Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
CAGL0M06941g2.286ON49249225060.0
KAFR0H033102.286ON48849518090.0
NDAI0G006602.286ON49650317550.0
SAKL0E07678g2.286ON47749317340.0
Skud_14.3072.286ON49049517250.0
Kpol_1003.382.286ON49650217240.0
Suva_14.3252.286ON49049217170.0
KLLA0E08361g2.286ON49149717110.0
YNL022C2.286ON49049717070.0
KNAG0H020002.286ON49850317040.0
TPHA0C034002.286ON49450016920.0
Ecym_33252.286ON49649416640.0
KLTH0G10362g2.286ON52949216610.0
Smik_14.3092.286ON49049616480.0
TDEL0G021702.286ON48449316310.0
NCAS0G037902.286ON49249916200.0
Kwal_27.115322.286ON47949416040.0
ZYRO0A01892g2.286ON46549115900.0
TBLA0B069602.286ON50850915750.0
ADL215W2.286ON48449615500.0
CAGL0J10032g2.247ON6192941624e-11
SAKL0E08624g2.247ON6112681625e-11
Kpol_1003.152.247ON6332761528e-10
TBLA0E038502.247ON6322851511e-09
KAFR0J009702.247ON6102761492e-09
AFR179C8.171ON7002971492e-09
ADL254W2.247ON6032131492e-09
TPHA0H001508.171ON6493031482e-09
Smik_2.928.171ON6742951482e-09
TPHA0C031502.247ON6082291483e-09
KLLA0F03399g2.247ON6192761473e-09
Ecym_32842.247ON6062851473e-09
KNAG0I018702.247ON6292761464e-09
Kwal_23.48412.247ON6272941464e-09
ZYRO0A01562g2.247ON6172161455e-09
Suva_2.978.171ON6702951456e-09
KLTH0G09460g2.247ON6373021447e-09
YNL061W (NOP2)2.247ON6183001447e-09
Smik_14.2662.247ON6183001439e-09
SAKL0H19448g8.171ON6912931431e-08
NDAI0D010502.247ON6252761421e-08
NCAS0G030302.247ON4902761411e-08
Suva_14.2802.247ON6202761412e-08
TDEL0B043908.171ON6732981412e-08
YBL024W (NCL1)8.171ON6842951412e-08
TDEL0C041502.247ON6142761402e-08
KNAG0G015108.171ON6662981402e-08
KNAG0D020508.171ON6822971402e-08
NCAS0B043908.171ON6712961384e-08
Skud_14.2712.247ON6192681374e-08
Skud_2.818.171ON6812951359e-08
Ecym_23538.171ON6902941359e-08
KLTH0H08096g8.171ON6882931331e-07
KAFR0B022208.171ON6862911322e-07
NDAI0B018308.171ON6862951295e-07
Kpol_1002.1098.171ON6702971285e-07
TPHA0C028708.171ON6742911285e-07
ZYRO0G08998g8.171ON6832931287e-07
NCAS0B056408.171ON6592951261e-06
CAGL0K01991g8.171ON6722211261e-06
NDAI0B029808.171ON6792941251e-06
KLLA0F12562g8.171ON7042961162e-05
TBLA0A087408.171ON6862281152e-05
Kwal_14.20818.171ON272129890.020
Ecym_30036.1ON319119820.17
Skud_16.116.1ON318119800.30
YPL266W (DIM1)6.1ON318119780.41
Suva_16.396.1ON318119770.55
NDAI0I027106.1ON319119751.2
Smik_13.4728.811ON1417116761.2
SAKL0E00660g6.1ON322119751.2
Smik_6.4746.1ON318119731.7
Kpol_449.126.1ON319119731.8
TBLA0A070806.1ON321119731.9
ZYRO0F00308g6.1ON319119732.0
TPHA0J002006.1ON319119722.2
KAFR0B064506.1ON318119722.4
CAGL0L07678g6.1ON317119722.4
KNAG0L024406.1ON317119722.6
ZYRO0B11836g8.237ON77076723.7
TBLA0H018805.370ON170849714.5
KLTH0H03102g6.261ON47043704.9
Kwal_56.242706.261ON47043705.1
SAKL0D06644g1.331ON80389705.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0M06941g
         (492 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0M06941g Chr13 complement(706878..708356) [1479 bp, 492 aa] ...   969   0.0  
KAFR0H03310 Chr8 complement(630597..632063) [1467 bp, 488 aa] {O...   701   0.0  
NDAI0G00660 Chr7 (144471..145961) [1491 bp, 496 aa] {ON} Anc_2.2...   680   0.0  
SAKL0E07678g Chr5 complement(621183..622616) [1434 bp, 477 aa] {...   672   0.0  
Skud_14.307 Chr14 complement(562104..563576) [1473 bp, 490 aa] {...   669   0.0  
Kpol_1003.38 s1003 (94479..95969) [1491 bp, 496 aa] {ON} (94479....   668   0.0  
Suva_14.325 Chr14 complement(574309..575781) [1473 bp, 490 aa] {...   665   0.0  
KLLA0E08361g Chr5 complement(751889..753364) [1476 bp, 491 aa] {...   663   0.0  
YNL022C Chr14 complement(591427..592899) [1473 bp, 490 aa] {ON} ...   662   0.0  
KNAG0H02000 Chr8 complement(353074..354570) [1497 bp, 498 aa] {O...   660   0.0  
TPHA0C03400 Chr3 (747016..748500) [1485 bp, 494 aa] {ON} Anc_2.2...   656   0.0  
Ecym_3325 Chr3 (623214..624704) [1491 bp, 496 aa] {ON} similar t...   645   0.0  
KLTH0G10362g Chr7 (876756..878345) [1590 bp, 529 aa] {ON} highly...   644   0.0  
Smik_14.309 Chr14 complement(553805..555277) [1473 bp, 490 aa] {...   639   0.0  
TDEL0G02170 Chr7 (427274..428728) [1455 bp, 484 aa] {ON} Anc_2.2...   632   0.0  
NCAS0G03790 Chr7 complement(699962..701440) [1479 bp, 492 aa] {O...   628   0.0  
Kwal_27.11532 s27 complement(837572..839011) [1440 bp, 479 aa] {...   622   0.0  
ZYRO0A01892g Chr1 (156967..158364) [1398 bp, 465 aa] {ON} simila...   617   0.0  
TBLA0B06960 Chr2 (1646966..1648492) [1527 bp, 508 aa] {ON} Anc_2...   611   0.0  
ADL215W Chr4 (326584..328038) [1455 bp, 484 aa] {ON} Syntenic ho...   601   0.0  
CAGL0J10032g Chr10 (983405..985264) [1860 bp, 619 aa] {ON} highl...    67   4e-11
SAKL0E08624g Chr5 complement(704579..706414) [1836 bp, 611 aa] {...    67   5e-11
Kpol_1003.15 s1003 (41683..43584) [1902 bp, 633 aa] {ON} (41683....    63   8e-10
TBLA0E03850 Chr5 (967569..969467) [1899 bp, 632 aa] {ON} Anc_2.2...    63   1e-09
KAFR0J00970 Chr10 (174873..176705) [1833 bp, 610 aa] {ON} Anc_2....    62   2e-09
AFR179C Chr6 complement(766458..768560) [2103 bp, 700 aa] {ON} S...    62   2e-09
ADL254W Chr4 (253602..255413) [1812 bp, 603 aa] {ON} Syntenic ho...    62   2e-09
TPHA0H00150 Chr8 (15977..17926) [1950 bp, 649 aa] {ON} Anc_8.171...    62   2e-09
Smik_2.92 Chr2 (166201..168225) [2025 bp, 674 aa] {ON} YBL024W (...    62   2e-09
TPHA0C03150 Chr3 (697508..699334) [1827 bp, 608 aa] {ON} Anc_2.2...    62   3e-09
KLLA0F03399g Chr6 (319007..320866) [1860 bp, 619 aa] {ON} simila...    61   3e-09
Ecym_3284 Chr3 (537227..539047) [1821 bp, 606 aa] {ON} similar t...    61   3e-09
KNAG0I01870 Chr9 complement(366800..368689) [1890 bp, 629 aa] {O...    61   4e-09
Kwal_23.4841 s23 (890138..892021) [1884 bp, 627 aa] {ON} YNL061W...    61   4e-09
ZYRO0A01562g Chr1 (128145..129998) [1854 bp, 617 aa] {ON} simila...    60   5e-09
Suva_2.97 Chr2 (172667..174679) [2013 bp, 670 aa] {ON} YBL024W (...    60   6e-09
KLTH0G09460g Chr7 (787197..789110) [1914 bp, 637 aa] {ON} simila...    60   7e-09
YNL061W Chr14 (510540..512396) [1857 bp, 618 aa] {ON}  NOP2Proba...    60   7e-09
Smik_14.266 Chr14 (490908..492764) [1857 bp, 618 aa] {ON} YNL061...    60   9e-09
SAKL0H19448g Chr8 (1713663..1715738) [2076 bp, 691 aa] {ON} high...    60   1e-08
NDAI0D01050 Chr4 (236435..238312) [1878 bp, 625 aa] {ON} Anc_2.2...    59   1e-08
NCAS0G03030 Chr7 (556908..558380) [1473 bp, 490 aa] {ON} Anc_2.2...    59   1e-08
Suva_14.280 Chr14 (509488..511350) [1863 bp, 620 aa] {ON} YNL061...    59   2e-08
TDEL0B04390 Chr2 (769749..771770) [2022 bp, 673 aa] {ON} Anc_8.1...    59   2e-08
YBL024W Chr2 (172534..174588) [2055 bp, 684 aa] {ON}  NCL1S-aden...    59   2e-08
TDEL0C04150 Chr3 complement(734914..736758) [1845 bp, 614 aa] {O...    59   2e-08
KNAG0G01510 Chr7 complement(341469..343469) [2001 bp, 666 aa] {O...    59   2e-08
KNAG0D02050 Chr4 (339873..341921) [2049 bp, 682 aa] {ON} Anc_8.1...    59   2e-08
NCAS0B04390 Chr2 complement(795633..797648) [2016 bp, 671 aa] {O...    58   4e-08
Skud_14.271 Chr14 (500809..502668) [1860 bp, 619 aa] {ON} YNL061...    57   4e-08
Skud_2.81 Chr2 (156273..158318) [2046 bp, 681 aa] {ON} YBL024W (...    57   9e-08
Ecym_2353 Chr2 complement(691422..693494) [2073 bp, 690 aa] {ON}...    57   9e-08
KLTH0H08096g Chr8 (706261..708327) [2067 bp, 688 aa] {ON} simila...    56   1e-07
KAFR0B02220 Chr2 complement(438809..440869) [2061 bp, 686 aa] {O...    55   2e-07
NDAI0B01830 Chr2 (436254..438314) [2061 bp, 686 aa] {ON} Anc_8.1...    54   5e-07
Kpol_1002.109 s1002 (272892..274904) [2013 bp, 670 aa] {ON} (272...    54   5e-07
TPHA0C02870 Chr3 (620913..622937) [2025 bp, 674 aa] {ON} Anc_8.1...    54   5e-07
ZYRO0G08998g Chr7 complement(726070..728121) [2052 bp, 683 aa] {...    54   7e-07
NCAS0B05640 Chr2 complement(1068983..1070962) [1980 bp, 659 aa] ...    53   1e-06
CAGL0K01991g Chr11 (173969..175987) [2019 bp, 672 aa] {ON} highl...    53   1e-06
NDAI0B02980 Chr2 complement(757926..759965) [2040 bp, 679 aa] {O...    53   1e-06
KLLA0F12562g Chr6 (1163366..1165480) [2115 bp, 704 aa] {ON} high...    49   2e-05
TBLA0A08740 Chr1 (2141750..2143810) [2061 bp, 686 aa] {ON} Anc_8...    49   2e-05
Kwal_14.2081 s14 (598648..599463) [816 bp, 272 aa] {ON} YBL024W ...    39   0.020
Ecym_3003 Chr3 complement(6934..7893) [960 bp, 319 aa] {ON} simi...    36   0.17 
Skud_16.11 Chr16 (18214..19170) [957 bp, 318 aa] {ON} YPL266W (R...    35   0.30 
YPL266W Chr16 (39121..40077) [957 bp, 318 aa] {ON}  DIM1Essentia...    35   0.41 
Suva_16.39 Chr16 (54705..55661) [957 bp, 318 aa] {ON} YPL266W (R...    34   0.55 
NDAI0I02710 Chr9 (636403..637362) [960 bp, 319 aa] {ON} Anc_6.1 ...    33   1.2  
Smik_13.472 Chr13 complement(767729..771982) [4254 bp, 1417 aa] ...    34   1.2  
SAKL0E00660g Chr5 complement(42779..43747) [969 bp, 322 aa] {ON}...    33   1.2  
Smik_6.474 Chr6 complement(781184..782140) [957 bp, 318 aa] {ON}...    33   1.7  
Kpol_449.12 s449 complement(42834..43793) [960 bp, 319 aa] {ON} ...    33   1.8  
TBLA0A07080 Chr1 complement(1748948..1749913) [966 bp, 321 aa] {...    33   1.9  
ZYRO0F00308g Chr6 complement(32198..33157) [960 bp, 319 aa] {ON}...    33   2.0  
TPHA0J00200 Chr10 complement(47344..48303) [960 bp, 319 aa] {ON}...    32   2.2  
KAFR0B06450 Chr2 complement(1337903..1338859) [957 bp, 318 aa] {...    32   2.4  
CAGL0L07678g Chr12 complement(846285..847238) [954 bp, 317 aa] {...    32   2.4  
KNAG0L02440 Chr12 (434232..435185) [954 bp, 317 aa] {ON} Anc_6.1...    32   2.6  
ZYRO0B11836g Chr2 (940987..943299) [2313 bp, 770 aa] {ON} highly...    32   3.7  
TBLA0H01880 Chr8 (441695..446821) [5127 bp, 1708 aa] {ON} Anc_5....    32   4.5  
KLTH0H03102g Chr8 (275767..277179) [1413 bp, 470 aa] {ON} highly...    32   4.9  
Kwal_56.24270 s56 complement(930311..931723) [1413 bp, 470 aa] {...    32   5.1  
SAKL0D06644g Chr4 complement(548576..550987) [2412 bp, 803 aa] {...    32   5.9  

>CAGL0M06941g Chr13 complement(706878..708356) [1479 bp, 492 aa]
           {ON} similar to uniprot|P53972 Saccharomyces cerevisiae
           YNL022c
          Length = 492

 Score =  969 bits (2506), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 480/492 (97%), Positives = 480/492 (97%)

Query: 1   MEFYRDSTWVLEYLEGQIEKTGRVSGSLQTIVLRCCKQYRIKTNPKHIYAIVSSCWKYKP 60
           MEFYRDSTWVLEYLEGQIEKTGRVSGSLQTIVLRCCKQYRIKTNPKHIYAIVSSCWKYKP
Sbjct: 1   MEFYRDSTWVLEYLEGQIEKTGRVSGSLQTIVLRCCKQYRIKTNPKHIYAIVSSCWKYKP 60

Query: 61  YLDKIMKKSGLLDAIPRKKGKPAFSKXXXXXXXXXXXXSKAKRIQMGKHPIKNYVLKYKN 120
           YLDKIMKKSGLLDAIPRKKGKPAFSK            SKAKRIQMGKHPIKNYVLKYKN
Sbjct: 61  YLDKIMKKSGLLDAIPRKKGKPAFSKLTLLLLCHDLLLSKAKRIQMGKHPIKNYVLKYKN 120

Query: 121 ALNAEFVKLKIKLKITDLSQVVDKDDAADDMTPVRWIRINPLRISNHDTDQVLNELKKKF 180
           ALNAEFVKLKIKLKITDLSQVVDKDDAADDMTPVRWIRINPLRISNHDTDQVLNELKKKF
Sbjct: 121 ALNAEFVKLKIKLKITDLSQVVDKDDAADDMTPVRWIRINPLRISNHDTDQVLNELKKKF 180

Query: 181 PTRVNTWKDIIPGSIYYDEFIPNLYGIHISDKITSHELYKQGKIIIQDRASCFPAHILNP 240
           PTRVNTWKDIIPGSIYYDEFIPNLYGIHISDKITSHELYKQGKIIIQDRASCFPAHILNP
Sbjct: 181 PTRVNTWKDIIPGSIYYDEFIPNLYGIHISDKITSHELYKQGKIIIQDRASCFPAHILNP 240

Query: 241 SADDVVIDACSAPGNKTTHVAAHIFGDPENPRNDNVQIYAFEKDPERAQILQKMIKTAGC 300
           SADDVVIDACSAPGNKTTHVAAHIFGDPENPRNDNVQIYAFEKDPERAQILQKMIKTAGC
Sbjct: 241 SADDVVIDACSAPGNKTTHVAAHIFGDPENPRNDNVQIYAFEKDPERAQILQKMIKTAGC 300

Query: 301 HKNIDVNVGDFTQIATPSKYSDVTGFILDPSCSGSGIFGRKSVDILNNHGKKSNDEVPDE 360
           HKNIDVNVGDFTQIATPSKYSDVTGFILDPSCSGSGIFGRKSVDILNNHGKKSNDEVPDE
Sbjct: 301 HKNIDVNVGDFTQIATPSKYSDVTGFILDPSCSGSGIFGRKSVDILNNHGKKSNDEVPDE 360

Query: 361 NDAEETTDSKNEQLKERLSKLASFQFQIVRHAMSFPNAKKIVYSTCSIHAEENERVVIDL 420
           NDAEETTDSKNEQLKERLSKLASFQFQIVRHAMSFPNAKKIVYSTCSIHAEENERVVIDL
Sbjct: 361 NDAEETTDSKNEQLKERLSKLASFQFQIVRHAMSFPNAKKIVYSTCSIHAEENERVVIDL 420

Query: 421 LLDKKVQSWGWRVAKKELVLPTWYRRGFKEEFQEVFTDKTEQECQELADGCVRALPKEDG 480
           LLDKKVQSWGWRVAKKELVLPTWYRRGFKEEFQEVFTDKTEQECQELADGCVRALPKEDG
Sbjct: 421 LLDKKVQSWGWRVAKKELVLPTWYRRGFKEEFQEVFTDKTEQECQELADGCVRALPKEDG 480

Query: 481 GIGFFAVCFVRD 492
           GIGFFAVCFVRD
Sbjct: 481 GIGFFAVCFVRD 492

>KAFR0H03310 Chr8 complement(630597..632063) [1467 bp, 488 aa] {ON}
           Anc_2.286 YNL022C
          Length = 488

 Score =  701 bits (1809), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 328/495 (66%), Positives = 406/495 (82%), Gaps = 11/495 (2%)

Query: 1   MEFYRDSTWVLEYLEGQIEKTGRVSGSLQTIVLRCCKQYRIKTNPKHIYAIVSSCWKYKP 60
           MEFYRD+TWVLEY+E Q  K GR+SGSLQ++VL+ C++Y++KTNPKHIYA++ SCWKYKP
Sbjct: 1   MEFYRDATWVLEYIEQQDSK-GRISGSLQSLVLKSCQKYKLKTNPKHIYAVLDSCWKYKP 59

Query: 61  YLDKIMKKSGLLDAIPRKKGKPAFSKXXXXXXXXXXXXSKAKRIQMGKHPIKNYVLKYKN 120
           +L+K+M KSG+L  IP+KKGKP +++            SK KRIQMGKHPIK +VL+YK+
Sbjct: 60  FLEKVMSKSGILKDIPKKKGKPVYTRLTLLLLIHDLLLSKQKRIQMGKHPIKLFVLRYKS 119

Query: 121 ALNAEFVKLKIKLKITDLSQVVDKDDAADDMTPVRWIRINPLRISNHDTDQVLNELKKKF 180
            L++E VKLK+K K+ DLS++VD  D+++D+TPVRW RINPLR    D   V+ EL+KKF
Sbjct: 120 RLHSELVKLKLKAKVRDLSELVDTGDSSNDITPVRWFRINPLRCP--DASAVMKELEKKF 177

Query: 181 PTRVNTWKDIIPGSIYYDEFIPNLYGIHISDKITSHELYKQGKIIIQDRASCFPAHILNP 240
           P RV +W+ I+PGSIY+DEFIP L+GIH  DKITSHELYKQG+IIIQDRASCFPAHILNP
Sbjct: 178 PQRVESWEGIVPGSIYHDEFIPYLFGIHPQDKITSHELYKQGRIIIQDRASCFPAHILNP 237

Query: 241 SADDVVIDACSAPGNKTTHVAAHIFGDPENPRNDNVQIYAFEKDPERAQILQKMIKTAGC 300
           + +D +IDACSAPGNKTTHVA+++FG   N   D+V+I+AFEKDPERA++LQKMIK AGC
Sbjct: 238 TLEDKIIDACSAPGNKTTHVASYMFG---NGLVDDVRIFAFEKDPERAKVLQKMIKVAGC 294

Query: 301 HKNIDVNVGDFTQIATPSKYSDVTGFILDPSCSGSGIFGRKSVDILNNHGKKSN---DEV 357
            K I VNVGDFT++ATPSK+ DVTGFI+DPSCSGSGIFGRK +D LN   K  +   + V
Sbjct: 295 SKQISVNVGDFTKLATPSKFPDVTGFIVDPSCSGSGIFGRKYIDSLNRQKKTQDIVDNGV 354

Query: 358 PDENDAEETTDSKNEQLKERLSKLASFQFQIVRHAMSFPNAKKIVYSTCSIHAEENERVV 417
           PDE   EE  + +N  L+ERLSKL+SFQFQ+V+HAMSFP AK+IVYSTCSIHAEENERV 
Sbjct: 355 PDEQ--EEMAEKENGNLQERLSKLSSFQFQVVKHAMSFPKAKRIVYSTCSIHAEENERVA 412

Query: 418 IDLLLDKKVQSWGWRVAKKELVLPTWYRRGFKEEFQEVFTDKTEQECQELADGCVRALPK 477
           +DLLLD+KV+ WGW++AK+E V+P W RRGF  EFQE+F DKT  ECQE+ADGC+RALP+
Sbjct: 413 LDLLLDEKVKQWGWKIAKRESVIPQWPRRGFVSEFQEIFRDKTASECQEMADGCIRALPR 472

Query: 478 EDGGIGFFAVCFVRD 492
           EDGGIGFFA+CF RD
Sbjct: 473 EDGGIGFFAICFERD 487

>NDAI0G00660 Chr7 (144471..145961) [1491 bp, 496 aa] {ON} Anc_2.286
           YNL022C
          Length = 496

 Score =  680 bits (1755), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 338/503 (67%), Positives = 406/503 (80%), Gaps = 19/503 (3%)

Query: 1   MEFYRDSTWVLEYLEGQIEKTGRVSGSLQTIVLRCCKQYRIKTNPKHIYAIVSSCWKYKP 60
           M FYRD+TWVLEY+E Q E  GR+SGSLQT+VL+ C +Y++K NPKH+YA++ SCWKYKP
Sbjct: 1   MNFYRDATWVLEYVEQQ-EAKGRISGSLQTLVLQSCTKYKLKCNPKHVYAVIDSCWKYKP 59

Query: 61  YLDKIMKKSGLLDAIPRKKGKPAFSKXXXXXXXXXXXXSKAKRIQMGKHPIKNYVLKYKN 120
           YL+K+MKKSG+LD IP+KKGKP +S+            SK+KRIQMGKHPIK YVLK+K+
Sbjct: 60  YLEKVMKKSGILDDIPKKKGKPMYSRLTLMLLCHDLLFSKSKRIQMGKHPIKEYVLKHKS 119

Query: 121 ALNAEFVKLKIKLKITDLSQVVDKDDAADDMTPVRWIRINPLRI-SNHDTDQVLNELKKK 179
            L++E V+LK+KLK+ +LS++VD +D+ +D+TPVRWIRINPLR     D + VL EL KK
Sbjct: 120 RLHSELVRLKLKLKVKNLSEIVDNNDSTEDVTPVRWIRINPLRCYQGRDVNAVLEELGKK 179

Query: 180 FPTRVNTWKDIIPGSIYYDEFIPNLYGIHISDKITSHELYKQGKIIIQDRASCFPAHILN 239
           FP RV  W DI+PGSIYYDE+IP+LYGIH  DKITSHELYKQGKIIIQDRASCFPAHILN
Sbjct: 180 FPKRVENWNDIVPGSIYYDEYIPHLYGIHPQDKITSHELYKQGKIIIQDRASCFPAHILN 239

Query: 240 PSADDVVIDACSAPGNKTTHVAAHIFGDPENPRNDNVQIYAFEKDPERAQILQKMIKTAG 299
           PS DD++IDAC+APGNKTTHVA+++FGD +   + +VQIYAFEKDPERA+IL+KMIK AG
Sbjct: 240 PSKDDIIIDACAAPGNKTTHVASYMFGDAKQ-EDPHVQIYAFEKDPERAKILEKMIKVAG 298

Query: 300 CHKNIDVNVGDFTQIATPSKYSDVTGFILDPSCSGSGIFGRKSVDILN--------NHGK 351
           C KNI V VGDFT+ ATP K+ DVTGFI+DPSCSGSGIFGRK VD LN        +  K
Sbjct: 299 CSKNIQVTVGDFTKAATPDKFKDVTGFIVDPSCSGSGIFGRKYVDSLNRQRNNDTTDKDK 358

Query: 352 KS---NDEVPDENDAEETTDSKNEQLKERLSKLASFQFQIVRHAMSFPNAKKIVYSTCSI 408
           KS   +DEVPDE +      +K E LK RL+KL+SFQFQ+++HAMSFP AKKIVYSTCSI
Sbjct: 359 KSTEEDDEVPDEQEDY----NKKEDLKTRLAKLSSFQFQVIKHAMSFPTAKKIVYSTCSI 414

Query: 409 HAEENERVVIDLLLDKKVQSWGWRVAKKELVLPTWYRRGFKEEFQEVFTDKTEQECQELA 468
           HAEENERVV+DLLLD KV+ WGW+VA KE V+PTW RRG  EEF+EVF D   + CQ LA
Sbjct: 415 HAEENERVVLDLLLDSKVKQWGWKVAAKESVIPTWPRRGKIEEFEEVFRDDPAK-CQALA 473

