANIEKML 438

Query: 329 ALQKLLNAVPE---AIKGYK---PVPVPARVPENKSCDPATPLKQEWMWNQVSKFLQE-G 381
           ++   + A  E    IK +K   P       PE+K       LK + +  ++SK     G
Sbjct: 439 SMIFPVRARSEWLNTIKQWKKEFPYDYMRETPESK-------LKPQTVITKLSKLANSTG 491

Query: 382 DVVITETGTSAFGINQTPFPNNAYGISQVLWGSIGFTTGACLGAAFAAEEIDPKKRVILF 441
             VI  TG     +    +       S +  G +G T G  L AA  A+   P+  VI  
Sbjct: 492 KPVIVTTGVGQHQMWTAQYWTWKNPRSFITSGGLG-TMGYGLPAAIGAQVAKPEALVIDI 550

Query: 442 IGDGSLQLTVQEISTMIRWGLKPYLFVLNNDGYTI----ERLIHGEKAGYNDIQNWDHLA 497
            GD S  +++ E+S+ ++ G    + +LNN    +    + L +  +  +    N D + 
Sbjct: 551 DGDASFNMSLTELSSAVQAGTAVKVLILNNGEQGMVTQWQSLFYEHRYSHTHQLNPDFMK 610

Query: 498 LLPTFGAKDYENHRVATTGEWDKLTQDKEF 527
           L    G K     RV    E D     KEF
Sbjct: 611 LADAMGLKGI---RVKKQNELDSAL--KEF 635

>NCAS0A04320 Chr1 complement(873722..875791) [2070 bp, 689 aa] {ON}
           Anc_2.441 YMR108W
          Length = 689

 Score = 77.0 bits (188), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 131/559 (23%), Positives = 226/559 (40%), Gaps = 92/559 (16%)

Query: 4   ITLGRYLFERLNQVDVKTIFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADGYAR 63
           +T G+   E + + +V TIFG PG   L + D I++ +  ++    NE  A + A+GYAR
Sbjct: 94  LTGGQIFHEMILRNNVDTIFGYPGGAILPVYDAIHDSKSFQFILPKNEQGAGHMAEGYAR 153

Query: 64  IKGM-SCIITTFGVGELSALNGIAGSYAEHVGVLHVVG-VPSISSQAKQLLLHHTLGNGD 121
             G    ++ T G    + +  +A + A+ V ++   G VP+ +           LG   
Sbjct: 154 ASGKPGVVLVTSGPAATNVITPMADALADGVPMVVFTGQVPTSAIGTDAFQEADVLG--- 210

Query: 122 FTVFHRMSANISETTAMVTDIATAPAEIDRCIRTTY---ITQR--PVYLGLPANLVDLKV 176
                 +S + ++   MV  +   P    RCI   +   ++ R  PV + LP +     V
Sbjct: 211 ------ISRSCTKWNVMVRTVDDMP----RCINEAFEIAMSGRPGPVLVDLPKD-----V 255

Query: 177 PAKLLETPIDL-SLKPNDP----------EAETEVVDTVLELIKAAKNPVILADA-CASR 224
            A +L  PI + S  P+            E   E ++    LI  AK PV+   A   + 
Sbjct: 256 TAAILRNPIPVKSTLPSSALSQITKLAHDEFTMENIERAAALINIAKKPVLYVGAGILNN 315

Query: 225 HDVKAETKKLIDATQFPSFVTPMGKGSIDEQHPRFGGVYVGTLSRPEVKEAVESADLILS 284
            D     K+L D  Q P   T  G G+ D++ P+   + +G         AV++ADL+++
Sbjct: 316 VDGPRIIKELSDRAQIPVTTTIQGLGAFDQEDPKSLDM-LGMHGCATANLAVQNADLVIA 374

Query: 285 VGALLSDFNTGSFSYSYKTKNIVEFHSDYIKIRNATFPG----VQMKFALQKLLNAVPE- 339
           +G    D  TG         NI +F  +    R A   G    +  + + + +   V   
Sbjct: 375 LGTRFDDRVTG---------NITKFAPEA---RRAAMEGRGGIIHFEISPKNISKVVETQ 422

Query: 340 -AIKG----------YKPVPVPAR-------------VPENKSCD-PATPLKQEWMWNQV 374
            A++G           K  PV  R              P +   + P + +K + +  ++
Sbjct: 423 VAVEGDATANVEKMLTKIFPVRERNEWFGMINKWKKQYPYDYMRETPTSKIKPQTVITKL 482

Query: 375 SKFLQE-GDVVITETGTSAFGI---NQTPFPNNAYGISQVLWGSIGFTTGACLGAAFAAE 430
           SK   + G  VI  TG     +       + N    IS    G++G+   A +GA  A  
Sbjct: 483 SKLANDSGRPVIVTTGVGQHQMWTAQHWTWKNPRSFISSGGLGTMGYGLPAAIGAQVA-- 540

Query: 431 EIDPKKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNDGYTI----ERLIHGEKAG 486
              P+  VI   GD S  +++ E+S+ ++ G    + +LNN+   +    + L +  +  
Sbjct: 541 --KPEALVIDIDGDASFNMSLTELSSAVQAGTPVKVLILNNEEQGMVTQWQSLFYEHRYS 598

Query: 487 YNDIQNWDHLALLPTFGAK 505
           +    N D + L    G K
Sbjct: 599 HTHQLNPDFIKLADAMGLK 617

>KLLA0B12584g Chr2 complement(1100489..1102564) [2076 bp, 691 aa]
           {ON} highly similar to uniprot|P07342 Saccharomyces
           cerevisiae YMR108W ILV2 Acetolactate synthase catalyses
           the first common step in isoleucine and valine
           biosynthesis and is the target of several classes of
           inhibitors localizes to the mitochondria expression of
           the gene is under general amino acid control
          Length = 691

 Score = 76.6 bits (187), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 126/514 (24%), Positives = 205/514 (39%), Gaps = 72/514 (14%)

Query: 4   ITLGRYLFERLNQVDVKTIFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADGYAR 63
           +T G    E + + +V T+FG PG   L + D IY  +   +    +E  A + A+GYAR
Sbjct: 96  MTGGEIFHEMMQRHNVDTVFGYPGGAILPVYDAIYNSDKFTFVLPKHEQGAGHMAEGYAR 155

Query: 64  IKGM-SCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNGDF 122
             G    ++ T G G  + +  +A + A+  GV  VV    +++ A        +G   F
Sbjct: 156 ASGKPGVVLVTSGPGATNVVTPMADALAD--GVPLVVFTGQVATSA--------IGTDAF 205

Query: 123 TVFH--RMSANISETTAMVTDIATAPAEIDRCIR-TTYITQRPVYLGLPANLVDLKVPAK 179
                  +S + ++   MV  I   P  I+      T     PV + LP +     V A 
Sbjct: 206 QEADVVGISRSCTKWNVMVKTIEELPRRINEAFEIATSGRPGPVLVDLPKD-----VTAA 260

Query: 180 LLETPIDL-SLKPNDP----------EAETEVVDTVLELIKAAKNPVILADACASRHDVK 228
           +L  PI + S+ P+D           E   E +    +LI  AK P++   A     ++ 
Sbjct: 261 VLRNPIPMKSILPSDTLNQLTQRVVDEFTLENISRAADLINRAKKPLLYVGAGILGSEMG 320

Query: 229 AE-TKKLIDATQFPSFVTPMGKGSID-EQHPRFGGVYVGTLSRPEVKEAVESADLILSVG 286
            +  K+L D  Q P   T  G G+ + E H       VG         A+++ADLI+++G
Sbjct: 321 PQYLKQLSDRAQIPVTTTLQGLGAFNQEDHKSLD--MVGMHGNAAANLAIQNADLIIALG 378

Query: 287 ALLSDFNTGSFSYSYKTKNIVEFHSDYIKIRNATFPGVQMKFALQKLLNAVPE---AIKG 343
           A   D           T NI +F  +  K       G+       K +N V E   A++G
Sbjct: 379 ARFDD---------RVTLNISKFAPEARKAALEKRGGIVHFEISPKNINKVVEAEVAVEG 429

Query: 344 ------YKPVPVPARVPEN------------------KSCDPATPLKQEWMWNQVSKF-L 378
                  K +P+   VPE                   +   P + +K + + +++S   L
Sbjct: 430 DVTRNLEKLLPLVESVPERPEWSAQVAKWKQEYPYAYQKETPGSKIKPQTVISKLSDLVL 489

Query: 379 QEGDVVITETGTSAFGINQTPFPNNAYGISQVLWGSIGFTTGACLGAAFAAEEIDPKKRV 438
           + G   I  TG     +            S +  G +G T G  L AA  A+   P   V
Sbjct: 490 KSGRPAIVTTGVGQHQMWAAQHWTWKSPRSFITSGGLG-TMGYGLPAAIGAQVARPDAIV 548

Query: 439 ILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNND 472
           I   GD S  +T+ E+S+ ++      + +LNN+
Sbjct: 549 IDIDGDASFNMTLMELSSAVQARTPVKVLLLNNE 582

>SAKL0E03740g Chr5 (302160..304199) [2040 bp, 679 aa] {ON} highly
           similar to uniprot|P07342 Saccharomyces cerevisiae
           YMR108W ILV2 Acetolactate synthase catalyses the first
           common step in isoleucine and valine biosynthesis and is
           the target of several classes of inhibitors localizes to
           the mitochondria expression of the gene is under general
           amino acid control
          Length = 679

 Score = 76.3 bits (186), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 128/519 (24%), Positives = 202/519 (38%), Gaps = 82/519 (15%)

Query: 4   ITLGRYLFERLNQVDVKTIFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADGYAR 63
           +T G+   E + +  V T+FG PG   L + D IY      +    +E  A + A+GYAR
Sbjct: 84  LTGGQIFHEMMQRHKVDTVFGYPGGAILPVYDAIYNSNAFNFVLPKHEQGAGHMAEGYAR 143

Query: 64  IKGM-SCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNGDF 122
             G    ++ T G G  + +  +A + A+  GV  VV    +S+ A        +G   F
Sbjct: 144 ASGKPGVVLVTSGPGATNVVTPMADALAD--GVPMVVFTGQVSTTA--------IGTDAF 193

Query: 123 TVFH--RMSANISETTAMVTDIATAPAEIDRCIR-TTYITQRPVYLGLPANLVDLKVPAK 179
                  +S + ++   MV  I   P  I+      T     PV + LP +     V A 
Sbjct: 194 QEADVVGISRSCTKWNVMVKSIEELPRRINEAFEIATSGRPGPVLVDLPKD-----VTAA 248

Query: 180 LLETPIDL-SLKPNDP----------EAETEVVDTVLELIKAAKNPVILADACASRHDVK 228
           +L  PI   S  P+D           E     +    +LI  AK P++        H+  
Sbjct: 249 VLRNPIPTKSTLPSDALLQITKRAVDEFTMNSIAKASDLINVAKKPLLYVGGGILGHENG 308

Query: 229 AE-TKKLIDATQFPSFVTPMGKGSIDEQHPRFGGVYVGTLSRPEVKEAVESADLILSVGA 287
            +  K+L +  Q P   T  G G+ D++ P+   + +G         AV++ADLI+++GA
Sbjct: 309 PKFLKELSERAQIPVTTTLQGLGAFDQEDPKSLDM-LGMHGSAAANTAVQNADLIIALGA 367

Query: 288 LLSDFNTGSFSYSYKTKNIVEFHSDYIKIRNATFPGVQMKFALQKLLNAVPEAIKGYKPV 347
              D           T NI +F  +  K       G+       K +N V EA      V
Sbjct: 368 RFDD---------RVTCNISKFAPEARKAALEHRGGIVHFEISPKNINKVVEA-----QV 413

Query: 348 PVPARVPEN--KSCDPATPLKQEWMW-NQVSKFLQ----------EG-----DVVITETG 389
            V   V  N  K     TP+K+   W +Q++++ +          EG       VI E  
Sbjct: 414 AVEGDVTRNLEKLIPLVTPVKERKEWFDQINEWREKYPYEYQKETEGSKIKPQTVIAELS 473

Query: 390 TSAFGINQTPFPNNAYGISQVLW----------------GSIGFTTGACLGAAFAAEEID 433
             A    +        G  Q +W                G +G T G  L AA  A+   
Sbjct: 474 KMANATGKNVIVTTGVGQHQ-MWAAQHWTWKNPRTFITSGGLG-TMGFGLPAAIGAQVAK 531

