Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
CAGL0M06919g2.288ON95695650070.0
YNL023C (FAP1)2.288ON96589829810.0
NDAI0G006702.288ON96895729500.0
Suva_14.3242.288ON96890029490.0
Smik_14.3082.288ON96590029350.0
KNAG0H019902.288ON97395229150.0
Skud_14.3062.288ON97090029030.0
TDEL0G021902.288ON93694028770.0
NCAS0G037802.288ON95794228750.0
KAFR0H033002.288ON96696028020.0
TBLA0B059502.288ON99593127270.0
ZYRO0A01936g2.288ON95390126900.0
Kpol_1039.452.288ON96890325780.0
KLTH0G10406g2.288ON96396825690.0
SAKL0E07634g2.288ON97489625510.0
TPHA0D015302.288ON96290725280.0
Kwal_27.115182.288ON95389825110.0
KLLA0E08317g2.288ON92190023800.0
ADL213W2.288ON90889923370.0
Ecym_33272.288ON92688822100.0
Kwal_0.3271.427ON101985772.2
TPHA0C010008.295ON490163753.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0M06919g
         (956 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0M06919g Chr13 complement(703702..706572) [2871 bp, 956 aa] ...  1933   0.0  
YNL023C Chr14 complement(588263..591160) [2898 bp, 965 aa] {ON} ...  1152   0.0  
NDAI0G00670 Chr7 (146574..149480) [2907 bp, 968 aa] {ON} Anc_2.2...  1140   0.0  
Suva_14.324 Chr14 complement(571146..574052) [2907 bp, 968 aa] {...  1140   0.0  
Smik_14.308 Chr14 complement(550650..553547) [2898 bp, 965 aa] {...  1135   0.0  
KNAG0H01990 Chr8 complement(349855..352776) [2922 bp, 973 aa] {O...  1127   0.0  
Skud_14.306 Chr14 complement(558943..561855) [2913 bp, 970 aa] {...  1122   0.0  
TDEL0G02190 Chr7 (430157..432967) [2811 bp, 936 aa] {ON} Anc_2.2...  1112   0.0  
NCAS0G03780 Chr7 complement(696877..699750) [2874 bp, 957 aa] {O...  1112   0.0  
KAFR0H03300 Chr8 complement(627520..630420) [2901 bp, 966 aa] {O...  1083   0.0  
TBLA0B05950 Chr2 (1404509..1407496) [2988 bp, 995 aa] {ON} Anc_2...  1055   0.0  
ZYRO0A01936g Chr1 (159749..162610) [2862 bp, 953 aa] {ON} simila...  1040   0.0  
Kpol_1039.45 s1039 (135833..138739) [2907 bp, 968 aa] {ON} (1358...   997   0.0  
KLTH0G10406g Chr7 (880042..882933) [2892 bp, 963 aa] {ON} simila...   994   0.0  
SAKL0E07634g Chr5 complement(616444..619368) [2925 bp, 974 aa] {...   987   0.0  
TPHA0D01530 Chr4 complement(313063..315951) [2889 bp, 962 aa] {O...   978   0.0  
Kwal_27.11518 s27 complement(832986..835847) [2862 bp, 953 aa] {...   971   0.0  
KLLA0E08317g Chr5 complement(747272..750037) [2766 bp, 921 aa] {...   921   0.0  
ADL213W Chr4 (329646..332372) [2727 bp, 908 aa] {ON} Syntenic ho...   904   0.0  
Ecym_3327 Chr3 (626396..629176) [2781 bp, 926 aa] {ON} similar t...   855   0.0  
Kwal_0.327 s0 complement(154643..157702) [3060 bp, 1019 aa] {ON}...    34   2.2  
TPHA0C01000 Chr3 (214320..229025) [14706 bp, 4901 aa] {ON} Anc_8...    33   3.5  

>CAGL0M06919g Chr13 complement(703702..706572) [2871 bp, 956 aa]
           {ON} similar to uniprot|P53971 Saccharomyces cerevisiae
           YNL023c FAP1
          Length = 956

 Score = 1933 bits (5007), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 942/956 (98%), Positives = 942/956 (98%)

Query: 1   MQDGRTEVTQDEYRHYDDHPDNSSLVIGLSEDESEIETNMGAXXXXXXXXXXXXXXKDMA 60
           MQDGRTEVTQDEYRHYDDHPDNSSLVIGLSEDESEIETNMGA              KDMA
Sbjct: 1   MQDGRTEVTQDEYRHYDDHPDNSSLVIGLSEDESEIETNMGAELSEELSDLDEGDEKDMA 60

Query: 61  YYEKAVQEIVKGDSYSCLICTVELDYTCKLYACEKCYRVYDYECIREWAEKSTSKRTDKL 120
           YYEKAVQEIVKGDSYSCLICTVELDYTCKLYACEKCYRVYDYECIREWAEKSTSKRTDKL
Sbjct: 61  YYEKAVQEIVKGDSYSCLICTVELDYTCKLYACEKCYRVYDYECIREWAEKSTSKRTDKL 120

Query: 121 WACPNCFYTKKAIPKKNRPTCWCGEQVNPEPNPLNPNSCGQTCNAKICSHGCSQICHLGP 180
           WACPNCFYTKKAIPKKNRPTCWCGEQVNPEPNPLNPNSCGQTCNAKICSHGCSQICHLGP
Sbjct: 121 WACPNCFYTKKAIPKKNRPTCWCGEQVNPEPNPLNPNSCGQTCNAKICSHGCSQICHLGP 180

Query: 181 HQECTRMMSIKCSCGKVTKDIVCFQRRLYSKGFNCETVCDKLLPCGIHKCNRKCHTGLCG 240
           HQECTRMMSIKCSCGKVTKDIVCFQRRLYSKGFNCETVCDKLLPCGIHKCNRKCHTGLCG
Sbjct: 181 HQECTRMMSIKCSCGKVTKDIVCFQRRLYSKGFNCETVCDKLLPCGIHKCNRKCHTGLCG 240

Query: 241 SCPETIISKNTNMKIRCYCGQTSKDKIKCKDVRFPANAAYSKDDKGQRWIGVFMCDKIRK 300
           SCPETIISKNTNMKIRCYCGQTSKDKIKCKDVRFPANAAYSKDDKGQRWIGVFMCDKIRK
Sbjct: 241 SCPETIISKNTNMKIRCYCGQTSKDKIKCKDVRFPANAAYSKDDKGQRWIGVFMCDKIRK 300

Query: 301 VPYECGEHSFYEKCKAPPSISGRLICEFSPKKLKTCPCGKNELTDLSKPRSKCTDAIPTC 360
           VPYECGEHSFYEKCKAPPSISGRLICEFSPKKLKTCPCGKNELTDLSKPRSKCTDAIPTC
Sbjct: 301 VPYECGEHSFYEKCKAPPSISGRLICEFSPKKLKTCPCGKNELTDLSKPRSKCTDAIPTC 360

Query: 361 GQVCGKMLKCGKHKCPFACHLGDCMDPCTQIEKVRCACEQKQFTIPCGFNDHARCNLKCE 420
           GQVCGKMLKCGKHKCPFACHLGDCMDPCTQIEKVRCACEQKQFTIPCGFNDHARCNLKCE
Sbjct: 361 GQVCGKMLKCGKHKCPFACHLGDCMDPCTQIEKVRCACEQKQFTIPCGFNDHARCNLKCE 420

Query: 421 SLMSCRRHRCTERCCAGRPLAERRRKTMKINVRDLADESTIEPIHICLKDCNLTLSCGIH 480
           SLMSCRRHRCTERCCAGRPLAERRRKTMKINVRDLADESTIEPIHICLKDCNLTLSCGIH
Sbjct: 421 SLMSCRRHRCTERCCAGRPLAERRRKTMKINVRDLADESTIEPIHICLKDCNLTLSCGIH 480

Query: 481 KCNRKCHAGKCPPCLESDSNDLVCPCGKTIVEAPVRCGTKLPNCPYPCIRVVRGETDCGH 540
           KCNRKCHAGKCPPCLESDSNDLVCPCGKTIVEAPVRCGTKLPNCPYPCIRVVRGETDCGH
Sbjct: 481 KCNRKCHAGKCPPCLESDSNDLVCPCGKTIVEAPVRCGTKLPNCPYPCIRVVRGETDCGH 540

Query: 541 SPMPHECHPPDIPCPDCTATVFKPCKCGKEQRVRTVCFMKDVSCGKVCGERLQTCYHKCQ 600
           SPMPHECHPPDIPCPDCTATVFKPCKCGKEQRVRTVCFMKDVSCGKVCGERLQTCYHKCQ
Sbjct: 541 SPMPHECHPPDIPCPDCTATVFKPCKCGKEQRVRTVCFMKDVSCGKVCGERLQTCYHKCQ 600