Query: 469 DGCVRALPKEDGGIGFFAVCFVR 491
           DGC+RALP++DGGIGFFAVCF R
Sbjct: 474 DGCIRALPRDDGGIGFFAVCFER 496

>SAKL0E07678g Chr5 complement(621183..622616) [1434 bp, 477 aa] {ON}
           highly similar to uniprot|P53972 Saccharomyces
           cerevisiae YNL022C
          Length = 477

 Score =  672 bits (1734), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 333/493 (67%), Positives = 403/493 (81%), Gaps = 17/493 (3%)

Query: 1   MEFYRDSTWVLEYLEGQIEKTGRVSGSLQTIVLRCCKQYRIKTNPKHIYAIVSSCWKYKP 60
           M  YRD+TWV EY+E Q E  G+++GSLQT+VL  CK+Y++KTNPKH+YAIV SCWKYKP
Sbjct: 1   MNLYRDATWVFEYVE-QEESKGKIAGSLQTLVLNSCKRYKLKTNPKHLYAIVHSCWKYKP 59

Query: 61  YLDKIMKKSGLLDAIPRKKGKPAFSKXXXXXXXXXXXXSKAKRIQMGKHPIKNYVLKYKN 120
           +L+KI+KKSG+L  IP+KKG+PAFS             SK KRIQMGKHPIK +VLK+K 
Sbjct: 60  FLEKILKKSGILKDIPKKKGQPAFSNTTILLLVHDLLLSKNKRIQMGKHPIKEFVLKHKV 119

Query: 121 ALNAEFVKLKIKLKITDLSQVVDKDDAADDMTPVRWIRINPLRISNHDTDQVLNELKKKF 180
            L AE  KLK+KL++T+LSQ+V KDD+ +DMTPVRWIRINP+R  N   D V  EL+KKF
Sbjct: 120 RLQAELAKLKVKLRVTNLSQLV-KDDS-NDMTPVRWIRINPVR-CNGKVDDVKGELQKKF 176

Query: 181 PTRVNTWKDIIPGSIYYDEFIPNLYGIHISDKITSHELYKQGKIIIQDRASCFPAHILNP 240
           PT+V+ W +I+PG+IY+DEFIPNL+G+H +DKITSHELYK+GKIIIQDRASCFPAHILNP
Sbjct: 177 PTKVSNWSEIVPGTIYHDEFIPNLFGVHPADKITSHELYKRGKIIIQDRASCFPAHILNP 236

Query: 241 SADDVVIDACSAPGNKTTHVAAHIFGDPE-NPRNDNVQIYAFEKDPERAQILQKMIKTAG 299
           + +DV+ID+CSAPGNKTTHVAAH+F DPE  P+    QI+AFEKDPERA+ LQKMI+ AG
Sbjct: 237 TPEDVIIDSCSAPGNKTTHVAAHMF-DPEFVPKQK--QIHAFEKDPERAKTLQKMIQVAG 293

Query: 300 CHKNIDVNVGDFTQIATPSKYSDVTGFILDPSCSGSGIFGRKSVDILNNHGKKSNDEVPD 359
           C K+I+V+VGDFT++A P K+S VTGFI+DPSCSGSGIFGRK +D  NN     N+ +P+
Sbjct: 294 CDKSIEVHVGDFTKLAKPDKFSQVTGFIVDPSCSGSGIFGRKIIDDTNN----KNEVLPE 349

Query: 360 ENDAEETTDSKNEQLKERLSKLASFQFQIVRHAMSFPNAKKIVYSTCSIHAEENERVVID 419
           E   +E  D   + LK RL+KL+SFQFQI++HAMSFPNAKK+VYSTCSIHAEENERVVID
Sbjct: 350 EEQEKEEMD---QDLKTRLTKLSSFQFQILKHAMSFPNAKKLVYSTCSIHAEENERVVID 406

Query: 420 LLLDKKVQSWGWRVAKKELVLPTWYRRGFKEEFQEVFTDKTEQECQELADGCVRALPKED 479
           LLLD KVQ WGWRV K+  V+PTW RRGF EEFQ+V+ DK  Q+ QELADGC+RALPKED
Sbjct: 407 LLLDDKVQQWGWRVRKRAGVIPTWSRRGFVEEFQQVYQDK--QQAQELADGCIRALPKED 464

Query: 480 GGIGFFAVCFVRD 492
           GGIGFFAVCF RD
Sbjct: 465 GGIGFFAVCFERD 477

>Skud_14.307 Chr14 complement(562104..563576) [1473 bp, 490 aa] {ON}
           YNL022C (REAL)
          Length = 490

 Score =  669 bits (1725), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 324/495 (65%), Positives = 395/495 (79%), Gaps = 10/495 (2%)

Query: 1   MEFYRDSTWVLEYLEGQIEKTGRVSGSLQTIVLRCCKQYRIKTNPKHIYAIVSSCWKYKP 60
           M FYRD+TWVLE +E +  K  R+SGS+QT+VLR CK+Y++K+NPKHIYA++ SCWKYKP
Sbjct: 1   MNFYRDATWVLEDIEKEAAKE-RISGSMQTLVLRSCKKYKLKSNPKHIYAVLDSCWKYKP 59

Query: 61  YLDKIMKKSGLLDAIPRKKGKPAFSKXXXXXXXXXXXXSKAKRIQMGKHPIKNYVLKYKN 120
           YL+K+MKK+ +L+ IP+KKGKP FS+            SK KRIQMGKHPIK+YVLK+K+
Sbjct: 60  YLEKVMKKARILEDIPKKKGKPLFSRLTLLLLCHDLLLSKQKRIQMGKHPIKDYVLKFKS 119

Query: 121 ALNAEFVKLKIKLKITDLSQVVDKDDAADDMTPVRWIRINPLRI-SNHDTDQVLNELKKK 179
            L++E VKLK+KLK+ DLS+VV  +D  +D+ PVRWIRINPL+   N DT+ VL EL+KK
Sbjct: 120 PLHSEMVKLKLKLKVRDLSEVVLSEDITNDLPPVRWIRINPLKCHPNGDTEPVLAELRKK 179

Query: 180 FPTRVNTWKDIIPGSIYYDEFIPNLYGIHISDKITSHELYKQGKIIIQDRASCFPAHILN 239
           F  +VN W D++PGSIYYDE+IPNL+GIH +DKIT+HELYK GKIIIQDRASCFPAHIL+
Sbjct: 180 FTLKVNKWSDLVPGSIYYDEYIPNLFGIHPTDKITAHELYKHGKIIIQDRASCFPAHILH 239

Query: 240 PSADDVVIDACSAPGNKTTHVAAHIFGDPENPRNDNVQIYAFEKDPERAQILQKMIKTAG 299
           P ADD+VIDACSAPGNKTTH A++I   P  P+++ ++IYAFEKDPERA+ILQKM+K AG
Sbjct: 240 PGADDIVIDACSAPGNKTTHTASYICSGP--PKDNIIRIYAFEKDPERAKILQKMVKVAG 297

Query: 300 CHKNIDVNVGDFTQIATPSKYSDVTGFILDPSCSGSGIFGRKSVDILNNHGKKSNDEVPD 359
           C  NIDV VGDFT++ATP K    TGFI+DPSCSGSGIFGRK  D LN   K+  DE  D
Sbjct: 298 CSSNIDVKVGDFTKLATPDKCKGATGFIVDPSCSGSGIFGRKFFDSLN---KRKMDEKDD 354

Query: 360 ENDA---EETTDSKNEQLKERLSKLASFQFQIVRHAMSFPNAKKIVYSTCSIHAEENERV 416
           +ND    E+      E+L+ RL+KL+SFQFQ+V+HAMSFP AKKIVYSTCSIHAEENERV
Sbjct: 355 DNDVIPDEQEEFMAKEELQTRLAKLSSFQFQMVKHAMSFPAAKKIVYSTCSIHAEENERV 414

Query: 417 VIDLLLDKKVQSWGWRVAKKELVLPTWYRRGFKEEFQEVFTDKTEQECQELADGCVRALP 476
           VIDLLLDK VQ WGW+VA +  V+P+W RRG  EEF EVF D T    ++LA+GC+RALP
Sbjct: 415 VIDLLLDKAVQEWGWKVAPRTEVIPSWPRRGKVEEFGEVFRDGTAHNPRQLAEGCIRALP 474

Query: 477 KEDGGIGFFAVCFVR 491
           KEDGGIGFFAVCF R
Sbjct: 475 KEDGGIGFFAVCFER 489

>Kpol_1003.38 s1003 (94479..95969) [1491 bp, 496 aa] {ON}
           (94479..95969) [1491 nt, 497 aa]
          Length = 496

 Score =  668 bits (1724), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 328/502 (65%), Positives = 399/502 (79%), Gaps = 16/502 (3%)

Query: 1   MEFYRDSTWVLEYLEGQIEKTGRVSGSLQTIVLRCCKQYRIKTNPKHIYAIVSSCWKYKP 60
           M+FYRDSTWVLEYLE +  K  ++SGSLQ +VL+ CK+Y++K+NP+H+YA VSSCWK KP
Sbjct: 1   MDFYRDSTWVLEYLEKENAKD-KISGSLQGLVLKSCKKYKVKSNPRHVYAAVSSCWKVKP 59

Query: 61  YLDKIMKKSGLLDAIPRKKGKPAFSKXXXXXXXXXXXXSKAKRIQMGKHPIKNYVLKYKN 120
           YL+K+MK+SG+LD IP KKGKP F +            SK+KRIQMGKHPIK Y+LKYK 
Sbjct: 60  YLEKVMKRSGILDDIPNKKGKPQFERLTLLLLCHDLLLSKSKRIQMGKHPIKTYILKYKT 119

Query: 121 ALNAEFVKLKIKLKITDLSQVVDKDDAADDMTPVRWIRINPLRIS-NHDTDQVLNELKKK 179
            L++E VKLK+KLK+ DLS++++ +++ DD+TPVRWIRINP+R   +   + ++NEL KK
Sbjct: 120 RLHSELVKLKLKLKVRDLSELIEDENSNDDITPVRWIRINPIRAQYDKGLEPIMNELNKK 179

Query: 180 FPTRVNTWKDIIPGSIYYDEFIPNLYGIHISDKITSHELYKQGKIIIQDRASCFPAHILN 239
           FPTRVN W DI+PG+IY+D++IPNL+G+H  DKITSHELYK GK+IIQDRASCFPAHILN
Sbjct: 180 FPTRVNHWSDIVPGTIYHDDYIPNLFGVHTKDKITSHELYKTGKVIIQDRASCFPAHILN 239

Query: 240 PSADDVVIDACSAPGNKTTHVAAHIFGDPENPRNDNVQIYAFEKDPERAQILQKMIKTAG 299
           P  +D+VIDAC+APGNKTTH A++I G P+  ++   QIYAFEKDPERA+ILQ MIK AG
Sbjct: 240 PGKNDIVIDACAAPGNKTTHTASYILGGPK--KDQTTQIYAFEKDPERAKILQHMIKVAG 297

Query: 300 CHKNIDVNVGDFTQIATPSKYSDVTGFILDPSCSGSGIFGRKSVDILN---------NHG 350
           C   I VNVGDFT+IATP K+ +VTGFI+DPSCSGSGIFGRK VD +N         N  
Sbjct: 298 CSNTIQVNVGDFTKIATPEKFRNVTGFIVDPSCSGSGIFGRKYVDSINKKKQESSGDNGN 357

Query: 351 KKSNDEVPDENDAEETTDSKNEQLKERLSKLASFQFQIVRHAMSFPNAKKIVYSTCSIHA 410
           +   D VPDE   EE  D K + LK RLSKLASFQFQ+V+HAMSFP AKKIVYSTCSIHA
Sbjct: 358 QDDEDAVPDEQ--EEEFDLKRDDLKTRLSKLASFQFQVVKHAMSFPKAKKIVYSTCSIHA 415

Query: 411 EENERVVIDLLLDKKVQSWGWRVAKKELVLPTWYRRGFKEEFQEVFTDKTEQECQELADG 470
           EENE VVIDLLLDKKVQ WGW+VA +  V+PTW RRGF+ EF +VF D+ E+ CQELADG
Sbjct: 416 EENEGVVIDLLLDKKVQEWGWKVAPRSEVIPTWPRRGFQAEFSKVFRDEDEK-CQELADG 474

Query: 471 CVRALPKEDGGIGFFAVCFVRD 492
           C+R LPKEDGGIGFFAVCF R+
Sbjct: 475 CIRVLPKEDGGIGFFAVCFERN 496

>Suva_14.325 Chr14 complement(574309..575781) [1473 bp, 490 aa] {ON}
           YNL022C (REAL)
          Length = 490

 Score =  665 bits (1717), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 317/492 (64%), Positives = 395/492 (80%), Gaps = 4/492 (0%)

Query: 1   MEFYRDSTWVLEYLEGQIEKTGRVSGSLQTIVLRCCKQYRIKTNPKHIYAIVSSCWKYKP 60
           M FYRD+TWVLE +E +  K  R+SGS+QT+VL+ CK+Y++K+NPKHIYA++ SCWKYKP
Sbjct: 1   MNFYRDATWVLEDIEKEAAKV-RISGSMQTLVLKSCKRYKLKSNPKHIYAVLDSCWKYKP 59

Query: 61  YLDKIMKKSGLLDAIPRKKGKPAFSKXXXXXXXXXXXXSKAKRIQMGKHPIKNYVLKYKN 120
           YL+K+MKK+ +L+ IP+KKGKP F++            SK KRIQMGKHPIK YVLK+K+
Sbjct: 60  YLEKVMKKARILEEIPKKKGKPLFARLTLLLLCHDLLLSKQKRIQMGKHPIKEYVLKFKS 119

Query: 121 ALNAEFVKLKIKLKITDLSQVVDKDDAADDMTPVRWIRINPLRI-SNHDTDQVLNELKKK 179
            L++E VKLK+KLK+ DLS++V  +D  +D+ PVRWIRINPL+   + +T+ VL ELKKK
Sbjct: 120 PLHSEMVKLKLKLKVRDLSELVLSEDIVNDLPPVRWIRINPLKCHPDGNTEPVLAELKKK 179

Query: 180 FPTRVNTWKDIIPGSIYYDEFIPNLYGIHISDKITSHELYKQGKIIIQDRASCFPAHILN 239
           F  +V+ W +++PGSIY+DE+IPNL+GIH +DKIT+HELYK GKIIIQDRASCFPAHIL+
Sbjct: 180 FTQKVDNWSELVPGSIYHDEYIPNLFGIHPTDKITAHELYKHGKIIIQDRASCFPAHILH 239

Query: 240 PSADDVVIDACSAPGNKTTHVAAHIFGDPENPRNDNVQIYAFEKDPERAQILQKMIKTAG 299
           P ++D+VIDACSAPGNKTTH A++IF +P  P++  +QIYAFEKDPERA+ILQKMIK AG
Sbjct: 240 PGSNDIVIDACSAPGNKTTHTASYIFSEP--PKDKKIQIYAFEKDPERAKILQKMIKVAG 297

Query: 300 CHKNIDVNVGDFTQIATPSKYSDVTGFILDPSCSGSGIFGRKSVDILNNHGKKSNDEVPD 359
           C  NIDVNVGDFT++ATP K   VTGFI+DPSCSGSGIFGRK  D LN       D+  D
Sbjct: 298 CSANIDVNVGDFTKLATPEKCKGVTGFIVDPSCSGSGIFGRKFFDSLNRRKIDEKDDEDD 357

Query: 360 ENDAEETTDSKNEQLKERLSKLASFQFQIVRHAMSFPNAKKIVYSTCSIHAEENERVVID 419
               E+      E+L+ RL+KL+SFQFQ+V+HAMSFP AKKIVYSTCSIHAEENERVVID
Sbjct: 358 AVPDEQEEFMAKEELQTRLAKLSSFQFQMVKHAMSFPGAKKIVYSTCSIHAEENERVVID 417

Query: 420 LLLDKKVQSWGWRVAKKELVLPTWYRRGFKEEFQEVFTDKTEQECQELADGCVRALPKED 479
           LLLDK VQ WGW+VA +  V+P+W RRG  EEF+EVF D +  + Q+LA+GC+RALPKED
Sbjct: 418 LLLDKAVQEWGWKVASRTEVVPSWPRRGKVEEFEEVFRDGSAHDPQQLAEGCIRALPKED 477

Query: 480 GGIGFFAVCFVR 491
           GGIGFFAVCFVR
Sbjct: 478 GGIGFFAVCFVR 489

>KLLA0E08361g Chr5 complement(751889..753364) [1476 bp, 491 aa] {ON}
           similar to uniprot|P53972 Saccharomyces cerevisiae
           YNL022C
          Length = 491

 Score =  663 bits (1711), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 316/497 (63%), Positives = 394/497 (79%), Gaps = 11/497 (2%)

Query: 1   MEFYRDSTWVLEYLEGQIEKTGRVSGSLQTIVLRCCKQYRIKTNPKHIYAIVSSCWKYKP 60
           MEFYRD+TWVLE++E ++ K  RV+GSLQT+VL  CK+Y++KTNP+HIYAIVSS W+Y+ 
Sbjct: 1   MEFYRDATWVLEFVEQELSKDKRVAGSLQTLVLTSCKRYKLKTNPRHIYAIVSSTWQYRE 60

Query: 61  YLDKIMKKSGLLDAIPRKKGKPAFSKXXXXXXXXXXXXSKAKRIQMGKHPIKNYVLKYKN 120
           YLDKI+KKSG+L+ +P+KKGKP F+K            SK+KRIQMGKHPIK ++LK++ 
Sbjct: 61  YLDKIIKKSGILEDVPKKKGKPLFNKDTIRLLVHDLLLSKSKRIQMGKHPIKTFILKHQT 120

Query: 121 ALNAEFVKLKIKLKITDLSQVVDKDDAADDMTPVRWIRINPLRISNHDTDQVLNELKKKF 180
            L AE  KLK+KLK+T LSQ++  DD  +D+TPVRWIRINP+ +     D VL EL KKF
Sbjct: 121 RLKAELTKLKVKLKVTSLSQLIKTDD-GEDVTPVRWIRINPILVKER-YDDVLAELNKKF 178

Query: 181 PTRVNTWKDIIPGSIYYDEFIPNLYGIHISDKITSHELYKQGKIIIQDRASCFPAHILNP 240
           P RVN+WK I+PGSIYYDE+IPNL+GIH  DKITSHE YK+GKIIIQDRASCFPAHILNP
Sbjct: 179 PQRVNSWKQIVPGSIYYDEYIPNLFGIHPGDKITSHEQYKRGKIIIQDRASCFPAHILNP 238

Query: 241 SADDVVIDACSAPGNKTTHVAAHIFGDPENPRNDNVQIYAFEKDPERAQILQKMIKTAGC 300
           ++ DVVIDAC+APGNKTTHVAAHIFGD +  + D+V+I+AFEKDPERA+ LQ M+ TAGC
Sbjct: 239 NSTDVVIDACAAPGNKTTHVAAHIFGDVDT-KVDSVKIHAFEKDPERAKTLQMMVATAGC 297

Query: 301 HKNIDVNVGDFTQIATPSKYSDVTGFILDPSCSGSGIFGRKSVDILNNHGKKSNDEVPDE 360
            K + ++VGDFT++  P  + +VTGFI+DPSCSGSGIFGRK++D +N     S++   D+
Sbjct: 298 AKGVKIHVGDFTKLGKPELFQNVTGFIVDPSCSGSGIFGRKAIDKVNLSKTGSSNTDEDQ 357

Query: 361 NDAEETTD-----SKNEQLKERLSKLASFQFQIVRHAMSFPNAKKIVYSTCSIHAEENER 415
              E          K + LK RL+KL+SFQ+QIV+HAMSFP+AKKI YSTCSIHAEENER
Sbjct: 358 TSVEPVEQEKELFEKEQDLKNRLAKLSSFQYQIVKHAMSFPSAKKICYSTCSIHAEENER 417

Query: 416 VVIDLLLDKKVQSWGWRVAKKELVLPTWYRRGFKEEFQEVFTDKTEQECQELADGCVRAL 475
           VVIDLLLD KV+ WGW+V K+  V+PTW RRG+  EF+EVF    ++E +ELA+GC+RAL
Sbjct: 418 VVIDLLLDSKVKEWGWKVRKRTGVIPTWPRRGWTSEFEEVF---PKEEAKELAEGCIRAL 474

Query: 476 PKEDGGIGFFAVCFVRD 492
           PKEDGGIGFFAVCF RD
Sbjct: 475 PKEDGGIGFFAVCFERD 491

>YNL022C Chr14 complement(591427..592899) [1473 bp, 490 aa] {ON}
           Putative cytosine 5-methyltransferase, contains seven
           beta-strand methyltransferase motif similar to
           NOP2/YNL061W; green fluorescent protein (GFP)-fusion
           protein localizes to the nucleus; predicted to be
           involved in ribosome biogenesis
          Length = 490

 Score =  662 bits (1707), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 320/497 (64%), Positives = 395/497 (79%), Gaps = 12/497 (2%)

Query: 1   MEFYRDSTWVLEYLEGQIEKTGRVSGSLQTIVLRCCKQYRIKTNPKHIYAIVSSCWKYKP 60
           M FYRD+TWVLE +E +  K  R+SGS+QT+VL+ CK+Y++K+NPKHIYA++ SCWKYKP
Sbjct: 1   MNFYRDATWVLEDIEKEAAKE-RISGSMQTLVLKSCKRYKLKSNPKHIYAVLDSCWKYKP 59

Query: 61  YLDKIMKKSGLLDAIPRKKGKPAFSKXXXXXXXXXXXXSKAKRIQMGKHPIKNYVLKYKN 120
           YL+K+MKK+ +L+ IP+KKGKP FS+            SK KRIQMGKHPIK+YVLK+K+
Sbjct: 60  YLEKVMKKAHILEDIPKKKGKPLFSRLTLLLLCHDLLLSKQKRIQMGKHPIKDYVLKFKS 119

Query: 121 ALNAEFVKLKIKLKITDLSQVVDKDDAADDMTPVRWIRINPLRI-SNHDTDQVLNELKKK 179
            L++E VKLK+KLK+ +LS++V  +D ++D+ PVRWIRINPL+   N +T+ VL EL+KK
Sbjct: 120 PLHSEMVKLKLKLKVRELSELVLSEDISNDLPPVRWIRINPLKCHPNGETEPVLAELRKK 179

Query: 180 FPTRVNTWKDIIPGSIYYDEFIPNLYGIHISDKITSHELYKQGKIIIQDRASCFPAHILN 239
           F  +V+ W +++PGSIYYDEFIPNL+GIH SDKIT+HELYK GKIIIQDRASCFPAHILN
Sbjct: 180 FTLKVDKWSELVPGSIYYDEFIPNLFGIHPSDKITAHELYKHGKIIIQDRASCFPAHILN 239

Query: 240 PSADDVVIDACSAPGNKTTHVAAHIFGDPENPRNDNVQIYAFEKDPERAQILQKMIKTAG 299
           P   D+VID+CSAPGNKTTH A++I+  PE P+++N +IYAFEKDPERA++LQKMIK AG
Sbjct: 240 PGPSDIVIDSCSAPGNKTTHTASYIY--PEPPKDNNTRIYAFEKDPERAKVLQKMIKIAG 297

Query: 300 CHKNIDVNVGDFTQIATPSKYSDVTGFILDPSCSGSGIFGRKSVDILN----NHGKKSND 355
           C  NI VNVGDFT++ATP KY DVT FI+DPSCSGSGIFGRK  D  N    +       
Sbjct: 298 CSPNISVNVGDFTKLATPEKYKDVTCFIVDPSCSGSGIFGRKFFDSFNRRKIDDKDDDGG 357

Query: 356 EVPDENDAEETTDSKNEQLKERLSKLASFQFQIVRHAMSFPNAKKIVYSTCSIHAEENER 415
            VPDE   EE      E+L+ RL+KL+SFQFQ+V+HAMSFP AKKIVYSTCSIHAEENER
Sbjct: 358 IVPDEQ--EEFI--AKEELQTRLAKLSSFQFQMVKHAMSFPAAKKIVYSTCSIHAEENER 413

Query: 416 VVIDLLLDKKVQSWGWRVAKKELVLPTWYRRGFKEEFQEVFTDKTEQECQELADGCVRAL 475
           VVIDLLLDK V+ WGW+VA K  V+P+W RRG  EEF+EVF D    + Q+LA+GC+RAL
Sbjct: 414 VVIDLLLDKSVREWGWKVAPKREVIPSWPRRGKVEEFEEVFRDGVTYDPQQLAEGCIRAL 473

Query: 476 PKEDGGIGFFAVCFVRD 492
           PK DGGIGFFAVCF RD
Sbjct: 474 PKSDGGIGFFAVCFERD 490

>KNAG0H02000 Chr8 complement(353074..354570) [1497 bp, 498 aa] {ON}
           Anc_2.286 YNL022C
          Length = 498

 Score =  660 bits (1704), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 320/503 (63%), Positives = 394/503 (78%), Gaps = 19/503 (3%)

Query: 1   MEFYRDSTWVLEYLEGQIEKTGRVSGSLQTIVLRCCKQYRIKTNPKHIYAIVSSCWKYKP 60
           M+FYRD+TWVLE +E Q  K G++SGSLQT+VL  CK++++KTNPKHIYA+VSSCW+YKP
Sbjct: 1   MDFYRDATWVLESIENQDAK-GKLSGSLQTLVLNSCKRFKVKTNPKHIYAVVSSCWRYKP 59

Query: 61  YLDKIMKKSGLLDAIPRKKGKPAFSKXXXXXXXXXXXXSKAKRIQMGKHPIKNYVLKYKN 120
           +L+K+MKKS +LD +P+KKG P F +            SK+KRIQMGKHPIK +VLKYK 
Sbjct: 60  FLEKVMKKSKILDEVPQKKGAPVFQRLTLLLLCHDLLLSKSKRIQMGKHPIKMFVLKYKT 119

Query: 121 ALNAEFVKLKIKLKITDLSQVVDKDDAADDMTPVRWIRINPLRISNHDTDQ-VLNELKKK 179
            LNAE  K+K+KLK+ DLSQ+ D DD  +D+TPVRW R+NPLR +     Q V+ EL+KK
Sbjct: 120 RLNAELAKMKVKLKVKDLSQLTDSDDLTNDITPVRWFRVNPLRCTAEKPVQSVVTELRKK 179