Query: 434 PKKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNND 472
           P   V+   GD S  +T+ E+S+ ++      + +LNN+
Sbjct: 532 PDAIVVDIDGDASFNMTLMELSSAVQARAPVKILLLNNE 570

>TPHA0G02440 Chr7 complement(498107..500182) [2076 bp, 691 aa] {ON}
           Anc_2.441 YMR108W
          Length = 691

 Score = 75.9 bits (185), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 122/537 (22%), Positives = 203/537 (37%), Gaps = 116/537 (21%)

Query: 4   ITLGRYLFERLNQVDVKTIFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADGYAR 63
           +T G    E + + +V T+FG PG   L + D IY  +   +    +E  A + A+GYAR
Sbjct: 94  LTGGEIFHEMMKRHNVDTVFGYPGGAILPVYDAIYNSKDFNFVLPRHEQGAGHMAEGYAR 153

Query: 64  IKG-MSCIITTFGVGELSALNGIAGSYAEHVGVLHVVG-VPSISSQAKQLLLHHTLGNGD 121
             G    ++ T G G  + +  IA + A+ V ++   G VP+ +           +G   
Sbjct: 154 ASGKCGVVLVTSGPGATNVITPIADALADGVPMVVFTGQVPTAAIGTDAFQEADVIG--- 210

Query: 122 FTVFHRMSANISETTAMVTDIATAPAEIDRCIR-TTYITQRPVYLGLPANLVDLKVPAKL 180
                 +S + ++   MV  I   P  I+      T     PV + LP +     V A +
Sbjct: 211 ------ISRSCTKWNVMVKRIEDLPKCINEAFEIATSGRPGPVLVDLPKD-----VQASI 259

Query: 181 LETPIDL-------SLKPNDPEAETEVVDTVL----ELIKAAKNPVI-LADACASRHDVK 228
           L+TPI +       +L+      +T+  +  +    ELI  AK P++ +     +  +  
Sbjct: 260 LKTPIPIKTTIPSNALRHLTRNVQTQFSEVAIKRAAELINIAKKPILYVGGGILNNPEGP 319

Query: 229 AETKKLIDATQFPSFVTPMGKGSIDEQHPRFGGVYVGTLSRPEVKEAVESADLILSVGAL 288
              K+L D  Q P   T    G+ D++ P+   + +G         A+++ADLI++VGA 
Sbjct: 320 RLIKELSDRAQIPVTTTLQALGAFDQEDPKSLDM-LGMHGHAPANLAMQNADLIIAVGAR 378

Query: 289 LSD---FNTGSFSYSYKTK------NIVEFHSDYIKIRNATFPGVQMK----FALQKLLN 335
             D    N   F+   +         I+ F      I       V ++      L KLL 
Sbjct: 379 FDDRVTLNISKFAPEARRAALENRGGIIHFDISAKNINKVVETQVPIEGDAGANLTKLLP 438

Query: 336 AV-----------PEAIKGY-----------------KPVPVPARVPE--NKSCDPATPL 365
           ++            E IK +                 KP  V A++ E  NKS  P    
Sbjct: 439 SIFSVSEAERKEWMETIKTWKEKHPYTYQKESPGSKIKPQTVIAKLSEIANKSGKPIVVT 498

Query: 366 ----------KQEWMWNQVSKFLQEGDVVITETGTSAFGINQTPFPNNAYGISQVLWGSI 415
                      Q W W +   F+  G +                             G++
Sbjct: 499 AGVGQHQMWAAQHWTWKKPRTFISSGGL-----------------------------GTM 529

Query: 416 GFTTGACLGAAFAAEEIDPKKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNND 472
           G+   A +GA  A     P   VI   GD S  +T+ E+S+ ++ G    + +LNN+
Sbjct: 530 GYGLPAAIGAQVA----RPDAIVIDIDGDASFNMTLTELSSAVQAGTPIKILLLNNE 582

>KNAG0A06250 Chr1 complement(948840..950882) [2043 bp, 680 aa] {ON}
           Anc_2.441 YMR108W
          Length = 680

 Score = 75.1 bits (183), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 118/522 (22%), Positives = 207/522 (39%), Gaps = 87/522 (16%)

Query: 4   ITLGRYLFERLNQVDVKTIFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADGYAR 63
           +T G+   E + + +V T+FG PG   L + D I+E    ++    +E  A + A+GYAR
Sbjct: 84  MTGGQIFHEMMIRNNVDTVFGYPGGAILPVYDAIHESSAFKFVLPKHEQGAGHMAEGYAR 143

Query: 64  IKGM-SCIITTFGVGELSALNGIAGSYAEHVGVLHVVG-VPSISSQAKQLLLHHTLGNGD 121
             G    ++ T G G  + +  +A + A+ + ++   G VP+ +           LG   
Sbjct: 144 ASGKPGVVLVTSGPGATNVVTPMADALADGIPMVVFTGQVPTSAIGTDAFQEADVLG--- 200

Query: 122 FTVFHRMSANISETTAMVTDIATAPAEIDRCIRTTYITQ-RPVYLGLPANLVDLKVPAKL 180
                 +S + ++   MV ++A  P  I+         +  PV + LP +     V A +
Sbjct: 201 ------ISRSCTKWNIMVKNVAEMPKRINEAFDIAMSGRPGPVLVDLPKD-----VTAAI 249

Query: 181 LETPIDL----------SLKPNDPEAET-EVVDTVLELIKAAKNPVI-LADACASRHDVK 228
           L  PI +          +L  +  +A T E ++   +LI  AK PV+ +     +  +  
Sbjct: 250 LRNPIPVESTLPTSTLKNLVGDMHDAFTKERIEKAAKLINIAKKPVLYVGGGILNNPEGP 309

Query: 229 AETKKLIDATQFPSFVTPMGKGSIDEQHPR------FGGVYVGTLSRPEVKEAVESADLI 282
              K L D  Q P   T  G G+ D++ P+        G  V  LS       +++ADLI
Sbjct: 310 KLLKTLSDRAQIPVTTTIQGLGAFDQEDPKSLDMLGMHGSAVANLS-------IQNADLI 362

Query: 283 LSVGALLSDFNTGSFSYSYKTKNIVEFHSDYIKIRNATFPGVQMKFALQKLLNAVPE--- 339
           +++G    D  TG         N+V+F  +  K       G+       K +N + +   
Sbjct: 363 IAIGTRFDDRVTG---------NLVKFAPEAKKAALENRGGIIHFDISAKNINKIVKVDV 413

Query: 340 AIKGYKPVPVPARVPENKSCDPATPLKQEWM-----WNQVSKFLQEGDVVITETGTSAFG 394
           A++G       A + E     PA   ++EW+     W     +    D   ++   +   
Sbjct: 414 AVEG----DAGANLKELLPLIPAVREREEWLTKIDEWKLKHSYDYMKDTPDSKIKPTNCD 469

Query: 395 INQTPFPNNAYGISQVLWGSIG-----------------FTTGACLG-------AAFAAE 430
           I       NA G   ++   +G                 F T   LG       +A  A+
Sbjct: 470 IQSYTKLANASGREVIVTTGVGQHQMWAAQYWTWKHPRTFITSGGLGTMGYGLPSAIGAQ 529

Query: 431 EIDPKKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNND 472
              P   VI   GD S  +++ E+S+ ++ G    + +LNN+
Sbjct: 530 VAKPDALVIDIDGDASFNMSLTELSSAVQAGTPVKILLLNNE 571

>TDEL0A02160 Chr1 complement(389068..391116) [2049 bp, 682 aa] {ON}
           Anc_2.441 YMR108W
          Length = 682

 Score = 75.1 bits (183), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 126/549 (22%), Positives = 220/549 (40%), Gaps = 72/549 (13%)

Query: 4   ITLGRYLFERLNQVDVKTIFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADGYAR 63
           +T G+   E + + +V T+FG PG   L + D I++ +   +    +E  A + A+GYAR
Sbjct: 87  LTGGQIFHEMMIRHNVDTVFGYPGGAILPVYDAIHDSKSFNFVLPRHEQGAGHMAEGYAR 146

Query: 64  IKGM-SCIITTFGVGELSALNGIAGSYAEHVGVLHVVG-VPSISSQAKQLLLHHTLGNGD 121
             G    ++ T G G  + +  +A + A+ V ++   G VP+ +           +G   
Sbjct: 147 ASGKPGVVLVTSGPGATNVVTPMADALADGVPMVVFTGQVPTSAIGTDAFQEADVVG--- 203

Query: 122 FTVFHRMSANISETTAMVTDIATAPAEIDRCIRTTYITQR--PVYLGLPANLVDLKVPAK 179
                 +S + ++   MV  I   P  I+       ++ R  PV + LP +     V A 
Sbjct: 204 ------ISRSCTKWNVMVRSIEELPLRINEAFEIA-VSGRPGPVLVDLPKD-----VTAA 251

Query: 180 LLETPI------------DLSLKPNDPEAETEVVDTVLELIKAAKNPVILADACASRHDV 227
           +L+ PI             L+ +  D      +V T  +L+  AK PV+   A    +  
Sbjct: 252 ILKNPIPTKTTLPSNSLAQLTKRAMDESTNENIVRTA-DLLNKAKTPVLYVGAGILNNPA 310

Query: 228 KAE-TKKLIDATQFPSFVTPMGKGSIDEQHPRFGGVYVGTLSRPEVKEAVESADLILSVG 286
             +  K+L +  Q P   T    G+ D+Q P+   + +G         A+++ADLIL+VG
Sbjct: 311 GPKLLKELSERAQIPVTTTIQALGAFDQQDPKSLDM-LGMHGCATANMAIQNADLILAVG 369

Query: 287 ALLSD---FNTGSFSYSYKTK------NIVEFHSDYIKIRNATFPGVQMKFALQKLLNAV 337
           +   D    N   F+   +         IV F      I       V+ + A++      
Sbjct: 370 SRFDDRVTLNISKFAPEARRAALENRGGIVHFEICPKNISKV----VETQVAVE---GDA 422

Query: 338 PEAIKGYKPVPVP--------ARVPENKSC--------DPATPLKQEWMWNQVSKFLQEG 381
              I+   P+ VP        A++ E K           P + +K + + +++S    + 
Sbjct: 423 ASNIEKLLPLVVPVKERTEWFAQIEEWKEKYPYAYQKETPGSKIKPQTVISKLSDLANKS 482

Query: 382 DV-VITETGTSAFGINQTPFPNNAYGISQVLWGSIGFTTGACLGAAFAAEEIDPKKRVIL 440
           D  VI  TG     +    +       S +  G +G T G  L AA  A+   P   VI 
Sbjct: 483 DKEVIVTTGVGQHQMWAAQYWTWKSPRSFITSGGLG-TMGYGLPAAIGAQVAKPDALVID 541

Query: 441 FIGDGSLQLTVQEISTMIRWGLKPYLFVLNNDGYTI----ERLIHGEKAGYNDIQNWDHL 496
             GD S  +T+ E+S+ ++      + +LNN+   +    + L +  +  +    N D L
Sbjct: 542 IDGDASFNMTLMELSSAVQAKTPVKILLLNNEEQGMVTQWQSLFYEHRYSHTHQLNPDFL 601

Query: 497 ALLPTFGAK 505
            L    G K
Sbjct: 602 KLADAMGLK 610

>Kpol_297.12 s297 complement(20788..22803) [2016 bp, 671 aa] {ON}
           complement(20788..22803) [2016 nt, 672 aa]
          Length = 671

 Score = 73.9 bits (180), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 119/549 (21%), Positives = 216/549 (39%), Gaps = 72/549 (13%)

Query: 4   ITLGRYLFERLNQVDVKTIFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADGYAR 63
           +T G    E + + +V T+FG PG   L + D IY  +  ++    +E  A + A+GY+R
Sbjct: 76  LTGGEIFHEMMIRNNVDTVFGYPGGAILPVYDAIYNSDKFKFVLPRHEQGAGHMAEGYSR 135

Query: 64  IKGM-SCIITTFGVGELSALNGIAGSYAEHVGVLHVVG-VPSISSQAKQLLLHHTLGNGD 121
             G    ++ T G G  + +  +A + A+ + ++   G VP+ +           +G   
Sbjct: 136 ASGKPGVVLVTSGPGATNVVTPMADALADGIPMVVFTGQVPTSAIGTDAFQEADVIG--- 192