Query: 601 KKCHEPGACQTVCKQTCNMPRLYCNHRCPKPCHKFEECPDIPCTALVKITCPCGRIEKEV 660
           KKCHEPGACQTVCKQTCNMPRLYCNHRCPKPCHKFEECPDIPCTALVKITCPCGRIEKEV
Sbjct: 601 KKCHEPGACQTVCKQTCNMPRLYCNHRCPKPCHKFEECPDIPCTALVKITCPCGRIEKEV 660

Query: 661 TCGVYSKNKEAQDSTRIVCDEECAVLQRHMQLKEAFGIVDKPQNTHNEEMARLEQVISTA 720
           TCGVYSKNKEAQDSTRIVCDEECAVLQRHMQLKEAFGIVDKPQNTHNEEMARLEQVISTA
Sbjct: 661 TCGVYSKNKEAQDSTRIVCDEECAVLQRHMQLKEAFGIVDKPQNTHNEEMARLEQVISTA 720

Query: 721 STFADLDLPFTEPVITTYIRHENWCTDIENTLNKLIDDNNRTSLHFKPMRPPQRYFIREL 780
           STFADLDLPFTEPVITTYIRHENWCTDIENTLNKLIDDNNRTSLHFKPMRPPQRYFIREL
Sbjct: 721 STFADLDLPFTEPVITTYIRHENWCTDIENTLNKLIDDNNRTSLHFKPMRPPQRYFIREL 780

Query: 781 AKAYNLYSESQDPEPNRSVFVKKNLDGSSTKPILSISEAAPLYQSYKKLEKEKKQANFES 840
           AKAYNLYSESQDPEPNRSVFVKKNLDGSSTKPILSISEAAPLYQSYKKLEKEKKQANFES
Sbjct: 781 AKAYNLYSESQDPEPNRSVFVKKNLDGSSTKPILSISEAAPLYQSYKKLEKEKKQANFES 840

Query: 841 MTTTRLINFTPEMSPELESAARFNGFLVTNVGEFTSTDDLQNLFAPYLKSTLVVEPQFQI 900
           MTTTRLINFTPEMSPELESAARFNGFLVTNVGEFTSTDDLQNLFAPYLKSTLVVEPQFQI
Sbjct: 841 MTTTRLINFTPEMSPELESAARFNGFLVTNVGEFTSTDDLQNLFAPYLKSTLVVEPQFQI 900

Query: 901 LPERKQAVIYPNKYKEISINVERDMETLVQHFDFLIKESLLAGGVELCNIENVLAE 956
           LPERKQAVIYPNKYKEISINVERDMETLVQHFDFLIKESLLAGGVELCNIENVLAE
Sbjct: 901 LPERKQAVIYPNKYKEISINVERDMETLVQHFDFLIKESLLAGGVELCNIENVLAE 956

>YNL023C Chr14 complement(588263..591160) [2898 bp, 965 aa] {ON}
           FAP1Protein that binds to Fpr1p, conferring rapamycin
           resistance by competing with rapamycin for Fpr1p
           binding; accumulates in the nucleus upon treatment of
           cells with rapamycin; has similarity to D. melanogaster
           shuttle craft and human NFX1
          Length = 965

 Score = 1152 bits (2981), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 543/898 (60%), Positives = 660/898 (73%), Gaps = 2/898 (0%)

Query: 58  DMAYYEKAVQEIVKGDSYSCLICTVELDYTCKLYACEKCYRVYDYECIREWAEKSTSKRT 117
           DM YYE+A+QEI  GDSY C+ICTVE+DYTC+++AC++CYRV+DY CIREWA KST K  
Sbjct: 49  DMQYYERAIQEISSGDSYVCMICTVEMDYTCQMFACKRCYRVFDYGCIREWALKSTEKTV 108

Query: 118 DKLWACPNCFYTKKAIPKKNRPTCWCGEQVNPEPNPLNPNSCGQTCNAKICSHGCSQICH 177
           D++W CPNC+Y  K +P KNRPTCWCG+ VNP+PNPL+PNSCGQTCNA  C HGCS+ICH
Sbjct: 109 DRIWKCPNCYYVSKRVPVKNRPTCWCGKVVNPDPNPLDPNSCGQTCNASTCMHGCSKICH 168

Query: 178 LGPHQECTRMMSIKCSCGKVTKDIVCFQRRLYSKGFNCETVCDKLLPCGIHKCNRKCHTG 237
           LGPH ECTRM+ I C CGK +K I C+Q ++  K FNC+ VC   L C IH C +KCH G
Sbjct: 169 LGPHPECTRMVEIMCHCGKHSKSIFCYQSKVMKKNFNCQEVCGLPLSCSIHTCKKKCHPG 228

Query: 238 LCGSCPETIISKNTNMK-IRCYCGQTSKDKIKCKDVRFPANAAYSKDDKGQRWIGVFMCD 296
           LCG CPE IISK++  K I+CYCG  ++  IKC + +FP +   SKD+ G RWIGVF C 
Sbjct: 229 LCGPCPEMIISKDSPKKQIKCYCGNHTRANIKCSETKFPKSGKSSKDENGNRWIGVFACA 288

Query: 297 KIRKVPYECGEHSFYEKCKAPPSISGRLICEFSPKKLKTCPCGKNELTDLSKPRSKCTDA 356
             R V Y C +HSF E C +PP+I+G   C F P  LKTCPCG+  L +L+KPR  C D 
Sbjct: 289 DNRVVDYSCRKHSFIESCISPPTINGEKACPFLPSSLKTCPCGRTALEELTKPRKHCDDP 348

Query: 357 IPTCGQVCGKMLKCGKHKCPFACHLGDCMDPCTQIEKVRCACEQKQFTIPCGFNDHARCN 416
           IPTC   CGK LKCGKH CPF CH   CM+PC QI+ V+CACEQ  F++PCGF    RCN
Sbjct: 349 IPTCDSRCGKPLKCGKHSCPFTCHDKACMEPCLQIDSVKCACEQSTFSVPCGFQGRPRCN 408

Query: 417 LKCESLMSCRRHRCTERCCAGRPLAERRRKTMKINVRDLADESTIEPIHICLKDCNLTLS 476
           +KCESLMSCRRHRCT+RCC+GRP A RR+K +    +DL DES +E  HICLK CNLTLS
Sbjct: 409 IKCESLMSCRRHRCTDRCCSGRPSAIRRKKNL-FRTQDLLDESLVEAKHICLKPCNLTLS 467

Query: 477 CGIHKCNRKCHAGKCPPCLESDSNDLVCPCGKTIVEAPVRCGTKLPNCPYPCIRVVRGET 536
           CGIHKC RKCH GKCPPCLESDSNDLVCPCG T+V APVRCGTKLP C +PCI+VVRGE+
Sbjct: 468 CGIHKCQRKCHPGKCPPCLESDSNDLVCPCGNTVVPAPVRCGTKLPTCNHPCIKVVRGES 527

Query: 537 DCGHSPMPHECHPPDIPCPDCTATVFKPCKCGKEQRVRTVCFMKDVSCGKVCGERLQTCY 596
            CGH PMPH CH  D+ CP CT TVFKPCKCGK+ +VRTVCF  DVSCG  CG  L  CY
Sbjct: 528 TCGHKPMPHTCHSLDVSCPPCTETVFKPCKCGKKTKVRTVCFQTDVSCGIKCGIPLSYCY 587

Query: 597 HKCQKKCHEPGACQTVCKQTCNMPRLYCNHRCPKPCHKFEECPDIPCTALVKITCPCGRI 656
           H CQK CH PG CQ VCKQTC   RL CNH CPKPCH   ECPD+PC  LVKI C CGRI
Sbjct: 588 HTCQKTCHLPGNCQKVCKQTCGQKRLNCNHECPKPCHGKTECPDLPCATLVKIYCKCGRI 647

Query: 657 EKEVTCGVYSKNKEAQDSTRIVCDEECAVLQRHMQLKEAFGIVDKPQNTHNEEMARLEQV 716
           +K VTCG  S      +S+ + C+EEC  L+R  +LKEAFGI ++  N  + E+  L+++
Sbjct: 648 KKSVTCGAKSDRVSVTESSVLDCNEECEALKRLKELKEAFGIKEETNNFTSNELDALKKL 707

Query: 717 ISTASTFADLDLPFTEPVITTYIRHENWCTDIENTLNKLIDDNNRTSLHFKPMRPPQRYF 776
           +S A+TF +L LPFTE  ++ Y + E WC+ IE  LNKL+DD  R+SLHFKPMRPPQR+F
Sbjct: 708 VSVATTFEELQLPFTEAALSVYSKQERWCSQIEAILNKLMDDKTRSSLHFKPMRPPQRHF 767