Query: 180 FPTRVNTWKDIIPGSIYYDEFIPNLYGIHISDKITSHELYKQGKIIIQDRASCFPAHILN 239
           F  +V++WKD++PGSIYYDE+IPNL+ +H  DKITSHELYKQGKIIIQDRASCFPAHILN
Sbjct: 180 FTEKVDSWKDVVPGSIYYDEYIPNLFCVHPQDKITSHELYKQGKIIIQDRASCFPAHILN 239

Query: 240 PSADDVVIDACSAPGNKTTHVAAHIFGDPENPRNDNVQIYAFEKDPERAQILQKMIKTAG 299
           P +DD+VIDAC+APGNKTTH+AAH+F D        VQIYAFEKDPERAQ+L KMIK AG
Sbjct: 240 PKSDDIVIDACAAPGNKTTHLAAHMFQDKTADEKPKVQIYAFEKDPERAQVLNKMIKIAG 299

Query: 300 CHKNIDVNVGDFTQIATPSKYSDVTGFILDPSCSGSGIFGRKSVDILNNHGKKSN----- 354
           C K I+V VGDFT++ATP    +V G I+DPSCSGSGIFGRK +D +N+  KK++     
Sbjct: 300 CSKEIEVIVGDFTKLATPQACPNVNGLIVDPSCSGSGIFGRKYIDSINH--KKTDEEKEE 357

Query: 355 -----DEVPDENDAEETTDSKNEQLKERLSKLASFQFQIVRHAMSFPNAKKIVYSTCSIH 409
                D VP+E + +E  D+    LK RLSKL+SFQFQIV++A+SFP A K+VYSTCSIH
Sbjct: 358 EERELDAVPEEQEEQELDDN----LKTRLSKLSSFQFQIVKYALSFPQATKVVYSTCSIH 413

Query: 410 AEENERVVIDLLLDKKVQSWGWRVAKKELVLPTWYRRGFKEEFQEVFTDKTEQE-CQELA 468
           AEENERVVIDLLLDKKV+  GWRVA +  V+PTW RRG  +EFQ+VF + +E   CQE+A
Sbjct: 414 AEENERVVIDLLLDKKVKESGWRVAPRSKVIPTWERRGLVDEFQQVFREDSESSNCQEMA 473

Query: 469 DGCVRALPKEDGGIGFFAVCFVR 491
           DGC+RALP+EDGGIGFFAVCF R
Sbjct: 474 DGCIRALPREDGGIGFFAVCFER 496

>TPHA0C03400 Chr3 (747016..748500) [1485 bp, 494 aa] {ON} Anc_2.286
           YNL022C
          Length = 494

 Score =  656 bits (1692), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 310/500 (62%), Positives = 395/500 (79%), Gaps = 15/500 (3%)

Query: 1   MEFYRDSTWVLEYLEGQIEKTGRVSGSLQTIVLRCCKQYRIKTNPKHIYAIVSSCWKYKP 60
           M FYRD+TWVLE+LE +  K G++SGS+Q+IVL+ CK Y++++NPKHIYA+++SCWKYKP
Sbjct: 1   MNFYRDATWVLEFLEKEDAK-GKISGSMQSIVLKSCKIYKVQSNPKHIYAVMASCWKYKP 59

Query: 61  YLDKIMKKSGLLDAIPRKKGKPAFSKXXXXXXXXXXXXSKAKRIQMGKHPIKNYVLKYKN 120
           YL+ IMKKSG+L+ IP+K GKP F +            SK+KRIQMGKHP+K YVLKYK 
Sbjct: 60  YLETIMKKSGILNNIPKKNGKPRFERLTILLLCHDLLFSKSKRIQMGKHPLKEYVLKYKT 119

Query: 121 ALNAEFVKLKIKLKITDLSQVVDKDDAADDMTPVRWIRINPLRIS-NHDTDQVLNELKKK 179
           +L +E VKL++K+K+     ++   D A+D+TPVRW RINP+R   +   + +L EL+KK
Sbjct: 120 SLRSEMVKLQVKMKLKSWGDLISSQDDANDITPVRWFRINPIRTPLSKGVEGILEELEKK 179

Query: 180 FPTRVNTWKDIIPGSIYYDEFIPNLYGIHISDKITSHELYKQGKIIIQDRASCFPAHILN 239
           FPTRV+ W  I  G+IY+DEFIPNL+G+H  DKITSHELYKQGKIIIQDRASCFPAH+LN
Sbjct: 180 FPTRVDHWSKIEQGTIYHDEFIPNLFGVHTKDKITSHELYKQGKIIIQDRASCFPAHVLN 239

Query: 240 PSADDVVIDACSAPGNKTTHVAAHIFGDPENPRNDNVQIYAFEKDPERAQILQKMIKTAG 299
           P  DD+VID+C+APGNKTTH AA+I G P   ++  +QI+AFEKDPERA++LQKM++TAG
Sbjct: 240 PGKDDIVIDSCAAPGNKTTHTAAYILGGPS--KDQKIQIHAFEKDPERAKVLQKMVRTAG 297

Query: 300 CHKNIDVNVGDFTQIATPSKYSDVTGFILDPSCSGSGIFGRKSVDILNNHGK-------K 352
           C + I+VNVGDFT+IATP K+ +VTGFI+DPSCSGSGIFGRK +D LN   +        
Sbjct: 298 CARTIEVNVGDFTKIATPEKFKNVTGFIVDPSCSGSGIFGRKFIDTLNKKKEGEDVDEDD 357

Query: 353 SNDEVPDENDAEETTDSKNEQLKERLSKLASFQFQIVRHAMSFPNAKKIVYSTCSIHAEE 412
            ++ +P E D E    SK + LK RLSKLASFQFQ+V+HAM+FP A+K+VYSTCSIHAEE
Sbjct: 358 ESESIPVEQDEEF---SKKDDLKTRLSKLASFQFQVVKHAMTFPKARKLVYSTCSIHAEE 414

Query: 413 NERVVIDLLLDKKVQSWGWRVAKKELVLPTWYRRGFKEEFQEVFTDKTEQECQELADGCV 472
           NERVVIDLLLD+ ++  GWRVA +E V+PTW RRG+ +EF+EVF D  E++C+E+A GC+
Sbjct: 415 NERVVIDLLLDETIKKAGWRVANREKVIPTWPRRGWVDEFKEVFRD-DEEKCKEIAGGCI 473

Query: 473 RALPKEDGGIGFFAVCFVRD 492
           RALPKEDGGIGFFAVCF RD
Sbjct: 474 RALPKEDGGIGFFAVCFERD 493

>Ecym_3325 Chr3 (623214..624704) [1491 bp, 496 aa] {ON} similar to
           Ashbya gossypii ADL215W
          Length = 496

 Score =  645 bits (1664), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 319/494 (64%), Positives = 388/494 (78%), Gaps = 13/494 (2%)

Query: 1   MEFYRDSTWVLEYLEGQIEKTGRVSGSLQTIVLRCCKQYRIKTNPKHIYAIVSSCWKYKP 60
           MEFYRDS+WVLEY+E +  K  R+SGSLQT+VLR CK+Y++KTNPKHIYAIVSSCWKYK 
Sbjct: 14  MEFYRDSSWVLEYIEQEFSKNSRISGSLQTLVLRSCKRYKLKTNPKHIYAIVSSCWKYKM 73

Query: 61  YLDKIMKKSGLLDAIPRKKGKPAFSKXXXXXXXXXXXXSKAKRIQMGKHPIKNYVLKYKN 120
           YL+KI+K SGLL  +P KKG+P FSK            SK KRI MGKHPIK +VLK + 
Sbjct: 74  YLEKIIKNSGLLADVPLKKGEPVFSKTTIMLLVHDLLLSKNKRIHMGKHPIKAFVLKRQV 133

Query: 121 ALNAEFVKLKIKLKITDLSQVVDKDDAADDMTPVRWIRINPLRISNHDTDQVLNELKKKF 180
            L+ EF K+ +KLK+  LS++V+ +DA  DM+PVRWIRINP R      D VL EL+KKF
Sbjct: 134 RLSGEFKKMLVKLKVKSLSELVEDNDA--DMSPVRWIRINPFRCQG-KVDDVLKELRKKF 190

Query: 181 PTRVNTWKDIIPGSIYYDEFIPNLYGIHISDKITSHELYKQGKIIIQDRASCFPAHILNP 240
           P +V+ W  I+PGSIY DE+IPNLYG+H SDKITSHELYK+GKIIIQDRASCFPA+ILNP
Sbjct: 191 PKQVDDWTQIVPGSIYRDEYIPNLYGVHPSDKITSHELYKRGKIIIQDRASCFPAYILNP 250

Query: 241 SADDVVIDACSAPGNKTTHVAAHIFGDPENPRNDNVQIYAFEKDPERAQILQKMIKTAGC 300
           +  DVVIDACSAPGNKTTH+AAHIF D       +V+IYAFE+D +RA+IL+KM+ +AGC
Sbjct: 251 TPHDVVIDACSAPGNKTTHIAAHIFPDGN---ASDVKIYAFERDAKRAEILEKMVTSAGC 307

Query: 301 HKNIDVNVGDFTQIATPSKYSDVTGFILDPSCSGSGIFGRKSVDILNNH--GKKSNDEVP 358
              I ++VGDFTQ+A P  + DVTGFILDPSCSGSGIFGR+SVD+ N     +K  +EV 
Sbjct: 308 ESCIQISVGDFTQLAKPQMFKDVTGFILDPSCSGSGIFGRQSVDLANKSKLAEKVPNEVF 367

Query: 359 DENDAEETTDSKNEQLKERLSKLASFQFQIVRHAMSFPNAKKIVYSTCSIHAEENERVVI 418
           +E D +E    +NE  K RL+KL+SFQFQIV+HAMSFPNAKK+VYSTCSIHAEENERVVI
Sbjct: 368 EEQDPKEM--EQNELYKTRLAKLSSFQFQIVKHAMSFPNAKKLVYSTCSIHAEENERVVI 425

Query: 419 DLLLDKKVQSWGWRVAKKELVLPTWYRRGFKEEFQEVFTDKTEQECQELADGCVRALPKE 478
           DLLLD+ ++ +GW+VAK++ V+P W RRG   EF+EVF     ++ QELADGC+RALPKE
Sbjct: 426 DLLLDQNIKQYGWKVAKRDSVIPAWQRRGILSEFEEVF---PHEQAQELADGCIRALPKE 482

Query: 479 DGGIGFFAVCFVRD 492
           DGGIGFFAVCF R+
Sbjct: 483 DGGIGFFAVCFERE 496

>KLTH0G10362g Chr7 (876756..878345) [1590 bp, 529 aa] {ON} highly
           similar to uniprot|P53972 Saccharomyces cerevisiae
           YNL022C
          Length = 529

 Score =  644 bits (1661), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 314/492 (63%), Positives = 383/492 (77%), Gaps = 9/492 (1%)

Query: 1   MEFYRDSTWVLEYLEGQIEKTGRVSGSLQTIVLRCCKQYRIKTNPKHIYAIVSSCWKYKP 60
           M FYRD+TWVLEY+E   EK GRV+GSLQT+VL  CK+Y++KTNPKHIYA V SCW+Y  
Sbjct: 47  MNFYRDATWVLEYVESA-EKGGRVAGSLQTLVLNSCKKYQLKTNPKHIYAAVYSCWRYNE 105

Query: 61  YLDKIMKKSGLLDAIPRKKGKPAFSKXXXXXXXXXXXXSKAKRIQMGKHPIKNYVLKYKN 120
           +LDK++K+SG+L  IP+KKGK  F+             SK KRIQMGKHP+K +VLKYK 
Sbjct: 106 FLDKLLKRSGILKDIPKKKGKEVFNPTTIKLLVHDLLFSKNKRIQMGKHPLKEFVLKYKA 165

Query: 121 ALNAEFVKLKIKLKITDLSQVVDKDDAADDMTPVRWIRINPLRISNHDTDQVLNELKKKF 180
            L++E V+LKIKLK+TDL Q++ KDD  +DMTPVRW R+NP+R      D +L EL KKF
Sbjct: 166 RLSSELVRLKIKLKVTDLQQLL-KDDR-NDMTPVRWFRLNPIRCGAKSED-ILQELSKKF 222

Query: 181 PTRVNTWKDIIPGSIYYDEFIPNLYGIHISDKITSHELYKQGKIIIQDRASCFPAHILNP 240
           PTRVN+W +I PG IY+DE+IP L+G+H +DKITSHELYK GK+IIQDRASCFPAHILN 
Sbjct: 223 PTRVNSWTNIAPGCIYHDEYIPGLFGVHPADKITSHELYKTGKVIIQDRASCFPAHILNA 282

Query: 241 SADDVVIDACSAPGNKTTHVAAHIFGDPENPRNDNVQIYAFEKDPERAQILQKMIKTAGC 300
           S++D++IDAC+APGNKTTHVAAHIF D      ++V+I+AFEKDPERA+ L+ MI TAGC
Sbjct: 283 SSEDLIIDACAAPGNKTTHVAAHIFQDQAV---ESVRIHAFEKDPERAKTLRTMINTAGC 339

Query: 301 HKNIDVNVGDFTQIATPSKYSDVTGFILDPSCSGSGIFGRKSVDILNNHGKKSNDEVPDE 360
            K I+V+VGDFTQ+A P K+ DVTGFILDPSCSGSGIFGRK +D  N         V +E
Sbjct: 340 TKGIEVHVGDFTQLAKPGKFPDVTGFILDPSCSGSGIFGRKMIDDRNKSKADGASPVEEE 399

Query: 361 NDAEETTDSKNEQLKERLSKLASFQFQIVRHAMSFPNAKKIVYSTCSIHAEENERVVIDL 420
              EE  D  ++ LK RL KLASFQF+IV+HAMSFP+AKK+VYSTCS+HAEENER+V+DL
Sbjct: 400 EKEEEREDISDKDLKNRLEKLASFQFEIVKHAMSFPSAKKLVYSTCSVHAEENERIVVDL 459

Query: 421 LLDKKVQSWGWRVAKKELVLPTWYRRGFKEEFQEVFTDKTEQECQELADGCVRALPKEDG 480
           LLD KV+ WGWRV K+  V+PTW RRGF +EF+EVF D  E   +ELA+ C+R  PKEDG
Sbjct: 460 LLDSKVKEWGWRVRKRAGVIPTWSRRGFYKEFEEVFRD--EDTAKELAEACIRVAPKEDG 517

Query: 481 GIGFFAVCFVRD 492
           GIGFFAVCF RD
Sbjct: 518 GIGFFAVCFERD 529

>Smik_14.309 Chr14 complement(553805..555277) [1473 bp, 490 aa] {ON}
           YNL022C (REAL)
          Length = 490

 Score =  639 bits (1648), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 317/496 (63%), Positives = 391/496 (78%), Gaps = 12/496 (2%)

Query: 1   MEFYRDSTWVLEYLEGQIEKTGRVSGSLQTIVLRCCKQYRIKTNPKHIYAIVSSCWKYKP 60
           M FYRD+TWVLE +E +  K  R+SGS+QT+VL+ CK+Y++K+NPKH+YA++ SCWKYKP
Sbjct: 1   MNFYRDATWVLEDIEKEAAKE-RISGSMQTLVLKSCKRYKLKSNPKHVYAVLDSCWKYKP 59

Query: 61  YLDKIMKKSGLLDAIPRKKGKPAFSKXXXXXXXXXXXXSKAKRIQMGKHPIKNYVLKYKN 120
           YL+K+MKK+ +L+ IP+KKGKP FS+            SK KRIQMGKHPIK+YVLK+K+
Sbjct: 60  YLEKVMKKARILEDIPKKKGKPLFSRLTLLLLCHDLLISKQKRIQMGKHPIKDYVLKFKS 119

Query: 121 ALNAEFVKLKIKLKITDLSQVVDKDDAADDMTPVRWIRINPLRI-SNHDTDQVLNELKKK 179
            L++E VKLK+KLK+ +LS++V  +D A+D+ PVRWIRINPL+   N  T+ VL EL+KK
Sbjct: 120 PLHSEMVKLKLKLKVRNLSELVLSEDIANDLPPVRWIRINPLKCYPNGKTEPVLAELRKK 179

Query: 180 FPTRVNTWKDIIPGSIYYDEFIPNLYGIHISDKITSHELYKQGKIIIQDRASCFPAHILN 239
           F  +V  W +++P SIYYDE+IPNL+GIH SDKIT+HELYK GKIIIQDRASCFPAHILN
Sbjct: 180 FTLKVEKWSELVPESIYYDEYIPNLFGIHPSDKITAHELYKNGKIIIQDRASCFPAHILN 239

Query: 240 PSADDVVIDACSAPGNKTTHVAAHIFGDPENPRNDNVQIYAFEKDPERAQILQKMIKTAG 299
           P  +D+VIDACSAPGNKTTH A++I  +P  P++   +IYAFEKDPERA+ILQKMIK AG
Sbjct: 240 PGPNDIVIDACSAPGNKTTHTASYICSEP--PKDSRTRIYAFEKDPERAKILQKMIKIAG 297

Query: 300 CHKNIDVNVGDFTQIATPSKYSDVTGFILDPSCSGSGIFGRKSVDILNNHGKKSNDE--- 356
           C  NIDV+VGDFT++ATP K+ D TGFI+DPSCSGSGIFGRK  D LN       D+   
Sbjct: 298 CSSNIDVSVGDFTKLATPEKFKDATGFIVDPSCSGSGIFGRKFFDSLNRKKMDDKDDDND 357

Query: 357 -VPDENDAEETTDSKNEQLKERLSKLASFQFQIVRHAMSFPNAKKIVYSTCSIHAEENER 415
            VPDE +         E+L+ RL+KL+SFQFQ+V+HAMSFP AKKIVYSTCSIHAEENER
Sbjct: 358 IVPDEQEEFMA----KEELQTRLAKLSSFQFQMVKHAMSFPVAKKIVYSTCSIHAEENER 413

Query: 416 VVIDLLLDKKVQSWGWRVAKKELVLPTWYRRGFKEEFQEVFTDKTEQECQELADGCVRAL 475
           VVIDLLLDK VQ WGWRVA +  V+P W RRG  EEF+EVF +    + QELA+GC+RAL
Sbjct: 414 VVIDLLLDKAVQEWGWRVAPRSEVIPFWPRRGKVEEFEEVFREGAAHDPQELAEGCIRAL 473

Query: 476 PKEDGGIGFFAVCFVR 491
           PK+DGGIGFFAVCF R
Sbjct: 474 PKDDGGIGFFAVCFER 489

>TDEL0G02170 Chr7 (427274..428728) [1455 bp, 484 aa] {ON} Anc_2.286
           YNL022C
          Length = 484

 Score =  632 bits (1631), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 313/493 (63%), Positives = 388/493 (78%), Gaps = 11/493 (2%)

Query: 1   MEFYRDSTWVLEYLEGQIEKTGRVSGSLQTIVLRCCKQYRIKTNPKHIYAIVSSCWKYKP 60
           M FYRD+TWVLEY+E + EK GR+SGS+QT+VL+ C++Y++K++PKH+YA+V SCW+YK 
Sbjct: 1   MNFYRDATWVLEYVEQEDEK-GRLSGSMQTLVLKSCQRYKLKSDPKHLYAVVDSCWRYKA 59

Query: 61  YLDKIMKKSGLLDAIPRKKGKPAFSKXXXXXXXXXXXXSKAKRIQMGKHPIKNYVLKYKN 120
            L+KIMK+S + D IP+KKGKP +S+            SK KRIQMGK PIK YVLK+K 
Sbjct: 60  LLEKIMKRSKIYDDIPKKKGKPIYSRLTLLLMCHDLLISKQKRIQMGKLPIKEYVLKHKT 119

Query: 121 ALNAEFVKLKIKLKITDLSQVVDKDDAADDMTPVRWIRINPLRISNHDTDQVLNELKKKF 180
            LN+E VKLK+KLK+  LS++VDK+D+++D+TPVRWIRINPLR   +D + VL EL KKF
Sbjct: 120 RLNSELVKLKLKLKVKSLSEIVDKEDSSNDVTPVRWIRINPLRCPKNDVEPVLKELIKKF 179

Query: 181 PTRVNTWKDIIPGSIYYDEFIPNLYGIHISDKITSHELYKQGKIIIQDRASCFPAHILNP 240
           P RV+ W DI  G++YYDEF+PNL+G+H  DKITSHELY+QGKIIIQDR+SCFPAHILNP
Sbjct: 180 PQRVSHWSDITSGTLYYDEFVPNLFGVHPRDKITSHELYRQGKIIIQDRSSCFPAHILNP 239

Query: 241 SADDVVIDACSAPGNKTTHVAAHIFGDPENPRNDNVQIYAFEKDPERAQILQKMIKTAGC 300
             +DVVIDAC+APGNKTTHVAAHI   PE  R    +IYAFEKDP RA IL+KM   AGC
Sbjct: 240 GKNDVVIDACAAPGNKTTHVAAHIL--PEYTREQTPKIYAFEKDPARANILKKMTSVAGC 297

Query: 301 HKNIDVNVGDFTQIATPSKYSDVTGFILDPSCSGSGIFGRKSVDILNNHGKK--SNDEVP 358
            + ++++VGDFT++A P+ + DVTG I+DPSCSGSGIFGRKSVD  N   KK  ++ E+P
Sbjct: 298 GQTVEIHVGDFTKLAVPANFKDVTGLIVDPSCSGSGIFGRKSVDSHNVAKKKTETDSEIP 357

Query: 359 DENDAEETTDSKNEQLKERLSKLASFQFQIVRHAMSFPNAKKIVYSTCSIHAEENERVVI 418
           DE +     D  N     RLSKLASFQFQ+V+HAMS PNAKKIVYSTCSIHAEENERVVI
Sbjct: 358 DEEEKMVGDDVAN-----RLSKLASFQFQVVKHAMSMPNAKKIVYSTCSIHAEENERVVI 412

Query: 419 DLLLDKKVQSWGWRVAKKELVLPTWYRRGFKEEFQEVFTDKTEQECQELADGCVRALPKE 478
           DLLLD+ ++ WGW+VA +E V+P W RRG  +EF++VF D   + C ELADGC+RALP+E
Sbjct: 413 DLLLDRNIKEWGWKVASREEVIPKWPRRGKVKEFEQVFRDDPVK-CNELADGCIRALPQE 471

Query: 479 DGGIGFFAVCFVR 491
           DGGIGFFAVCF R
Sbjct: 472 DGGIGFFAVCFKR 484

>NCAS0G03790 Chr7 complement(699962..701440) [1479 bp, 492 aa] {ON}
           Anc_2.286 YNL022C
          Length = 492

 Score =  628 bits (1620), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 318/499 (63%), Positives = 388/499 (77%), Gaps = 15/499 (3%)

Query: 1   MEFYRDSTWVLEYLEGQIEKTGRVSGSLQTIVLRCCKQYRIKTNPKHIYAIVSSCWKYKP 60
           MEFYRD+TWVLE++E Q +  GR+SGSLQT+V + CK+Y++K NPKH+YA++ SCWKYKP
Sbjct: 1   MEFYRDATWVLEFVE-QEDAKGRISGSLQTLVFQSCKRYKLKCNPKHVYAVLDSCWKYKP 59

Query: 61  YLDKIMKKSGLLDAIPRKKGKPAFSKXXXXXXXXXXXXSKAKRIQMGKHPIKNYVLKYKN 120
           YL+K+MKKSG+LD IP++KGKP +S+            SKAKRIQMGK PIK YVLK+K+
Sbjct: 60  YLEKVMKKSGILDEIPKRKGKPMYSRLTLMLMCHDLLFSKAKRIQMGKLPIKTYVLKHKS 119

Query: 121 ALNAEFVKLKIKLKITDLSQVVDKDDAADDMTPVRWIRINPLRISNHDTDQVLNELKKKF 180
            L++E VKLK+KLK+ +LS++V   D+ +DMTPVRWIRINPLR    D +    E++KKF
Sbjct: 120 RLHSELVKLKLKLKVKNLSELVSNADSENDMTPVRWIRINPLRC---DVEATKLEIQKKF 176

Query: 181 PTRVNTWKDIIPGSIYYDEFIPNLYGIHISDKITSHELYKQGKIIIQDRASCFPAHILNP 240
           PTRV  W DI+PGSIYYDE+IPNL+GIH  DKITSH LYKQGKIIIQDRASCFPAHIL+P
Sbjct: 177 PTRVENWSDIVPGSIYYDEYIPNLFGIHPQDKITSHNLYKQGKIIIQDRASCFPAHILHP 236

Query: 241 SADDVVIDACSAPGNKTTHVAAHIFGDPENPRNDNVQIYAFEKDPERAQILQKMIKTAGC 300
             +DVVID C+APGNKTTH A+++  +P   ++  +QIYAFEK+PERA+IL KMIK AGC
Sbjct: 237 DENDVVIDGCAAPGNKTTHTASYMIKEPS--KDPKIQIYAFEKNPERAKILDKMIKVAGC 294

Query: 301 HKNIDVNVGDFTQIATPSKYSDVTGFILDPSCSGSGIFGRKSVDILNNHGKKSNDEVPDE 360
            KNI +NVGDFT+IA P KY DVTGFI+DPSCSGSGIFGRK +D LN   K + DE   +
Sbjct: 295 SKNIKINVGDFTKIALPEKYKDVTGFIVDPSCSGSGIFGRKFIDSLNRK-KMNKDEADKK 353

Query: 361 NDAEETTD-------SKNEQLKERLSKLASFQFQIVRHAMSFPNAKKIVYSTCSIHAEEN 413
              EE          +K E LK RLSKL+SFQFQ+V+HAMSFPNAKKIVYSTCSIHAEEN
Sbjct: 354 EGDEEEEVPDEQEEYNKREDLKTRLSKLSSFQFQVVKHAMSFPNAKKIVYSTCSIHAEEN 413

Query: 414 ERVVIDLLLDKKVQSWGWRVAKKELVLPTWYRRG-FKEEFQEVFTDKTEQECQELADGCV 472
           ERVVIDL+LD KV+ WGW+VA +  V+PTW RRG  +E  +    D    +C+ELA GC+
Sbjct: 414 ERVVIDLMLDSKVKQWGWKVAPRSKVIPTWPRRGKVEEFEEVFREDGNSSKCEELAGGCI 473