Query: 122 FTVFHRMSANISETTAMVTDIATAPAEIDRCIR-TTYITQRPVYLGLPANLVDLKVPAKL 180
                 +S + ++   MV  +   P  I+      T     PV + LP +     V A +
Sbjct: 193 ------ISRSCTKWNVMVKSVEELPRRINEAFEIATSGRPGPVLVDLPKD-----VTAAI 241

Query: 181 LETPIDLS-----------LKPNDPEAETEVVDTVLELIKAAKNPVILADACASRHDVKA 229
           L  PI ++           +K    E   E +     LI  AK PV+        H+   
Sbjct: 242 LRNPIPVNSTLPSNALNQLVKNAHNEFTEESLSKAASLINIAKRPVLYVGGGILNHEEGP 301

Query: 230 E-TKKLIDATQFPSFVTPMGKGSIDEQHPRFGGVYVGTLSRPEVKEAVESADLILSVGAL 288
              ++L +  Q P   + +G G+ D++ P+   + +G         A+++ADLI++VGA 
Sbjct: 302 RLLRELSERAQIPVTTSLLGLGAFDQEDPKSLDM-LGMHGHAPANLAIQNADLIIAVGAR 360

Query: 289 LSDFNTGSFSYSYKTKNIVEFHSDYIKIRNATFPGVQMKFALQKLLNAVPE---AIKG-- 343
             D  TG         NI +F  +  +       G+       K +N V +   A++G  
Sbjct: 361 FDDRVTG---------NIAKFAPEARRAALENRGGIIHFEITAKNINKVVDTQVAVEGDA 411

Query: 344 ----YKPVPVPARVPENKSC------------------DPATPLKQEWMWNQVSKFLQEG 381
                K +P    V E K                    +P + +K + +  ++SK   E 
Sbjct: 412 AANLEKLLPNIFAVKERKDWFDLIEDWKQKYPYSYMKEEPGSRIKPQTIIAKLSKLANES 471

Query: 382 DV-VITETGTSAFGINQTPFPNNAYGISQVLWGSIGFTTGACLGAAFAAEEIDPKKRVIL 440
           +   I  TG     +         +  + +  G +G T G  L +A  A+   P   VI 
Sbjct: 472 NRETIVTTGVGQHQMWAAQHWTWKHPRTFITSGGLG-TMGFGLPSAIGAQVAKPDSMVID 530

Query: 441 FIGDGSLQLTVQEISTMIRWGLKPYLFVLNNDGYTI----ERLIHGEKAGYNDIQNWDHL 496
             GD S  +T+ E+++ ++      + +LNN+   +    + L +  +  +    N D +
Sbjct: 531 IDGDASFNMTLMEMTSAVQASAPVKVLLLNNEEQGMVTQWQSLFYKHRYSHTHQLNPDFV 590

Query: 497 ALLPTFGAK 505
            L    G K
Sbjct: 591 KLAEAMGFK 599

>ZYRO0G19954g Chr7 (1653353..1655455) [2103 bp, 700 aa] {ON} highly
           similar to uniprot|P07342 Saccharomyces cerevisiae
           YMR108W ILV2 Acetolactate synthase catalyses the first
           common step in isoleucine and valine biosynthesis and is
           the target of several classes of inhibitors localizes to
           the mitochondria expression of the gene is under general
           amino acid control
          Length = 700

 Score = 73.9 bits (180), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 117/512 (22%), Positives = 201/512 (39%), Gaps = 68/512 (13%)

Query: 4   ITLGRYLFERLNQVDVKTIFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADGYAR 63
           +T G+   E + + DV T+FG PG   L + D I+E +   +    +E  A + A+GYAR
Sbjct: 104 LTGGQIFHEMMRRHDVDTVFGYPGGAILPVYDAIHESDAFNFILPRHEQGAGHMAEGYAR 163

Query: 64  IKGM-SCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNGDF 122
             G    ++ T G G  + +  +  + A+ V ++   G  + S+          +G   F
Sbjct: 164 ATGRPGVVLVTSGPGATNVVTPMTDALADGVPLIVFTGQVATSA----------IGTDAF 213

Query: 123 TVFH--RMSANISETTAMVTDIATAPAEIDRCIRTTYITQ-RPVYLGLPANLVDLKVPAK 179
                  +S + ++   MV ++   P  I+         +  PV + LP +     V A 
Sbjct: 214 QEADVVGISRSCTKWNVMVKNVEELPKRINEAFEIAMSGRPGPVLVDLPKD-----VTAA 268

Query: 180 LLETPIDL-SLKPNDPEAE----------TEVVDTVLELIKAAKNPVILADA-CASRHDV 227
           +L  PI   S  P+D  A+          +  V    +L+  AK P++   A   +  D 
Sbjct: 269 VLRNPIPTKSTLPSDSLAQLTKRAQDEFTSNNVKRAADLVNVAKKPILYVGAGIFNNPDG 328

Query: 228 KAETKKLIDATQFPSFVTPMGKGSIDEQHPRFGGVYVGTLSRPEVKEAVESADLILSVGA 287
               K+L +  Q P   T  G G+ D++  +   + +G         A+++ADLIL+VGA
Sbjct: 329 PRLLKELSERAQIPVTTTLQGLGAFDQEDTKSLDM-LGMHGCATANLAIQNADLILAVGA 387

Query: 288 LLSDFNTGSFS-------------------YSYKTKNIVEFHSDYIKIRNATFPGVQMKF 328
              D  T + S                   +    KNI +     + +       +Q   
Sbjct: 388 RFDDRVTCNISKFAPEARRAALEGRGGIVHFEMTPKNISKVVETQVAVHGDAATNIQKLI 447

Query: 329 AL-------QKLLNAVPEAIKGYKPVPVPARVPENKSCDPATPLKQEWMWNQVSKFLQE- 380
            L       Q+  N + +  K Y P+      P +K       +K + + +++S      
Sbjct: 448 PLVFGVKERQEWFNQISQWKKEY-PLDYMHETPGSK-------IKPQTVISKLSDIANAT 499

Query: 381 GDVVITETGTSAFGINQTPFPNNAYGISQVLWGSIGFTTGACLGAAFAAEEIDPKKRVIL 440
           G  VI  TG     +            S +  G +G T G  L AA  A+   P   V  
Sbjct: 500 GKEVIVTTGVGQHQMWAAQHWTWKTPRSFITSGGLG-TMGYGLPAAIGAQIAKPNALVFD 558

Query: 441 FIGDGSLQLTVQEISTMIRWGLKPYLFVLNND 472
             GD S  +T+ E+S+ ++      + VLNN+
Sbjct: 559 IDGDASFNMTLTELSSAVQAKTPIKILVLNNE 590

>KLTH0D04532g Chr4 (417085..419121) [2037 bp, 678 aa] {ON} highly
           similar to uniprot|P07342 Saccharomyces cerevisiae
           YMR108W ILV2 Acetolactate synthase catalyses the first
           common step in isoleucine and valine biosynthesis and is
           the target of several classes of inhibitors localizes to
           the mitochondria expression of the gene is under general
           amino acid control
          Length = 678

 Score = 72.4 bits (176), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 138/617 (22%), Positives = 242/617 (39%), Gaps = 96/617 (15%)

Query: 7   GRYLFERLNQVDVKTIFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADGYARIKG 66
           G+   E + +  V T+FG PG   L++ D IY  E   +    +E  A + A+GYAR+ G
Sbjct: 86  GQIFHEMMRRHKVNTVFGYPGGAILAVYDAIYNSEHFNFVLPKHEQGAGHMAEGYARVSG 145

Query: 67  M-SCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNGDFTVF 125
               ++ T G G  + +  +A + A+ V ++   G  + SS          +G   F   
Sbjct: 146 KPGVVLVTSGPGATNVVTPMADALADGVPMVVFTGQVATSS----------IGTDAFQEA 195

Query: 126 H--RMSANISETTAMVTDIATAPAEIDRCIRTTYITQR--PVYLGLPANLVD--LKVPAK 179
               +S + ++   MV ++   P  I+       ++ R  PV + LP ++    L+ P  
Sbjct: 196 DVIGISRSCTKWNVMVKNVEELPRRINEAFEIA-VSGRPGPVLVDLPKDVTSAILRTPIP 254

Query: 180 LLETPIDLSLKPNDPEAETEV----VDTVLELIKAAKNPVI-LADACASRHDVKAETKKL 234
           +  T    +L      A  E     +    +LI  AK P+I +      +       ++L
Sbjct: 255 VKSTLPSNALSKITKSAAKEFTLANLQRAADLINIAKKPLIYVGGGIFGKEQGPKLLREL 314

Query: 235 IDATQFPSFVTPMGKGSIDEQHPRFGGVYVGTLSRPEVKEAVESADLILSVGALLSDFNT 294
            +  Q P   T  G G+ D++ P+   + +G         +V++ADLI+++GA   D   
Sbjct: 315 AERAQIPVSTTIQGLGAFDQEDPKSLDM-LGMHGSAFANLSVQNADLIIALGARFDD--- 370

Query: 295 GSFSYSYKTKNIVEFHSDYIKIRNATFPGVQMKFALQ-KLLNAVPEAIKGYKPVPVPARV 353
                   T N+ +F  +  K       G+ + F +  K +N V EA      V V   V
Sbjct: 371 ------RVTCNVAKFAPEARKAALENRGGI-IHFEISPKNINKVVEA-----QVAVEGDV 418

Query: 354 PENKSCDPATPL------KQEWMWNQVSKFLQE--------------------------- 380
            +N   +   PL      ++EW + Q+  + +E                           
Sbjct: 419 TDN--LERLIPLVNNVKERKEW-FAQIDAWKKEYPYDYQRETKDSKIKPQTLVARLSEVA 475

Query: 381 ---GDVVITETGTSAFGINQTPFPNNAYGISQVLWGSIGFTTGACLGAAFAAEEIDPKKR 437
              G  VI  TG     +         +  + +  G +G T G  L +A  A+   P   
Sbjct: 476 SSTGRDVIVTTGVGQHQMWAAQHWTWRHPRTFITSGGLG-TMGYGLPSAIGAQIARPDAL 534

Query: 438 VILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNDGYTI----ERLIHGEKAGYNDIQNW 493
           VI   GD S  +T+ E+S+ ++ G    + VLNN+   +    + L +  +  +    N 
Sbjct: 535 VIDIDGDASFNMTLMELSSAVQAGAPVKIVVLNNEEQGMVTQWQSLFYEHRYSHTHQLNP 594

Query: 494 DHLALLPTFGAKDYENHRVATTGEWDKLTQDKEFNKNSKIRMIEVM-------LPVMDAP 546
           D + L    G K     R++   + D +   KEF       ++EV+       LP++ A 
Sbjct: 595 DFVKLAEAMGLKGM---RLSKQEDMDSVL--KEFVNTEGPVLLEVIVEKKVPVLPMVPAG 649

Query: 547 TSLIEQAKLTASINAKQ 563
             L E     A +  +Q
Sbjct: 650 KGLHEFINFDAEVEKEQ 666

>Ecym_6107 Chr6 complement(201133..203202) [2070 bp, 689 aa] {ON}
           similar to Ashbya gossypii AEL305C
          Length = 689

 Score = 72.0 bits (175), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 125/518 (24%), Positives = 205/518 (39%), Gaps = 82/518 (15%)

Query: 4   ITLGRYLFERLNQVDVKTIFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADGYAR 63
           +T G    E + +  V TIFG PG   L + D IY  +  ++    +E  A + A+GYA+
Sbjct: 94  LTGGEIFHEMMRRHKVDTIFGFPGGAILPVFDAIYSSDVFKFVLPKHEQGAGHMAEGYAK 153

Query: 64  IKGM-SCIITTFGVGELSALNGIAGSYAEHVGVLHVVG-VPSISSQAKQLLLHHTLGNGD 121
             G    ++ T G G  + +  +A + A+ V ++   G VP  +           +G   
Sbjct: 154 ASGKPGVVLVTSGPGATNVVTPMADALADGVPMVVFTGQVPRSAIGTDAFQEADVVG--- 210

Query: 122 FTVFHRMSANISETTAMVTDIATAPAEIDRCIR-TTYITQRPVYLGLPANLVDLKVPAKL 180
                 +S + ++   MV  +   P  I+      T     PV + LP +     V A +
Sbjct: 211 ------ISRSCTKWNVMVNSVEELPRRINEAFEIATSGRPGPVLVDLPKD-----VTASV 259