Query: 777 IRELAKAYNLYSESQDPEPNRSVFVKKNLDGSSTKPILSISEAAPLYQSYKKLEKEKKQA 836
           IRELAKAY LYSESQD EP RSVF+KK  +G+S KP+LS++EA PLY+S+K+L+KE+K  
Sbjct: 768 IRELAKAYGLYSESQDREPMRSVFIKKEDNGASNKPVLSLAEAYPLYESFKQLQKERKAQ 827

Query: 837 NFESMTTTRLINFTPEMSPELESAARFNGFLVTNVGEFTSTDDLQNLFAPYLKSTLVVEP 896
            F++ TT +LINF  + +      A+ NGFLV N+    + +DL+  F P+LK TLVV P
Sbjct: 828 EFQARTTAKLINFEVQDTEPKVEVAKKNGFLVQNLVAGNTAEDLRRFFEPHLKHTLVVNP 887

Query: 897 QFQILPERKQAVIYPNKYKEISINVERDMETLVQHFDFLIKESLLAGGVELCNIENVL 954
           Q+ IL + K A++YP  Y+  S+N ERDME LV HFDF+ KE+ LA  + LC+ E  L
Sbjct: 888 QYLILDDGKTALVYPENYETASVNTERDMELLVGHFDFMAKEAFLADSISLCSTEEEL 945

>NDAI0G00670 Chr7 (146574..149480) [2907 bp, 968 aa] {ON} Anc_2.288
           YNL023C
          Length = 968

 Score = 1140 bits (2950), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 545/957 (56%), Positives = 680/957 (71%), Gaps = 12/957 (1%)

Query: 8   VTQDEYRHYDDHPDNSSLVIGLSEDESEIETNMGAXX------XXXXXXXXXXXXKDMAY 61
           ++  E      HPD  SL++  S DE +   N+ +                    +DM Y
Sbjct: 1   MSDTELNEVSTHPDPKSLILQASADEIKSSENVSSTSDNDEYDQEDEYAAATAADEDMKY 60

Query: 62  YEKAVQEIVKGDSYSCLICTVELDYTCKLYACEKCYRVYDYECIREWAEKSTSKRTDKLW 121
           YE+ +QEI KGDSY C+ICTVE+DYTC++YAC++CYRV+DY+CIREWA KST K  D++W
Sbjct: 61  YERTIQEIAKGDSYVCMICTVEMDYTCQMYACKECYRVFDYDCIREWAVKSTEKTVDRIW 120

Query: 122 ACPNCFYTKKAIPKKNRPTCWCGEQVNPEPNPLNPNSCGQTCNAKICSHGCSQICHLGPH 181
            CPNC++  K +P KNR TCWCG+ VNPE NPLNPNSCGQTCNAKIC HGC+ ICHLGPH
Sbjct: 121 KCPNCYHVNKKVPPKNRSTCWCGKVVNPEANPLNPNSCGQTCNAKICVHGCTNICHLGPH 180

Query: 182 QECTRMMSIKCSCGKVTKDIVCFQRRLY--SKGFNCETVCDKLLPCGIHKCNRKCHTGLC 239
            ECTRM+SI C CGK TKDI C+Q + +  +  F C+  C   L CGIHKC RKCH+GLC
Sbjct: 181 PECTRMLSITCRCGKHTKDIFCYQSKTFKGNSKFQCKDECGLPLSCGIHKCKRKCHSGLC 240

Query: 240 GSCPETI-ISKNTNMKIRCYCGQTSKDKIKCKDVRFPANAAYSKDDKGQRWIGVFMCDKI 298
           G CPE + +++     ++CYCG  ++  +KCKD++ P +A YS D +G +WIGVF C +I
Sbjct: 241 GVCPERLEVNEENAWILKCYCGSETQKSMKCKDIKIPESAKYSSDAEGNKWIGVFACKEI 300

Query: 299 RKVPYECGEHSFYEKCKAPPSISGRLICEFSPKKLKTCPCGKNELTDLSKPRSKCTDAIP 358
           R V Y+C +HSF E+C APP++S    C +SPK LKTCPCGK  L  L+KPR+ CTD IP
Sbjct: 301 RTVQYDCDKHSFIERCIAPPTLSMEKPCPYSPKLLKTCPCGKTPLQKLAKPRTLCTDPIP 360

Query: 359 TCGQVCGKMLKCGKHKCPFACHLGDCMDPCTQIEKVRCACEQKQFTIPCGFNDHARCNLK 418
           TC   C K LKCGKHKCPF CH G CMDPC QIE  +C+CEQ+ F +PC F     CN+K
Sbjct: 361 TCESHCNKPLKCGKHKCPFKCHTGACMDPCLQIETRKCSCEQQSFLVPCQFTGSPHCNIK 420

Query: 419 CESLMSCRRHRCTERCCAGRPLAERRRKTMKINVRDLADESTIEPIHICLKDCNLTLSCG 478
           CESLMSCRRHRC ERCC+GRP AE+R+KT+    +DL DE+ +E  HICLK+CNL LSCG
Sbjct: 421 CESLMSCRRHRCLERCCSGRPAAEKRKKTL-FRSQDLMDETLVEAEHICLKECNLLLSCG 479

Query: 479 IHKCNRKCHAGKCPPCLESDSNDLVCPCGKTIVEAPVRCGTKLPNCPYPCIRVVRGETDC 538
           IH+C RKCH GKCPPCLESDSNDLVCPCGKTIVEAPVRCGTKLP CP+ CI+VVR E  C
Sbjct: 480 IHRCQRKCHPGKCPPCLESDSNDLVCPCGKTIVEAPVRCGTKLPPCPFQCIKVVRNEYPC 539

Query: 539 GHSPMPHECHPPDIPCPDCTATVFKPCKCGKEQRVRTVCFMKDVSCGKVCGERLQTCYHK 598
           GH+PMPH CHP D PCP CTA VFKPCKCGK + VRT+CF  DVSCGK+CG  L+ C HK
Sbjct: 540 GHTPMPHTCHPLDEPCPPCTAPVFKPCKCGKVKEVRTLCFQNDVSCGKICGLPLKDCPHK 599

Query: 599 CQKKCHEPGACQTVCKQTCNMPRLYCNHRCPKPCHKFEECPDIPCTALVKITCPCGRIEK 658
           C K+CH PG CQT CKQ C   R+ C+H C +PCH   ECPD+PCT   K+TC CGR E 
Sbjct: 600 CMKRCHIPGDCQTKCKQICGKRRINCDHTCSRPCHGNTECPDVPCTVSAKVTCECGRRET 659

Query: 659 EVTCGVYSKNKEAQDSTRIVCDEECAVLQRHMQLKEAFGIVDKPQNTHNEEMARLEQVIS 718
            VTCG  S    A  +T + CDEEC +L+RH QLKEAFGI +   ++ + E  RL+ ++ 
Sbjct: 660 YVTCGAMSNIASAVTTTILECDEECEMLERHRQLKEAFGIKEIISSSTDLEFERLKDIVP 719

Query: 719 TASTFADLDLPFTEPVITTYIRHENWCTDIENTLNKLIDDNNRTSLHFKPMRPPQRYFIR 778
           TA  F +L LPFTE  ++ + R E WC  IE  +NK +DD +R SLHFKPMRPPQR+FI 
Sbjct: 720 TAIAFEELQLPFTEATLSIFSRQERWCQQIEEIINKFMDDKSRPSLHFKPMRPPQRHFIH 779

Query: 779 ELAKAYNLYSESQDPEPNRSVFVKKNLDGSSTKPILSISEAAPLYQSYKKLEKEKKQANF 838
           EL+KAYNLY ESQDPEP RSVF+KKN   +S+KP  S+S+  PLYQ++K+LEKE+K   F
Sbjct: 780 ELSKAYNLYCESQDPEPKRSVFIKKNT--TSSKPSFSLSKVLPLYQTFKELEKERKLQEF 837

Query: 839 ESMTTTRLINFTPEMSPELESAARFNGFLVTNVGEFTSTDDLQNLFAPYLKSTLVVEPQF 898
           E+ T+ RL+N      P     A  NGFL+ ++   T+ +DL+ +F  YLKSTL+  PQ+
Sbjct: 838 EARTSKRLVNVEVPEGPTDNYIAEANGFLIKDLSPGTTVEDLERIFGQYLKSTLIKNPQY 897

Query: 899 QILPERKQAVIYPNKYKEISINVERDMETLVQHFDFLIKESLLAGGVELCNIENVLA 955
            +L + K  VIYP  Y  I+ NVERD ++LV HFD L K++ ++ GVELC I++VL+
Sbjct: 898 LVLQDGKSGVIYPEDYPTITANVERDFKSLVGHFDVLAKDTFISEGVELCKIDDVLS 954