Query: 473 RALPKEDGGIGFFAVCFVR 491
           RALP+ DGGIGFFAVCF R
Sbjct: 474 RALPRSDGGIGFFAVCFER 492

>Kwal_27.11532 s27 complement(837572..839011) [1440 bp, 479 aa] {ON}
           YNL022C - Non-essential protein with similarity to S.
           pombe hypothetical protein E349594 [contig 27] FULL
          Length = 479

 Score =  622 bits (1604), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 302/494 (61%), Positives = 384/494 (77%), Gaps = 17/494 (3%)

Query: 1   MEFYRDSTWVLEYLEGQIEKTGRVSGSLQTIVLRCCKQYRIKTNPKHIYAIVSSCWKYKP 60
           M FYRD+TWVLEY+E + E +GRV+GSLQT+VL  CK+Y +KTNPKH+YA V SCW+Y  
Sbjct: 1   MNFYRDATWVLEYVE-KAESSGRVAGSLQTLVLNSCKKYNLKTNPKHLYAAVYSCWRYNE 59

Query: 61  YLDKIMKKSGLLDAIPRKKGKPAFSKXXXXXXXXXXXXSKAKRIQMGKHPIKNYVLKYKN 120
           +L+K++KKS +L  +P+KKGK  F+             +K KRIQMGKHP+K +VLK+K 
Sbjct: 60  FLEKLLKKSEILKDVPKKKGKEIFNPTTIKLLVHDLLFTKNKRIQMGKHPLKEFVLKHKT 119

Query: 121 ALNAEFVKLKIKLKITDLSQVVDKDDAADDMTPVRWIRINPLRISNHDTDQVLNELKKKF 180
            LN+E V+LKIKLK+TDL Q++ KDD  +DMTPVRW RINP+R      ++V+ EL KKF
Sbjct: 120 RLNSELVRLKIKLKVTDLHQLL-KDDR-NDMTPVRWFRINPVRCHGKH-EEVMAELAKKF 176

Query: 181 PTRVNTWKDIIPGSIYYDEFIPNLYGIHISDKITSHELYKQGKIIIQDRASCFPAHILNP 240
           PTRV++WKD++PGSIY+DE+IPNL+G+H  DKITSHELYK GKIIIQDRASCFPAHILNP
Sbjct: 177 PTRVDSWKDVVPGSIYHDEYIPNLFGVHPGDKITSHELYKTGKIIIQDRASCFPAHILNP 236

Query: 241 SADDVVIDACSAPGNKTTHVAAHIFGD--PENPRNDNVQIYAFEKDPERAQILQKMIKTA 298
           S  DV+IDAC+APGNKTTHVAAH+F +  P+ P      I+AFEKDPERA+ L+ M+KTA
Sbjct: 237 SPSDVIIDACAAPGNKTTHVAAHMFLNDQPQEP-----LIHAFEKDPERAKTLRTMVKTA 291

Query: 299 GCHKNIDVNVGDFTQIATPSKYSDVTGFILDPSCSGSGIFGRKSVDILNNHGKKSNDEVP 358
           GC K I+++VGDFT++A PS + +V+GFI+DPSCSGSGIFGR+ +D  N    KS +E  
Sbjct: 292 GCSKGINIHVGDFTKLAKPSLFPNVSGFIVDPSCSGSGIFGRQIIDDHN----KSREEGA 347

Query: 359 DENDAEETTDSKNEQLKERLSKLASFQFQIVRHAMSFPNAKKIVYSTCSIHAEENERVVI 418
                EE  + + + +K RL+KLASFQF+IV++A+SFP+AKK+VYSTCSIHAEENER+VI
Sbjct: 348 LPTQEEERQEIEGKDIKNRLAKLASFQFEIVKYALSFPSAKKLVYSTCSIHAEENERIVI 407

Query: 419 DLLLDKKVQSWGWRVAKKELVLPTWYRRGFKEEFQEVFTDKTEQECQELADGCVRALPKE 478
           DLLLD KV+ WGWRV K+   +PTW RRGF  EF++VF  +     +ELA+ C+R  PKE
Sbjct: 408 DLLLDSKVKEWGWRVRKRAGAIPTWPRRGFYHEFEDVF--REGDTAKELAEACIRVAPKE 465

Query: 479 DGGIGFFAVCFVRD 492
           DGGIGFFAVCF RD
Sbjct: 466 DGGIGFFAVCFERD 479

>ZYRO0A01892g Chr1 (156967..158364) [1398 bp, 465 aa] {ON} similar
           to uniprot|P53972 Saccharomyces cerevisiae YNL022C
          Length = 465

 Score =  617 bits (1590), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 300/491 (61%), Positives = 380/491 (77%), Gaps = 26/491 (5%)

Query: 1   MEFYRDSTWVLEYLEGQIEKTGRVSGSLQTIVLRCCKQYRIKTNPKHIYAIVSSCWKYKP 60
           M+FYRDSTW+LEYLE + EK G++SGSLQ+ VL+ C +Y++K NPKHIYA+V+SCWKY+ 
Sbjct: 1   MDFYRDSTWILEYLEAE-EKKGKLSGSLQSNVLKTCTKYKVKNNPKHIYAVVASCWKYRM 59

Query: 61  YLDKIMKKSGLLDAIPRKKGKPAFSKXXXXXXXXXXXXSKAKRIQMGKHPIKNYVLKYKN 120
           YL++IM KSG+L  IP+KKGKPAFS+            SK KRIQMGKHPIK+YVLKYK 
Sbjct: 60  YLERIMHKSGILKTIPQKKGKPAFSRLTIMLLCHDLLISKQKRIQMGKHPIKDYVLKYKT 119

Query: 121 ALNAEFVKLKIKLKITDLSQVVDKDDAADDMTPVRWIRINPLRISNHDTDQVLNELKKKF 180
            L+AE VKLK+KLK+ +LS++VD+DD  DD TPVRWIRINPL+    D   V+ +L KKF
Sbjct: 120 RLHAELVKLKVKLKVKELSELVDQDDG-DDATPVRWIRINPLKC---DIPVVVEQLNKKF 175

Query: 181 PTRVNTWKDIIPGSIYYDEFIPNLYGIHISDKITSHELYKQGKIIIQDRASCFPAHILNP 240
           P RV+ W  + PGSIYYDE++PNL+GIH S+KITSH+LYKQGK+IIQDRASC PAHILNP
Sbjct: 176 PHRVDHWDQLSPGSIYYDEYVPNLFGIHPSEKITSHDLYKQGKVIIQDRASCLPAHILNP 235

Query: 241 SADDVVIDACSAPGNKTTHVAAHIFGDPENPRNDNVQIYAFEKDPERAQILQKMIKTAGC 300
             +DVV+DAC+APGNKTTH+AAHI     +      QI+AFEK+P RA++LQKM   AGC
Sbjct: 236 GKEDVVMDACAAPGNKTTHLAAHIISAAGDSNGGQAQIHAFEKEPARAKVLQKMTSQAGC 295

Query: 301 HKNIDVNVGDFTQIATPSKYSDVTGFILDPSCSGSGIFGRKSVDILNNHGKKSNDEVPDE 360
              + ++VGDFT++A P ++ DVT  ++DPSCSGSGIFGRKS+                 
Sbjct: 296 GSLVKIHVGDFTRLAVPDQFEDVTAALVDPSCSGSGIFGRKSL----------------- 338

Query: 361 NDAEETTDSKNEQLKERLSKLASFQFQIVRHAMSFPNAKKIVYSTCSIHAEENERVVIDL 420
              E + DS++++L++RLSKL+SFQFQ+V+HAMS PNA+KIVYSTCS+HAEENERVVIDL
Sbjct: 339 ---ESSNDSQDQKLQDRLSKLSSFQFQVVKHAMSMPNARKIVYSTCSVHAEENERVVIDL 395

Query: 421 LLDKKVQSWGWRVAKKELVLPTWYRRGFKEEFQEVFTDKTEQECQELADGCVRALPKEDG 480
           LLD KV+ WGW+++ +  V+PTW RRG  EEF+EVF D  + +CQ LA+ C+RALP+EDG
Sbjct: 396 LLDSKVKEWGWQLSPRSEVVPTWPRRGIAEEFEEVFRD-DKPKCQLLAESCIRALPREDG 454

Query: 481 GIGFFAVCFVR 491
           GIGFFAVCF R
Sbjct: 455 GIGFFAVCFQR 465

>TBLA0B06960 Chr2 (1646966..1648492) [1527 bp, 508 aa] {ON}
           Anc_2.286 YNL022C
          Length = 508

 Score =  611 bits (1575), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 303/509 (59%), Positives = 394/509 (77%), Gaps = 19/509 (3%)

Query: 1   MEFYRDSTWVLEYLEGQIEKTGRVSGSLQTIVLRCCKQYRIKTNPKHIYAIVSSCWKYKP 60
           M FYRD+TWVLE+LE Q +K GRVSGSL ++V++ CKQ++I++NPKH+YA+V S WK+KP
Sbjct: 1   MNFYRDATWVLEHLEAQ-DKKGRVSGSLLSLVVKSCKQFKIQSNPKHVYAVVESAWKFKP 59

Query: 61  YLDKIMKKSGLLDAIPRKKGKPAFSKXXXXXXXXXXXXSKAKRIQMGKHPIKNYVLKYKN 120
           ++++IM KSG+LD IP+KKGKP + +            SK++RIQMGKHPIK +VL YK 
Sbjct: 60  FIERIMAKSGILDDIPKKKGKPIYQRLTLLLLIHDLMFSKSRRIQMGKHPIKTFVLGYKT 119

Query: 121 ALNAEFVKLKIKLKITDLSQVVD----KDDAADDMTPVRWIRINPLRISNH-DTDQVLNE 175
            L++E VKLK+KLK+T+L+ +++     +D+ DD+TPVRWIRINP+RI     +D ++ E
Sbjct: 120 RLHSELVKLKLKLKVTNLNDMINANSNSNDSTDDITPVRWIRINPIRIPKQKSSDDIILE 179

Query: 176 LKKKFPTRVNTWKDIIPGSIYYDEFIPNLYGIHISDKITSHELYKQGKIIIQDRASCFPA 235
           L+KKF T+V+ W  I PG IYYDE+IPNL+GI  +DKITSHELYK GKIIIQDRASCFPA
Sbjct: 180 LRKKFTTKVDHWSKIKPGCIYYDEYIPNLFGISPTDKITSHELYKNGKIIIQDRASCFPA 239

Query: 236 HILNPSADDVVIDACSAPGNKTTHVAAHI--FGDPENPRNDNVQIYAFEKDPERAQILQK 293
           HILN + DD +IDAC+APGNKTTHVA++I    +  +   D  +++AFEKDPER++IL K
Sbjct: 240 HILNATPDDYIIDACAAPGNKTTHVASYIMSLNNDTHINFDKKRVFAFEKDPERSKILDK 299

Query: 294 MIKTAGCHKNIDVNVGDFTQIATPSKYSDVTGFILDPSCSGSGIFGRKSVDILNNHGKKS 353
           M+K AGC K +++N GDFT+IATP KY +VTGFI+DPSCSGSGIFGRK +D +N++ KK 
Sbjct: 300 MVKIAGCKKLVEINTGDFTKIATPEKYPNVTGFIVDPSCSGSGIFGRKFIDNINSN-KKL 358

Query: 354 NDEVPDEN-DAEETTDSKNEQLKE---------RLSKLASFQFQIVRHAMSFPNAKKIVY 403
            ++V DE  D E+    + E L E         RLSKL+SFQFQ+V+HAMSFP+AKKIVY
Sbjct: 359 TEKVKDEGEDDEQDIPLEQETLAEAKAKDDLETRLSKLSSFQFQVVKHAMSFPSAKKIVY 418

Query: 404 STCSIHAEENERVVIDLLLDKKVQSWGWRVAKKELVLPTWYRRGFKEEFQEVFTDKTEQE 463
           STCSIHAEENERVVIDLLLDKKV+ WGW+V  + L +PTW RRG   EF++VF +    +
Sbjct: 419 STCSIHAEENERVVIDLLLDKKVKEWGWKVTPRSLSIPTWERRGLVSEFEDVFKNDPAMD 478

Query: 464 CQELADGCVRALPKEDGGIGFFAVCFVRD 492
            ++LA+GC+R LPKEDGGIGFFAVCF R+
Sbjct: 479 PKQLAEGCIRTLPKEDGGIGFFAVCFERN 507

>ADL215W Chr4 (326584..328038) [1455 bp, 484 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YNL022C
          Length = 484

 Score =  601 bits (1550), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 291/496 (58%), Positives = 372/496 (75%), Gaps = 16/496 (3%)

Query: 1   MEFYRDSTWVLEYLEGQIEKTGRVSGSLQTIVLRCCKQYRIKTNPKHIYAIVSSCWKYKP 60
           MEFYRD++WVLEY+E +  +  +V+GSL ++VL+  K+Y++K++ +H+YAIV+S WKYK 
Sbjct: 1   MEFYRDASWVLEYIEQEFARKSKVAGSLHSLVLQSHKKYKLKSDVRHVYAIVASFWKYKA 60

Query: 61  YLDKIMKKSGLLDAIPRKKGKPAFSKXXXXXXXXXXXXSKAKRIQMGKHPIKNYVLKYKN 120
           YLD+I++KSGLL  +PRKKG+PAF +            SK KRI MGKHP+K +VLK++ 
Sbjct: 61  YLDRIIEKSGLLKDVPRKKGEPAFKRSTLGLVVHDLLLSKKKRIHMGKHPLKAFVLKHQT 120

Query: 121 ALNAEFVKLKIKLKITDLSQVVDKDDAADDMTPVRWIRINPLRISNHDTDQVLNELKKKF 180
            L  E+ K  +KL + DLS +V   D  +D TPVRWIR+NP RI     ++VL EL+KKF
Sbjct: 121 RLRGEYAKQLVKLGVADLSVLV--QDEREDATPVRWIRLNPFRIRGQ-REEVLQELQKKF 177

Query: 181 PTRVNTWKDIIPGSIYYDEFIPNLYGIHISDKITSHELYKQGKIIIQDRASCFPAHILNP 240
           P RV  W+++ PGSIY DE++  LYG+H +DKITSHELYK+GKIIIQDRASCFPA IL P
Sbjct: 178 PRRVADWRELTPGSIYEDEYVAGLYGVHPADKITSHELYKRGKIIIQDRASCFPAQILAP 237

Query: 241 SADDVVIDACSAPGNKTTHVAAHIFGDPENPRNDNVQIYAFEKDPERAQILQKMIKTAGC 300
              DV+IDAC+APGNKTTHVAAHIF  PE    D+ QI+AFE+DP+RA+ L+KMI TAGC
Sbjct: 238 GRSDVIIDACAAPGNKTTHVAAHIF--PEGG-ADHAQIHAFERDPQRAKTLRKMIATAGC 294

Query: 301 HKNIDVNVGDFTQIATPSKYSDVTGFILDPSCSGSGIFGRKSVDILNNHGKKS----NDE 356
              I+V+VGDFT+ A P  + +VTGFI+DPSCSGSGIFGR+ VD      K +    + +
Sbjct: 295 DNAIEVHVGDFTRDAQPEIFKNVTGFIVDPSCSGSGIFGRQLVDATQETQKGTETDPSAD 354

Query: 357 VPDENDAEETTDSKNEQLKERLSKLASFQFQIVRHAMSFPNAKKIVYSTCSIHAEENERV 416
           VP+E   E T  +   +LK RL+KL+SFQFQIV+HAMSFP+AKK++YSTCS+HAEENERV
Sbjct: 355 VPEEETFEATKSAV--ELKNRLAKLSSFQFQIVKHAMSFPSAKKLIYSTCSVHAEENERV 412

Query: 417 VIDLLLDKKVQSWGWRVAKKELVLPTWYRRGFKEEFQEVFTDKTEQECQELADGCVRALP 476
           VIDLLLD KVQ  GW+VA +  V+P W RRG + EF+EVF D+ E    ELA GC+R LP
Sbjct: 413 VIDLLLDSKVQKGGWKVASRSKVIPAWPRRGHQAEFEEVFPDQAE----ELAGGCIRVLP 468

Query: 477 KEDGGIGFFAVCFVRD 492
           KEDGGIGFFAVCF R+
Sbjct: 469 KEDGGIGFFAVCFERE 484

>CAGL0J10032g Chr10 (983405..985264) [1860 bp, 619 aa] {ON} highly
           similar to uniprot|P40991 Saccharomyces cerevisiae
           YNL061w NOP2
          Length = 619

 Score = 67.0 bits (162), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 78/294 (26%), Positives = 125/294 (42%), Gaps = 63/294 (21%)

Query: 157 IRINPLRISNHDTDQVL-NELKKKFPTRVNTWKDIIPGSIYYDEFIPNLYGIHISDKITS 215
           IR N L+ S  D  Q L N      P  + +W  +  G   +D  +P          I +
Sbjct: 276 IRTNTLKTSRRDLAQALVNRGVNLQP--IGSWTKV--GLQIFDSQVP----------IGA 321

Query: 216 HELYKQGKIIIQDRASCFPAHILNPSADDVVIDACSAPGNKTTHVAAHIFGDPENPRNDN 275
              Y  G  I+Q  +S  P   L+P  ++ V+D  SAPG KTT+++A +       +N  
Sbjct: 322 TPEYLAGNYILQAASSFLPVVALDPQENERVLDMASAPGGKTTYISALM-------KNTG 374

Query: 276 VQIYAFEKDPERAQILQKMIKTAGCHKNIDVNVGDFTQIATPSKYSDVTGFILDPSCSGS 335
             ++A + + +R + L   I   GC   I   V ++     P         +LD  CSG+
Sbjct: 375 C-VFANDANKKRTKSLIANIHRLGCTNTI---VCNYDAREFPKVIGGFDRVLLDAPCSGT 430

Query: 336 GIFGR-KSVDILNNHGKKSNDEVPDENDAEETTDSKNEQLKERLSKLASFQFQIVRHAMS 394
           G+ G+ +SV +                       S+ E+      ++   Q Q++  A+ 
Sbjct: 431 GVIGKDQSVKV-----------------------SRTEK---DFIQIPHLQKQLLLSAID 464

Query: 395 F--PNAKK---IVYSTCSIHAEENERVVIDLLLDK----KVQSWGWRVAKKELV 439
               N+KK   IVYSTCS+  EE+E  V+D  L K    K+   G ++ K+  V
Sbjct: 465 SVDANSKKGGVIVYSTCSVAVEEDE-AVVDYALRKRPNVKLVDTGLQIGKEGFV 517

>SAKL0E08624g Chr5 complement(704579..706414) [1836 bp, 611 aa] {ON}
           similar to uniprot|P40991 Saccharomyces cerevisiae
           YNL061W NOP2 Probable RNA m(5)C methyltransferase
           essential for processing and maturation of 27S pre-rRNA
           and large ribosomal subunit biogenesis localized to the
           nucleolus
          Length = 611

 Score = 67.0 bits (162), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 69/268 (25%), Positives = 111/268 (41%), Gaps = 58/268 (21%)

Query: 157 IRINPLRISNHDTDQVL-NELKKKFPTRVNTWKDIIPGSIYYDEFIPNLYGIHISDKITS 215
           IR N L+    D  Q L N      P  + +W  +  G   +D  +P          I +
Sbjct: 267 IRTNTLKTRRRDLAQTLVNRGVNLQP--IGSWTKV--GLQIFDSQVP----------IGA 312

Query: 216 HELYKQGKIIIQDRASCFPAHILNPSADDVVIDACSAPGNKTTHVAAHIFGDPENPRNDN 275
              Y  G  I+Q  +S  P   L+P  ++ ++D  +APG KTT+++A +       +N  
Sbjct: 313 TPEYLAGHYILQAASSFLPVIALDPQENERILDMAAAPGGKTTYISALM-------KNTG 365

Query: 276 VQIYAFEKDPERAQILQKMIKTAGCHKNIDVNVGDFTQIATPSKYSDVTGFILDPSCSGS 335
             ++A + +  R + L   I   GCH  I   V ++     P         +LD  CSG+
Sbjct: 366 C-VFANDANKARTKSLIANIHRLGCHNTI---VCNYDAREFPKVIGGFDRILLDAPCSGT 421

Query: 336 GIFGR-KSVDILNNHGKKSNDEVPDENDAEETTDSKNEQLKERLSKLASFQFQIVRHAMS 394
           G+ G+ +SV +                       S+ E+      ++   Q Q++  A+ 
Sbjct: 422 GVIGKDQSVKV-----------------------SRTEK---DFMQIPHLQKQLILSAID 455

Query: 395 FPNAKK-----IVYSTCSIHAEENERVV 417
             +A       IVYSTCS+  EENE VV
Sbjct: 456 SVDAHSKTGGVIVYSTCSVAVEENEAVV 483

>Kpol_1003.15 s1003 (41683..43584) [1902 bp, 633 aa] {ON}
           (41683..43584) [1902 nt, 634 aa]
          Length = 633

 Score = 63.2 bits (152), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 69/276 (25%), Positives = 115/276 (41%), Gaps = 59/276 (21%)

Query: 157 IRINPLRISNHDTDQVL-NELKKKFPTRVNTWKDIIPGSIYYDEFIPNLYGIHISDKITS 215
           IR N L+    D  Q L N+     P  +  W  +  G   +D  +P          I +
Sbjct: 288 IRTNTLKTRRRDLAQALVNKGVNLQP--IGAWTKV--GLQIFDSQVP----------IGA 333

Query: 216 HELYKQGKIIIQDRASCFPAHILNPSADDVVIDACSAPGNKTTHVAAHIFGDPENPRNDN 275
              Y  G+ I+Q  +S  P   L+P  ++ V+D  +APG KTT+++A +       +N  
Sbjct: 334 TSEYLAGQYILQAASSFLPVVALDPQENERVLDMAAAPGGKTTYISALM-------KNTG 386

Query: 276 VQIYAFEKDPERAQILQKMIKTAGCHKNIDVNVGDFTQIATPSKYSDVTGFILDPSCSGS 335
             ++A + +  R + L   I   GC   I   V ++     P         +LD  CSG+
Sbjct: 387 C-VFANDANKARTKSLIANIHRLGCTNTI---VCNYDAREFPKVIGGFDRILLDAPCSGT 442

Query: 336 GIFGR-KSVDILNNHGKKSNDEVPDENDAEETTDSKNEQLKERLSKLASFQFQIVRHAMS 394
           G+ G+ +SV                          K+ + ++   ++   Q Q++  A+ 
Sbjct: 443 GVIGKDQSV--------------------------KSSRTEKDFIQIPHLQKQLLLSAID 476

Query: 395 FPNAKK-----IVYSTCSIHAEENERVVIDLLLDKK 425
             +A       IVYSTCS+  EE+E  V+D  L K+
Sbjct: 477 SVDANSKTGGVIVYSTCSVAVEEDE-AVVDYALRKR 511

>TBLA0E03850 Chr5 (967569..969467) [1899 bp, 632 aa] {ON} Anc_2.247
           YNL061W
          Length = 632

 Score = 62.8 bits (151), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 72/285 (25%), Positives = 118/285 (41%), Gaps = 59/285 (20%)

Query: 148 ADDMTPVRWIRINPLRISNHDTDQVL-NELKKKFPTRVNTWKDIIPGSIYYDEFIPNLYG 206
           A++++    IR N L+    D  Q L N      P  +  W  +  G   +D  +P    
Sbjct: 278 ANEVSRPITIRTNTLKTRRRDLAQALVNRGVNLQP--IGAWTKV--GLQIFDSQVP---- 329

Query: 207 IHISDKITSHELYKQGKIIIQDRASCFPAHILNPSADDVVIDACSAPGNKTTHVAAHIFG 266
                 I +   Y  G  I+Q  +S  P   L+P  ++ V+D  SAPG KTT+++A +  
Sbjct: 330 ------IGATPEYLAGNYILQAASSFLPVIALDPQENERVLDMASAPGGKTTYISALM-- 381

Query: 267 DPENPRNDNVQIYAFEKDPERAQILQKMIKTAGCHKNIDVNVGDFTQIATPSKYSDVTGF 326
                +N    I+A + +  R + L   I   GC   I   V ++     P         
Sbjct: 382 -----KNTGC-IFANDANKARTKSLIANIHRLGCTNTI---VCNYDAREFPKVIGGFDRI 432

Query: 327 ILDPSCSGSGIFGR-KSVDILNNHGKKSNDEVPDENDAEETTDSKNEQLKERLSKLASFQ 385
           +LD  CSG+G+ G+ +SV +                       S+ E+      ++   Q
Sbjct: 433 LLDAPCSGTGVIGKDQSVKV-----------------------SRTEK---DFIQIPHLQ 466

Query: 386 FQIVRHAM-----SFPNAKKIVYSTCSIHAEENERVVIDLLLDKK 425
            Q++  A+     +  N   +VYSTCS+  EE+E  V+D  L K+
Sbjct: 467 KQLILSAIDSLDSNSKNGGVLVYSTCSVAVEEDE-AVVDYALRKR 510

>KAFR0J00970 Chr10 (174873..176705) [1833 bp, 610 aa] {ON} Anc_2.247
           YNL061W
          Length = 610

 Score = 62.0 bits (149), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 70/276 (25%), Positives = 114/276 (41%), Gaps = 59/276 (21%)

Query: 157 IRINPLRISNHDTDQVL-NELKKKFPTRVNTWKDIIPGSIYYDEFIPNLYGIHISDKITS 215
           IR N L+    D  Q L N      P  +  W  +  G   +D  +P          I +
Sbjct: 268 IRTNTLKTRRRDLAQTLVNRGVNLQP--IGNWTKV--GLQIFDSQVP----------IGA 313

Query: 216 HELYKQGKIIIQDRASCFPAHILNPSADDVVIDACSAPGNKTTHVAAHIFGDPENPRNDN 275
              Y  G+ I+Q  +S  P   L+P  ++ ++D  SAPG KTT+++A +       +N  
Sbjct: 314 TPEYLAGQYILQAASSFLPVIALDPQENERILDMASAPGGKTTYISALM-------KNTG 366