Query: 181 LETPIDL--SLKPNDPEAETE-VVD--------TVLELIKAAKNPVILADACASRHDVKA 229
           L++PI +  +L  N  E  T  VVD           +LI  AK P++   A    +++  
Sbjct: 260 LKSPIPMTSTLPSNTLEELTRHVVDQHTVKTIANAAKLINMAKKPLLYVGAGILNNELGP 319

Query: 230 ET-KKLIDATQFPSFVTPMGKGSIDEQHPRFGGVYVGTLSRPEVKEAVESADLILSVGAL 288
           +  K+L +  Q P   T  G G+ D+  P+   + +G         A+++AD+I+++GA 
Sbjct: 320 KVLKELAERAQIPVTTTLHGLGAFDQDDPKSLDM-LGMHGSAAANIAIQNADVIVALGAR 378

Query: 289 LSDFNTGSFSYSYKTKNIVEFHSDYIKIRNATFPGVQMKFALQKLLNAVPEAIKGYKPVP 348
             D  TG         N+ +F  +  K       G+       K +N V +A      V 
Sbjct: 379 FDDRVTG---------NVAKFAPEARKAAAEGRGGIVHLEISPKNINKVIDA-----QVA 424

Query: 349 VPARVPENKS-----CDPATPLKQEWMWNQVSKFLQE----------------------- 380
           V   V  N +      DP    + EW+  Q+ K+ ++                       
Sbjct: 425 VEGDVTANLAKILPLIDPVE-TRPEWL-GQIYKWKEQYPYAYQKETPDSGIKPQTVIARL 482

Query: 381 -------GDVVITETGTSAFGINQTPFPNNAYGISQVLWGSIGFTTGACLGAAFAAEEID 433
                  G  VI  TG     +            S +  G +G T G  L AA  A+   
Sbjct: 483 SEISNSTGKDVIVTTGVGQHQMWAAQHWQWKKPWSFITSGGLG-TMGFGLPAAIGAQVAR 541

Query: 434 PKKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNN 471
           P   VI   GD SL +T+ E+ST ++ G    + +LNN
Sbjct: 542 PNALVIDIDGDASLNMTITELSTTVQAGTPVKILLLNN 579

>Smik_5.87 Chr5 complement(124637..126319) [1683 bp, 560 aa] {ON}
           YEL020C (REAL)
          Length = 560

 Score = 71.6 bits (174), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 119/514 (23%), Positives = 216/514 (42%), Gaps = 64/514 (12%)

Query: 8   RYLFERLNQVDVKTIFGLPGDFNLSLLDKIYEVEGMRWAGNANE--LNAAYAADGYARIK 65
           +Y  E L +  + T+FG+ G   + L D +   +G+++    NE   + A +A GY   K
Sbjct: 7   QYFAELLQRYGIDTVFGIVGIPIVQLADTMVS-KGIKFIPCRNEQAASYAASAYGYVNDK 65

Query: 66  GMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAK---QLLLHHTLGNGDF 122
               +I   G G + +L GI  S +    +L + G  S     K   Q L   +L     
Sbjct: 66  PGVLLIVG-GPGLIHSLAGIYNSMSNRWPLLVIAGSSSHGDTHKGGFQELDQVSL----L 120

Query: 123 TVFHRMSANIS-ETTAMVTDIATAPAEIDRCIRTTYITQRPVYLGLPANLVDLKVPAK-- 179
           + F + +  ++ +   M+T  A     ++ CI+ T       Y+ +PA+ ++ + P +  
Sbjct: 121 SPFLKFTGKLAPDNIRMITQKA-----LNHCIQGTAGV---AYIDVPADFIEYEKPLEGN 172

Query: 180 -LLETPIDLSLKPN----DPEAETEVVDTVLELIKAAKNPVILADACASRHDVKAETKKL 234
             +   + + L PN    DP    EVV  +L+  +     VI   A  + H+V+    +L
Sbjct: 173 CHIGDELPVILTPNKCGPDPSRIKEVVQLILKNKENNILVVIGKGAVKNSHEVR----RL 228

Query: 235 IDATQFPSFVTPMGKGSIDEQHPRFGGVYVGTLSRPEVKEAVESADLILSVGALLSDFNT 294
           I+    P   TPM KG + +  P    + V +       +A+++AD++L +GA L+    
Sbjct: 229 INKFNIPFLPTPMAKGIVPDSSP----LNVSSAR----SQALKTADIVLVLGARLNWILH 280

Query: 295 GSFSYSYKTKNI-VEFHSDYIKI-RNATFPGVQMK------FALQKLLNAVPEAIKGYKP 346
              S  + +++I ++F S+   +  N   PG  +        ++  L+  V      +K 
Sbjct: 281 FGASPKWNSESIFIQFDSNPETLGDNNISPGADLSVWGDIGLSVTALMEEVVRQDPCWKY 340

Query: 347 VPVPARVPENKSCDPATPLKQE----------WMWNQVSKFLQEGDVVITETGTSAFGIN 396
             +   + E    +    LK+E           ++  +   + +    +   G +   I 
Sbjct: 341 SGISQAIQEKIQFNQTRLLKKERTGGTQLNYHQVYGTLRPLIDDYRTFLVTEGANTMDIA 400

Query: 397 QTPFPNNAYGISQVLWGSIGFTTGACLGAAFAAEEIDPKKRVILFIGDGSLQLTVQEIST 456
           +  FP NA    + L      T G  LG A A +   P+  V+L  GD +   +  EI T
Sbjct: 401 RVSFPTNAP--KRRLDAGTNATMGVGLGYALACKASHPELDVVLIQGDSAFGFSAMEIET 458

Query: 457 MIRWGLKPYLFVLNNDGYTIERLIHGEKAGYNDI 490
            +R  L   + V+NN G     + HGEK   +D+
Sbjct: 459 AVRCQLALVIVVMNNSG-----IYHGEKDTGSDL 487

>AEL305C Chr5 complement(69381..71387) [2007 bp, 668 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YMR108W
           (ILV2)
          Length = 668

 Score = 68.6 bits (166), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 116/513 (22%), Positives = 199/513 (38%), Gaps = 76/513 (14%)

Query: 7   GRYLFERLNQVDVKTIFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADGYARIKG 66
           G    E + + +V T+FG PG   L + D IY  +   +    +E  A + A+GYAR  G
Sbjct: 76  GEIFHEMMRRHNVDTVFGYPGGAILPVYDAIYNSDAFNFVLPKHEQGAGHMAEGYARASG 135

Query: 67  M-SCIITTFGVGELSALNGIAGSYAEHVGVLHVVG-VPSISSQAKQLLLHHTLGNGDFTV 124
               ++ T G G  + +  +A + A+ V ++   G VP  +           +G      
Sbjct: 136 KPGVVLVTSGPGATNVVTPMADALADGVPMVVFTGQVPKAAIGTDAFQEADVVG------ 189

Query: 125 FHRMSANISETTAMVTDIATAPAEIDRCIR-TTYITQRPVYLGLPANLVDLKVPAKLLET 183
              +S + ++   MV  +   P  I+      T     PV + LP +     V A +L +
Sbjct: 190 ---ISRSCTKWNVMVNHVEELPRRINEAFEIATSGRPGPVLVDLPKD-----VTAAILRS 241

Query: 184 PI------------DLSLKPNDPEAETEVVDTVLELIKAAKNPVILADACASRHDVKAE- 230
           PI             L+ +  D +    + D    LI  A+ PV+   A         E 
Sbjct: 242 PIPLASALPSTTLAQLTRQAADIDGVRSLADAS-RLINMAQKPVLYVGAGILNSTRGPEF 300

Query: 231 TKKLIDATQFPSFVTPMGKGSIDEQHPRFGGVYVGTLSRPEVKEAVESADLILSVGALLS 290
            ++L +  Q P   T    G+ D++  +   + +G          V++ADLI+++GA   
Sbjct: 301 LRELAEKAQIPVTTTLQALGAFDQEDSKSVDM-LGMHGSAAANLTVQNADLIIALGARFD 359

Query: 291 DFNTGSFSYSYKTKNIVEFHSDYIKIRNATFPGVQMKFALQKLLNAVPE---AIKG---- 343
           D  TG         NI +F  +  +       G+       K +N V +   A++G    
Sbjct: 360 DRVTG---------NIAKFAPEAQRAAREQRGGIVHFEISPKNINKVVDAQVAVEGDVTA 410

Query: 344 --YKPVPVPARVPENKSC------------------DPATPLKQEWMWNQVSKFLQE-GD 382
              K +P+   V E K                     P + +K + +  ++S+     G 
Sbjct: 411 NLEKLLPLIKPVAERKEWLGQIASWKSEYPYDYSRETPGSRIKPQTVITRLSEIANATGK 470

Query: 383 VVITETGTSA---FGINQTPFPNNAYGISQVLWGSIGFTTGACLGAAFAAEEIDPKKRVI 439
            VI  TG      +      +      I+    G++GF   A +GA  A     P   VI
Sbjct: 471 EVIVTTGVGQHQMWAAQHWTWKKPRTFITSGGLGTMGFGLPAAIGAQVA----KPDAIVI 526

Query: 440 LFIGDGSLQLTVQEISTMIRWGLKPYLFVLNND 472
              GD SL +T+ E+S+ ++ G    + +LNN+
Sbjct: 527 DIDGDASLNMTLMEMSSAVQAGAPVKILLLNNE 559

>YEL020C Chr5 complement(118617..120299) [1683 bp, 560 aa] {ON}
           Protein of unknown function with low sequence identity
           to Pdc1p; mRNA identified as translated by ribosome
           profiling data
          Length = 560

 Score = 67.8 bits (164), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 115/507 (22%), Positives = 210/507 (41%), Gaps = 56/507 (11%)

Query: 5   TLGRYLFERLNQVDVKTIFGLPGDFNLSLLDKIYEVEGMRWAGNANE--LNAAYAADGYA 62
           T  ++  + L +  + T+FG+ G   + L D +    G+++    NE   + A +A GY 
Sbjct: 4   TATQHFAQLLQKYGIDTVFGIVGIPIVQLADTMV-ANGIKFIPCRNEQAASYAASAYGYI 62

Query: 63  RIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAK---QLLLHHTLGN 119
             K    ++   G G + AL GI  S +    +L + G  S S   K   Q L   +L  
Sbjct: 63  SDKP-GVLLIVGGPGLIHALAGIYNSMSNRWPLLVIAGSSSQSDIHKGGFQELDQVSL-- 119

Query: 120 GDFTVFHRMSANIS-ETTAMVTDIATAPAEIDRCIRTTYITQRPVYLGLPANLVDLKVPA 178
              + F + +  ++ +   M+T  A     ++ CI+ T       Y+ +PA+ ++ + P 
Sbjct: 120 --LSPFLKFTGKLTPDNIDMITQKA-----LNYCIQGTAGVS---YIDVPADFIEYEKPL 169

Query: 179 K---LLETPIDLSLKPNDPEAETEVVDTVLELIKAAKNPVILADACASRHDVKAETKKLI 235
           +        + + L PN    +   +  V++LI   KN  IL            E ++L+
Sbjct: 170 EGNDRTGNELPMILTPNICGPDPSKIKKVVQLILQHKNKNILIVIGKGAVKNSHEIRRLV 229

Query: 236 DATQFPSFVTPMGKGSIDEQHPRFGGVYVGTLSRPEVKEAVESADLILSVGALLSDFNTG 295
           +    P   TPM KG + +  P    + V +       +A++ AD++L +GA L+     
Sbjct: 230 NTFNLPFLPTPMAKGIVPDSSP----LNVSSAR----SQALKIADIVLVLGARLNWILHF 281

Query: 296 SFSYSYKTKNI-VEFHSDYIKI-RNATFPGVQMK------FALQKLLNAVPEAIKGYKPV 347
             S  + +++I ++F S+   +  N   PG  +        ++  L+  +      +K  
Sbjct: 282 GTSPKWNSESIFIQFDSNPETLGDNNVSPGADLSIWGDIGLSVTALVEELTRQDSCWKYS 341