>Suva_14.324 Chr14 complement(571146..574052) [2907 bp, 968 aa] {ON}
           YNL023C (REAL)
          Length = 968

 Score = 1140 bits (2949), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 538/900 (59%), Positives = 666/900 (74%), Gaps = 4/900 (0%)

Query: 58  DMAYYEKAVQEIVKGDSYSCLICTVELDYTCKLYACEKCYRVYDYECIREWAEKSTSKRT 117
           DM YYE+A+QEI KGDSY C+ICTVE+DYTC+++AC+KCYRV+DY CIREWA KST K  
Sbjct: 53  DMQYYERAIQEIAKGDSYICMICTVEMDYTCQMFACKKCYRVFDYACIREWALKSTEKTV 112

Query: 118 DKLWACPNCFYTKKAIPKKNRPTCWCGEQVNPEPNPLNPNSCGQTCNAKICSHGCSQICH 177
           DK+W CPNC++  K +P +NRPTCWCG+ VNP+ NPL+PNSCGQTCNA  C HGCS+ICH
Sbjct: 113 DKIWKCPNCYHIGKKVPTRNRPTCWCGKVVNPDHNPLDPNSCGQTCNAPTCVHGCSKICH 172

Query: 178 LGPHQECTRMMSIKCSCGKVTKDIVCFQRRLYSKGFNCETVCDKLLPCGIHKCNRKCHTG 237
           LGPH ECTR + IKC CGK +K I C+Q +   K F+C+  C   L CGIHKC +KCH+G
Sbjct: 173 LGPHPECTRTVEIKCRCGKHSKSIFCYQSKAMKKHFDCQEECGLPLSCGIHKCKKKCHSG 232

Query: 238 LCGSCPETIISKNTNMK-IRCYCGQTSKDKIKCKDVRFPANAAYSKDDKGQRWIGVFMCD 296
           LCG CPE I+S++  M  I+CYCG  SKD IKC +V FP +   SKD+ G  WIGVF C 
Sbjct: 233 LCGPCPELIMSEDKAMDWIKCYCGIHSKDSIKCCEVNFPKSGRSSKDESGNEWIGVFACK 292

Query: 297 KIRKVPYECGEHSFYEKCKAPPSISGRLICEFSPKKLKTCPCGKNELTDLSKPRSKCTDA 356
            IR V Y C +HSF E C +PP+++G+  C F P  LKTCPCG+  L +L+KPR  CTD 
Sbjct: 293 DIRTVDYACHKHSFIEPCISPPTVNGKKTCPFLPSLLKTCPCGRTALEELTKPRKHCTDP 352

Query: 357 IPTCGQVCGKMLKCGKHKCPFACHLGDCMDPCTQIEKVRCACEQKQFTIPCGFNDHARCN 416
           IPTC   C K LKCGKH CPF CH G CMDPC Q + V+CACEQ  F +PCGF +   CN
Sbjct: 353 IPTCSSRCSKPLKCGKHSCPFICHDGACMDPCLQTDSVKCACEQSTFLVPCGFQEKPHCN 412

Query: 417 LKCESLMSCRRHRCTERCCAGRPLAERRRKTMKINVRDLADESTIEPIHICLKDCNLTLS 476
           +KCESLMSCRRHRC +RCC+GRP A  R+K +    +DL DES +E  HICLK CNLTLS
Sbjct: 413 IKCESLMSCRRHRCIDRCCSGRPSALERKKRI-FRSQDLMDESLVEAQHICLKPCNLTLS 471

Query: 477 CGIHKCNRKCHAGKCPPCLESDSNDLVCPCGKTIVEAPVRCGTKLPNCPYPCIRVVRGET 536
           CGIHKC RKCH GKCPPCLESDSNDLVCPCGKT++ APVRCGTKLP C Y CI+VVRGE+
Sbjct: 472 CGIHKCQRKCHPGKCPPCLESDSNDLVCPCGKTVIPAPVRCGTKLPLCNYACIKVVRGES 531

Query: 537 DCGHSPMPHECHPPDIPCPDCTATVFKPCKCGKEQRVRTVCFMKDVSCGKVCGERLQTCY 596
           +CGH PMPH CHP D+ CP CT TVFKPCKCGK+ +VRTVCF  DVSCG  CG+ L  C+
Sbjct: 532 ECGHKPMPHTCHPLDLACPPCTETVFKPCKCGKKDKVRTVCFQTDVSCGTTCGKPLSGCH 591

Query: 597 HKCQKKCHEPGACQTVCKQTCNMPRLYCNHRCPKPCHKFEECPDIPCTALVKITCPCGRI 656
           H CQK CH P  CQ VCKQ C   R  C+H CPKPCH   ECPD+PC +LVKITC CGRI
Sbjct: 592 HTCQKTCHLPENCQKVCKQICRQKRPNCDHACPKPCHGRSECPDLPCASLVKITCKCGRI 651

Query: 657 EKEVTCGVYSKNKEAQDSTRIVCDEECAVLQRHMQLKEAFGIVDKPQNTHNEEMARLEQV 716
           EK+V CG  S      ++ ++ C+EEC  L+R  +L+EAFGI ++   + N E+  L+++
Sbjct: 652 EKKVACGAKSNVVSVTEAPQLDCNEECEALKRLKELREAFGISEESNESTNNELDTLKKL 711

Query: 717 ISTASTFADLDLPFTEPVITTYIRHENWCTDIENTLNKLIDDNNRTSLHFKPMRPPQRYF 776
           +S A+TF +L LPFTE V++ Y + E WC  IEN +NKL+ D  R+SLHFKPMRPPQR+F
Sbjct: 712 VSVATTFEELQLPFTETVLSVYAKQEGWCLQIENIVNKLMSDKTRSSLHFKPMRPPQRHF 771

Query: 777 IRELAKAYNLYSESQDPEPNRSVFVKKNLDGSSTKPILSISEAAPLYQSYKKLEKEKKQA 836
           IRELAKAYNLYSESQD EP RSVF+KK  +  S++PILS++EA PLY+S+K+L+KE+K  
Sbjct: 772 IRELAKAYNLYSESQDREPMRSVFIKKEDNSKSSRPILSLAEAFPLYESFKELQKERKIQ 831

Query: 837 NFESMTTTRLINF-TPEMSPELESAARFNGFLVTNVGEFTSTDDLQNLFAPYLKSTLVVE 895
            F++ TT +LINF   +  P++E  A+ NGFLV  +      DDL+  F P+LK TLVV+
Sbjct: 832 EFQARTTAKLINFEVRDAEPKVE-LAKNNGFLVQKLVNGNDVDDLRRFFEPHLKHTLVVK 890

Query: 896 PQFQILPERKQAVIYPNKYKEISINVERDMETLVQHFDFLIKESLLAGGVELCNIENVLA 955
           PQ+ I+ + K A++YP  Y+E+S+N ERDM+ LV HFDF+ KE+ LA  + LC+I+  L 
Sbjct: 891 PQYLIIDDGKTALVYPENYQEVSVNTERDMDILVGHFDFMAKEAFLADSISLCSIDEELG 950

>Smik_14.308 Chr14 complement(550650..553547) [2898 bp, 965 aa] {ON}
           YNL023C (REAL)
          Length = 965

 Score = 1135 bits (2935), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 536/900 (59%), Positives = 655/900 (72%), Gaps = 2/900 (0%)

Query: 58  DMAYYEKAVQEIVKGDSYSCLICTVELDYTCKLYACEKCYRVYDYECIREWAEKSTSKRT 117
           DM YYE+++QEI KGDSY C+ICTVE+DYTC+++AC++CYRV+DY CIREWA KST K  
Sbjct: 49  DMQYYERSIQEISKGDSYICMICTVEMDYTCQMFACKRCYRVFDYGCIREWAIKSTEKTV 108

Query: 118 DKLWACPNCFYTKKAIPKKNRPTCWCGEQVNPEPNPLNPNSCGQTCNAKICSHGCSQICH 177
           D++W CPNC++  K +P  NRPTCWCG+ VNP+PNPL+PNSCGQTC+A IC HGCS+ CH
Sbjct: 109 DRIWKCPNCYHVGKKVPANNRPTCWCGKVVNPDPNPLDPNSCGQTCSAPICIHGCSKTCH 168

Query: 178 LGPHQECTRMMSIKCSCGKVTKDIVCFQRRLYSKGFNCETVCDKLLPCGIHKCNRKCHTG 237
           LGPH ECTRM+ I C CGK ++ I C+Q +   K F C+  C   L C +H C RKCHTG
Sbjct: 169 LGPHPECTRMVEIMCHCGKHSQSIFCYQSKAMKKNFKCQEECGLPLSCSVHNCKRKCHTG 228