Query: 276 VQIYAFEKDPERAQILQKMIKTAGCHKNIDVNVGDFTQIATPSKYSDVTGFILDPSCSGS 335
             ++A + +  R + L   I   GC   I   V ++     P         +LD  CSG+
Sbjct: 367 C-VFANDANKNRTKSLIANIHRLGCTNTI---VCNYDAREFPKVIGGFDRILLDAPCSGT 422

Query: 336 GIFGR-KSVDILNNHGKKSNDEVPDENDAEETTDSKNEQLKERLSKLASFQFQIVRHAMS 394
           G+ G+ +SV +                       S+ E+      ++   Q Q++  A+ 
Sbjct: 423 GVIGKDQSVKV-----------------------SRTEK---DFIQIPHLQKQLLLSAID 456

Query: 395 FPNAKK-----IVYSTCSIHAEENERVVIDLLLDKK 425
             +A       IVYSTCS+  EE+E  V+D  L K+
Sbjct: 457 SVDANSKSGGVIVYSTCSVAVEEDE-AVVDYALRKR 491

>AFR179C Chr6 complement(766458..768560) [2103 bp, 700 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YBL024W
           (NCL1)
          Length = 700

 Score = 62.0 bits (149), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 73/297 (24%), Positives = 114/297 (38%), Gaps = 65/297 (21%)

Query: 222 GKIIIQDRASCFPAHILNPSADDVVIDACSAPGNKTTHVAAHIFGDPENPRNDNVQIYAF 281
           G I  Q+  S  P ++L       V+D C+APG+KT  +   +  +   P      + A 
Sbjct: 146 GNISRQEAVSMIPPNVLGVEPHHSVLDMCAAPGSKTAQLVEALHANGPEPSG---FVVAN 202

Query: 282 EKDPERAQILQKMIKTAGCHKNIDVN--VGDFTQIATPSKYSDVTGF---ILDPSCSGSG 336
           + D  R+ +L   +K       I VN     F +I T     D   F   + D  CSG G
Sbjct: 203 DADYRRSHMLVHQLKRLNSANLIVVNHDAQFFPRIKTAEGSKDFLKFDRVLCDVPCSGDG 262

Query: 337 IFGRKSVDILNNHGKKSNDEVPDENDAEETTDSKNEQLKERLSKLASFQFQIVRHAMS-F 395
              RK++++  + G  S                           L + Q  I+   ++  
Sbjct: 263 TM-RKNINVWKDWGTGSG------------------------LGLHTVQLNILNRGLTLL 297

Query: 396 PNAKKIVYSTCSIHAEENERVVIDLLLDKKVQSWGWRVAKKELV--------------LP 441
            N  ++VYSTCS++  ENE VV   L     + WG   AK +LV              + 
Sbjct: 298 KNGGRLVYSTCSLNPIENEAVVAAAL-----RKWG---AKIKLVNCDDQLLGLVRSTGIS 349

Query: 442 TW------YRRGFKEEFQEVFT--DKTEQECQEL-ADGCVRALPKEDGGIGFFAVCF 489
           +W      Y    K +   + T    +E+E +E   + C+R  P +    GFF   F
Sbjct: 350 SWPVLDKNYEEKNKGDDGTIATWFPPSEEEAKEFNLENCIRVYPHQQNTGGFFISVF 406

>ADL254W Chr4 (253602..255413) [1812 bp, 603 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YNL061W (NOP2)
          Length = 603

 Score = 62.0 bits (149), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 56/213 (26%), Positives = 93/213 (43%), Gaps = 44/213 (20%)

Query: 219 YKQGKIIIQDRASCFPAHILNPSADDVVIDACSAPGNKTTHVAAHIFGDPENPRNDNVQI 278
           Y  G  I+Q  +S  P   L+P  ++ ++D  +APG KTT+++A +       +N    +
Sbjct: 309 YLAGHYILQAASSFLPVIALDPHENERILDMAAAPGGKTTYISAMM-------KNTGC-V 360

Query: 279 YAFEKDPERAQILQKMIKTAGCHKNIDVNVGDFTQIATPSKYSDVTGFILDPSCSGSGIF 338
           +A + +  R + L   I   GC   I   V ++     P         +LD  CSG+G+ 
Sbjct: 361 FANDANKARTKSLIANIHRLGCTNTI---VCNYDAREFPKVIGGFDRILLDAPCSGTGVI 417

Query: 339 GR-KSVDILNNHGKKSNDEVPDENDAEETTDSKNEQLKERLSKLASFQFQIVRHAMSFPN 397
           G+ +SV +  N  +K   ++P                          Q Q++  A+   +
Sbjct: 418 GKDQSVKV--NRTEKDFMQIP------------------------HLQKQLILSAIDSVD 451

Query: 398 AKK-----IVYSTCSIHAEENERVVIDLLLDKK 425
           +       IVYSTCS+  EENE  V+D  L K+
Sbjct: 452 SNSKHGGVIVYSTCSVAVEENE-AVVDYALRKR 483

>TPHA0H00150 Chr8 (15977..17926) [1950 bp, 649 aa] {ON} Anc_8.171
           YBL024W
          Length = 649

 Score = 61.6 bits (148), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 76/303 (25%), Positives = 119/303 (39%), Gaps = 72/303 (23%)

Query: 222 GKIIIQDRASCFPAHILNPSADDVVIDACSAPGNKTTHVAAHIFGDPENPRNDNVQIYAF 281
           G I  Q+  S  P  +L+      V+D C+APG+KT  +   +  D + P      + A 
Sbjct: 140 GNISRQEAVSMLPPILLDVKPHHTVLDMCAAPGSKTAQLMESLHIDSDEPSG---FVIAN 196

Query: 282 EKDPERAQILQKMIKT------------AGCHKNIDVNVGDFTQIATPSKYSDVTGFILD 329
           + D +R+ +L   +K             A    N+ +N  D    A+  +       + D
Sbjct: 197 DADNKRSHLLVHQLKRLSTSNVLIVNHDAQFFPNLKINTKD----ASSQEDLKFDRILCD 252

Query: 330 PSCSGSGIFGRKSVDILNNHGKKSNDEVPDENDAEETTDSKNEQLKERLSKLASFQFQIV 389
             CSG G   RK+V++                        KN   +  L  L + QF I+
Sbjct: 253 VPCSGDGTM-RKNVNVW-----------------------KNWNTQNALG-LHNVQFNIL 287

Query: 390 RHAMSF-PNAKKIVYSTCSIHAEENERVVIDLLLDKKVQSWGWRV-------AKKELV-- 439
              ++      K+VYSTCS++  ENE VV  +L     + WG +V         K L+  
Sbjct: 288 DRGLTLLKETGKLVYSTCSLNPIENEAVVAAVL-----RKWGDKVRLVCCDDKLKGLIRS 342

Query: 440 --LPTW--YRRGFKEEFQEVFTDKTEQEC-----QELA----DGCVRALPKEDGGIGFFA 486
             L TW    R  +E  +    DK  + C     +E++    D C+R  P +    GFF 
Sbjct: 343 KGLTTWPVINRDMEEVPRNRSDDKINKSCYPPTEEEVSKFNLDRCMRVYPHQQNTGGFFI 402

Query: 487 VCF 489
             F
Sbjct: 403 TMF 405

>Smik_2.92 Chr2 (166201..168225) [2025 bp, 674 aa] {ON} YBL024W
           (REAL)
          Length = 674

 Score = 61.6 bits (148), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 72/295 (24%), Positives = 111/295 (37%), Gaps = 58/295 (19%)

Query: 222 GKIIIQDRASCFPAHILNPSADDVVIDACSAPGNKTTHVAAHIFGDPENPRNDNVQIYAF 281
           G I  Q+  S  P  +L       V+D C+APG+KT  +   +  D + P      + A 
Sbjct: 145 GNISRQEAVSMIPPIVLEVKPHHTVLDMCAAPGSKTAQLIEALHKDTDEPSG---FVVAN 201

Query: 282 EKDPERAQILQKMIKTAGCHKNIDVN--VGDFTQI---ATPSKYSDVTGF---ILDPSCS 333
           + D  R+ +L   +K       + VN     F +I      S  +DV  F   + D  CS
Sbjct: 202 DADARRSHMLVHQLKRLNSANLMVVNHDAQFFPRIRLHGNSSNKNDVLKFDRILCDVPCS 261

Query: 334 GSGIFGRKSVDILNNHGKKSNDEVPDENDAEETTDSKNEQLKERLSKLASFQFQIVRHAM 393
           G G   RK+V++  +   ++                           L + Q  I+   +
Sbjct: 262 GDGTM-RKNVNVWKDWNTQAG------------------------LGLHTVQLNILNRGL 296

Query: 394 S-FPNAKKIVYSTCSIHAEENERVVIDLL---------------LDKKVQSWG---WRVA 434
               N  ++VYSTCS++  ENE VV + L               L   ++S G   W V 
Sbjct: 297 HLLKNNGRLVYSTCSLNPIENEAVVAEALRKWGDKIRLVNCDDKLPGLIRSKGVSKWPVY 356

Query: 435 KKELVLPTWYRRGFKEEFQEVFTDKTEQECQELADGCVRALPKEDGGIGFFAVCF 489
            + L   T    G  E F   F+   E+  +     C+R  P +    GFF   F
Sbjct: 357 DRNLTEKTKGDEGTLESF---FSPSEEEASRFNLQNCMRVYPHQQNTGGFFITVF 408

>TPHA0C03150 Chr3 (697508..699334) [1827 bp, 608 aa] {ON} Anc_2.247
           YNL061W
          Length = 608

 Score = 61.6 bits (148), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 60/229 (26%), Positives = 100/229 (43%), Gaps = 47/229 (20%)

Query: 206 GIHISDK---ITSHELYKQGKIIIQDRASCFPAHILNPSADDVVIDACSAPGNKTTHVAA 262
           G+ I D    I +   Y  G+ I+Q  +S  P   L+P  ++ V+D  +APG KTT+++A
Sbjct: 301 GLQIFDSQVPIGATSEYLAGQYILQAASSFLPVVALDPQLNERVLDMAAAPGGKTTYISA 360

Query: 263 HIFGDPENPRNDNVQIYAFEKDPERAQILQKMIKTAGCHKNIDVNVGDFTQIATPSKYSD 322
            +       +N    ++A + +  R + L   I   GC   I   V ++     P     
Sbjct: 361 LM-------KNTGC-VFANDANKARTKSLIANIHRLGCTNTI---VCNYDAREFPKVIGG 409

Query: 323 VTGFILDPSCSGSGIFGR-KSVDILNNHGKKSNDEVPDENDAEETTDSKNEQLKERLSKL 381
               +LD  CSG+G+ G+ +SV +                       S+ E+      ++
Sbjct: 410 FDRILLDAPCSGTGVIGKDQSVKV-----------------------SRTEK---DFIQI 443

Query: 382 ASFQFQIVRHAMSFPNAKK-----IVYSTCSIHAEENERVVIDLLLDKK 425
              Q Q++  A+   +A       IVYSTCS+  EE+E  V+D  L K+
Sbjct: 444 PHLQKQLLLSAIDSVDANSKTGGFIVYSTCSVAVEEDE-AVVDYALRKR 491

>KLLA0F03399g Chr6 (319007..320866) [1860 bp, 619 aa] {ON} similar
           to uniprot|P40991 Saccharomyces cerevisiae YNL061W NOP2
           Probable RNA m(5)C methyltransferase essential for
           processing and maturation of 27S pre-rRNA and large
           ribosomal subunit biogenesis localized to the nucleolus
          Length = 619

 Score = 61.2 bits (147), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 70/276 (25%), Positives = 115/276 (41%), Gaps = 59/276 (21%)

Query: 157 IRINPLRISNHDTDQVL-NELKKKFPTRVNTWKDIIPGSIYYDEFIPNLYGIHISDKITS 215
           IR N L+    D  Q L N      P  + +W  +  G   +D  +P          I +
Sbjct: 270 IRTNTLKTRRRDLAQTLVNRGVNLQP--IGSWTKV--GLQIFDSQVP----------IGA 315

Query: 216 HELYKQGKIIIQDRASCFPAHILNPSADDVVIDACSAPGNKTTHVAAHIFGDPENPRNDN 275
              Y  G  I+Q  +S  P   L+P  ++ ++D  +APG KTT+++A +       +N  
Sbjct: 316 TPEYLAGHYILQAASSFLPVIALDPQENERILDMAAAPGGKTTYISAMM-------KNTG 368

Query: 276 VQIYAFEKDPERAQILQKMIKTAGCHKNIDVNVGDFTQIATPSKYSDVTGFILDPSCSGS 335
             ++A + +  R + L   I   GC   I   V ++     P         +LD  CSG+
Sbjct: 369 C-VFANDANKARTKSLIANIHRLGCTNTI---VCNYDAREFPKVIGGFDRILLDAPCSGT 424

Query: 336 GIFGR-KSVDILNNHGKKSNDEVPDENDAEETTDSKNEQLKERLSKLASFQFQIVRHAMS 394
           G+ G+ +SV +                       S+ E+      ++   Q Q++  A+ 
Sbjct: 425 GVIGKDQSVKV-----------------------SRTEK---DFMQIPHLQKQLLLSAID 458

Query: 395 F--PNAKK---IVYSTCSIHAEENERVVIDLLLDKK 425
               N+K    IVYSTCS+  +ENE  V+D  L K+
Sbjct: 459 SVDSNSKTGGVIVYSTCSVAVDENE-AVVDYALRKR 493

>Ecym_3284 Chr3 (537227..539047) [1821 bp, 606 aa] {ON} similar to
           Ashbya gossypii ADL254W
          Length = 606

 Score = 61.2 bits (147), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 70/285 (24%), Positives = 118/285 (41%), Gaps = 59/285 (20%)

Query: 148 ADDMTPVRWIRINPLRISNHDTDQVL-NELKKKFPTRVNTWKDIIPGSIYYDEFIPNLYG 206
           A++++    IR N L+    D  Q L N      P  + TW  +  G   +D  +P    
Sbjct: 253 ANEVSRPITIRTNTLKTRRRDLAQTLVNRGVNLQP--IGTWTKV--GLQIFDSQVP---- 304

Query: 207 IHISDKITSHELYKQGKIIIQDRASCFPAHILNPSADDVVIDACSAPGNKTTHVAAHIFG 266
                 I +   Y  G  I+Q  +S  P   L+P  ++ ++D  +APG KTT+++A +  
Sbjct: 305 ------IGATPEYLAGHYILQAASSFLPVIALDPQENERILDMAAAPGGKTTYISALM-- 356

Query: 267 DPENPRNDNVQIYAFEKDPERAQILQKMIKTAGCHKNIDVNVGDFTQIATPSKYSDVTGF 326
                +N    ++A + +  R + L   I   GC   I   V ++     P         
Sbjct: 357 -----KNTGC-VFANDANKARTKSLIANIHRLGCTNTI---VCNYDAREFPKVIGGFDRI 407

Query: 327 ILDPSCSGSGIFGR-KSVDILNNHGKKSNDEVPDENDAEETTDSKNEQLKERLSKLASFQ 385
           +LD  CSG+G+  + +SV +                       S+ E+      ++   Q
Sbjct: 408 LLDAPCSGTGVIAKDQSVKV-----------------------SRTEK---DFMQIPHLQ 441

Query: 386 FQIVRHAMSFPNAKK-----IVYSTCSIHAEENERVVIDLLLDKK 425
            Q++  A+   ++       IVYSTCS+  EENE  V+D  L K+
Sbjct: 442 KQLILSAIDSVDSNSKTGGIIVYSTCSVAVEENE-AVVDYALRKR 485

>KNAG0I01870 Chr9 complement(366800..368689) [1890 bp, 629 aa] {ON}
           Anc_2.247 YNL061W
          Length = 629

 Score = 60.8 bits (146), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 71/276 (25%), Positives = 115/276 (41%), Gaps = 59/276 (21%)

Query: 157 IRINPLRISNHDTDQVL-NELKKKFPTRVNTWKDIIPGSIYYDEFIPNLYGIHISDKITS 215
           IR N L+    D  Q L N      P  +  W  +  G   +D  +P          I +
Sbjct: 285 IRTNTLKTRRRDLAQSLVNRGVNLQP--IGNWTKV--GLQIFDSQVP----------IGA 330

Query: 216 HELYKQGKIIIQDRASCFPAHILNPSADDVVIDACSAPGNKTTHVAAHIFGDPENPRNDN 275
              Y  G  I+Q  +S  P   L+P  ++ ++D  +APG KTT+++A +       +N  
Sbjct: 331 TPEYLAGHYILQAASSFLPVIALDPQENERILDMAAAPGGKTTYISAMM-------KNTG 383

Query: 276 VQIYAFEKDPERAQILQKMIKTAGCHKNIDVNVGDFTQIATPSKYSDVTGFILDPSCSGS 335
             ++A + +  R + L   I   GC   I   V ++     P         +LD  CSG+
Sbjct: 384 C-VFANDANKNRTKSLIANIHRLGCTNTI---VCNYDAREFPKVIGGFDRILLDAPCSGT 439

Query: 336 GIFGR-KSVDILNNHGKKSNDEVPDENDAEETTDSKNEQLKERLSKLASFQFQIVRHAMS 394
           G+ G+ +SV +                       S+ E+      ++   Q Q++  A+ 
Sbjct: 440 GVIGKDQSVKV-----------------------SRTEK---DFIQIPHLQKQLLLSAID 473

Query: 395 F--PNAKK---IVYSTCSIHAEENERVVIDLLLDKK 425
               N+KK   IVYSTCS+  EE+E  V+D  L K+
Sbjct: 474 SVDANSKKGGIIVYSTCSVAVEEDE-AVVDYALRKR 508

>Kwal_23.4841 s23 (890138..892021) [1884 bp, 627 aa] {ON} YNL061W
           (NOP2) - 90-kDa protein, located in nucleolus, that is
           homologous to a human proliferation-associated nucleolar
           protein, p120 [contig 5] FULL
          Length = 627

 Score = 60.8 bits (146), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 74/294 (25%), Positives = 118/294 (40%), Gaps = 63/294 (21%)

Query: 157 IRINPLRISNHDTDQVL-NELKKKFPTRVNTWKDIIPGSIYYDEFIPNLYGIHISDKITS 215
           IR N L+    D  Q L N      P  +  W  +  G   +D  +P          I +
Sbjct: 282 IRTNSLKTRRRDLAQTLVNRGVNLKP--IGPWTKV--GLQIFDSQVP----------IGA 327

Query: 216 HELYKQGKIIIQDRASCFPAHILNPSADDVVIDACSAPGNKTTHVAAHIFGDPENPRNDN 275
              Y  G  I+Q  +S  P   L+P  ++ ++D  +APG KTT+++A +       +N  
Sbjct: 328 TPEYLAGHYILQAASSFLPVIALDPHENERILDMAAAPGGKTTYISAMM-------KNTG 380

Query: 276 VQIYAFEKDPERAQILQKMIKTAGCHKNIDVNVGDFTQIATPSKYSDVTGFILDPSCSGS 335
             ++A + +  R + L   I   GC   I   V ++     P         +LD  CSG+
Sbjct: 381 C-VFANDANKARTKSLIANIHRLGCTNTI---VCNYDAREFPKVIGGFDRILLDAPCSGT 436

Query: 336 GIFGR-KSVDILNNHGKKSNDEVPDENDAEETTDSKNEQLKERLSKLASFQFQIVRHAMS 394
           G+  + +SV +                       S+ E+      ++   Q Q++  A+ 
Sbjct: 437 GVIAKDQSVKV-----------------------SRTEK---DFIQIPHLQKQLLLSAID 470

Query: 395 FPNAKK-----IVYSTCSIHAEENERVVIDLLLDK----KVQSWGWRVAKKELV 439
             +A       IVYSTCS+  EENE  VID  L K    K+   G  + K+  V
Sbjct: 471 SVDANSKTGGVIVYSTCSVAVEENE-AVIDYALRKRPNVKLVDAGLSIGKEAFV 523

>ZYRO0A01562g Chr1 (128145..129998) [1854 bp, 617 aa] {ON} similar
           to uniprot|P40991 Saccharomyces cerevisiae YNL061W NOP2
           Probable RNA m(5)C methyltransferase essential for
           processing and maturation of 27S pre-rRNA and large
           ribosomal subunit biogenesis localized to the nucleolus
          Length = 617

 Score = 60.5 bits (145), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 58/216 (26%), Positives = 99/216 (45%), Gaps = 36/216 (16%)

Query: 206 GIHISDK---ITSHELYKQGKIIIQDRASCFPAHILNPSADDVVIDACSAPGNKTTHVAA 262
           G+ I D    I +   Y  G  I+Q  +S  P   L+P  ++ ++D  +APG KTT+++A
Sbjct: 307 GLQIFDSQVPIGATPEYLAGNYILQAASSFLPVIALDPQENERILDMAAAPGGKTTYISA 366

Query: 263 HIFGDPENPRNDNVQIYAFEKDPERAQILQKMIKTAGCHKNIDVNVGDFTQIATPSKYSD 322
            +       +N    ++A + +  R + L   I   GC   I   V ++     P     
Sbjct: 367 LM-------KNTGC-VFANDANKSRTKSLVANIHRLGCTNTI---VCNYDAREFPRVIGG 415

Query: 323 VTGFILDPSCSGSGIFGR-KSVDILNNHGKKSNDEVPDENDAEETTDSKNEQLKERLSKL 381
               +LD  CSG+G+ G+ +SV +  +  +K   ++P               L+++L  L
Sbjct: 416 FDRILLDAPCSGTGVIGKDQSVKV--SRTEKDFMQIP--------------HLQKQL--L 457

Query: 382 ASFQFQIVRHAMSFPNAKKIVYSTCSIHAEENERVV 417
            S    +  H+ +      IVYSTCS+  EE+E+VV
Sbjct: 458 LSAIDSVDSHSKT---GGIIVYSTCSVAVEEDEQVV 490

>Suva_2.97 Chr2 (172667..174679) [2013 bp, 670 aa] {ON} YBL024W
           (REAL)
          Length = 670

 Score = 60.5 bits (145), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 71/295 (24%), Positives = 111/295 (37%), Gaps = 58/295 (19%)

Query: 222 GKIIIQDRASCFPAHILNPSADDVVIDACSAPGNKTTHVAAHIFGDPENPRNDNVQIYAF 281
           G I  Q+  S  P  +L       V+D C+APG+KT  +   +  D + P      + A 
Sbjct: 145 GNISRQEAVSMIPPIVLEVKPHHTVLDMCAAPGSKTAQLIEALHKDTDEPSG---FVVAN 201

Query: 282 EKDPERAQILQKMIKTAGCHKNIDVN--VGDFTQI---ATPSKYSDVTGF---ILDPSCS 333
           + D  R+ +L   +K       + VN     F +I      +K +DV  F   + D  CS
Sbjct: 202 DADARRSHMLVHQLKRLNSANLMVVNHDAQFFPRIRLHENSNKKNDVLKFDRILCDVPCS 261

Query: 334 GSGIFGRKSVDILNNHGKKSNDEVPDENDAEETTDSKNEQLKERLSKLASFQFQIVRHAM 393
           G G   RK+V++  +   ++                           L + Q  I+   +
Sbjct: 262 GDGTM-RKNVNVWKDWNTQAG------------------------LGLHTVQLNILNRGL 296

Query: 394 S-FPNAKKIVYSTCSIHAEENERVVIDLL---------------LDKKVQSWG---WRVA 434
               +  ++VYSTCS++  ENE V+ + L               L   V+S G   W V 
Sbjct: 297 HLLKDGGRLVYSTCSLNPIENEAVIAEALRKWGDKIRLVNCDDKLSGLVRSKGVSKWPVY 356

Query: 435 KKELVLPTWYRRGFKEEFQEVFTDKTEQECQELADGCVRALPKEDGGIGFFAVCF 489
            + L   T    G  E F   F    E+  +     C+R  P +    GFF   F
Sbjct: 357 DRNLTEKTKGDEGTLESF---FAPSEEEASKFNLQNCMRVYPHQQNTGGFFITVF 408

>KLTH0G09460g Chr7 (787197..789110) [1914 bp, 637 aa] {ON} similar
           to uniprot|P40991 Saccharomyces cerevisiae YNL061W NOP2
           Probable RNA m(5)C methyltransferase essential for
           processing and maturation of 27S pre-rRNA and large
           ribosomal subunit biogenesis localized to the nucleolus
          Length = 637

 Score = 60.1 bits (144), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 73/302 (24%), Positives = 120/302 (39%), Gaps = 61/302 (20%)

Query: 148 ADDMTPVRWIRINPLRISNHDTDQVL-NELKKKFPTRVNTWKDIIPGSIYYDEFIPNLYG 206
           A++++    IR N L+    D  Q L N      P  +  W  +  G   +D  +P    
Sbjct: 275 ANEVSRPVTIRTNSLKTRRRDLAQTLVNRGVNLKP--IGPWTKV--GLQIFDSQVP---- 326

Query: 207 IHISDKITSHELYKQGKIIIQDRASCFPAHILNPSADDVVIDACSAPGNKTTHVAAHIFG 266
                 I +   Y  G  I+Q  +S  P   L+P  ++ ++D  +APG KTT+++A +  
Sbjct: 327 ------IGATPEYLAGHYILQAASSFLPVVALDPHENERILDMAAAPGGKTTYISAMM-- 378

Query: 267 DPENPRNDNVQIYAFEKDPERAQILQKMIKTAGCHKNIDVNVGDFTQIATPSKYSDVTGF 326
                +N    ++A + +  R + L   I   GC   I   V ++     P         
Sbjct: 379 -----KNTGC-VFANDANKARTKSLIANIHRLGCTNTI---VCNYDAREFPKVIGGFDRI 429

Query: 327 ILDPSCSGSGIFGRKSVDILNNHGKKSNDEVPDENDAEETTDSKNEQLKERLSKLASFQF 386
           +LD  CSG+G+  +                  D++     TD           ++   Q 
Sbjct: 430 LLDAPCSGTGVIAK------------------DQSVKVSRTDKD-------FMQIPHLQK 464

Query: 387 QIVRHAMSFPNAKK-----IVYSTCSIHAEENERVVIDLLLDK----KVQSWGWRVAKKE 437
           Q++  A+   +A       IVYSTCS+  EENE  V+D  L K    K+   G  + K+ 
Sbjct: 465 QLLLSAIDSVDANSKTGGVIVYSTCSVAVEENE-AVVDYALRKRPNVKLVDAGLAIGKEA 523