Query: 348 PVPARVPENKSCDPATPLKQE------WMWNQV----SKFLQEGDVVITETGTSAFGINQ 397
            V   + E    +    L++E        +NQV       + +   ++   G +   I +
Sbjct: 342 GVKQEIREKIQLNQTRLLRKEKTRGAQLNYNQVYGTLRPLIDDYRTILVTEGANTMDIAR 401

Query: 398 TPFPNNAYGISQVLWGSIGFTTGACLGAAFAAEEIDPKKRVILFIGDGSLQLTVQEISTM 457
             FP +A    + L      T G  LG A A +   P+  V+L  GD +   +  EI T 
Sbjct: 402 ISFPTDAP--RRRLDAGTNATMGIGLGYALACKASHPELDVVLIQGDSAFGFSAMEIETA 459

Query: 458 IRWGLKPYLFVLNNDGYTIERLIHGEK 484
           +R  L   + V+NN G     + HGEK
Sbjct: 460 VRCQLALVIVVMNNSG-----IYHGEK 481

>Skud_5.76 Chr5 complement(117925..119607) [1683 bp, 560 aa] {ON}
           YEL020C (REAL)
          Length = 560

 Score = 67.0 bits (162), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 112/513 (21%), Positives = 209/513 (40%), Gaps = 62/513 (12%)

Query: 8   RYLFERLNQVDVKTIFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADGYARIKGM 67
           ++  + L +  + T+FG+ G   + L D +    G+++    NE  A+YAA GY  +   
Sbjct: 7   QHFAQLLQRYGIDTVFGIVGIPIVQLADTMV-ANGIKFIPCRNEQAASYAASGYGYVNDK 65

Query: 68  -SCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAK---QLLLHHTLGNGDFT 123
              ++   G G + +L GI  S      +L + G  S S   K   Q L   +L      
Sbjct: 66  PGVLLIVGGPGLIHSLAGIYNSMNNRWPLLVIAGSSSQSDIHKGGFQELDQISL----LY 121

Query: 124 VFHRMSANIS-ETTAMVTDIATAPAEIDRCIRTTYITQRPVYLGLPANLVDLKVPAK--- 179
            F + +  ++ +   MVT  A     ++ CI+ T       Y+ +PA+ ++ + P +   
Sbjct: 122 PFLKFTGKLTPDNVDMVTQKA-----LNHCIQGTAGVS---YIDVPADFIESEKPLEGND 173

Query: 180 LLETPIDLSLKPN----DPEAETEVVDTVLELIKAAKNPVILADACASRHDVKAETKKLI 235
            +   + + L P     DP    E+V  +L         VI   A  + H    E ++LI
Sbjct: 174 YIANELPMILTPKKCGPDPSQIKEIVQLILHHRDNNILIVIGKGAVKNSH----EIRRLI 229

Query: 236 DATQFPSFVTPMGKGSIDEQHPRFGGVYVGTLSRPEVKEAVESADLILSVGALLSDFNTG 295
           +    P   TPM KG + +  P    + V +       +A+++AD++L +GA L+     
Sbjct: 230 NKFNLPFLPTPMAKGIVPDSSP----LNVSSAR----SQALKTADVVLVLGARLNWILHF 281

Query: 296 SFSYSYKTKNI-VEFHSDYIKI-RNATFPGVQMK------FALQKLLNAVPEAIKGYKPV 347
             S  +  ++I ++F S+   +  N   PG  +        ++  L+  +      +K  
Sbjct: 282 GTSPKWNAESIFLQFDSNPETLGDNNASPGADLSVWGDVGLSVTALMGELERQSPRWKYS 341

Query: 348 PVPARVPENKSCDPATPLKQE----------WMWNQVSKFLQEGDVVITETGTSAFGINQ 397
            V   + E    +    L++E           ++  +   + +   ++   G +   I +
Sbjct: 342 GVNQAMREKIQLNQTRLLEKEKVGGAQLNYHQVYGTLRPLIDDYRTILVTEGANTMDIAR 401

Query: 398 TPFPNNAYGISQVLWGSIGFTTGACLGAAFAAEEIDPKKRVILFIGDGSLQLTVQEISTM 457
             FP +     + L      T G  LG A A++    +  V+L  GD +   +  EI T 
Sbjct: 402 VSFPTDVP--RRRLDAGTNATMGIGLGYALASKASHLELDVVLIQGDSAFGFSAMEIETA 459

Query: 458 IRWGLKPYLFVLNNDGYTIERLIHGEKAGYNDI 490
           +R  L   + V+NN G     + HGE    +D+
Sbjct: 460 VRCQLALIIVVMNNSG-----IYHGENNTGSDL 487

>AEL055C Chr5 complement(533904..535541) [1638 bp, 545 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YEL020C
          Length = 545

 Score = 66.2 bits (160), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 99/480 (20%), Positives = 200/480 (41%), Gaps = 50/480 (10%)

Query: 14  LNQVDVKTIFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADGYARIKGM-SCIIT 72
           L Q  ++ +FG+ G   + L +K+ E  G+R+    NE + +YAA  Y  +      ++ 
Sbjct: 13  LKQHGIEVVFGIVGIPIVELAEKLAE-HGVRFIACRNEQSCSYAASVYGYLTNKPGALLV 71

Query: 73  TFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNGDFTVFH-RMSAN 131
             G G + AL GI  ++     +L + G      +     L        +T F  R+S  
Sbjct: 72  VGGSGVVHALAGIHNAWVNKWPLLVIAGSTEDEYKGGFQELDQLRIVAPWTSFKGRLS-- 129

Query: 132 ISETTAMVTDIATAPAEIDRCIRTTYITQRPVYLGLPANLVDLKVPAKLLETPIDLSLKP 191
           +     MV             ++T  +     YL +P  L+++     L   P+D+    
Sbjct: 130 LDNVNYMVYT----------AVKTAVLQHGVSYLDVPGRLINMDAVGPLASKPVDIQHVR 179

Query: 192 NDPEAETEVVDTVLELIKAAKNP-VILADACASRHDVKAETKKLIDATQFPSFVTPMGKG 250
           + P++    V    +L++  +N  V++   CA    V    +  ++  + P    PM KG
Sbjct: 180 SGPDSSR--VQGAAKLLQDGRNILVVVGRGCAEYPGV---VRSFLERYRLPFLPVPMAKG 234

Query: 251 SIDEQHPRFGGVYVGTLSRPEVKE-AVESADLILSVGALLS-DFNTGSFSYSYKTKNIVE 308
            + + H          L+    +  A++ A+++L +GA L+   + GS          ++
Sbjct: 235 IVPDSH---------ELNVNGCRSLALKRAEIVLVLGARLNWILHYGSAPKWNADATFIQ 285

Query: 309 FHSDYIKIRNATFPGVQMKFA--LQKLLNAV----PEAIKGYKPV--PVPARVPEN---- 356
              D   + +    GV       ++  +NA+    P++ + Y+ V   V  ++ EN    
Sbjct: 286 VDRDPATLGHNNSSGVNYSVLSDVELFINAITAVLPQSWQ-YRGVDNEVLDKIRENGVKL 344

Query: 357 ---KSCDPATPLKQEWMWNQVSKFLQEGDVVITETGTSAFGINQTPFPNNAYGISQVLWG 413
                  P +PL    +++ + K + + + +++  G +    ++  F  + Y   ++  G
Sbjct: 345 QRKAQLTPGSPLNYHAVYSLLRKLIDDKNTILSAEGANTMDNSRLWFGTD-YPKRRLDAG 403

Query: 414 SIGFTTGACLGAAFAAEEIDPKKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNDG 473
           + G T G  +G A +A+  +P K V+   GD +   +  E+ T +R  +   + V+NN G
Sbjct: 404 T-GATMGLGVGYALSAKLANPDKFVVALEGDSAFGFSCMELETAVRNKVGLVVVVMNNGG 462

>TPHA0G02885 Chr7 complement(616977..619043) [2067 bp, 688 aa] {ON}
          Length = 688

 Score = 65.9 bits (159), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 75/303 (24%), Positives = 127/303 (41%), Gaps = 30/303 (9%)

Query: 4   ITLGRYLFERLNQVDVKTIFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADGYAR 63
           +T G    E + + +V T+FG PG   L + D IY  +   +    +E  A + A+GYAR
Sbjct: 91  LTGGEIFHEMMKRHNVDTVFGYPGGAILPVYDAIYNSKDFNFVLPRHEQGAGHMAEGYAR 150

Query: 64  IKG-MSCIITTFGVGELSALNGIAGSYAEHVGVLHVVG-VPSISSQAKQLLLHHTLGNGD 121
             G    ++ T G G  + +  +A + A+ V ++   G VP+ +           +G   
Sbjct: 151 ASGKCGVVLVTSGPGATNVITPMADALADGVPMVVFTGQVPTAAIGTDAFQEADVIG--- 207

Query: 122 FTVFHRMSANISETTAMVTDIATAPAEIDRCIR-TTYITQRPVYLGLPANLVDLKVPAKL 180
                 +S + ++   MV  +   P  I+      T     PV + LP +     V A +
Sbjct: 208 ------ISRSCTKWNVMVKRVEDLPKCINEAFEIATSGRPGPVLVDLPKD-----VQASI 256

Query: 181 LETPIDL-------SLKPNDPEAETEV----VDTVLELIKAAKNPVI-LADACASRHDVK 228
           L  PI +       +LK     A T+     +    ELI  AK P++ +     +  +  
Sbjct: 257 LRAPIPIKTTIPSNALKQLTRSAYTQFSEAGIKRAAELINIAKKPILYVGGGILNNPEGP 316

Query: 229 AETKKLIDATQFPSFVTPMGKGSIDEQHPRFGGVYVGTLSRPEVKEAVESADLILSVGAL 288
              K+L D  Q P   T    G+ D+  P+   + +G         A+++ADLI++VGA 
Sbjct: 317 RLIKELSDRAQIPVTTTLQALGAFDQDDPKSLDM-LGMHGYAPANLAIQNADLIIAVGAR 375

Query: 289 LSD 291
             D
Sbjct: 376 FDD 378

>Ecym_1360 Chr1 (739963..741597) [1635 bp, 544 aa] {ON} similar to
           Ashbya gossypii AEL055C
          Length = 544

 Score = 65.5 bits (158), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 99/488 (20%), Positives = 200/488 (40%), Gaps = 65/488 (13%)

Query: 14  LNQVDVKTIFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADGYARIKGM-SCIIT 72
           L Q  V+ +FG+ G   + + +   E  G+R+ G  NE + +YAA  Y  + G    ++ 
Sbjct: 11  LKQYGVEVVFGIVGIPIVEVAESFVE-HGIRFIGCRNEQSCSYAASAYGYLTGKPGVLLV 69

Query: 73  TFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNGDFTVFHRMSANI 132
             G G + AL G+  S+     +L + G    SS+ +            F    ++S  +
Sbjct: 70  VGGPGVIHALAGVYNSFVNKWPLLVLAG----SSENEYY--------EGFQELDQLSV-M 116

Query: 133 SETTAMVTDIATAPAE--IDRCIRTTYITQRPVYLGLPANLVDLKVPAKLLETPIDLSLK 190
           S        I T      +   ++T+ +     Y+ +P  L++ K  +   E P  + + 
Sbjct: 117 SRWCKFYGRINTGNLSHLVYTAMKTSMLQNAVTYIDIPGGLIEEKAKSSD-ELPKKMEIA 175

Query: 191 PNDPEAETEVVDTVLELIKAAKNPVILADACASRHDVKAETKKLIDATQFPSFVTPMGKG 250
                 + + V  V  ++++ K  +++    ++ +   AE +  ++  Q P   TPM KG
Sbjct: 176 HIRCGPDIQRVKEVATIMQSGKKILVVVGRGSANY--PAEVRAFLEKYQLPFLPTPMAKG 233

Query: 251 SIDEQHPRFGGVYVGTLSRPEVKE-AVESADLILSVGALLS------------------- 290
            + + H          L+    +  A++SA+++L +GA L+                   
Sbjct: 234 IVPDTH---------ELNVNGARSLALKSAEVVLILGARLNWILHFGLEPKWSDDACFIQ 284

Query: 291 -DFNTGSFSYSYKTKNIVEFHSD---YIKIRNATFPGVQMKFAL-QKLLNAVPEAIKGYK 345
            D +  +   +         HSD   +I+  +   P       + +K+L+ +    K  K
Sbjct: 285 VDRDLSALGTNNPRGVNFSVHSDIGLFIEACDNVLPKTWKNDGVDEKILSKIHSNGKAMK 344