Query: 238 LCGSCPETIISKN-TNMKIRCYCGQTSKDKIKCKDVRFPANAAYSKDDKGQRWIGVFMCD 296
           LCG CPE I SK+ T  +I+CYCG  S+  IKC + RFP +   SKD  G  WIGVF C 
Sbjct: 229 LCGPCPELITSKDSTEEQIKCYCGNHSRASIKCSEARFPKSGRSSKDGNGNEWIGVFACT 288

Query: 297 KIRKVPYECGEHSFYEKCKAPPSISGRLICEFSPKKLKTCPCGKNELTDLSKPRSKCTDA 356
            IR V + C +HSF E C +PPS++GR +C F P  LKTCPCG+  L +L+KPR  C D 
Sbjct: 289 DIRTVDFSCRKHSFIEPCLSPPSVNGRKVCPFLPSLLKTCPCGRTALDELTKPRKHCDDP 348

Query: 357 IPTCGQVCGKMLKCGKHKCPFACHLGDCMDPCTQIEKVRCACEQKQFTIPCGFNDHARCN 416
           IPTC   C K LKCGKH CPF CH   CMDPC QI+  +CACEQ  F++PCGF    RCN
Sbjct: 349 IPTCNSRCSKPLKCGKHSCPFICHDLACMDPCLQIDSAKCACEQSTFSVPCGFQGRPRCN 408

Query: 417 LKCESLMSCRRHRCTERCCAGRPLAERRRKTMKINVRDLADESTIEPIHICLKDCNLTLS 476
           +KCESLMSCRRHRCT+RCC+GRP A +RRK      +DL DES +E  HICLK CNLTLS
Sbjct: 409 IKCESLMSCRRHRCTDRCCSGRPSAVKRRKNF-FRSQDLLDESLVEAKHICLKPCNLTLS 467

Query: 477 CGIHKCNRKCHAGKCPPCLESDSNDLVCPCGKTIVEAPVRCGTKLPNCPYPCIRVVRGET 536
           CGIHKC RKCH GKCPPCLESDSNDL+CPCGKT+V APVRCGT+LP C +PCI+VVRGE+
Sbjct: 468 CGIHKCQRKCHPGKCPPCLESDSNDLICPCGKTVVPAPVRCGTELPVCNHPCIKVVRGES 527

Query: 537 DCGHSPMPHECHPPDIPCPDCTATVFKPCKCGKEQRVRTVCFMKDVSCGKVCGERLQTCY 596
            CGH PMPH CHP  +PCP CT TVFKPCKCGK+ +VRTVCF KDVSCG  CG  L  C 
Sbjct: 528 SCGHKPMPHTCHPLGVPCPPCTETVFKPCKCGKKDKVRTVCFQKDVSCGTKCGLLLHFCR 587

Query: 597 HKCQKKCHEPGACQTVCKQTCNMPRLYCNHRCPKPCHKFEECPDIPCTALVKITCPCGRI 656
           H CQK CH PG CQ VCKQ C   RL C H CPKPCH   ECPD+PC  LVKITC CGR 
Sbjct: 588 HTCQKTCHLPGNCQKVCKQICGHERLSCRHTCPKPCHGKTECPDLPCPTLVKITCKCGRN 647

Query: 657 EKEVTCGVYSKNKEAQDSTRIVCDEECAVLQRHMQLKEAFGIVDKPQNTHNEEMARLEQV 716
           EK VTC   S    A +S+ + CDEEC  L+R  +L+EAFGI ++  N  + E+  L+++
Sbjct: 648 EKSVTCSAKSGVVPANESSVLDCDEECEALKRLKELREAFGIKEESNNVTSNELDALKKL 707

Query: 717 ISTASTFADLDLPFTEPVITTYIRHENWCTDIENTLNKLIDDNNRTSLHFKPMRPPQRYF 776
           +S A+TF +L LPFTE  ++ Y + E WC+ IE  LNKL+DD  R+SLHFKPMRPPQR+F
Sbjct: 708 VSVATTFEELHLPFTETTLSVYSKQERWCSQIEVILNKLMDDKTRSSLHFKPMRPPQRHF 767

Query: 777 IRELAKAYNLYSESQDPEPNRSVFVKKNLDGSSTKPILSISEAAPLYQSYKKLEKEKKQA 836
           IRELAKAY LYSESQD EP RSVF+KK  +G+S KP+LS+ EA PLY+S+K+L+KE+K  
Sbjct: 768 IRELAKAYGLYSESQDREPMRSVFIKKEDNGTSNKPVLSLGEALPLYESFKQLQKERKVQ 827

Query: 837 NFESMTTTRLINFTPEMSPELESAARFNGFLVTNVGEFTSTDDLQNLFAPYLKSTLVVEP 896
            F+S TT +LINF  + +      A+ NGFLV N+    + +DL+  F P+LK TLVV P
Sbjct: 828 EFQSRTTAKLINFEVQDAQPKVEVAKNNGFLVRNLVTGNTVEDLKRFFEPHLKHTLVVNP 887

Query: 897 QFQILPERKQAVIYPNKYKEISINVERDMETLVQHFDFLIKESLLAGGVELCNIENVLAE 956
           Q+ IL + K A++YP  Y+  S+N ERDME LV HFDF+ KE+ LA  + LC+ +  + +
Sbjct: 888 QYLILDDGKTALVYPENYETASVNTERDMELLVGHFDFMAKEAFLADSILLCSTDEEVGK 947

>KNAG0H01990 Chr8 complement(349855..352776) [2922 bp, 973 aa] {ON}
           Anc_2.288 YNL023C
          Length = 973

 Score = 1127 bits (2915), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 548/952 (57%), Positives = 665/952 (69%), Gaps = 15/952 (1%)

Query: 17  DDHPDNSSLVIGLSEDE--SEIETNM--GAXXXXXXXXXXXXXXKDMAYYEKAVQEIVKG 72
           D  PD  SLV+  S D+  S  E N+                  +D+ YYE+AV+EI KG
Sbjct: 5   DGKPDPKSLVLNFSSDDEDSATEANITYSEEEEEEIATSDTEEDQDLPYYERAVREIAKG 64

Query: 73  DSYSCLICTVELDYTCKLYACEKCYRVYDYECIREWAEKSTSKRTDKLWACPNCFYTKKA 132
           D Y+C+ICTVE+DYTCK++AC KCYRV+DY+C+REWA KST K  D++W CPNC+   K 
Sbjct: 65  DLYTCMICTVEMDYTCKMFACRKCYRVFDYDCVREWAIKSTDKTVDRIWKCPNCYLVNKK 124

Query: 133 IPKKNRPTCWCGEQVNPEPNPLNPNSCGQTCNAKICSHGCSQICHLGPHQECTRMMSIKC 192
           +P KNRPTCWCG+ VNPEPNPL+PNSCGQTC+AKIC HGCS+ICHLGPH EC R  S+KC
Sbjct: 125 VPTKNRPTCWCGKVVNPEPNPLDPNSCGQTCDAKICIHGCSKICHLGPHPECLRTTSVKC 184

Query: 193 SCGKVTKDIVCFQR--RLYSKGFNCETVCDKLLPCGIHKCNRKCHTGLCGSCPETI-ISK 249
            CGK TK+I CF+   R     F C   C+ LLPCGIH+C + CH+GLCGSCPE + + +
Sbjct: 185 RCGKATKEIPCFETKGRRGRNLFQCNEPCNSLLPCGIHRCQKICHSGLCGSCPENLTVKE 244

Query: 250 NTNMKIRCYCGQTSKDKIKCKDVRFPANAAYSKDDKGQRWIGVFMCDKIRKVPYECGEHS 309
             ++ I CYCGQ +++ IKCKDV        SK+  G  WIGV+ C  IR V Y C +HS
Sbjct: 245 GDDVSISCYCGQHTRNSIKCKDVN--VTGRKSKNANGDEWIGVYACKDIRSVEYSCRQHS 302

Query: 310 FYEKCKAPPSISGRLICEFSPKKLKTCPCGKNELTDLSKPRSKCTDAIPTCGQVCGKMLK 369
           F+E+C APP+++G   C FSPK LKTC CGK  L  L K R +C D IP C   C K+LK
Sbjct: 303 FFEECIAPPTVTGTKRCPFSPKYLKTCSCGKTPLQALGKARRRCIDPIPHCESRCDKLLK 362