Query: 438 LV 439
            V
Sbjct: 524 FV 525

>YNL061W Chr14 (510540..512396) [1857 bp, 618 aa] {ON}  NOP2Probable
           RNA m(5)C methyltransferase, essential for processing
           and maturation of 27S pre-rRNA and large ribosomal
           subunit biogenesis; localized to the nucleolus;
           constituent of 66S pre-ribosomal particles
          Length = 618

 Score = 60.1 bits (144), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 75/300 (25%), Positives = 121/300 (40%), Gaps = 66/300 (22%)

Query: 157 IRINPLRISNHDTDQVL-NELKKKFPTRVNTWKDIIPGSIYYDEFIPNLYGIHISDKITS 215
           IR N L+    D  Q L N      P  + +W  +  G   +D  +P          I +
Sbjct: 273 IRTNTLKTRRRDLAQTLVNRGVNLQP--IGSWTKV--GLQIFDSQVP----------IGA 318

Query: 216 HELYKQGKIIIQDRASCFPAHILNPSADDVVIDACSAPGNKTTHVAAHIFGDPENPRNDN 275
              Y  G  I+Q  +S  P   L+P  ++ ++D  +APG KTT+++A +       +N  
Sbjct: 319 TPEYLAGHYILQAASSFLPVIALDPHENERILDMAAAPGGKTTYISAMM-------KNTG 371

Query: 276 VQIYAFEKDPERAQILQKMIKTAGCHKNIDVNVGDFTQIATPSKYSDVTGFILDPSCSGS 335
             ++A + +  R + L   I   GC   I   V ++     P         +LD  CSG+
Sbjct: 372 C-VFANDANKSRTKSLIANIHRLGCTNTI---VCNYDAREFPKVIGGFDRILLDAPCSGT 427

Query: 336 GIFGR-KSVDILNNHGKKSNDEVPDENDAEETTDSKNEQLKERLSKLASFQFQIVRHAMS 394
           G+ G+ +SV +                       S+ E+      ++   Q Q++  A+ 
Sbjct: 428 GVIGKDQSVKV-----------------------SRTEK---DFIQIPHLQKQLLLSAID 461

Query: 395 FPNAKK-----IVYSTCSIHAEENERVVIDLLLDK----KVQSWGWRVAKKELVLPTWYR 445
             +        IVYSTCS+  EE+E  VID  L K    K+   G  + K+     T YR
Sbjct: 462 SVDCNSKHGGVIVYSTCSVAVEEDE-AVIDYALRKRPNVKLVDTGLAIGKEAF---TSYR 517

>Smik_14.266 Chr14 (490908..492764) [1857 bp, 618 aa] {ON} YNL061W
           (REAL)
          Length = 618

 Score = 59.7 bits (143), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 74/300 (24%), Positives = 120/300 (40%), Gaps = 66/300 (22%)

Query: 157 IRINPLRISNHDTDQVL-NELKKKFPTRVNTWKDIIPGSIYYDEFIPNLYGIHISDKITS 215
           IR N L+    D  Q L N      P  + +W  +  G   +D  +P          I +
Sbjct: 273 IRTNTLKTRRRDLAQTLVNRGVNLQP--IGSWTKV--GLQIFDSQVP----------IGA 318

Query: 216 HELYKQGKIIIQDRASCFPAHILNPSADDVVIDACSAPGNKTTHVAAHIFGDPENPRNDN 275
              Y  G  I+Q  +S  P   L+P  ++ ++D  +APG KTT+++A +         + 
Sbjct: 319 TPEYLAGHYILQAASSFLPVIALDPHENERILDMAAAPGGKTTYISAMM--------KNT 370

Query: 276 VQIYAFEKDPERAQILQKMIKTAGCHKNIDVNVGDFTQIATPSKYSDVTGFILDPSCSGS 335
             ++A + +  R + L   I   GC   I   V ++     P         +LD  CSG+
Sbjct: 371 GCVFANDANKSRTKSLIANIHRLGCTNTI---VCNYDAREFPKVIGGFDRILLDAPCSGT 427

Query: 336 GIFGR-KSVDILNNHGKKSNDEVPDENDAEETTDSKNEQLKERLSKLASFQFQIVRHAMS 394
           G+ G+ +SV +                       S+ E+      ++   Q Q++  A+ 
Sbjct: 428 GVIGKDQSVKV-----------------------SRTEK---DFIQIPHLQKQLLLSAID 461

Query: 395 FPNAKK-----IVYSTCSIHAEENERVVIDLLLDK----KVQSWGWRVAKKELVLPTWYR 445
             +        IVYSTCS+  EE+E  VID  L K    K+   G  + K+     T YR
Sbjct: 462 SVDCNSKHGGVIVYSTCSVAVEEDE-AVIDYALRKRPNVKLVETGLAIGKEAF---TSYR 517

>SAKL0H19448g Chr8 (1713663..1715738) [2076 bp, 691 aa] {ON} highly
           similar to uniprot|P38205 Saccharomyces cerevisiae
           YBL024W
          Length = 691

 Score = 59.7 bits (143), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 69/293 (23%), Positives = 110/293 (37%), Gaps = 57/293 (19%)

Query: 222 GKIIIQDRASCFPAHILNPSADDVVIDACSAPGNKTTHVAAHIFGDPENPRNDNVQIYAF 281
           G I  Q+  S  P  +L    +  V+D C+APG+KT  +   +    + P      + A 
Sbjct: 145 GNISRQEAVSMIPPIVLEVKPNHTVLDMCAAPGSKTAQLIEALHAQEDEPTGF---VVAN 201

Query: 282 EKDPERAQILQKMIKTAGCHKNIDVN--VGDFTQIATPSKYSDVTGF---ILDPSCSGSG 336
           + D +R+ +L   +K       + VN     F +I +     +   F   + D  CSG G
Sbjct: 202 DADAKRSHMLVHQLKRLNSANLMVVNHDAQFFPRIKSQPDSKEFLKFDRVLCDVPCSGDG 261

Query: 337 IFGRKSVDILNNHGKKSNDEVPDENDAEETTDSKNEQLKERLSKLASFQFQIVRHAMS-F 395
              RK+V++  + G  S                           L + Q  I+   ++  
Sbjct: 262 TM-RKNVNVWRDWGTASG------------------------LGLHTVQLNILNRGLNLL 296

Query: 396 PNAKKIVYSTCSIHAEENERVVIDLL---------------LDKKVQSWG---WRVAKKE 437
            +  ++VYSTCS++  ENE V+   L               L   V+S G   W V  K 
Sbjct: 297 KDGGRLVYSTCSLNPIENESVIAAALRKWGDKIRLVNCDEKLPGLVRSKGITQWPVYDKN 356

Query: 438 LVLPTWYRRGFKEEFQEVFTDKTEQECQEL-ADGCVRALPKEDGGIGFFAVCF 489
             L    +    E   E +   TE+E      + C+R  P +    GFF   F
Sbjct: 357 FAL----KEKGDEGVIETWFPPTEEEATRFHLENCIRVYPHQQNTGGFFITVF 405

>NDAI0D01050 Chr4 (236435..238312) [1878 bp, 625 aa] {ON} Anc_2.247
           YNL061W
          Length = 625

 Score = 59.3 bits (142), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 69/276 (25%), Positives = 114/276 (41%), Gaps = 59/276 (21%)

Query: 157 IRINPLRISNHDTDQVL-NELKKKFPTRVNTWKDIIPGSIYYDEFIPNLYGIHISDKITS 215
           IR N L+    D  Q L N      P  + +W  +  G   +D  +P          I +
Sbjct: 280 IRTNTLKTRRRDLAQALVNRGVNLQP--IGSWTKV--GLQIFDSQVP----------IGA 325

Query: 216 HELYKQGKIIIQDRASCFPAHILNPSADDVVIDACSAPGNKTTHVAAHIFGDPENPRNDN 275
              Y  G  I+Q  +S  P   L+P  ++ ++D  +APG KTT+++A +         + 
Sbjct: 326 TPEYLAGNYILQAASSFLPVIALDPHENERILDMAAAPGGKTTYISALM--------KNT 377

Query: 276 VQIYAFEKDPERAQILQKMIKTAGCHKNIDVNVGDFTQIATPSKYSDVTGFILDPSCSGS 335
             ++A + +  R + L   I   GC   I   V ++     P         +LD  CSG+
Sbjct: 378 GTVFANDANKNRTKSLIANIHRLGCTNTI---VCNYDAREFPKVIGGFDRILLDAPCSGT 434

Query: 336 GIFGR-KSVDILNNHGKKSNDEVPDENDAEETTDSKNEQLKERLSKLASFQFQIVRHAMS 394
           G+ G+ +SV +                       S+ E+      ++   Q Q++  A+ 
Sbjct: 435 GVIGKDQSVKV-----------------------SRTEK---DFIQIPHLQKQLLLSAID 468

Query: 395 FP--NAKK---IVYSTCSIHAEENERVVIDLLLDKK 425
               N+K    IVYSTCS+  EE+E  V+D  L K+
Sbjct: 469 SVDCNSKHGGIIVYSTCSVAVEEDE-AVVDYALRKR 503

>NCAS0G03030 Chr7 (556908..558380) [1473 bp, 490 aa] {ON} Anc_2.247
           YNL061W
          Length = 490

 Score = 58.9 bits (141), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 68/276 (24%), Positives = 113/276 (40%), Gaps = 59/276 (21%)

Query: 157 IRINPLRISNHDTDQVL-NELKKKFPTRVNTWKDIIPGSIYYDEFIPNLYGIHISDKITS 215
           IR N L+    D  Q L N      P  + +W  +  G   +D  +P          I +
Sbjct: 145 IRTNTLKTRRRDLAQALVNRGVNLQP--IGSWTKV--GLQIFDSQVP----------IGA 190

Query: 216 HELYKQGKIIIQDRASCFPAHILNPSADDVVIDACSAPGNKTTHVAAHIFGDPENPRNDN 275
              Y  G  I+Q  +S  P   L+P  ++ ++D  +APG KTT+++A +       +N  
Sbjct: 191 TPEYLAGNYILQAASSFLPVIALDPHENERILDMAAAPGGKTTYISAMM-------KNTG 243

Query: 276 VQIYAFEKDPERAQILQKMIKTAGCHKNIDVNVGDFTQIATPSKYSDVTGFILDPSCSGS 335
             ++A + +  R + L   I   GC   I   V ++     P         +LD  CSG+
Sbjct: 244 C-VFANDANKNRTKSLIANIHRLGCTNTI---VCNYDAREFPKVIGGFDRILLDAPCSGT 299

Query: 336 GIFGR-KSVDILNNHGKKSNDEVPDENDAEETTDSKNEQLKERLSKLASFQFQIVRHAMS 394
           G+ G+ +SV +                       S+ E+      ++   Q Q++  A+ 
Sbjct: 300 GVIGKDQSVKV-----------------------SRTEK---DFIQIPHLQKQLLLSAID 333

Query: 395 FPNAKK-----IVYSTCSIHAEENERVVIDLLLDKK 425
             +        IVYSTCS+  EE+E  V+D  L K+
Sbjct: 334 SVDCNSKHGGVIVYSTCSVAVEEDE-AVVDYALRKR 368

>Suva_14.280 Chr14 (509488..511350) [1863 bp, 620 aa] {ON} YNL061W
           (REAL)
          Length = 620

 Score = 58.9 bits (141), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 70/276 (25%), Positives = 115/276 (41%), Gaps = 59/276 (21%)

Query: 157 IRINPLRISNHDTDQVL-NELKKKFPTRVNTWKDIIPGSIYYDEFIPNLYGIHISDKITS 215
           IR N L+    D  Q L N      P  + +W  +  G   +D  +P          I +
Sbjct: 275 IRTNTLKTRRRDLAQTLVNRGVNLQP--IGSWTKV--GLQIFDSQVP----------IGA 320

Query: 216 HELYKQGKIIIQDRASCFPAHILNPSADDVVIDACSAPGNKTTHVAAHIFGDPENPRNDN 275
              Y  G  I+Q  +S  P   L+P  ++ ++D  +APG KTT+++A +       +N  
Sbjct: 321 TPEYLAGHYILQAASSFLPVIALDPHENERILDMAAAPGGKTTYISAMM-------KNTG 373

Query: 276 VQIYAFEKDPERAQILQKMIKTAGCHKNIDVNVGDFTQIATPSKYSDVTGFILDPSCSGS 335
             ++A + +  R + L   I   GC   I   V ++     P         +LD  CSG+
Sbjct: 374 C-VFANDANKSRTKSLIANIHRLGCTNTI---VCNYDAREFPKVIGGFDRILLDAPCSGT 429

Query: 336 GIFGR-KSVDILNNHGKKSNDEVPDENDAEETTDSKNEQLKERLSKLASFQFQIVRHAMS 394
           G+ G+ +SV +                       S+ E+      ++   Q Q++  A+ 
Sbjct: 430 GVIGKDQSVKV-----------------------SRTEK---DFIQIPHLQKQLLLSAID 463

Query: 395 FP--NAKK---IVYSTCSIHAEENERVVIDLLLDKK 425
               N+K    IVYSTCS+  EE+E  V+D  L K+
Sbjct: 464 SVDCNSKHGGVIVYSTCSVAVEEDE-AVVDYALRKR 498

>TDEL0B04390 Chr2 (769749..771770) [2022 bp, 673 aa] {ON} Anc_8.171
           YBL024W
          Length = 673

 Score = 58.9 bits (141), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 71/298 (23%), Positives = 112/298 (37%), Gaps = 63/298 (21%)

Query: 222 GKIIIQDRASCFPAHILNPSADDVVIDACSAPGNKTTHVAAHIFGDPENPRNDNVQIYAF 281
           G I  Q+  S  P  +L       V+D C+APG+KT  +   +  D + P      + A 
Sbjct: 143 GNISRQEAVSMIPPIVLEVEPHHTVLDMCAAPGSKTAQMIEALHKDTDEPTG---FVVAN 199

Query: 282 EKDPERAQILQKMIKTAGCHKNIDVN--VGDFTQI----ATPSKYSDVTGF---ILDPSC 332
           + D +R+ +L   +K       + VN     F +I    A  S  ++V  F   + D  C
Sbjct: 200 DADSKRSHMLVHQLKRLNSANLMVVNHDAQFFPRIKSSAADDSSKANVLKFDRVLCDVPC 259

Query: 333 SGSGIFGRKSVDILNNHGKKSNDEVPDENDAEETTDSKNEQLKERLSKLASFQFQIVRHA 392
           SG G   RK+V++  +   +                            L + QF I+   
Sbjct: 260 SGDGTM-RKNVNVWRDWTPQGG------------------------LGLHTVQFNILNRG 294

Query: 393 MS-FPNAKKIVYSTCSIHAEENERVVIDLLLDKKVQSWG--WRVAKKELVLPTWYR---- 445
           +    N  ++VYSTCS++  ENE VV + L     + WG   R+   E  LP   R    
Sbjct: 295 LHLLKNKGRLVYSTCSMNPIENEAVVAEAL-----RKWGDKIRLVSCEDKLPGLVRSKGV 349

Query: 446 --------------RGFKEEFQEVFTDKTEQECQELADGCVRALPKEDGGIGFFAVCF 489
                         +G +      F    E+  +   + C+R  P +    GFF   F
Sbjct: 350 SQWPVIDRNMTPREKGDEGTHDSWFPPTEEEAAKFNLENCIRVYPHQQNTGGFFITVF 407

>YBL024W Chr2 (172534..174588) [2055 bp, 684 aa] {ON}
           NCL1S-adenosyl-L-methionine-dependent tRNA:
           m5C-methyltransferase, methylates cytosine to m5C at
           several positions in tRNAs and intron-containing
           pre-tRNAs; increases proportion of tRNALeu(CAA) with m5C
           at wobble position in response to hydrogen peroxide,
           causing selective translation of mRNA from genes
           enriched in TTG codon; loss of NCL1 confers
           hypersensitivity to oxidative stress; similar to Nop2p
           and human proliferation associated nucleolar protein
           p120
          Length = 684

 Score = 58.9 bits (141), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 69/295 (23%), Positives = 111/295 (37%), Gaps = 58/295 (19%)

Query: 222 GKIIIQDRASCFPAHILNPSADDVVIDACSAPGNKTTHVAAHIFGDPENPRNDNVQIYAF 281
           G I  Q+  S  P  +L       V+D C+APG+KT  +   +  D + P      + A 
Sbjct: 145 GNISRQEAVSMIPPIVLEVKPHHTVLDMCAAPGSKTAQLIEALHKDTDEPSG---FVVAN 201

Query: 282 EKDPERAQILQKMIKTAGCHKNIDVN--VGDFTQI---ATPSKYSDVTGF---ILDPSCS 333
           + D  R+ +L   +K       + VN     F +I      +  +DV  F   + D  CS
Sbjct: 202 DADARRSHMLVHQLKRLNSANLMVVNHDAQFFPRIRLHGNSNNKNDVLKFDRILCDVPCS 261

Query: 334 GSGIFGRKSVDILNNHGKKSNDEVPDENDAEETTDSKNEQLKERLSKLASFQFQIVRHAM 393
           G G   RK+V++  +   ++                           L + Q  I+   +
Sbjct: 262 GDGTM-RKNVNVWKDWNTQAG------------------------LGLHAVQLNILNRGL 296

Query: 394 S-FPNAKKIVYSTCSIHAEENERVVIDLL---------------LDKKVQSWG---WRVA 434
               N  ++VYSTCS++  ENE VV + L               L   ++S G   W V 
Sbjct: 297 HLLKNNGRLVYSTCSLNPIENEAVVAEALRKWGDKIRLVNCDDKLPGLIRSKGVSKWPVY 356

Query: 435 KKELVLPTWYRRGFKEEFQEVFTDKTEQECQELADGCVRALPKEDGGIGFFAVCF 489
            + L   T   +G +      F+   E+  +     C+R  P +    GFF   F
Sbjct: 357 DRNLTEKT---KGDEGTLDSFFSPSEEEASKFNLQNCMRVYPHQQNTGGFFITVF 408

>TDEL0C04150 Chr3 complement(734914..736758) [1845 bp, 614 aa] {ON}
           Anc_2.247 YNL061W
          Length = 614

 Score = 58.5 bits (140), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 68/276 (24%), Positives = 115/276 (41%), Gaps = 59/276 (21%)

Query: 157 IRINPLRISNHDTDQVL-NELKKKFPTRVNTWKDIIPGSIYYDEFIPNLYGIHISDKITS 215
           IR N L+    D  Q L N      P  + +W  +  G   +D  +P          I +
Sbjct: 270 IRTNTLKTRRRDLAQALVNRGVNLQP--IGSWTKV--GLQIFDSQVP----------IGA 315

Query: 216 HELYKQGKIIIQDRASCFPAHILNPSADDVVIDACSAPGNKTTHVAAHIFGDPENPRNDN 275
              Y  G  I+Q  +S  P   L+P  ++ ++D  +APG KTT+++A +       +N  
Sbjct: 316 TPEYLAGNYILQAASSFLPVIALDPHENERILDMAAAPGGKTTYISALM-------KNTG 368

Query: 276 VQIYAFEKDPERAQILQKMIKTAGCHKNIDVNVGDFTQIATPSKYSDVTGFILDPSCSGS 335
             ++A + +  R + L   I   GC   I   V ++     P         +LD  C+G+
Sbjct: 369 C-VFANDANKARTKSLIANIHRLGCTNTI---VCNYDAREFPKVIGGFDRILLDAPCTGT 424

Query: 336 GIFGR-KSVDILNNHGKKSNDEVPDENDAEETTDSKNEQLKERLSKLASFQFQIVRHAMS 394
           G+ G+ +SV +  +  +K   +VP                          Q Q++  A+ 
Sbjct: 425 GVIGKDQSVKV--SRTEKDFIQVP------------------------HLQKQLLLSAID 458

Query: 395 FPNAKK-----IVYSTCSIHAEENERVVIDLLLDKK 425
             ++       IVYSTCS+  EE+E +V+D  L K+
Sbjct: 459 SVDSNSKTGGIIVYSTCSVAVEEDE-MVVDYALRKR 493

>KNAG0G01510 Chr7 complement(341469..343469) [2001 bp, 666 aa] {ON}
           Anc_8.171 YBL024W
          Length = 666

 Score = 58.5 bits (140), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 69/298 (23%), Positives = 113/298 (37%), Gaps = 60/298 (20%)

Query: 222 GKIIIQDRASCFPAHILNPSADDVVIDACSAPGNKTTHVAAHIFGDPENPRNDNVQIYAF 281
           G I  Q+  S  P  +L   ++  V+D C+APG+KT  +   +  D + P      I A 
Sbjct: 159 GNISRQEAVSMIPPLLLRLESNHNVLDMCAAPGSKTAQLIEQLHKDTDEPTG---IIVAN 215

Query: 282 EKDPERAQILQKMIKTAGCHKNIDVN--VGDFTQIATPSKYSDVTG----FILDPSCSGS 335
           + D  R+ +L   +K       + VN     F  I T S  +++T      + D  CSG 
Sbjct: 216 DSDMRRSYLLVHQLKRLNSSNILVVNHDAQFFPNIRTNSLNNNITMKFDRILCDVPCSGD 275

Query: 336 GIFGRKSVDILNNHGKKSNDEVPDENDAEETTDSKNEQLKERLSKLASFQFQIVRHAMS- 394
           G   RK+++I N+                        + +  L  L   Q  I+   +  
Sbjct: 276 GTL-RKNINIWNDW-----------------------RFQNALG-LHRLQNNILNRGLQL 310

Query: 395 FPNAKKIVYSTCSIHAEENERVVIDLLLDKKVQSWGWRVAKKEL--VLPTWYR------- 445
             N  ++VYSTCS++  ENE V+ + L     ++W   V+       LP   R       
Sbjct: 311 LRNGGRLVYSTCSMNPIENEAVIANAL-----RNWAGEVSLVNFDDELPGLIRSRGISSW 365

Query: 446 -----------RGFKEEFQEVFTDKTEQECQELADGCVRALPKEDGGIGFFAVCFVRD 492
                      RG  E     F    +++     + C+R  P +     FF   F ++
Sbjct: 366 PVIDRNGEMRERGDPETLDSWFPPTADEQKTFNLEKCIRVYPHQQDTGAFFIAVFEKN 423

>KNAG0D02050 Chr4 (339873..341921) [2049 bp, 682 aa] {ON} Anc_8.171
           YBL024W
          Length = 682

 Score = 58.5 bits (140), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 75/297 (25%), Positives = 114/297 (38%), Gaps = 62/297 (20%)

Query: 222 GKIIIQDRASCFPAHILNPSADDVVIDACSAPGNKTTHVAAHIFGDPENPRNDNVQIYAF 281
           G I  Q+  S  P  +L       V+D C+APG+KT  +   +  D + P      + A 
Sbjct: 145 GNISRQEAVSMIPPIVLEVEPQHTVLDMCAAPGSKTAQLLEALHRDTDEPTG---FVVAN 201

Query: 282 EKDPERAQILQKMIKTAGCHKNIDVN--VGDFTQIAT---PSKYSDVTGF---ILDPSCS 333
           + D  R+ +L   +K       I VN     F +I T     K SD+  F   + D  CS
Sbjct: 202 DADNRRSHMLVHQLKRLNSANLIVVNHDAQFFPRIKTSKNSEKKSDLLKFDRILCDVPCS 261

Query: 334 GSGIFGRKSVDILNNHGKKSNDEVPDENDAEETTDSKNEQLKERLSKLASFQFQIVRHAM 393
           G G   RK+V++  +   ++                           L   Q  I+   +
Sbjct: 262 GDGTM-RKNVNVWRDWNTQN------------------------ALGLHQVQANILNRGL 296

Query: 394 S-FPNAKKIVYSTCSIHAEENERVVIDLLLDKKVQSWG--WRVAKKELVLPTWYR-RGFK 449
                  ++VYSTCS++  ENE VV   L     + WG   R+   +  LP   R +G  
Sbjct: 297 HLLKKGGRLVYSTCSMNPIENEAVVAQAL-----RKWGDKVRLVNCDDKLPGLVRNKGIS 351

Query: 450 ------------EEFQEVFTDK----TEQECQELA-DGCVRALPKEDGGIGFFAVCF 489
                       E+ QE   D     TE+E ++   + C+R  P +    GFF   F
Sbjct: 352 KWPTLNRNMEEMEKGQEGANDSWFQPTEEEAEKFQLENCIRVYPHQQNTGGFFITVF 408

>NCAS0B04390 Chr2 complement(795633..797648) [2016 bp, 671 aa] {ON}
           Anc_8.171 YBL024W
          Length = 671

 Score = 57.8 bits (138), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 72/296 (24%), Positives = 109/296 (36%), Gaps = 60/296 (20%)

Query: 222 GKIIIQDRASCFPAHILNPSADDVVIDACSAPGNKTTHVAAHIFGDPENPRNDNVQIYAF 281
           G I  Q+  S  P  +L       V+D C+APG+KT  +   +  D + P      + A 
Sbjct: 145 GNISRQEAVSMIPPIVLEVEPQHTVLDMCAAPGSKTAQLIEALHKDTDEPTG---FVVAN 201

Query: 282 EKDPERAQILQKMIKTAGCHKNIDVN--VGDFTQIAT---PSKYSDVTGF---ILDPSCS 333
           + D  R+ +L   +K       + VN     F +I       K  D+  F   + D  CS
Sbjct: 202 DADARRSHMLVHQLKRLNSANLMVVNHDAQFFPRIKLHDDAEKKRDMLKFDRILCDVPCS 261

Query: 334 GSGIFGRKSVDILNNHGKKSNDEVPDENDAEETTDSKNEQLKERLSKLASFQFQIVRHAM 393
           G G   RK+V++  +   +                            L + Q+ I+   +
Sbjct: 262 GDGTM-RKNVNVWKDWNAQG------------------------ALGLHTVQWNILNRGL 296

Query: 394 SF--PNAKKIVYSTCSIHAEENERVVIDLL---------------LDKKVQSWG---WRV 433
               PN  ++VYSTCS++  ENE VV   L               L   V+S G   W V
Sbjct: 297 HLLKPNG-RLVYSTCSLNPIENEAVVAQALRKWGNKIRLVNCDEKLPGLVRSKGISQWPV 355