Query: 346 PVPVPARVPENKSCDPATPLKQEWMWNQVSKFLQEGDVVITETGTSAFGINQTPFPNNAY 405
              +   +PE       + L+   ++ ++ +F+ +   ++   G +   I +  FP  +Y
Sbjct: 345 EKEI---IPE------GSALRYHGVYAKLREFIDDKSTIMVLEGANTMDIARVSFPT-SY 394

Query: 406 GISQVLWGSIGFTTGACLGAAFAAEEIDPKKRVILFIGDGSLQLTVQEISTMIRWGLKPY 465
              ++  G+   T G  +G A AA+  +P K V+   GD +   +  E+ T+ R  L   
Sbjct: 395 QKHRLDAGTSA-TMGVGIGYAMAAKVANPSKFVVALEGDSAFGFSAMELETIARNKLGIV 453

Query: 466 LFVLNNDG 473
           + V+NN G
Sbjct: 454 VVVMNNGG 461

>Kpol_1061.50 s1061 (141784..143499) [1716 bp, 571 aa] {ON}
           (141784..143499) [1716 nt, 572 aa]
          Length = 571

 Score = 60.8 bits (146), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 112/502 (22%), Positives = 208/502 (41%), Gaps = 64/502 (12%)

Query: 8   RYLFERLNQVDVKTIFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADGYARIKGM 67
           +++ + L + D+ TIFG+ G   + L D  +    +R+    NE +A+YAA  Y  +   
Sbjct: 9   QHITDILLKYDIDTIFGIVGIPVVELADS-FIANNIRFISFRNEQSASYAASVYGYLNNK 67

Query: 68  SCIITTFG-VGELSALNGIAGSYAEHVGVLHVVGVPSISSQAK---QLLLHHTLGNGDFT 123
             I+ T G  G + +L GI  S      ++ + G    + Q K   Q L H +L      
Sbjct: 68  PGILLTVGGPGLIHSLAGIYNSIENKWPLIVLTGSIESTDQYKHGFQELDHVSL------ 121

Query: 124 VFHRMSANISETTAMVTDIATAPAEIDRC----IRTTYITQRPV-YLGLPANLVDLKVPA 178
             HR   +I+ T  +  +       IDRC    +R + +  + V ++ +P +L    +  
Sbjct: 122 -LHR---HINFTAKLSLE------NIDRCFYEAMRNSCLINKGVSFIEIPGDLFHSTIST 171

Query: 179 KLLET-----PIDLSLKPNDPEAE--TEVVDTVLELIKAAKNPVILADACASRHDVKAET 231
            +++      PI   L    P  E  T+V   +LE I   K   ++     +  D +  T
Sbjct: 172 DVIDKSIVHQPISKKLIEYQPTDELITKVSKFLLENINKNKKNCLVVIGDGAMDDSQKLT 231

Query: 232 KKLIDATQFPSFVTPMGKGSIDEQHPRFGGVYVGTLSRPEVKEAVESADLILSVGALLS- 290
           K  +     P   TPM +G +    P    + V +        A+++A+++L +G  L+ 
Sbjct: 232 K-FLTHFNLPFITTPMARGIV----PDSSKLNVASARSL----ALKNAEIVLLIGTKLNW 282

Query: 291 DFNTGSFSYSYKTKNIVEFHSDYIKIRNATFPGVQ------MKFALQKLLNAVPEAIKGY 344
             + GS S   +    ++  +    +      G++      +   L KL  ++ +  K  
Sbjct: 283 ILHFGSSSKWNENTLFIQIDNSPSNLGLNNSKGLEYSLFGNISVTLDKLSRSLIKFNKNK 342

Query: 345 K-----PVP-VPARVPENK-------SCDPATPLKQEWMWNQVSKFLQEGDVVITETGTS 391
           +     P   +  ++ EN+       S    + L    ++  + K L + + +I   G +
Sbjct: 343 QWRYQGPTENIKIKIKENEINLKKKESNHSTSQLNYNEVYGSLRKILNDRETIIVMEGAN 402

Query: 392 AFGINQTPFPNNAYGISQVLWGSIGFTTGACLGAAFAAEEIDPKKRVILFIGDGSLQLTV 451
              I +  F  + Y   ++  G++  T G  LG A +A+   P K V+L  GD +   + 
Sbjct: 403 TMDIARISFKTD-YPQHRLDCGNLA-TMGVGLGYAISAKLSRPDKTVVLIQGDSAFGFSG 460

Query: 452 QEISTMIRWGLKPYLFVLNNDG 473
            EI T +R  L   + V+NN G
Sbjct: 461 MEIETAVRNKLGLIIIVMNNSG 482

>SAKL0D10934g Chr4 (907649..909301) [1653 bp, 550 aa] {ON} similar
           to uniprot|P39994 Saccharomyces cerevisiae YEL020C
           Hypothetical ORF
          Length = 550

 Score = 60.5 bits (145), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 74/338 (21%), Positives = 138/338 (40%), Gaps = 53/338 (15%)

Query: 164 YLGLPANLV------DLKVPAKLLETPIDLSLKPNDPEAETEVVDTVLELIKAAKNPVIL 217
           Y+ +P NL+      + ++  K++ +P+  S  P        VV  V  LI   ++  IL
Sbjct: 153 YIDIPGNLITEEDCIEERISGKIIISPVRCSPDP-------LVVSEVARLIANNEHKEIL 205

Query: 218 ADACASRHDVKAETKKLIDATQFPSFVTPMGKGSIDEQHPRFGGVYVGTLSRPEVKE-AV 276
                   +   E ++ +D  Q P   TPM KG + + HP         L+    +  A+
Sbjct: 206 VVIGKGAVNCANEIRRFVDQFQLPFLPTPMAKGVVPDSHP---------LNVSSARSLAL 256

Query: 277 ESADLILSVGALLSDFNTGSFSYSYKTKNIVEF-----------HSDYIKIRNATFPGVQ 325
             AD++L +GA L+      F    K K+ V+F           H++   +  +    + 
Sbjct: 257 RKADVVLLLGARLNWIL--HFGEPPKWKDTVKFVQFDYTPEELGHNNVAGLNYSLCGDIG 314

Query: 326 MK----------FALQKLLNAVPEAIKGYKPVPVPARVPENKSCDPATPLKQEWMWNQVS 375
           +           F  + L NA+ E I     + +  +  E ++      L    ++  + 
Sbjct: 315 LSLEELGSKLHAFKYRGLNNAIREKID-TNELKLRGKERETRT----ALLHYNQVYALMR 369

Query: 376 KFLQEGDVVITETGTSAFGINQTPFPNNAYGISQVLWGSIGFTTGACLGAAFAAEEIDPK 435
           +++ + + ++   G +   + +  FP + Y   ++  G+   T G  LG A AA+  D  
Sbjct: 370 QYITDDETILVTEGANTMDVARISFPTD-YPKRKLDAGT-NATMGIGLGYALAAKASDTT 427

Query: 436 KRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNDG 473
           K VI   GD +   +  E+ T +R  L   + V+NN G
Sbjct: 428 KTVICIQGDSAFGFSAMELETAVRCSLPLVVVVMNNSG 465

>KLTH0H14102g Chr8 (1226474..1228129) [1656 bp, 551 aa] {ON} similar
           to uniprot|P39994 Saccharomyces cerevisiae YEL020C
           Hypothetical ORF
          Length = 551

 Score = 60.1 bits (144), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 113/508 (22%), Positives = 203/508 (39%), Gaps = 79/508 (15%)

Query: 9   YLFERLNQVDVKTIFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADGYARIKGM- 67
           YL E L+   +  +FG+ G   + L D +     +++ G  NE  A+YAA  Y  + G  
Sbjct: 7   YLSELLHGYGITAVFGIVGIPIVELADAMISHGKVKFYGFRNEQAASYAASAYGYLTGRP 66

Query: 68  SCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAK-QLLLHHTLGNGDFTVFH 126
             ++   G G + AL G+  S +    ++ + G    S++   Q L    L     + + 
Sbjct: 67  GVLLVVGGPGVIHALAGVYNSISNKWPLIVLAGSSEDSNRGGFQELDQIAL----LSKYV 122

Query: 127 RMSANISETTAMVTDIATAPAEIDRCIRTTYITQRPVYLGLPANLVDLKVP--------- 177
           + S+ +S +     D +   A     + T  ++    YL +PAN++D +V          
Sbjct: 123 KYSSRLSNSN---VDQSFYDALRQAVLGTPGVS----YLDIPANVIDQEVEKNESFSRRH 175

Query: 178 -AKLLETPIDLSLKPNDPEAETEVVDTVLELIKAAKNPVILADACASRHDVKAETKKLID 236
            AK+   P D +L+             V +L+ A ++  IL        +   + +  +D
Sbjct: 176 IAKISYQPTDAALQ------------RVAKLLNANRDKNILCVIGKGATENAQQIRPFVD 223

Query: 237 ATQFPSFVTPMGKGSIDEQHPRFGGVYVGTLSRPEVKE-AVESADLILSVGALLS----- 290
             Q P   TPM KG + + H          L+    +  A++SAD++L +GA L+     
Sbjct: 224 EFQLPFLSTPMAKGVVPDSH---------ALNVSSARSLALKSADIVLVLGARLNWILHF 274

Query: 291 ---------------DFNTGSFSYSYKTKNIVEFHSDYIKIRNATFPGVQMKFALQKLLN 335
                          D       ++     +     D I    A    +   F+ + L  
Sbjct: 275 GEAPKWKNDAIFIQIDTTAEELGHNNGAGTLFSLCGD-IGTTVAKLTPLLAGFSGRGLFG 333

Query: 336 AVPEAIKGYKPVPVPARVPENKSCDPATPLKQEWMWNQVSKFLQEGDVVITETGTSAFGI 395
           ++   I+  +      R  EN   +P+  L    ++  + K + + D +I   G +   +
Sbjct: 334 SLETRIQQNEK---RLRAREN---EPSPALTYNKVYATIRKQIVDKDTIIVSEGANTMDV 387

Query: 396 NQTPFPNNAYGISQVLWGSIGFTTGACLGAAFAAEEIDPKKRVILFIGDGSLQLTVQEIS 455
            +  FP + Y   ++  G+   T G  LG A AA+   P+K VI   GD +   +  E+ 
Sbjct: 388 ARISFPTD-YPKLRMDAGT-NATMGVGLGYAIAAKIAHPQKNVIAIQGDSAFGFSGMELE 445

Query: 456 TMIRWGLKPYLFVLNNDGYTIERLIHGE 483
           T  R+ L   + V+NN G     + HGE
Sbjct: 446 TASRYKLGITVVVMNNSG-----IYHGE 468

>Suva_5.68 Chr5 (108954..110639) [1686 bp, 561 aa] {ON} YEL020C
           (REAL)
          Length = 561

 Score = 58.9 bits (141), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 113/518 (21%), Positives = 216/518 (41%), Gaps = 65/518 (12%)

Query: 5   TLGRYLFERLNQVDVKTIFGLPGDFNLSLLDKIYEVEGMRWAGNANE--LNAAYAADGYA 62
           T+ ++  + L +  + T+FG+ G   + L D +    G+++    NE   + A +A GY 
Sbjct: 4   TVTQHFAQLLQKYGIDTVFGIVGIPIVQLADTMV-ANGVKFIPCRNEQAASYAASAYGYV 62

Query: 63  RIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAK---QLLLHHTLGN 119
             K    ++   G G + +L GI  S +    +L + G  S +   K   Q L   +L  
Sbjct: 63  NDKP-GVLLIVGGPGLIHSLAGIYNSMSNRWPLLVIAGSSSQNDVYKGGFQELDQISL-- 119

Query: 120 GDFTVFHRMSANI-SETTAMVTDIATAPAEIDRCIRTTYITQRPVYLGLPANLVDLKVPA 178
              + F + +  + S+   MVT  A     ++ CI+ T       Y+  PA+L++ +  +
Sbjct: 120 --LSPFLKFTGKLTSDNIDMVTRKA-----LNHCIQGTMGVS---YIDFPADLIENEKKS 169

Query: 179 ----KLLETPIDLSLKPN----DPEAETEVVDTVLELIKAAKNPVILADACASRHDVKAE 230
                 L   + + L PN    DP    E+V  +L+     KN +I+    A ++    E
Sbjct: 170 LAGNDHLVNELPMILTPNKCGPDPSKIEEIVQLILQ--NRDKNILIVIGKGAVKN--SHE 225