Query: 370 CGKHKCPFACHLGDCMDPCTQIEKVRCACEQKQFTIPCGFNDHARCNLKCESLMSCRRHR 429
           CGKH CPF CH G CMDPC QI+KV+CACE+  F +PCGF     C LKCESL+SCRRH+
Sbjct: 363 CGKHTCPFQCHDGPCMDPCIQIDKVKCACERNTFLVPCGFQGAPHCQLKCESLLSCRRHK 422

Query: 430 CTERCCAGRPLAERRRKTMKINVRDLADESTIEPIHICLKDCNLTLSCGIHKCNRKCHAG 489
           C ERCC+GRP AE RRK      +D+ DE+ +E  H+CLK CNLTLSCG H+C RKCH G
Sbjct: 423 CAERCCSGRPAAEERRKNSS-RFQDVNDETLMEAEHVCLKACNLTLSCGQHQCQRKCHPG 481

Query: 490 KCPPCLESDSNDLVCPCGKTIVEAPVRCGTKLPNCPYPCIRVVRGETDCGHSPMPHECHP 549
           KCPPCLESDSNDLVCPCGKTIV APVRCGTKLP+C +PCI+VV G ++CGH P+PH CHP
Sbjct: 482 KCPPCLESDSNDLVCPCGKTIVPAPVRCGTKLPSCRHPCIKVVEGISECGHKPIPHACHP 541

Query: 550 PDIPCPDCTATVFKPCKCGKEQRVRTVCFMKDVSCGKVCGERLQTCYHKCQKKCHEPGAC 609
            D PCP CTATVFKPCKCGK  RVRT+CF KDVSCG+ CG+ L  C+H CQK CH PG C
Sbjct: 542 LDQPCPPCTATVFKPCKCGKNSRVRTICFQKDVSCGQTCGKPLPNCHHFCQKTCHLPGQC 601

Query: 610 QTVCKQTCNMPRLYCNHRCPKPCHKFEECPDIPCTALVKITCPCGRIEKEVTCGVYSKNK 669
           Q  CKQ CN P + C H+C K CH    CPDI C ALVKI CPCGR E EVTCG  S   
Sbjct: 602 QATCKQVCNKPPVNCAHKCRKSCHGRLTCPDILCIALVKIRCPCGRKEVEVTCGATSTLS 661

Query: 670 EAQDSTRIVCDEECAVLQRHMQLKEAFGIVDKPQN---THNEEMARLEQVISTASTFADL 726
            +  + R+ CDEEC    RH QLKEAFGI DK  N      +E  RLE + S A+TF +L
Sbjct: 662 SSLFTERLECDEECEAYTRHRQLKEAFGITDKVANGSAMKEKEGTRLEGLASKATTFEEL 721

Query: 727 DLPFTEPVITTYIRHENWCTDIENTLNKLIDDNNRTSLHFKPMRPPQRYFIRELAKAYNL 786
             PFTE  I+TYIR   WC +IE TLN  +D+  ++SLHFKPM+PPQR FIRELAKAYNL
Sbjct: 722 QFPFTESTISTYIRQNKWCGEIEETLNNFMDNEGKSSLHFKPMKPPQRLFIRELAKAYNL 781

Query: 787 YSESQDPEPNRSVFVKKNLDGSSTKPILSISEAAPLYQSYKKLEKEKKQANFESMTTTRL 846
           YSE+QDPEP RSVFVKKN DGSS KPI S+SE APLYQS+K LEKE+K  +F + TTT L
Sbjct: 782 YSEAQDPEPKRSVFVKKNDDGSSAKPIFSLSEIAPLYQSFKLLEKERKMQDFLAKTTTHL 841

Query: 847 IN--FTPEMSPELESAARFNGFLVTNVGEFTSTDDLQNLFAPYLKSTLVVEPQFQILPER 904
           IN     +++   + + + N FL+ N+   T+  DL+NLF  Y++ TL+  PQ+Q LPE 
Sbjct: 842 INVKLNDDVATGAQHSGQNNAFLIKNISAGTTLQDLKNLFGKYMEKTLIRNPQYQELPEE 901

Query: 905 KQAVIYPNKYKEISINVERDMETLVQHFDFLIKESLLAGGVELCNIENVLAE 956
             A++YP  Y+ IS N   DME LV H +F++ ++ LA   ELC+  + L E
Sbjct: 902 NSAIVYPEDYRTISANAVNDMENLVGHINFIVNDAFLADSAELCDASSKLPE 953

>Skud_14.306 Chr14 complement(558943..561855) [2913 bp, 970 aa] {ON}
           YNL023C (REAL)
          Length = 970

 Score = 1122 bits (2903), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 525/900 (58%), Positives = 651/900 (72%), Gaps = 2/900 (0%)

Query: 58  DMAYYEKAVQEIVKGDSYSCLICTVELDYTCKLYACEKCYRVYDYECIREWAEKSTSKRT 117
           D+ YYE+A+QEI KGDSY C+ICTVE+DYTC+++AC+KCYRV+DY CIREWA KST K  
Sbjct: 54  DLQYYERAIQEIAKGDSYICMICTVEMDYTCQMFACKKCYRVFDYACIREWALKSTEKTV 113

Query: 118 DKLWACPNCFYTKKAIPKKNRPTCWCGEQVNPEPNPLNPNSCGQTCNAKICSHGCSQICH 177
           DK+W CPNC++  K +P +NRPTCWCG  VNP+PN L+PNSCGQTCNA  C HGC +ICH
Sbjct: 114 DKIWKCPNCYHVGKKVPTRNRPTCWCGNVVNPDPNQLDPNSCGQTCNAPTCVHGCFKICH 173

Query: 178 LGPHQECTRMMSIKCSCGKVTKDIVCFQRRLYSKGFNCETVCDKLLPCGIHKCNRKCHTG 237
           LGPH ECTRM+ IKC CG+ +K I C+Q +   + FNC+  C   L CG+HKC +KCH+G
Sbjct: 174 LGPHPECTRMVEIKCHCGRHSKTIFCYQSKAMRRRFNCQEECGLSLSCGVHKCKKKCHSG 233

Query: 238 LCGSCPETIISKNTNMK-IRCYCGQTSKDKIKCKDVRFPANAAYSKDDKGQRWIGVFMCD 296
           LCGSCPE II+ +++ K I+CYCG   ++ IKC + RFP +   SKD+ G  W GVF C 
Sbjct: 234 LCGSCPEFIINDDSSKKQIKCYCGNHIQNSIKCSEARFPKSGRTSKDESGNEWAGVFACA 293

Query: 297 KIRKVPYECGEHSFYEKCKAPPSISGRLICEFSPKKLKTCPCGKNELTDLSKPRSKCTDA 356
            IR V Y C +HSF E C +PP+ISG+  C F P  LKTCPCG+  L +L+KPR  C D 
Sbjct: 294 DIRTVDYACHKHSFIEPCLSPPTISGQKTCPFLPSLLKTCPCGRTALEELTKPRKHCHDP 353

Query: 357 IPTCGQVCGKMLKCGKHKCPFACHLGDCMDPCTQIEKVRCACEQKQFTIPCGFNDHARCN 416
           IPTC   C K LKCGKH CPF CH G CMDPC QI+   C+CEQ  F+IPCGF +  RCN
Sbjct: 354 IPTCNSRCSKPLKCGKHLCPFTCHDGACMDPCLQIDSANCSCEQSTFSIPCGFQESPRCN 413

Query: 417 LKCESLMSCRRHRCTERCCAGRPLAERRRKTMKINVRDLADESTIEPIHICLKDCNLTLS 476
           +KCESLMSCRRHRC +RCC+GRP A RR+K+     +DL DES +E  HICLK CNLTLS
Sbjct: 414 IKCESLMSCRRHRCIDRCCSGRPSAIRRKKSF-FRSQDLLDESLVEAKHICLKPCNLTLS 472

Query: 477 CGIHKCNRKCHAGKCPPCLESDSNDLVCPCGKTIVEAPVRCGTKLPNCPYPCIRVVRGET 536
           CG+HKC RKCH GKCPPCLESDSNDL+C CGKT+V APVRCGTKLP C +PCI+VVRGE+
Sbjct: 473 CGLHKCQRKCHPGKCPPCLESDSNDLICACGKTVVPAPVRCGTKLPTCNHPCIKVVRGES 532

Query: 537 DCGHSPMPHECHPPDIPCPDCTATVFKPCKCGKEQRVRTVCFMKDVSCGKVCGERLQTCY 596
            CGH PMPH CHP +I CP CT TVFKPC+CGK+ +VRTVCF  DVSCG  CG  L  CY
Sbjct: 533 WCGHKPMPHTCHPSNISCPPCTETVFKPCRCGKKDKVRTVCFQADVSCGTSCGIPLSGCY 592