Query: 434 AKKELVLPTWYRRGFKEEFQEVFTDKTEQECQELADGCVRALPKEDGGIGFFAVCF 489
             ++L        G  E +   F    E+      D C+R  P +    GFF   F
Sbjct: 356 LNRDLETKNKNDEGVLESW---FPPSEEEASLFNLDACIRVYPHQQNTGGFFITVF 408

>Skud_14.271 Chr14 (500809..502668) [1860 bp, 619 aa] {ON} YNL061W
           (REAL)
          Length = 619

 Score = 57.4 bits (137), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 66/268 (24%), Positives = 108/268 (40%), Gaps = 58/268 (21%)

Query: 157 IRINPLRISNHDTDQVL-NELKKKFPTRVNTWKDIIPGSIYYDEFIPNLYGIHISDKITS 215
           IR N L+    D  Q L N      P  +  W  +  G   +D  +P          I +
Sbjct: 274 IRTNTLKTRRRDLAQTLVNRGVNLQP--IGPWTKV--GLQIFDSQVP----------IGA 319

Query: 216 HELYKQGKIIIQDRASCFPAHILNPSADDVVIDACSAPGNKTTHVAAHIFGDPENPRNDN 275
              Y  G  I+Q  +S  P   L+P  ++ ++D  +APG KTT+++A +       +N  
Sbjct: 320 TPEYLAGHYILQAASSFLPVIALDPHENERILDMAAAPGGKTTYISAMM-------KNTG 372

Query: 276 VQIYAFEKDPERAQILQKMIKTAGCHKNIDVNVGDFTQIATPSKYSDVTGFILDPSCSGS 335
             ++A + +  R + L   I   GC   I   V ++     P         +LD  CSG+
Sbjct: 373 C-VFANDANKSRTKSLIANIHRLGCTNTI---VCNYDAREFPKVIGGFDRILLDAPCSGT 428

Query: 336 GIFGR-KSVDILNNHGKKSNDEVPDENDAEETTDSKNEQLKERLSKLASFQFQIVRHAMS 394
           G+ G+ +SV +                       S+ E+      ++   Q Q++  A+ 
Sbjct: 429 GVIGKDQSVKV-----------------------SRTEK---DFIQIPHLQKQLLLSAID 462

Query: 395 FPNAKK-----IVYSTCSIHAEENERVV 417
             +        IVYSTCS+  EE+E VV
Sbjct: 463 SVDCNSKHGGVIVYSTCSVAVEEDEAVV 490

>Skud_2.81 Chr2 (156273..158318) [2046 bp, 681 aa] {ON} YBL024W
           (REAL)
          Length = 681

 Score = 56.6 bits (135), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 67/295 (22%), Positives = 112/295 (37%), Gaps = 58/295 (19%)

Query: 222 GKIIIQDRASCFPAHILNPSADDVVIDACSAPGNKTTHVAAHIFGDPENPRNDNVQIYAF 281
           G I  Q+  S  P  +L       V+D C+APG+KT  +   +  D + P      + A 
Sbjct: 145 GNISRQEAVSMIPPIVLEVKPHHTVLDMCAAPGSKTAQLIEALHKDTDEPSG---FVVAN 201

Query: 282 EKDPERAQILQKMIKTAGCHKNIDVN--VGDFTQI---ATPSKYSDVTGF---ILDPSCS 333
           + D  R+ +L   +K       + VN     F +I      +K +D+  F   + D  CS
Sbjct: 202 DADARRSHMLVHQLKRLNSANLMVVNHDAQFFPRIRLHGNSNKKNDILKFDRILCDVPCS 261

Query: 334 GSGIFGRKSVDILNNHGKKSNDEVPDENDAEETTDSKNEQLKERLSKLASFQFQIVRHAM 393
           G G   RK+V++  +   ++                           L + Q  I+   +
Sbjct: 262 GDGTM-RKNVNVWKDWNTQAG------------------------LGLHTVQLNILNRGL 296

Query: 394 SFPNAK-KIVYSTCSIHAEENERVVIDLL---------------LDKKVQSWG---WRVA 434
               +  ++VYSTCS++  ENE V+ + L               L   ++S G   W V 
Sbjct: 297 HLLKSNGRLVYSTCSLNPIENEAVIAEALRKWGDKIRLVNCDDKLTGLIRSKGVSKWPVY 356

Query: 435 KKELVLPTWYRRGFKEEFQEVFTDKTEQECQELADGCVRALPKEDGGIGFFAVCF 489
            + L   T   +G +   +  F    E+  +     C+R  P +    GFF   F
Sbjct: 357 DRNL---TEKNKGDEGTLESFFPPSEEEASKFNLKNCMRVYPHQQNTGGFFISVF 408

>Ecym_2353 Chr2 complement(691422..693494) [2073 bp, 690 aa] {ON}
           similar to Ashbya gossypii AFR179C
          Length = 690

 Score = 56.6 bits (135), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 71/294 (24%), Positives = 109/294 (37%), Gaps = 59/294 (20%)

Query: 222 GKIIIQDRASCFPAHILNPSADDVVIDACSAPGNKTTHVAAHIFGDPENPRNDNVQIYAF 281
           G I  Q+  S  P  +L       V+D C+APG+KT  +   +      P      + A 
Sbjct: 145 GNISRQEAVSMIPPLLLEVEPQHTVLDMCAAPGSKTAQLIEALHAKGPEPSG---FVVAN 201

Query: 282 EKDPERAQILQKMIKTAGCHKNIDVN--VGDFTQIATPSKYSDVTGF---ILDPSCSGSG 336
           + D  R+ +L   +K       I VN     F +I T     D   F   + D  CSG G
Sbjct: 202 DADYRRSHMLVHQLKRLNSANLIVVNHDAQFFPRIKTSEGSKDFLRFDRVLCDVPCSGDG 261

Query: 337 IFGRKSVDILNNHGKKSNDEVPDENDAEETTDSKNEQLKERLSKLASFQFQIVRHAMS-F 395
              RK++++  +    S                           L + Q  I+   ++  
Sbjct: 262 TM-RKNINVWKDWATASG------------------------LGLHTVQVNILNRGLNLL 296

Query: 396 PNAKKIVYSTCSIHAEENERVVIDLLLDKKVQSWGWRVAKKEL--VLP---------TW- 443
            +  ++VYSTCS++  ENE VV   L     + WG ++   E    LP          W 
Sbjct: 297 KDGGRLVYSTCSLNPIENEAVVAAAL-----RKWGDKIKLVECGDKLPGLIRSQGISQWP 351

Query: 444 -YRRGFK------EEFQEVFTDKTEQECQEL-ADGCVRALPKEDGGIGFFAVCF 489
            Y +GF       E     +   T++E  +   + CVR  P +    GFF   F
Sbjct: 352 VYDKGFNAKQRSDEGVDASWFPPTDEEISKFHLESCVRVYPHQQNTGGFFIAVF 405

>KLTH0H08096g Chr8 (706261..708327) [2067 bp, 688 aa] {ON} similar
           to uniprot|P38205 Saccharomyces cerevisiae YBL024W
          Length = 688

 Score = 55.8 bits (133), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 67/293 (22%), Positives = 110/293 (37%), Gaps = 65/293 (22%)

Query: 222 GKIIIQDRASCFPAHILNPSADDVVIDACSAPGNKTTHVAAHIFGDPENPRNDNVQIYAF 281
           G I  Q+  S  P  +L   +   V+D C+APG+KT  +   +    + P      + A 
Sbjct: 145 GNISRQEAVSMIPPIVLEVESHHSVLDMCAAPGSKTAQMIEALHSSEDEPTG---FVVAN 201

Query: 282 EKDPERAQILQKMIKTAGCHKNIDVN--VGDFTQIATPSKYSDVTGF---ILDPSCSGSG 336
           + D  R+ +L   +K       + VN     F ++ T  + +    F   + D  CSG G
Sbjct: 202 DADARRSHMLVHQLKRLNSANLVVVNHDAQFFPRVKTDKETNQFLKFDRILCDVPCSGDG 261

Query: 337 IFGRKSVDILNNHGKKSNDEVPDENDAEETTDSKNEQLKERLSKLASFQFQIVRHAMS-F 395
              RK+V++  + G  S                           L + Q  I++  ++  
Sbjct: 262 TM-RKNVNVWKDWGTASG------------------------LGLHTVQLNILKRGLNLL 296

Query: 396 PNAKKIVYSTCSIHAEENERVVIDLLLDKKVQSWGWRVAKKELV-----LPTWYR----- 445
               ++VYSTCS++  ENE VV   L     + WG ++   +LV     LP   R     
Sbjct: 297 KKGGRLVYSTCSMNPIENEAVVAAAL-----RQWGDKI---KLVDCSDKLPGLVRSKGIS 348

Query: 446 -------------RGFKEEFQEVFTDKTEQECQELADGCVRALPKEDGGIGFF 485
                        +G +   +  F    E+      D C+R  P +    GFF
Sbjct: 349 NWPVIDKAFEKKEKGDEGTTESWFPPSAEEAADFHLDRCIRVYPHQQNTGGFF 401

>KAFR0B02220 Chr2 complement(438809..440869) [2061 bp, 686 aa] {ON}
           Anc_8.171 YBL024W
          Length = 686

 Score = 55.5 bits (132), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 68/291 (23%), Positives = 111/291 (38%), Gaps = 58/291 (19%)

Query: 222 GKIIIQDRASCFPAHILNPSADDVVIDACSAPGNKTTHVAAHIFGDPENPRNDNVQIYAF 281
           G I  Q+  S  P  +L       V+D C+APG+KT  +   +  D + P      + A 
Sbjct: 146 GNISRQEAVSMIPPIVLEVEPQHTVLDMCAAPGSKTAQLIEALHMDTDEPTG---FVVAN 202

Query: 282 EKDPERAQILQKMIKTAGCHKNIDVN--VGDFTQIATPS---KYSDVTGF---ILDPSCS 333
           + D  R+ +L   +K       + VN     F +I   +   K  D+  F   + D  CS
Sbjct: 203 DADSRRSHMLVHQLKRLNSANLMVVNHDAQFFPRIKISNDSDKKKDLLKFDRILCDVPCS 262

Query: 334 GSGIFGRKSVDILNNHGKKSNDEVPDENDAEETTDSKNEQLKERLSKLASFQFQIVRHAM 393
           G G   RK+V++  +   +S                           L + Q+ I+   +
Sbjct: 263 GDGTM-RKNVNVWKDWNTQSG------------------------LGLHTVQYNILNRGL 297

Query: 394 S-FPNAKKIVYSTCSIHAEENERVVIDLL---------------LDKKVQSWG---WRVA 434
           +   +  ++VYSTCS++  ENE VV   L               L   V+S G   W V 
Sbjct: 298 NLLKSGGRLVYSTCSLNPIENEAVVAQALRTWGDKIKLVNCGDKLPGLVRSQGISQWPVI 357

Query: 435 KKELVLPTWYRRGFKEEFQEVFTDKTEQECQELADGCVRALPKEDGGIGFF 485
            + +   T   +G +   +  F    E+      + C+R  P +    GFF
Sbjct: 358 DRNM---TEKNKGDEGTIESWFPPSEEEAKNFHLENCIRVYPHQQNTGGFF 405

>NDAI0B01830 Chr2 (436254..438314) [2061 bp, 686 aa] {ON} Anc_8.171
           YBL024W
          Length = 686

 Score = 54.3 bits (129), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 67/295 (22%), Positives = 111/295 (37%), Gaps = 58/295 (19%)

Query: 222 GKIIIQDRASCFPAHILNPSADDVVIDACSAPGNKTTHVAAHIFGDPENPRNDNVQIYAF 281
           G I  Q+  S  P  +L       V+D C+APG+KT  +   +  D + P      + A 
Sbjct: 145 GNISRQEAVSMIPPIVLEVEPHHTVLDMCAAPGSKTAQLIEALHKDTDEPTG---FVVAN 201

Query: 282 EKDPERAQILQKMIKTAGCHKNIDVN--VGDFTQI---ATPSKYSDVTGF---ILDPSCS 333
           + D +R+ +L   +K       + VN     F +I       K  ++  F   + D  CS
Sbjct: 202 DADAKRSHMLVHQLKRLNSANLMVVNHDAQFFPRIKLHTDAEKKKEMLKFDRILCDVPCS 261

Query: 334 GSGIFGRKSVDILNNHGKKSNDEVPDENDAEETTDSKNEQLKERLSKLASFQFQIVRHAM 393
           G G   RK+V++  +   +                            L + Q  I+   +
Sbjct: 262 GDGTM-RKNVNVWKDWNTQGG------------------------LGLHTVQLNILNRGL 296

Query: 394 S-FPNAKKIVYSTCSIHAEENERVVIDLL---------------LDKKVQSWG---WRVA 434
           +   +  ++VYSTCS++  ENE VV + L               L   V+S G   W V 
Sbjct: 297 NLLKSGGRLVYSTCSMNPIENEAVVAEALRKWGSKIKLVNCDDKLVGLVRSKGISNWPVL 356

Query: 435 KKELVLPTWYRRGFKEEFQEVFTDKTEQECQELADGCVRALPKEDGGIGFFAVCF 489
            + + +     +G +   +  F    E+      D C+R  P +    GFF   F
Sbjct: 357 DRNMAVKN---KGDEGTIESWFPPTEEEREIFHLDSCIRVYPHQQNTGGFFITVF 408

>Kpol_1002.109 s1002 (272892..274904) [2013 bp, 670 aa] {ON}
           (272892..274904) [2013 nt, 671 aa]
          Length = 670

 Score = 53.9 bits (128), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 69/297 (23%), Positives = 112/297 (37%), Gaps = 62/297 (20%)

Query: 222 GKIIIQDRASCFPAHILNPSADDVVIDACSAPGNKTTHVAAHIFGDPENPRNDNVQIYAF 281
           G I  Q+  S  P  +L       V+D C+APG+KT  +   +  + + P      + A 
Sbjct: 145 GNISRQEAVSMIPPIVLEVKPHHTVLDMCAAPGSKTAQLIEALHMEDDEPSG---FVVAN 201

Query: 282 EKDPERAQILQKMIKTAGCHKNIDVN--VGDFTQIAT---PSKYSDVTGF---ILDPSCS 333
           + D +R+ +L   +K       + VN     F +I      ++  DV  F   + D  CS
Sbjct: 202 DADAKRSHMLVHQLKRLNSANLMVVNHDAQFFPRIKLHEDATQKKDVLRFDRVLCDVPCS 261

Query: 334 GSGIFGRKSVDILNNHGKKSNDEVPDENDAEETTDSKNEQLKERLSKLASFQFQIVRHAM 393
           G G   RK+V++  +   +S                           L + Q  I+   +
Sbjct: 262 GDGTM-RKNVNVWRDWNTQSG------------------------LGLHTVQLNILNRGL 296

Query: 394 SFPNAK-KIVYSTCSIHAEENERVVIDLLLDKKVQSWG--WRVAKKELVLP--------- 441
                K ++VYSTCS++  ENE VV   L     + WG   R+   +  LP         
Sbjct: 297 HLLKPKGRLVYSTCSMNPIENEAVVAAAL-----RKWGDKIRLVNCDDKLPGLVRSKGIS 351

Query: 442 TW---------YRRGFKEEFQEVFTDKTEQECQELADGCVRALPKEDGGIGFFAVCF 489
           TW          ++G +   +  F    E+  +     C+R  P +    GFF   F
Sbjct: 352 TWPVVDRNMEEKKKGDENTVESWFAPTPEEAEKFDLSSCIRVYPHQQNTGGFFITVF 408

>TPHA0C02870 Chr3 (620913..622937) [2025 bp, 674 aa] {ON} Anc_8.171
           YBL024W
          Length = 674

 Score = 53.9 bits (128), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 65/291 (22%), Positives = 109/291 (37%), Gaps = 58/291 (19%)

Query: 222 GKIIIQDRASCFPAHILNPSADDVVIDACSAPGNKTTHVAAHIFGDPENPRNDNVQIYAF 281
           G I  Q+  S  P  +L   ++  V+D C+APG+KT  +   +  + + P      + A 
Sbjct: 144 GNISRQEAVSMIPPILLEVESNHTVLDMCAAPGSKTAQLIEALHTNEDEPTG---IVVAN 200

Query: 282 EKDPERAQILQKMIKTAGCHKNIDVN--VGDFTQIATPSKYSDVTGF------ILDPSCS 333
           + D  R+ +L   +K       + VN     F +IA     +D   F      + D  CS
Sbjct: 201 DADARRSHMLVHQLKRLNSANLMVVNHDAQFFPRIALHENTTDSNDFLKFDRILCDVPCS 260

Query: 334 GSGIFGRKSVDILNNHGKKSNDEVPDENDAEETTDSKNEQLKERLSKLASFQFQIVRHAM 393
           G G   RK+V++  +   +                            L + Q  I+   +
Sbjct: 261 GDGTM-RKNVNVWRDWTSQGG------------------------LGLHNIQLNILNRGL 295

Query: 394 SFPNAK-KIVYSTCSIHAEENERVVIDLL---------------LDKKVQSWG---WRVA 434
                K ++VYSTCS++  ENE V+   L               L   V+S G   W V 
Sbjct: 296 HLLKPKGRLVYSTCSMNPIENEAVIAAALRKWGSKIRVINCDEKLPGLVRSKGIDSWPVF 355

Query: 435 KKELVLPTWYRRGFKEEFQEVFTDKTEQECQELADGCVRALPKEDGGIGFF 485
            +++ +     +G    +   F    E++ Q     C+R  P +     FF
Sbjct: 356 NRDMEIRQKGDQGVSNTW---FPPSEEEKSQFNLQNCIRVYPHQQNTGAFF 403

>ZYRO0G08998g Chr7 complement(726070..728121) [2052 bp, 683 aa] {ON}
           similar to uniprot|P38205 Saccharomyces cerevisiae
           YBL024W
          Length = 683

 Score = 53.9 bits (128), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 70/293 (23%), Positives = 115/293 (39%), Gaps = 62/293 (21%)

Query: 222 GKIIIQDRASCFPAHILNPSADDVVIDACSAPGNKTTHVAAHIFGDPENPRNDNVQIYAF 281
           G I  Q+  S  P  +L+      V+D C+APG+KT  +  ++  D + P      + A 
Sbjct: 142 GNISRQEAVSMIPPTLLDVQPHHTVLDMCAAPGSKTAQMIEYLHRDNDEPSG---FVVAN 198

Query: 282 EKDPERAQILQKMIKTAGCHKNIDVN--VGDFTQIATPSKYS---DVTGF---ILDPSCS 333
           + D +R+ +L   +K       I VN     F ++     ++   D+  F   + D  CS
Sbjct: 199 DADAKRSHMLVHQLKRLNSANLIVVNHDAQFFPRVKAHPDHTNKKDILRFDRVLCDVPCS 258

Query: 334 GSGIFGRKSVDILNNHGKKSNDEVPDENDAEETTDSKNEQLKERLSKLASFQFQIVRHAM 393
           G G   RK+V++  +   ++                           L + Q  I+   +
Sbjct: 259 GDGTM-RKNVNVWRDWTTQNG------------------------LALHNVQLNILNRGL 293

Query: 394 S-FPNAKKIVYSTCSIHAEENERVVIDLLLDKKVQSWGWRVAKKELV--LPTWYR-RGFK 449
               +  ++VYSTCS++  ENE VV + L     + WG +V   +    LP   R  G  
Sbjct: 294 HLLKSGGRLVYSTCSMNPIENEAVVAEAL-----RKWGGKVRLVDCSDKLPGLVRSNGIN 348

Query: 450 E--------EFQEVFTDKT---------EQECQELADGCVRALPKEDGGIGFF 485
           +        E +E   D T         E+  +   D CVR  P +    GFF
Sbjct: 349 QWPVLNRNMETKEKGEDGTNDSWFPPTDEEAARFHLDYCVRVYPHQQNTGGFF 401

>NCAS0B05640 Chr2 complement(1068983..1070962) [1980 bp, 659 aa]
           {ON} 
          Length = 659

 Score = 53.1 bits (126), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 74/295 (25%), Positives = 113/295 (38%), Gaps = 58/295 (19%)

Query: 222 GKIIIQDRASCFPAHILNPSADDVVIDACSAPGNKTTHVAAHIFGDPENPRNDNVQIYAF 281
           G I  Q+  S  P  +L       V+D C+APG+KT  +   +  D   P      + A 
Sbjct: 139 GNISRQEAVSMIPPIVLEVEPHHTVLDMCAAPGSKTAQLLEALHRDSNEPTG---FVVAN 195

Query: 282 EKDPERAQILQKMIKTAGCHKNIDVN--VGDFTQIATPSKYSDVTGF------ILDPSCS 333
           + D  RA +L   +K       + VN     F +I   +  ++ +G       + D  CS
Sbjct: 196 DSDSRRAYMLVHQLKRLNSANLLVVNHDAQFFPKIKLRADATNKSGMLKYDRILCDVPCS 255

Query: 334 GSGIFGRKSVDILNNHGKKSNDEVPDENDAEETTDSKNEQLKERLSKLASFQFQIVRHAM 393
           G G   RK+V++                        K+   +  L  L + Q  I+   +
Sbjct: 256 GDGTM-RKNVNVW-----------------------KDWNTQNALG-LHNVQLNILNRGL 290

Query: 394 S-FPNAKKIVYSTCSIHAEENERVVIDLL---------------LDKKVQSWG---WRVA 434
               +  ++VYSTCS++  ENE VV   L               L   V+S G   W V 
Sbjct: 291 QLLKDNGRLVYSTCSLNPIENEAVVAAALRKWGNKIKLVDCQNKLQGLVRSNGISHWSVY 350

Query: 435 KKELVLPTWYRRGFKEEFQEVFTDKTEQECQELADGCVRALPKEDGGIGFFAVCF 489
            +E+   T      K  + E  TD  E+E   L + C+R  P +    GFF   F
Sbjct: 351 DREMNAITKDSESTKSSWFEP-TD-AEKENFNL-EHCMRVYPHQQNTGGFFIAVF 402

>CAGL0K01991g Chr11 (173969..175987) [2019 bp, 672 aa] {ON} highly
           similar to uniprot|P38205 Saccharomyces cerevisiae
           YBL024w NCL1 tRNA (cytosine-5-)-methyltransferase
          Length = 672

 Score = 53.1 bits (126), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 57/221 (25%), Positives = 88/221 (39%), Gaps = 42/221 (19%)

Query: 222 GKIIIQDRASCFPAHILNPSADDVVIDACSAPGNKTTHVAAHIFGDPENPRNDNVQIYAF 281
           G I  Q+  S  P  +L       V+D C+APG+KTT +   +  D + P      + A 
Sbjct: 143 GNISRQEAVSMIPPIVLEVEPHHTVLDMCAAPGSKTTQMIEALHKDTDEPTG---FVVAN 199

Query: 282 EKDPERAQILQKMIKTAGCHKNIDVN--VGDFTQIAT---PSKYSDVTGF---ILDPSCS 333
           + D  R+ +L   +K       + VN     F +I     PSK      F   + D  CS
Sbjct: 200 DADSRRSHMLVHQLKRLNSANLMVVNHDAQFFPRIILSDEPSKKKAQLKFDRILCDVPCS 259

Query: 334 GSGIFGRKSVDILNNHGKKSNDEVPDENDAEETTDSKNEQLKERLSKLASFQFQIVRHAM 393
           G G   RK+V++  +   +                            L + Q  I+   +
Sbjct: 260 GDGTM-RKNVNVWKDWNTQG------------------------ALGLHTVQLNILDRGL 294

Query: 394 S-FPNAKKIVYSTCSIHAEENERVVIDLLLDKKVQSWGWRV 433
               N  ++VYSTCS++  ENE VV + L     + WG +V
Sbjct: 295 HLLQNNGRLVYSTCSMNPIENEAVVAEAL-----RRWGDKV 330

>NDAI0B02980 Chr2 complement(757926..759965) [2040 bp, 679 aa] {ON} 
          Length = 679

 Score = 52.8 bits (125), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 66/294 (22%), Positives = 113/294 (38%), Gaps = 63/294 (21%)

Query: 222 GKIIIQDRASCFPAHILNPSADDVVIDACSAPGNKTTHVAAHIFGDPENPRNDNVQIYAF 281
           G I  Q+  S  P  +L+      V+D C+APG+KT  +   +  D   P      + A 
Sbjct: 139 GNISRQEAVSMIPPIVLDVKPHHTVLDMCAAPGSKTAQLIEALHMDGPEPSG---FVVAN 195

Query: 282 EKDPERAQILQKMIKTAGCHKNIDVN--VGDFTQIATPS-------KYSDVTGFILDPSC 332
           + D +R+ +L   +K       + VN     F +I   S       +Y      + D  C
Sbjct: 196 DSDSKRSHMLVHQLKRLNSANLMVVNHDAQFFPKIQLDSNKGRHNKEYLKFDRILCDVPC 255

Query: 333 SGSGIFGRKSVDILNNHGKKSNDEVPDENDAEETTDSKNEQLKERLSKLASFQFQIVRHA 392
           SG G   RK+V+I  +   +++                          L + Q  I+   
Sbjct: 256 SGDGTI-RKNVNIWKDWNTQNS------------------------LGLHNVQLNILNRG 290

Query: 393 MS-FPNAKKIVYSTCSIHAEENERVVIDLLLDKKVQSWGWRVAK---KELV--------L 440
           +    +  ++VYSTCS+   ENE V+        ++ WG ++     KE++        +
Sbjct: 291 IQLLKSGGRLVYSTCSLSPIENEAVI-----SATLRKWGNKIKLVDCKEMLPGLISSPGI 345

Query: 441 PTW--YRRGFK------EEFQEVFTDKTEQECQEL-ADGCVRALPKEDGGIGFF 485
             W  Y R         E+ ++ +   TE+E  +     C+R  P +    GFF
Sbjct: 346 SKWEVYDRTMSIVSKGAEKSKDTWFQPTEEEANDFNLSHCIRVFPHQQNTGGFF 399

>KLLA0F12562g Chr6 (1163366..1165480) [2115 bp, 704 aa] {ON} highly
           similar to uniprot|P38205 Saccharomyces cerevisiae
           YBL024W
          Length = 704

 Score = 49.3 bits (116), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 64/296 (21%), Positives = 108/296 (36%), Gaps = 59/296 (19%)