Query: 231 TKKLIDATQFPSFVTPMGKGSIDEQHPRFGGVYVGTLSRPEVKEAVESADLILSVGALLS 290
            ++L+ +   P   TPM KG + +  P    + V +       +A+++AD++L +GA L+
Sbjct: 226 IRRLVSSFNLPFLPTPMAKGIVPDSSP----LNVSSAR----SQALKTADIVLVLGARLN 277

Query: 291 DFNTGSFSYSYKTKNI-VEF--HSDYIKIRNATF-PGVQMKFALQKLLNAVPEAIKGYKP 346
                  S  +  +++ ++F  H + +   N +   G+ +   +   + A+ E +   +P
Sbjct: 278 WILQFGSSPRWNAESVFIQFDSHPETLGDNNTSAGAGLSVWGDIGLSVTALMEELARQRP 337

Query: 347 --------------VPVPARVPENKSCDPATPLKQEWMWNQVSKFLQEGDVVITETGTSA 392
                         + V     + K       L    ++  +   +++   ++   G + 
Sbjct: 338 RWKYSGVNNALREKIHVNETRLQEKEKMGGAQLNYHQVYGVLRPLIEDYRTILVTEGANT 397

Query: 393 FGINQTPFPNNAYGISQVLWGSIGFTTGACLGAAFAAEEIDPKKRVILFIGDGSLQLTVQ 452
             I +  FP +A      L      T G  LG A A++   P+  V+L  GD +   +  
Sbjct: 398 MDIARVSFPTDAP--RHRLDAGTNATMGIGLGYALASKASRPELDVVLIQGDSAFGFSAM 455

Query: 453 EISTMIRWGLKPYLFVLNNDGYTIERLIHGEKAGYNDI 490
           EI T +R  L   + V+NN G     + HG K    D+
Sbjct: 456 EIETAVRCQLALVIVVMNNSG-----IYHGVKDAGADL 488

>TPHA0B03940 Chr2 (928983..930710) [1728 bp, 575 aa] {ON} Anc_1.450
           YEL020C
          Length = 575

 Score = 58.5 bits (140), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 118/532 (22%), Positives = 214/532 (40%), Gaps = 105/532 (19%)

Query: 1   MSEITLGRYLFERLNQVDVKTIFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADG 60
           MS I++  Y+   L + D+ T+FG+ G   +  L + +   G+++    NE +A+YAA  
Sbjct: 1   MSGISVPDYISTVLKKYDIDTVFGIVG-IPIVELAESFITNGIKFISFRNEQSASYAASL 59

Query: 61  YARIKGM-SCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAK-----QLLLH 114
           Y  +      ++T  G G + AL GI  S   +  ++ + G   I SQ K     Q L H
Sbjct: 60  YGYLNNKPGVLLTVGGPGLIHALAGIYNSIENNWPLIVITG--GIESQQKYKNGFQELNH 117

Query: 115 HTLGNGDFTVFHRMSANISETTAMVTDIATAPAEIDRCIRTTYITQRPV-YLGLPANLVD 173
             L N        +S   +E   ++         +   +R + ++ + V +L +P +L+ 
Sbjct: 118 IALLNSYMKFTGELS---TENIDLL---------VYESMRNSMLSPKGVSFLEIPGDLIH 165

Query: 174 LKVPAKLLET-----PI---DLSLKPNDPEAETEVVDTVLELIKAAKNPVILADACASRH 225
             V   + ++     PI    L+  PND        D +LE  K       L DA   R 
Sbjct: 166 KSVGKNIGDSLAKHKPILVDALTFIPND--------DILLETAK------FLYDAMRKRD 211

Query: 226 D------------VKAETKKLIDATQFPSFVTPMGKGSIDEQHPRFGGVYVGTLSRPEVK 273
                          +  +  I+    P   TPM KG I++ +     V  G        
Sbjct: 212 QNMLVIVGKGAIGASSALRHFINCFNLPFLPTPMAKGIIEDSNEL--NVSSGR------S 263

Query: 274 EAVESADLILSVGALLSDFNTGSFSYSYKTKNIVEFHSDYIKIRNATFP-GVQMKFALQK 332
            A++ AD+IL  GA L+      +  + K K+ V+F    I++ N T   G+  +  LQ 
Sbjct: 264 MALKDADVILVFGAKLNWIL--HYGDTPKFKDNVKF----IQVDNNTKTIGLNNQRGLQN 317

Query: 333 LL--------------------------NAVPEAIKGYKPVPVPARVPENKSCDP----- 361
            L                            + +AIK  K +    ++ E ++  P     
Sbjct: 318 SLIGDIESTVKKLTMMINHLQNGQMITYKGLSKAIK-EKILSNAIKLNEKENATPRVVPN 376

Query: 362 ATPLKQEWMWNQVSKFLQEGDVVITETGTSAFGINQTPFPNNAYGISQVLWGSIGFTTGA 421
           A  L    ++ ++    ++ + ++   G +   + +  FP + +   ++  G++  T G 
Sbjct: 377 ANSLNYNVVFGRLKTLFKDEETILVTEGANTMDVARISFPTD-FPQHRIDCGTLA-TMGI 434

Query: 422 CLGAAFAAEEIDPKKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNDG 473
            LG A + +   P K V+L  GD +   +  E+ T +R+ L   + ++NN G
Sbjct: 435 GLGYAISTKLSKPNKSVVLIQGDSAFGFSGLELETSVRFNLGLIVVIMNNSG 486

>Kwal_34.16116 s34 complement(208847..210508) [1662 bp, 553 aa] {ON}
           YEL020C - Hypothetical ORF [contig 268] FULL
          Length = 553

 Score = 57.0 bits (136), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 109/495 (22%), Positives = 196/495 (39%), Gaps = 49/495 (9%)

Query: 9   YLFERLNQVDVKTIFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADGYARIKGM- 67
           ++ + L    + T+FG+ G   + + D I     +R+ G  NE  A+YAA  Y  + G  
Sbjct: 9   HISDLLASYGIDTVFGIVGIPIVEIADTIISKGKIRFYGFRNEQAASYAASAYGYLTGKP 68

Query: 68  SCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNGDFTVFHR 127
             ++   G G + AL G+  S +    +L + G    SS+         L  G F    +
Sbjct: 69  GVLLVVGGPGLIHALAGVYNSISNKWPLLVLAG----SSE--------DLNRGGFQALDQ 116

Query: 128 MSANISETTAMVTDIATAPAE--IDRCIRTTYITQRPV-YLGLPANLVDLKVPAKLLETP 184
           + A +S      + +  +     +   +R + +    V YL +P +L++  V  +     
Sbjct: 117 I-AVLSRYVKFSSRLNNSNVNEMLYNALRQSMVGTPGVSYLDIPGDLIEQSVEKEKYNCV 175

Query: 185 IDLSLKPNDPEAETEVVDTVLELIKAAKNPVILADACASRHDVKAETKKLIDATQFPSFV 244
            +++     P  +   +  V +LI       +L        D   E +K I+  Q P   
Sbjct: 176 RNITKVEYQPSKDA--LQRVADLITENSTKSLLCVIGKGATDSSMEVRKFIERFQLPFLP 233

Query: 245 TPMGKGSIDEQHPRFGGVYVGTLSRPEVKE-AVESADLILSVGALLSDFNTGSFSYSYKT 303
           TPM KG + + HP         L+    +  A+ SAD++L +GA L+          +  
Sbjct: 234 TPMAKGVVPDSHP---------LNVSSARSLALRSADIVLVLGARLNWILHFGEPPKWNQ 284

Query: 304 KNI---VEFHSDYIKIRNATFPGVQMKFALQKLLNAVPEAIKGYKPVPVP----ARVPEN 356
             I   V+  +D +   N+          +   L ++   +K +K   +      +V +N
Sbjct: 285 NAIFVQVDTSADELGFNNSAGTLYSSCGHIGATLQSLTPMLKKFKYCGLSRSMLQQVEQN 344

Query: 357 KSCDPATPLKQEWM--WNQVSKFLQEG----DVVITETGTSAFGINQTPFPNNAYGISQV 410
           K    A   ++     +NQV   ++E     +  I   G +   I +  FP +   +   
Sbjct: 345 KVRLRAKETQKTLTLNYNQVYAAMREHMVDRNTFIVSEGANTMDIARVSFPTDYPKLR-- 402

Query: 411 LWGSIGFTTGACLGAAFAAEEIDPKKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLN 470
           L      T G  +G A AA+   P+K V+   GD +   +  E+ T  R+ L     V+N
Sbjct: 403 LDAGTNATMGVGIGYAIAAKLAHPEKSVVCIQGDSAFGFSGLELETASRYQLGIVFVVMN 462

Query: 471 NDGYTIERLIHGEKA 485
           N G     + HGE +
Sbjct: 463 NSG-----IYHGEDS 472

>KNAG0H01580 Chr8 complement(279178..280860) [1683 bp, 560 aa] {ON}
           Anc_1.450 YEL020C
          Length = 560

 Score = 56.6 bits (135), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 105/524 (20%), Positives = 200/524 (38%), Gaps = 79/524 (15%)

Query: 4   ITLGRYLFERLNQVDVKTIFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADGYAR 63
           +T+   +   L   +V  +FG+ G   ++L ++ +   G+R+    NE +A+YAA  Y  
Sbjct: 3   VTITERITTVLRHYEVDLVFGIVGIPIVTLANE-FITHGIRFVSCRNEQSASYAASAYGY 61

Query: 64  IKGM-SCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNGDF 122
           + G    ++   G G + +L G+  S      ++ + G         +            
Sbjct: 62  LTGKPGVLLVVGGPGLIHSLAGVYNSINNRWPLIVLAGSNDHGHDQYRGAFQELDQISLL 121

Query: 123 TVFHRMSANISETTAMVTDIATAPAEIDRCIRTTYI-----TQRPVYLGLPANLVDLK-- 175
             + + S  ++E              +D  + + Y      T+   Y+ +P NL++ +  
Sbjct: 122 KPYVKFSGKLTE------------GNVDHVLFSAYNIALQGTKGVTYVDIPGNLIETQAV 169

Query: 176 ---VPAKLLETPIDLSLKPNDPEAETEVVDTVLELIKAAKNPVILADACASRHDVKAETK 232
               P  L   P  +   P DP     V   +LE     ++  +L           A  +
Sbjct: 170 CAGTPGLLPPVPQPIKCSP-DPHTVKRVASLILE----NRDKKVLVVVGKGSQGAFAAVR 224

Query: 233 KLIDATQFPSFVTPMGKGSIDEQHPRFGGVYVGTLSRPEVKE-AVESADLILSVGALLSD 291
           + ID   FP   TPMGKG + ++H          L+    +  A+  A ++L +GA L+ 
Sbjct: 225 RFIDEFNFPFLPTPMGKGVVPDEH---------ELNVSSARSYALAHAGIVLIMGARLNW 275

Query: 292 FNTGSFSYSYKTK---NIVEFHSDY----IKIRNATFPGVQM----KFALQKLLNAVPEA 340
                  Y+   K   N V    D     +   N    G+ +    ++ ++ L N +  A
Sbjct: 276 I----LHYAGPPKWNPNAVFIQCDSNGETLGQNNQYHAGLSLFGDIEYTVEALSNELRSA 331

Query: 341 IKG-YKPVPVPARVPEN--------KSCDPATP--------LKQEWMWNQVSKFLQEGDV 383
             G Y+   + + + E         +  + A P        L    ++  +   L++   
Sbjct: 332 GGGDYRYGGLSSSIQEKIHKNEQRLRDSEHAVPEESSPPHVLNYNRVYGIIRPLLEQDRT 391

Query: 384 VITETGTSAFGINQTPFPNNAYGISQVLWGSIGFTTGACLGAAFAAEEIDPKKR-VILFI 442
           V+   G +     +  FP +    S++  G+   T G  LG A AA+      R V+L  
Sbjct: 392 VLVTEGANTMDKARVSFPAST-PFSRLDAGT-NATMGVGLGYAMAAKLSSGAARDVVLIQ 449

Query: 443 GDGSLQLTVQEISTMIRWGLKPYLFVLNNDGYTIERLIHGEKAG 486
           GD +   +  E+ T++R+ +   + ++NN G     + HG   G
Sbjct: 450 GDSAFGFSGMELETLVRFQVGVVVMIMNNSG-----IYHGNGVG 488