Query: 597 HKCQKKCHEPGACQTVCKQTCNMPRLYCNHRCPKPCHKFEECPDIPCTALVKITCPCGRI 656
           H CQK CH  G CQ VCKQ C   RL C H CPKPCH   ECPD+PC ALVKITC CGRI
Sbjct: 593 HTCQKTCHLLGKCQKVCKQICGQKRLDCIHTCPKPCHGKTECPDLPCAALVKITCECGRI 652

Query: 657 EKEVTCGVYSKNKEAQDSTRIVCDEECAVLQRHMQLKEAFGIVDKPQNTHNEEMARLEQV 716
           +K +TC           S+ + C+EEC  L+R  +L+EAFG+ + P N    E+  L ++
Sbjct: 653 KKSITCSAKRDTVSVITSSILDCNEECETLKRLKELREAFGVSEGPNNVIRNELDALSEL 712

Query: 717 ISTASTFADLDLPFTEPVITTYIRHENWCTDIENTLNKLIDDNNRTSLHFKPMRPPQRYF 776
           +S A TF +L LPFTE  ++ Y + E WC  IE  LNKL+D   R+SLHFKPMRPPQR+F
Sbjct: 713 VSVAKTFEELQLPFTEATLSVYSKQERWCLQIEGILNKLMDSEIRSSLHFKPMRPPQRHF 772

Query: 777 IRELAKAYNLYSESQDPEPNRSVFVKKNLDGSSTKPILSISEAAPLYQSYKKLEKEKKQA 836
           I E+AKAYNLY+ESQD EP RSVF+KK  + +S KP+LS++EA PLY+S+K+ +KE+K  
Sbjct: 773 IHEMAKAYNLYAESQDREPMRSVFIKKEDNCTSKKPVLSLAEAYPLYESFKQSQKERKLQ 832

Query: 837 NFESMTTTRLINFTPEMSPELESAARFNGFLVTNVGEFTSTDDLQNLFAPYLKSTLVVEP 896
            F++ TT +LINF  + +     AA+ NGFLV N+    + +DL+  F P+LK TLV  P
Sbjct: 833 EFQARTTAKLINFEVQDAESKIEAAKNNGFLVQNLVSGNTVEDLKRFFEPHLKHTLVANP 892

Query: 897 QFQILPERKQAVIYPNKYKEISINVERDMETLVQHFDFLIKESLLAGGVELCNIENVLAE 956
           Q+ IL + + A+IYP  Y+  S+N ERDME LV HFDF+ KE+ LA  + LC+++  + +
Sbjct: 893 QYLILDDSRSALIYPENYETASVNTERDMELLVGHFDFMAKEAFLADSIHLCSVDEEIGK 952

>TDEL0G02190 Chr7 (430157..432967) [2811 bp, 936 aa] {ON} Anc_2.288
           YNL023C
          Length = 936

 Score = 1112 bits (2877), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 540/940 (57%), Positives = 663/940 (70%), Gaps = 16/940 (1%)

Query: 21  DNSSLVIGLSEDESEIETNMGAXXXXXXXXXXXXXXKDMAYYEKAVQEIVKGDSYSCLIC 80
           +  SLV+  SED+S+  +   +               DMAYYE+AVQEI  GD Y C+IC
Sbjct: 7   NQHSLVLEFSEDDSDFSSESCSVHEVRDE-------HDMAYYERAVQEIALGDRYVCMIC 59

Query: 81  TVELDYTCKLYACEKCYRVYDYECIREWAEKSTSKRTDKLWACPNCFYTKKAIPKKNRPT 140
           TVE+DYTCK+YACE CYRV+DYECIREWA KST K  D++W CPNC+   K +P KNRPT
Sbjct: 60  TVEMDYTCKMYACEGCYRVFDYECIREWALKSTEKTLDRVWKCPNCYKVNKRVPAKNRPT 119

Query: 141 CWCGEQVNPEPNPLNPNSCGQTCNAKICSHGCSQICHLGPHQECTRMMSIKCSCGKVTKD 200
           CWCG+ VNP+PNPL+PNSCGQTC+A IC HGCS+ CHLGPH +C R ++ KC CGK T++
Sbjct: 120 CWCGKTVNPDPNPLDPNSCGQTCDAPICPHGCSKQCHLGPHPDCVRTITTKCQCGKHTRE 179

Query: 201 IVCFQRRLYSKG---FNCETVCDKLLPCGIHKCNRKCHTGLCGSCPETIISKNTNMKIRC 257
             C+Q  +  KG   F C  VC   L CGIHKC R CH+G+CG CP  + +K+  +KIRC
Sbjct: 180 TFCYQT-ISMKGKSQFQCNEVCGLPLACGIHKCERLCHSGICGPCPAVLNAKSNKLKIRC 238

Query: 258 YCGQTSKDKIKCKDVRFPANAAYSKDDKGQRWIGVFMCDKIRKVPYECGEHSFYEKCKAP 317
           YCG   +D  KCKDVR  ++   SKD KG  WIG F C  IRK+ Y C EHSF EKC+  
Sbjct: 239 YCGLEHRDSFKCKDVRVASD--LSKDGKGDSWIGAFGCSGIRKIEYACREHSFVEKCQPS 296

Query: 318 PSISGRLICEFSPKKLKTCPCGKNELTDLSKPRSKCTDAIPTCGQVCGKMLKCGKHKCPF 377
           PSISG++ C FSPK LKTCPCG+  L  L++PR  CT  IP C   CGK L CG+H CPF
Sbjct: 297 PSISGKIACPFSPKLLKTCPCGRTSLKVLAEPRKSCTSPIPNCDSTCGKKLACGRHTCPF 356

Query: 378 ACHLGDCMDPCTQIEKVRCACEQKQFTIPCGFNDHARCNLKCESLMSCRRHRCTERCCAG 437
            CH G CMDPC QIE VRC+C +  +++PC F +  RC+ KCESLMSCRRHRCTERCC G
Sbjct: 357 TCHDGPCMDPCIQIETVRCSCHKNLYSVPCQFKEQPRCDTKCESLMSCRRHRCTERCCCG 416

Query: 438 RPLAERRRKTMKINVRDLADESTIEPIHICLKDCNLTLSCGIHKCNRKCHAGKCPPCLES 497
           RP AERRRKT  ++ R+L DES++E  HICLKDCNLTLSCG HKC RKCH GKCPPCLES
Sbjct: 417 RPFAERRRKT-PLSSRELMDESSVESEHICLKDCNLTLSCGCHKCQRKCHPGKCPPCLES 475

Query: 498 DSNDLVCPCGKTIVEAPVRCGTKLPNCPYPCIRVVRGETDCGHSPMPHECHPPDIPCPDC 557
           DSNDLVCPCGKT+VEAPVRCGT+LP C YPCIRV++    CGH PMPH CHP + PCP C
Sbjct: 476 DSNDLVCPCGKTVVEAPVRCGTRLPPCHYPCIRVIQNAYKCGHKPMPHTCHPLNEPCPSC 535

Query: 558 TATVFKPCKCGKEQRVRTVCFMKDVSCGKVCGERLQTCYHKCQKKCHEPGACQTVCKQTC 617
           TA VFKPCKCGK+ +VRT+CF  DVSCG  CG+ L  C H CQK CH PG CQ  CKQ C
Sbjct: 536 TAPVFKPCKCGKKDKVRTLCFQNDVSCGTTCGKPLDNCPHMCQKSCHIPGECQKKCKQIC 595

Query: 618 NMPRLYCNHRCPKPCHKFEECPDIPCTALVKITCPCGRIEKEVTCGVYSKNKEAQDSTRI 677
           N  R+YC+H+C   CH  ++CPDIPC   VKI C C   E  +TCG  S+      +T +
Sbjct: 596 NRKRIYCDHKCRLICHGNDKCPDIPCPLSVKIKCECEVKESFITCGANSETPSKATTTIL 655

Query: 678 VCDEECAVLQRHMQLKEAFGIVDKPQNTHNEEMARLEQVISTASTFADLDLPFTEPVITT 737
            CDEEC   +RH+QL+EAFGI +   N    + A LE + + A++F +L+LPF+EP + T
Sbjct: 656 PCDEECERHKRHLQLREAFGISNFSDNPSRSKTASLENLAAVANSFEELELPFSEPALGT 715

Query: 738 YIRHENWCTDIENTLNKLIDDNNRTSLHFKPMRPPQRYFIRELAKAYNLYSESQDPEPNR 797
           + + E WCT IEN LN  +D+  +TSLHFKPMRP QR+FI ELAK+YNLY ESQD EP R
Sbjct: 716 FAKQEAWCTQIENVLNSFMDNEEKTSLHFKPMRPAQRHFIHELAKSYNLYVESQDREPKR 775