Query: 222 GKIIIQDRASCFPAHILNPSADDVVIDACSAPGNKTTHVAAHIFGDPENPRNDNVQIYAF 281
           G I  Q+  S  P  +L+      V+D C+APG+KT  +   +  + + P      + A 
Sbjct: 145 GNISRQEAVSMIPPIVLDVKPHHYVLDMCAAPGSKTAQLIEALHAESDEPSG---FVIAN 201

Query: 282 EKDPERAQILQKMIKTAGCHKNIDVNVG---------DFTQIATPSKYSDVTGFILDPSC 332
           + D +R+ +L   +K       + VN           D T+ +   ++      + D  C
Sbjct: 202 DADYKRSHMLVHQLKRLNSANLMVVNHDAQFFPRIKVDSTEGSKGPQFLKFDRVLCDVPC 261

Query: 333 SGSGIFGRKSVDILNNHGKKSNDEVPDENDAEETTDSKNEQLKERLSKLASFQFQIVRHA 392
           SG G   RK+V++  +    S                           L   Q  I+   
Sbjct: 262 SGDGTM-RKNVNVWKDWNTGSG------------------------LGLHIVQLNILERG 296

Query: 393 MS-FPNAKKIVYSTCSIHAEENERVVIDLL---------------LDKKVQSWG---WRV 433
           ++      K+VYSTCS++  ENE V+   L               L   V+S G   W+V
Sbjct: 297 LNLLKEGGKLVYSTCSLNPIENEAVIAAALRRWGDKVRLVNCDDQLPGLVRSKGITEWKV 356

Query: 434 AKKELVLPTWYRRGFKEEFQEVFTDKTEQECQELADGCVRALPKEDGGIGFFAVCF 489
             K+  +     +G +      F    E+  +   + C+R    +    GFF   F
Sbjct: 357 YDKQFQV---REKGHENCLDSWFPPTAEEVEKFHLENCMRVYQHQQNTGGFFITVF 409

>TBLA0A08740 Chr1 (2141750..2143810) [2061 bp, 686 aa] {ON}
           Anc_8.171 YBL024W
          Length = 686

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 52/228 (22%), Positives = 89/228 (39%), Gaps = 56/228 (24%)

Query: 222 GKIIIQDRASCFPAHILNPSADDVVIDACSAPGNKTTHVAAHIFGDPENPRNDNVQIYAF 281
           G I  Q+  S  P  +L       V+D C+APG+KT  +   +  +   P      + A 
Sbjct: 145 GNISRQEAVSMIPPLVLEVKPHHTVLDMCAAPGSKTAQMIEALHMENAEPTG---FVVAN 201

Query: 282 EKDPERAQILQKMIKT------------AGCHKNIDVNVGDFTQIATPSKYSDVTGF--- 326
           + D  R+ +L   +K             A     I ++VGD       +K  D   F   
Sbjct: 202 DSDYRRSHMLVHQLKRLNSANMMVVNHDAQFFPRIKLSVGD-------NKAKDALKFDRI 254

Query: 327 ILDPSCSGSGIFGRKSVDILNNHGKKSNDEVPDENDAEETTDSKNEQLKERLSKLASFQF 386
           + D  CSG G   RK+V++  +   ++                           L + Q+
Sbjct: 255 LCDVPCSGDGTM-RKNVNVWKDWNTQAG------------------------LGLHTIQY 289

Query: 387 QIVRHAMS-FPNAKKIVYSTCSIHAEENERVVIDLLLDKKVQSWGWRV 433
            I+   +       ++VYSTCS++  ENE VV      + +++WG ++
Sbjct: 290 NILNRGLHLLKTGGRLVYSTCSLNPIENEAVVA-----RALRTWGSKI 332

>Kwal_14.2081 s14 (598648..599463) [816 bp, 272 aa] {ON} YBL024W
           (NCL1) - Probable proliferating-cell nucleolar antigen
           (human p120) [contig 230] PARTIAL
          Length = 272

 Score = 38.9 bits (89), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 32/129 (24%), Positives = 54/129 (41%), Gaps = 9/129 (6%)

Query: 222 GKIIIQDRASCFPAHILNPSADDVVIDACSAPGNKTTHVAAHIFGDPENPRNDNVQIYAF 281
           G I  Q+  S  P  +L       V+D C+APG+KT  +   +    + P      + A 
Sbjct: 145 GNISRQEAVSMIPPIVLEVEPHHAVLDMCAAPGSKTAQMIEALHATEDEPTG---FVVAN 201

Query: 282 EKDPERAQILQKMIKTAGCHKNIDVN--VGDFTQIATPSKYSDVTGF---ILDPSCSGSG 336
           + D  R+ +L   +K       + VN     F ++   +  +    F   + D  CSG G
Sbjct: 202 DADARRSHMLVHQLKRLNSANLMVVNHDAQFFPRVKLDNDSNQFLKFDRVLCDVPCSGDG 261

Query: 337 IFGRKSVDI 345
              RK+V++
Sbjct: 262 TM-RKNVNV 269

>Ecym_3003 Chr3 complement(6934..7893) [960 bp, 319 aa] {ON} similar
           to Ashbya gossypii ACR026W
          Length = 319

 Score = 36.2 bits (82), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 32/119 (26%), Positives = 49/119 (41%), Gaps = 24/119 (20%)

Query: 205 YGIHISDKITSHELYKQGKIIIQDRASCFPAHILNPSADDVVIDACSAPGNKTTHVAAHI 264
           +   +   I  + L  QG   I D+A   P+        D+V++     GN TT +    
Sbjct: 30  FNTDLGQHILKNPLVAQG---IVDKAQIKPS--------DIVLEVGPGTGNLTTRIL--- 75

Query: 265 FGDPENPRNDNVQIYAFEKDPERAQILQKMIKTAGCHKNIDVNVGDFTQIATPSKYSDV 323
               E  R    ++ A E DP  A  L K +      K +++ +GDFT+   P  Y DV
Sbjct: 76  ----EKAR----KVVAVEFDPRMAAELTKRVHGTAAEKKLEIILGDFTKTELP--YFDV 124

>Skud_16.11 Chr16 (18214..19170) [957 bp, 318 aa] {ON} YPL266W
           (REAL)
          Length = 318

 Score = 35.4 bits (80), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 31/119 (26%), Positives = 48/119 (40%), Gaps = 24/119 (20%)

Query: 205 YGIHISDKITSHELYKQGKIIIQDRASCFPAHILNPSADDVVIDACSAPGNKTTHVAAHI 264
           +   +   I  + L  QG   I D+A   P+        DVV++     GN T  +    
Sbjct: 30  FNTDLGQHILKNPLVAQG---IVDKAQIRPS--------DVVLEVGPGTGNLTVRIL--- 75

Query: 265 FGDPENPRNDNVQIYAFEKDPERAQILQKMIKTAGCHKNIDVNVGDFTQIATPSKYSDV 323
               E  +N    + A E DP  A  L K ++     K +++ +GDF +   P  Y DV
Sbjct: 76  ----EQAKN----VVAVEMDPRMAAELTKRVRGTPVEKKLEIMLGDFMKTELP--YFDV 124

>YPL266W Chr16 (39121..40077) [957 bp, 318 aa] {ON}  DIM1Essential
           18S rRNA dimethylase (dimethyladenosine transferase),
           responsible for conserved m6(2)Am6(2)A dimethylation in
           3'-terminal loop of 18S rRNA, part of 90S and 40S
           pre-particles in nucleolus, involved in pre-ribosomal
           RNA processing
          Length = 318

 Score = 34.7 bits (78), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 30/119 (25%), Positives = 48/119 (40%), Gaps = 24/119 (20%)

Query: 205 YGIHISDKITSHELYKQGKIIIQDRASCFPAHILNPSADDVVIDACSAPGNKTTHVAAHI 264
           +   +   I  + L  QG   I D+A   P+        DVV++     GN T  +    
Sbjct: 30  FNTDLGQHILKNPLVAQG---IVDKAQIRPS--------DVVLEVGPGTGNLTVRIL--- 75

Query: 265 FGDPENPRNDNVQIYAFEKDPERAQILQKMIKTAGCHKNIDVNVGDFTQIATPSKYSDV 323
               E  +N    + A E DP  A  L K ++     K +++ +GDF +   P  Y D+
Sbjct: 76  ----EQAKN----VVAVEMDPRMAAELTKRVRGTPVEKKLEIMLGDFMKTELP--YFDI 124

>Suva_16.39 Chr16 (54705..55661) [957 bp, 318 aa] {ON} YPL266W
           (REAL)
          Length = 318

 Score = 34.3 bits (77), Expect = 0.55,   Method: Compositional matrix adjust.
 Identities = 30/119 (25%), Positives = 48/119 (40%), Gaps = 24/119 (20%)

Query: 205 YGIHISDKITSHELYKQGKIIIQDRASCFPAHILNPSADDVVIDACSAPGNKTTHVAAHI 264
           +   +   I  + L  QG   I D+A   P+        DVV++     GN T  +    
Sbjct: 30  FNTDLGQHILKNPLVAQG---IVDKAQIRPS--------DVVLEVGPGTGNLTVRIL--- 75

Query: 265 FGDPENPRNDNVQIYAFEKDPERAQILQKMIKTAGCHKNIDVNVGDFTQIATPSKYSDV 323
               E  +N    + A E DP  A  L K ++     K +++ +GDF +   P  Y D+
Sbjct: 76  ----EQAKN----VVAVEMDPRMAAELTKRVRGTPVEKKLEILLGDFMKTELP--YFDI 124

>NDAI0I02710 Chr9 (636403..637362) [960 bp, 319 aa] {ON} Anc_6.1
           YPL266W
          Length = 319

 Score = 33.5 bits (75), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 30/119 (25%), Positives = 47/119 (39%), Gaps = 24/119 (20%)

Query: 205 YGIHISDKITSHELYKQGKIIIQDRASCFPAHILNPSADDVVIDACSAPGNKTTHVAAHI 264
           +   +   I  + L  QG   I D+A   P+        D+V++     GN T  +    
Sbjct: 31  FNTDLGQHILKNPLVAQG---IVDKAQIKPS--------DIVLEVGPGTGNLTVRIL--- 76

Query: 265 FGDPENPRNDNVQIYAFEKDPERAQILQKMIKTAGCHKNIDVNVGDFTQIATPSKYSDV 323
               E  RN    + A E DP  A  L K +      K +++ +GDF +   P  Y D+
Sbjct: 77  ----EQARN----VIAVEMDPRMAAELTKRVHGTPGEKKLEIMLGDFMKTELP--YFDI 125

>Smik_13.472 Chr13 complement(767729..771982) [4254 bp, 1417 aa]
           {ON} YMR259C (REAL)
          Length = 1417

 Score = 33.9 bits (76), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 30/116 (25%), Positives = 54/116 (46%), Gaps = 8/116 (6%)

Query: 160 NPLRISNHDTDQVLNELKKKFPTRVNTWKDIIPGSIYYDEFI-PNLYGIHISDKITSHEL 218
           NP +I+N + D +L E+++ F   +   KD +P        + P+ + I +   + SH++
Sbjct: 25  NPSKINNENKDVILGEIEQDFGYLIQYIKDGLPDLNESTRLVFPDTFSICL---LRSHQI 81

Query: 219 YKQGKIIIQDRASCFPAHILN-PSAD---DVVIDACSAPGNKTTHVAAHIFGDPEN 270
               KI  Q+  S    HIL  P+A+   + V+D  +  G    +    +FG   N
Sbjct: 82  IVNKKIDSQEYLSAIKRHILTVPNANIIFEYVLDFWADGGAPLMNALKDLFGKLLN 137

>SAKL0E00660g Chr5 complement(42779..43747) [969 bp, 322 aa] {ON}
           highly similar to uniprot|P41819 Saccharomyces
           cerevisiae YPL266W DIM1 Essential 18S rRNA dimethylase
           responsible for conserved m6(2)Am6(2)A dimethylation in
           3'- terminal loop of 18 S rRNA part of 90S and 40S pre-
           particles in nucleolus involved in pre-ribosomal RNA
           processing
          Length = 322

 Score = 33.5 bits (75), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 30/119 (25%), Positives = 47/119 (39%), Gaps = 24/119 (20%)

Query: 205 YGIHISDKITSHELYKQGKIIIQDRASCFPAHILNPSADDVVIDACSAPGNKTTHVAAHI 264
           +   +   I  + L  QG   I D+A   P+        DVV++     GN T  +    
Sbjct: 31  FNTDLGQHILKNPLVAQG---IVDKAQIKPS--------DVVLEVGPGTGNLTVRIL--- 76

Query: 265 FGDPENPRNDNVQIYAFEKDPERAQILQKMIKTAGCHKNIDVNVGDFTQIATPSKYSDV 323
               E  R    ++ A E DP  A  L K +      K +++ +GDF +   P  Y D+
Sbjct: 77  ----EQAR----RVVAVEMDPRMAAELTKRVHGTAAEKKLEILLGDFMKTELP--YFDI 125

>Smik_6.474 Chr6 complement(781184..782140) [957 bp, 318 aa] {ON}
           YPL266W (REAL)
          Length = 318

 Score = 32.7 bits (73), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 29/119 (24%), Positives = 48/119 (40%), Gaps = 24/119 (20%)

Query: 205 YGIHISDKITSHELYKQGKIIIQDRASCFPAHILNPSADDVVIDACSAPGNKTTHVAAHI 264
           +   +   I  + L  QG   I D+A   P+        DVV++     GN T  +    
Sbjct: 30  FNTDLGQHILKNPLVAQG---IVDKAQIRPS--------DVVLEVGPGTGNLTVRIL--- 75

Query: 265 FGDPENPRNDNVQIYAFEKDPERAQILQKMIKTAGCHKNIDVNVGDFTQIATPSKYSDV 323
               E  ++    + A E DP  A  L K ++     K +++ +GDF +   P  Y D+
Sbjct: 76  ----EQAKS----VVAVEMDPRMAAELTKRVRGTQVEKKLEIMLGDFMKTELP--YFDI 124

>Kpol_449.12 s449 complement(42834..43793) [960 bp, 319 aa] {ON}
           complement(42834..43793) [960 nt, 320 aa]
          Length = 319

 Score = 32.7 bits (73), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 29/119 (24%), Positives = 48/119 (40%), Gaps = 24/119 (20%)

Query: 205 YGIHISDKITSHELYKQGKIIIQDRASCFPAHILNPSADDVVIDACSAPGNKTTHVAAHI 264
           +   +   I  + L  QG   I D+A+  P+        D+V++     GN T  +    
Sbjct: 31  FNTDLGQHILKNPLVAQG---IVDKANIKPS--------DIVLEVGPGTGNLTVRIL--- 76

Query: 265 FGDPENPRNDNVQIYAFEKDPERAQILQKMIKTAGCHKNIDVNVGDFTQIATPSKYSDV 323
               E  R    ++ A E DP  A  L K +      K +++ +GDF +   P  Y D+
Sbjct: 77  ----EQAR----KVVAVEMDPRMAAELTKRVHGTPAEKKLEIMLGDFMKTELP--YFDI 125

>TBLA0A07080 Chr1 complement(1748948..1749913) [966 bp, 321 aa] {ON}
           Anc_6.1 YPL266W
          Length = 321

 Score = 32.7 bits (73), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 30/119 (25%), Positives = 47/119 (39%), Gaps = 24/119 (20%)

Query: 205 YGIHISDKITSHELYKQGKIIIQDRASCFPAHILNPSADDVVIDACSAPGNKTTHVAAHI 264
           +   +   I  + L  QG   I D+A   P+        D+V++     GN T  +    
Sbjct: 31  FNTDLGQHILKNPLVAQG---IVDKAQIKPS--------DIVLEVGPGTGNLTVRIL--- 76

Query: 265 FGDPENPRNDNVQIYAFEKDPERAQILQKMIKTAGCHKNIDVNVGDFTQIATPSKYSDV 323
               E  R    ++ A E DP  A  L K +      K +D+ +GDF +   P  Y D+
Sbjct: 77  ----EQAR----KVIAVEFDPRMAAELTKRVHGTPAEKKLDIILGDFMKTELP--YFDI 125

>ZYRO0F00308g Chr6 complement(32198..33157) [960 bp, 319 aa] {ON}
           highly similar to uniprot|P41819 Saccharomyces
           cerevisiae YPL266W DIM1 Essential 18S rRNA dimethylase
           responsible for conserved m6(2)Am6(2)A dimethylation in
           3'- terminal loop of 18 S rRNA part of 90S and 40S pre-
           particles in nucleolus involved in pre-ribosomal RNA
           processing
          Length = 319

 Score = 32.7 bits (73), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 28/119 (23%), Positives = 46/119 (38%), Gaps = 24/119 (20%)

Query: 205 YGIHISDKITSHELYKQGKIIIQDRASCFPAHILNPSADDVVIDACSAPGNKTTHVAAHI 264
           +   +   I  + L  QG   I D+A   P+        D V++     GN T  +   +
Sbjct: 31  FNTDLGQHILKNPLVAQG---IVDKAQLRPS--------DTVLEVGPGTGNLTVRILEQV 79

Query: 265 FGDPENPRNDNVQIYAFEKDPERAQILQKMIKTAGCHKNIDVNVGDFTQIATPSKYSDV 323
                       + YA E DP  A  L K ++     + +++ +GDF +   P  Y DV
Sbjct: 80  -----------RKAYAVEMDPRMAAELTKRVRGTDGERKLEILLGDFIKTDLP--YFDV 125

>TPHA0J00200 Chr10 complement(47344..48303) [960 bp, 319 aa] {ON}
           Anc_6.1 YPL266W
          Length = 319

 Score = 32.3 bits (72), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 30/119 (25%), Positives = 47/119 (39%), Gaps = 24/119 (20%)

Query: 205 YGIHISDKITSHELYKQGKIIIQDRASCFPAHILNPSADDVVIDACSAPGNKTTHVAAHI 264
           +   +   I  + L  QG   I D+A   P+        D+V++     GN T  +    
Sbjct: 31  FNTDLGQHILKNPLVAQG---IVDKAGIQPS--------DIVLEVGPGTGNLTVRIL--- 76

Query: 265 FGDPENPRNDNVQIYAFEKDPERAQILQKMIKTAGCHKNIDVNVGDFTQIATPSKYSDV 323
               E  R    ++ A E DP  A  L K +      K +D+ +GDF +   P  Y D+
Sbjct: 77  ----EQAR----KVVAVEMDPRMAAELTKRVHGTPGEKKLDILLGDFMKTDLP--YFDI 125

>KAFR0B06450 Chr2 complement(1337903..1338859) [957 bp, 318 aa] {ON}
           Anc_6.1 YPL266W
          Length = 318

 Score = 32.3 bits (72), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 30/119 (25%), Positives = 48/119 (40%), Gaps = 24/119 (20%)

Query: 205 YGIHISDKITSHELYKQGKIIIQDRASCFPAHILNPSADDVVIDACSAPGNKTTHVAAHI 264
           +   +   I  + L  QG   I D+A+  P+        DVV++     GN T  +    
Sbjct: 30  FNTDLGQHILKNPLVAQG---IVDKANIKPS--------DVVLEVGPGTGNLTVRIL--- 75

Query: 265 FGDPENPRNDNVQIYAFEKDPERAQILQKMIKTAGCHKNIDVNVGDFTQIATPSKYSDV 323
               E  R    ++ A E DP  A  L K +      + +++ +GDF +   P  Y DV
Sbjct: 76  ----EQAR----KVVAVEMDPRMAAELTKRVHGTPAERKLEIILGDFMKTELP--YFDV 124

>CAGL0L07678g Chr12 complement(846285..847238) [954 bp, 317 aa] {ON}
           highly similar to uniprot|P41819 Saccharomyces
           cerevisiae YPL266w DIM1
          Length = 317

 Score = 32.3 bits (72), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 29/119 (24%), Positives = 47/119 (39%), Gaps = 24/119 (20%)

Query: 205 YGIHISDKITSHELYKQGKIIIQDRASCFPAHILNPSADDVVIDACSAPGNKTTHVAAHI 264
           +   +   I  + L  QG   I D+A   P+        D+V++     GN T  +    
Sbjct: 30  FNTDLGQHILKNPLVAQG---IVDKAQIKPS--------DIVLEVGPGTGNLTVRIL--- 75

Query: 265 FGDPENPRNDNVQIYAFEKDPERAQILQKMIKTAGCHKNIDVNVGDFTQIATPSKYSDV 323
               E  R    ++ A E DP  A  L K +      K +++ +GDF +   P  Y D+
Sbjct: 76  ----EQAR----KVVAVEMDPRMAAELTKRVHGTPAEKKLEIMLGDFMKTELP--YFDI 124

>KNAG0L02440 Chr12 (434232..435185) [954 bp, 317 aa] {ON} Anc_6.1
           YPL266W
          Length = 317

 Score = 32.3 bits (72), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 28/119 (23%), Positives = 45/119 (37%), Gaps = 24/119 (20%)

Query: 205 YGIHISDKITSHELYKQGKIIIQDRASCFPAHILNPSADDVVIDACSAPGNKTTHVAAHI 264
           +   +   I  + L  QG   I D+A   P+        D+V++     GN T  +    
Sbjct: 30  FNTDLGQHILKNPLVAQG---IVDKAHIKPS--------DIVLEVGPGTGNLTVRIL--- 75

Query: 265 FGDPENPRNDNVQIYAFEKDPERAQILQKMIKTAGCHKNIDVNVGDFTQIATPSKYSDV 323
                       ++ A E DP  A  L K +      K +D+ +GDF +   P  Y D+
Sbjct: 76  --------EKAKKVVAVEMDPRMAAELTKRVHGTPAEKKLDIMLGDFMKTELP--YFDI 124

>ZYRO0B11836g Chr2 (940987..943299) [2313 bp, 770 aa] {ON} highly
           similar to uniprot|P06839 Saccharomyces cerevisiae
           YER171W RAD3 5' to 3' DNA helicase involved in
           nucleotide excision repair and transcription subunit of
           RNA polymerase II transcription initiation factor TFIIH
           subunit of Nucleotide Excision Repair Factor 3 (NEF3)
           homolog of human XPD protein
          Length = 770

 Score = 32.3 bits (72), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 22/76 (28%), Positives = 37/76 (48%), Gaps = 7/76 (9%)

Query: 362 DAEETTDSKNEQLKERLS---KLASFQFQIVRHAMSFPNAKKIVYSTCSIHAEENERVVI 418
           D + T DS    + E  S   K  S     + + M +P  +KI+Y  CS    E E+ ++
Sbjct: 27  DLKRTLDSGGNSILEMPSGTGKTVSLLSLTIAYQMHYPEHRKIIY--CSRTMSEIEKALV 84

Query: 419 DL--LLDKKVQSWGWR 432
           +L  L+D + +  G+R
Sbjct: 85  ELENLMDYRTKELGYR 100

>TBLA0H01880 Chr8 (441695..446821) [5127 bp, 1708 aa] {ON} Anc_5.370
           YHR080C
          Length = 1708

 Score = 32.0 bits (71), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 17/49 (34%), Positives = 26/49 (53%), Gaps = 7/49 (14%)

Query: 197 YDEFIPNLYGIHISDKIT-------SHELYKQGKIIIQDRASCFPAHIL 238
           +  F  N+ GI   +K+        S ++ +QGK+ I DR  CF A+IL
Sbjct: 826 FHSFFKNINGISPDEKLIIDITCALSRDILQQGKMYITDRNICFNANIL 874

>KLTH0H03102g Chr8 (275767..277179) [1413 bp, 470 aa] {ON} highly
           similar to uniprot|Q12464 Saccharomyces cerevisiae
           YPL235W RVB2 RUVB-like protein TIP49b Homologue
          Length = 470

 Score = 31.6 bits (70), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 14/43 (32%), Positives = 25/43 (58%), Gaps = 5/43 (11%)

Query: 162 LRISNHDTDQVLNELKKKFPTRVNTWK-----DIIPGSIYYDE 199
           L +   DT ++ +E++ +  T+V  WK     DI+PG ++ DE
Sbjct: 255 LALFTGDTGEIRSEVRDQINTKVAEWKEEGKADIVPGVLFIDE 297

>Kwal_56.24270 s56 complement(930311..931723) [1413 bp, 470 aa] {ON}
           YPL235W (RVB2) - RUVB-like protein [contig 165] FULL
          Length = 470

 Score = 31.6 bits (70), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 14/43 (32%), Positives = 25/43 (58%), Gaps = 5/43 (11%)

Query: 162 LRISNHDTDQVLNELKKKFPTRVNTWK-----DIIPGSIYYDE 199
           L +   DT ++ +E++ +  T+V  WK     DI+PG ++ DE
Sbjct: 255 LALFTGDTGEIRSEVRDQINTKVAEWKEEGKADIVPGVLFIDE 297

>SAKL0D06644g Chr4 complement(548576..550987) [2412 bp, 803 aa] {ON}
           weakly similar to uniprot|P47046 Saccharomyces
           cerevisiae YJL051W Protein of unknown function localized
           to the bud tip mRNA is targeted to the bud via the mRNA
           transport system involving She2p
          Length = 803

 Score = 31.6 bits (70), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 30/89 (33%), Positives = 45/89 (50%), Gaps = 17/89 (19%)

Query: 312 TQIATPSKYSDVTGFILDPSCSGSGIFGRKSVDILNNHGKKSNDE---VPDE------ND 362
           T IAT S     TG +  PS  GS  FG  S    N+H  +SN +   +P        N+
Sbjct: 575 TSIATGS----ATGSLRSPSKLGS-FFGTSSAVGTNHHHTRSNSQFTLLPSSMNLVGANN 629

Query: 363 AEETTDSKNEQLKERLSK---LASFQFQI 388
           +  ++ SK  +LK+RLSK   L++  F++
Sbjct: 630 SVHSSPSKGSRLKKRLSKKLSLSNISFKL 658

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.135    0.407 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 55,163,184
Number of extensions: 2557987
Number of successful extensions: 10194
Number of sequences better than 10.0: 106
Number of HSP's gapped: 10374
Number of HSP's successfully gapped: 126
Length of query: 492
Length of database: 53,481,399
Length adjustment: 114
Effective length of query: 378
Effective length of database: 40,409,475
Effective search space: 15274781550
Effective search space used: 15274781550
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 68 (30.8 bits)