>KAFR0H02890 Chr8 complement(551945..553627) [1683 bp, 560 aa] {ON}
           Anc_1.450 YEL020C
          Length = 560

 Score = 43.1 bits (100), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 76/372 (20%), Positives = 143/372 (38%), Gaps = 58/372 (15%)

Query: 174 LKVPAKLLETPIDLSLKPN-DPEAETEVVDTVLELIKAAKNPVILADACASRHDV----- 227
           +  P  L+E+   L  K N D E   + + +  +    +K   ++ DA +    V     
Sbjct: 159 IDFPGILIESNSLLEGKSNWDDEVTIDKIKSSPDQTTVSKISRLIVDAKSQDKKVLVVIG 218

Query: 228 ------KAETKKLIDATQFPSFVTPMGKGSIDEQHPRFGGVYVGTLSRPEVKEAVESADL 281
                  +E +  ID    P   TPM KG + + H       +  +S      A+ +AD+
Sbjct: 219 KGSVYYSSEVRTFIDKFNLPFLPTPMAKGVVPDNH-------MCNVSSAR-SFALANADI 270

Query: 282 ILSVGALLSDFNTGSFSYSYKTKNI-VEFHSDYIKIRNATFPGVQMKF----------AL 330
           IL  GA L+     + S  +KT  I ++  +D   + +     V +              
Sbjct: 271 ILVFGARLNWILHYAESPKWKTSAIFIQCDNDPETLGHNNMNHVNLSLLGDLDLTITSIT 330

Query: 331 QKLLNAVPEAIKGYKPVPVPARVPENKSC--------DPATPLKQEWMWNQVSKFLQEGD 382
           ++L+   P+         + +++  N+S         D    L    ++ ++S  + +  
Sbjct: 331 EELVKKYPDYKHNTPSKELISKIESNRSKLQELEKPKDETAELNYNTVYGKISPLIDDES 390

Query: 383 VVITETGTSAFGINQTPFPNNAYGISQVLWGSIGFTTGACLGAAFAAEEIDPKKRVILFI 442
            ++   G +     +  F + ++ + ++  G+ G T G  LG   A+   +P    IL  
Sbjct: 391 TMLIFEGANTMDKARISF-STSFPLRRLDAGTNG-TMGVGLGYLMASRLANPNLDNILIQ 448

Query: 443 GDGSLQLTVQEISTMIRWGLKPYLFVLNNDGYTIERLIHGEKAGYNDIQNWDHLA----- 497
           GD +   +  EI T+ R+ L   + ++NN G     + HG     ND+ +   L      
Sbjct: 449 GDSAFGFSGMEIETLCRFKLGSVIIIMNNSG-----IYHG-----NDVNSATKLGEKTRY 498

Query: 498 --LLPTFGAKDY 507
             L    GAK Y
Sbjct: 499 DLLAQGLGAKGY 510

>NDAI0G00520 Chr7 complement(112068..113795) [1728 bp, 575 aa] {ON}
           Anc_1.450 YEL020C
          Length = 575

 Score = 37.7 bits (86), Expect = 0.076,   Method: Compositional matrix adjust.
 Identities = 71/340 (20%), Positives = 127/340 (37%), Gaps = 46/340 (13%)

Query: 164 YLGLPANLV--DLKVPAKLLETPIDLSLKPNDPEAETEVVDTVLELIKAAKNPVILADAC 221
           Y+  P +L+  +++VP       I  ++K +   A+  V   V +L++   +  +L    
Sbjct: 163 YIDFPEHLISNNVRVPNMKQNISIPRAIKSS---ADPLVTKEVAQLLRRNSDQNVLVIIG 219

Query: 222 ASRHDVKAETKKLIDATQFPSFVTPMGKGSIDEQHPRFGGVYVGTLSRPEVK-EAVESAD 280
               +        I   QFP   TPMGKG I +  P         L+    +  A+  +D
Sbjct: 220 KGAVNYSKGLSAFIHKYQFPFLPTPMGKGIISDMDP---------LNVSSARSSALSKSD 270

Query: 281 LILSVGALLSDFNTGSFSYSYKTKNIVEF---HSDYIKIRNATFPGVQMKFA--LQKLLN 335
           ++L  GA L+      F    K K+ V+F    +D   I N     +       +  ++N
Sbjct: 271 IVLVFGARLNWL--LHFGKPPKWKSTVKFILCDNDPHAIGNNNMQSINYSLLGDIGLIIN 328

Query: 336 AVPEAIK------GYK------------PVPVPARVPENKSCDPATPLKQEWMWNQVSKF 377
            + E +       G K                  +  E++S      L    ++  + + 
Sbjct: 329 ELTEELDRVENEWGRKYGVTKELRSEILKNQFKLQEKESRSNTNGALLNYHVVYRTLREM 388

Query: 378 LQEGDVVITETGTSAFGINQTPFPNNAYGISQVLWGSIGFTTGACLGAAFAA----EEID 433
           L   +  +   G +   I +  FP  +    Q L      T G  LG   AA    + + 
Sbjct: 389 LDLKNTFLVTEGANTMDIARISFP--SLKPKQRLDAGTNATMGVGLGYGIAARLSQDYMK 446

Query: 434 PKKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNDG 473
            K  +++  GD +   +  EI T +R+ L   + V+NN G
Sbjct: 447 SKPDILVIQGDSAFGFSAIEIETAVRFKLGLIIIVINNSG 486

>TBLA0C01560 Chr3 (362966..364714) [1749 bp, 582 aa] {ON} Anc_1.450
           YEL020C
          Length = 582

 Score = 37.7 bits (86), Expect = 0.086,   Method: Compositional matrix adjust.
 Identities = 57/279 (20%), Positives = 112/279 (40%), Gaps = 53/279 (18%)

Query: 229 AETKKLIDATQFPSFVTPMGKGSIDEQHPRFGGVYVGTLSRPEVKEAVESADLILSVGAL 288
            +  + ++  Q P   TPM KG + + HP    V V          A++++D+I+ +GA 
Sbjct: 229 TKINEFVNKFQLPFLPTPMAKGIVPDSHPL--NVSVAR------SFALKNSDIIIVIGAR 280

Query: 289 LS-DFNTGSFSYSYKTKNIVEFHSDYIKIRNAT----------------------FPGVQ 325
           L+   + GSF    KTK   +    +I+I N +                         + 
Sbjct: 281 LNWILHFGSFG---KTK--FKPGCQFIQIDNDSEVLGWNNNQGNENCLLSDIGLALDSIS 335

Query: 326 MKFAL-----------QKLLNAVPEAIKGYKPVPVPARVPENKSCDPATPLKQEWMWNQV 374
            K  L            KL N + + I+         R+ +    +   P   E ++ ++
Sbjct: 336 QKLPLGFKFSKEKQEDNKLSNEIQKIIENNTN---KLRLKQRYDHNNGAP-SYEQVYYKL 391

Query: 375 SKFLQEGDVVITETGTSAFGINQTPFPNNAYGISQVLWGSIGFTTGACLGAAFAAEEIDP 434
           ++ + +   ++   G +   I +  F  + Y + ++  G+   T G  +G A A++   P
Sbjct: 392 NQVINDKQTILVTEGANTMDIARICFQTD-YPLHRLDCGT-NATMGIGIGYAIASKLAVP 449

Query: 435 KKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNDG 473
            K  +L  GD +   +  E+ T+ R+ L   + ++NN G
Sbjct: 450 DKLTVLIQGDSAFGFSGMELETISRFKLGIVVIIMNNSG 488

>CAGL0M03245g Chr13 complement(372122..373810) [1689 bp, 562 aa]
           {ON} similar to uniprot|P39994 Saccharomyces cerevisiae
           YEL020c
          Length = 562

 Score = 36.6 bits (83), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 18/56 (32%), Positives = 28/56 (50%)

Query: 418 TTGACLGAAFAAEEIDPKKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNDG 473
           T G  LG A AA+   P+  ++   GD +   +  EI T +R+ L     ++NN G
Sbjct: 420 TMGVGLGYAIAAKVHSPELNIVTIQGDSAFGFSGMEIETAVRYRLGIIFIIMNNSG 475

>Ecym_8112 Chr8 complement(237472..239301) [1830 bp, 609 aa] {ON}
           similar to Ashbya gossypii AEL132W
          Length = 609

 Score = 31.6 bits (70), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 44/176 (25%), Positives = 73/176 (41%), Gaps = 19/176 (10%)

Query: 142 IATAPAEIDRCIRTTYITQRPVYLGLPANLVDLKVPAKLLETPIDLSLKPND-PEAETEV 200
           ++T  + ID  + T+Y++  P+Y  +      + V        I   +K N  PE+ T +
Sbjct: 393 LSTHRSRIDDMVITSYLSHNPLYSPMIRTTKAVDV--------IKGGVKANALPESTTFI 444

Query: 201 VDTVLELIKAA----KNPVILADACASRHD--VKAETKKLIDATQFPSF-VTPMGKGSID 253
           V+  +E+  +     ++ ++L    A RH   +  E K++  AT      VTP+ +    
Sbjct: 445 VNHRVEITSSIDAVIEDDLVLVKRVARRHGYGITLEGKEIWPATPIGYIEVTPLNRLDPS 504

Query: 254 EQHPRFGG---VYVGTLSRPEVKEAVESADLILSVGALLSDFNTGSFSYSYKTKNI 306
              P  G    V+ GTL        +   D+   V   L   NT S  Y   TKNI
Sbjct: 505 PISPTSGSTWDVFAGTLQDVYESNVLVDKDIDFYVTGSLFSANTDSKFYWNSTKNI 560

>Suva_8.427 Chr8 complement(769308..772004) [2697 bp, 898 aa] {ON}
           YOR371C (REAL)
          Length = 898

 Score = 31.6 bits (70), Expect = 7.6,   Method: Compositional matrix adjust.
 Identities = 24/78 (30%), Positives = 35/78 (44%), Gaps = 6/78 (7%)

Query: 288 LLSDFNTGSFSYSYKTKNIVEFH-SDYIKIRNATFPGVQMKFALQKLLNAVPEAIKGYKP 346
           +L   +T S+   YK    V+   SD +K  N   P +  KF    + NA P+  +   P
Sbjct: 182 ILRSCSTRSYFKYYKKLLTVDLKDSDILKRHNLWMPLIARKFRFLLISNAEPKNARLASP 241

Query: 347 VPVPARVP-----ENKSC 359
           VP+P   P     E K+C
Sbjct: 242 VPIPIISPDLDIFEKKTC 259

>TDEL0C02790 Chr3 (487977..496337) [8361 bp, 2786 aa] {ON} Anc_7.418
            YBL088C
          Length = 2786

 Score = 31.2 bits (69), Expect = 8.7,   Method: Compositional matrix adjust.
 Identities = 34/150 (22%), Positives = 70/150 (46%), Gaps = 18/150 (12%)

Query: 146  PAEIDRCIRTTYITQRPVYLGLPANLVDLKVPAKLLE-TPIDLSLKPNDPEAETEVVDTV 204
            P  ID   ++ Y+T + +    P        P+K ++ + + +    ND E  +E V+T+
Sbjct: 1873 PQRIDSKEKSLYLTLKKISYDAPH-------PSKTIQDSLVQVVECKNDFETPSEWVETI 1925

Query: 205  LELIKAAKNPVILADACASRHDVKAETKKLIDATQFPSFVTPMG--KGSIDEQHPRFGGV 262
             E+    +    L+D  ++  ++ A  +K ID  +   +V      K +I  ++     +
Sbjct: 1926 AEMALLKE----LSDCMSNPENLVATLRKTIDFDRRALYVHDFSDYKSNIQSRY----ML 1977

Query: 263  YVGTLSRPEVKEAVESADLILSVGALLSDF 292
                L+R +   ++ SADL +  GALL+++
Sbjct: 1978 SKLLLNRSDEFPSISSADLTICTGALLANY 2007

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.317    0.134    0.394 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 58,381,614
Number of extensions: 2557002
Number of successful extensions: 6862
Number of sequences better than 10.0: 139
Number of HSP's gapped: 6766
Number of HSP's successfully gapped: 176
Length of query: 564
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 449
Effective length of database: 40,294,809
Effective search space: 18092369241
Effective search space used: 18092369241
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 68 (30.8 bits)