Query: 798 SVFVKKNLDGSSTKPILSISEAAPLYQSYKKLEKEKKQANFESMTTTRLINFTPEMSPEL 857
           SVFVKK  +G S KP++ + ++ P+YQ +K+ EKEKK   FE+ TTT  +NF P+  P+L
Sbjct: 776 SVFVKKQDNGGSCKPVIQLKDSLPIYQFFKENEKEKKAQRFEAQTTTEFVNFIPKEEPQL 835

Query: 858 ESAARFNGFLVTNVGEFTSTDDLQNLFAPYLKSTLVVEPQFQILPERKQAVIYPNKYKEI 917
           E  A+ N F + NV   T+ +DL+ +FA +LK TLV  PQF+I    K  +IYP  Y EI
Sbjct: 836 ER-AKNNAFKLKNVSTGTTKEDLERIFADHLKPTLVKNPQFKIQDSTKNGLIYPEDYAEI 894

Query: 918 SINVERDMETLVQHFDFLIKESLLAGGVELCNIE-NVLAE 956
           S+NVERD+E LV HFD+L KES +  G+ELC+I+  VL E
Sbjct: 895 SVNVERDLEALVGHFDYLCKESFIGDGIELCHIDLKVLQE 934

>NCAS0G03780 Chr7 complement(696877..699750) [2874 bp, 957 aa] {ON} 
          Length = 957

 Score = 1112 bits (2875), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 557/942 (59%), Positives = 691/942 (73%), Gaps = 11/942 (1%)

Query: 18  DHPDNSSLVIGLSEDESEIETNMGAXXXXXXXXXXXXXXKDMAYYEKAVQEIVKGDSYSC 77
           D PD  SLV+ LS+D+S  E+   +                M YYE+A+QEI KGDSY C
Sbjct: 10  DEPDPKSLVLELSDDDSNGESG-NSDSSEYESDFAGMDDDAMHYYERAIQEIAKGDSYVC 68

Query: 78  LICTVELDYTCKLYACEKCYRVYDYECIREWAEKSTSKRTDKLWACPNCFYTKKAIPKKN 137
           +ICTVE+DYTC++YAC++CYRV+DYECIREWA KST K  D++W CPNC++  K +P KN
Sbjct: 69  MICTVEMDYTCQMYACKQCYRVFDYECIREWALKSTEKTVDRIWKCPNCYHVNKKVPPKN 128

Query: 138 RPTCWCGEQVNPEPNPLNPNSCGQTCNAKICSHGCSQICHLGPHQECTRMMSIKCSCGKV 197
           RPTCWCG+ VNPEPNPLNPNSCGQTCNA  C HGCS+ICHLGPH ECTR+++IKC CGK 
Sbjct: 129 RPTCWCGKVVNPEPNPLNPNSCGQTCNAHTCVHGCSKICHLGPHPECTRIITIKCRCGKH 188

Query: 198 TKDIVCFQRRLY--SKGFNCETVCDKLLPCGIHKCNRKCHTGLCGSCPETIISKN-TNMK 254
           TKDI C+Q  L      F C+  C   L CG+H+C +KCH+GLCG CPE + +K   +  
Sbjct: 189 TKDISCYQSSLLRGKDKFQCDEPCGLPLACGLHRCQKKCHSGLCGICPEILNTKEYLDAH 248

Query: 255 IRCYCGQTSKDKIKCKDVRFPANAAYSKDDKGQRWIGVFMCDKIRKVPYECGEHSFYEKC 314
           IRCYCG   +D IKC+DV  P +A+ S++ KG++W+GVF CD IR V Y+C EHSF E+C
Sbjct: 249 IRCYCGSQDRDTIKCRDVHVPLSASLSQNLKGEKWVGVFKCDNIRNVDYKCHEHSFVEQC 308

Query: 315 KAPPSISGRLICEFSPKKLKTCPCGKNELTDLSKPRSKCTDAIPTCGQVCGKMLKCGKHK 374
            APP+I G   C FSPK LKTCPCGK  L +L + R KCTD IPTC   CGK LKCG+H 
Sbjct: 309 IAPPTIDGTKPCPFSPKLLKTCPCGKTPLKELVESRKKCTDPIPTCDSRCGKPLKCGRHT 368

Query: 375 CPFACHLGDCMDPCTQIEKVRCACEQKQFTIPCGFNDHARCNLKCESLMSCRRHRCTERC 434
           CPF CH+G CMDPC QI+K +C+C Q+ F +PC F+   +C  KCESLMSCRRHRCTERC
Sbjct: 369 CPFICHVGPCMDPCLQIDKKKCSCNQQSFLVPCQFHQDPQCTTKCESLMSCRRHRCTERC 428

Query: 435 CAGRPLAERRRKTMKINVRDLADESTIEPIHICLKDCNLTLSCGIHKCNRKCHAGKCPPC 494
           CAGRP AE R+K +    +DL DES +EP HICLK+CNL LSCG HKC RKCH GKCPPC
Sbjct: 429 CAGRPRAEARKKRL-FRSQDLMDESLVEPQHICLKECNLMLSCGKHKCQRKCHPGKCPPC 487

Query: 495 LESDSNDLVCPCGKTIVEAPVRCGTKLPNCPYPCIRVVRGETDCGHSPMPHECHPPDIPC 554
           LESDSNDLVCPCG+TI+EAPVRCGTKLP CPYPCI+VVRGE  CGH+PMPH CHP + PC
Sbjct: 488 LESDSNDLVCPCGRTIIEAPVRCGTKLPPCPYPCIKVVRGEYPCGHTPMPHTCHPLNEPC 547

Query: 555 PDCTATVFKPCKCGKEQRVRTVCFMKDVSCGKVCGERLQTCYHKCQKKCHEPGACQTVCK 614
           P CTA+VFKPCKCGK  +VRT+CF  DVSCGK+CG  L+ C H CQK+CH  G CQ  CK
Sbjct: 548 PPCTASVFKPCKCGKVDKVRTLCFQNDVSCGKICGLPLENCNHTCQKRCHLLGECQKTCK 607

Query: 615 QTCNMPRLYCNHRCPKPCHKFEECPDIPCTALVKITCPCGRIEKEVTCGVYSKNKEAQDS 674
           Q C   R+ C H C KPCH   +CPDIPC+  +KITC CGR E  VTCG  S    A   
Sbjct: 608 QICKKKRINCEHTCLKPCHGKTDCPDIPCSVSIKITCECGRKETYVTCGATSTIPSAATK 667

Query: 675 TRIVCDEECAVLQRHMQLKEAFGIVDKPQNTHNEEMARLEQVISTASTFADLDLPFTEPV 734
           T I CDEEC +L+RH QLKEAFGIVD  ++T + E+ +L+ +   A+TF +L LP+ E  
Sbjct: 668 THIECDEECELLERHRQLKEAFGIVDSNRST-SLEVEKLKDLAKVATTFEELQLPYNETT 726

Query: 735 ITTYIRHENWCTDIENTLNKLIDDNNRTSLHFKPMRPPQRYFIRELAKAYNLYSESQDPE 794
           ++ Y + E WC  IE  LNKL+DD  R SLHFKPMRPPQR+FI+E AK++NLY+E+QD E
Sbjct: 727 LSIYAKQEKWCDQIEEILNKLMDDKARPSLHFKPMRPPQRHFIQEFAKSFNLYAEAQDRE 786

Query: 795 PNRSVFVKKNLDGSSTKPILSISEAAPLYQSYKKLEKEKKQANFESMTTTRLINFTPEMS 854
           P RSVFVKK  DGSS+KPI+S+ +A PLYQ++K+LEKE+K   FE+ TTTRLIN     +
Sbjct: 787 PKRSVFVKKEEDGSSSKPIISLHDALPLYQTFKELEKERKLKEFEARTTTRLINVE---A 843

Query: 855 PELESA--ARFNGFLVTNVGEFTSTDDLQNLFAPYLKSTLVVEPQFQILPERKQAVIYPN 912
           P+ ++   A+++GFL+  +   T+ +DLQ +F  +L STL+V PQ+ I+ + K A+IYP 
Sbjct: 844 PQEDNVYHAKYSGFLIKKISPGTTVEDLQRIFGQFLTSTLIVNPQYLIIQDGKDALIYPE 903

Query: 913 KYKEISINVERDMETLVQHFDFLIKESLLAGGVELCNIENVL 954
            Y+E+S  VERD+ETLV HFDF+ KE+ +A GVELC++E  +
Sbjct: 904 NYQEMSAGVERDLETLVGHFDFISKENFIADGVELCDVEVAM 945

>KAFR0H03300 Chr8 complement(627520..630420) [2901 bp, 966 aa] {ON}
           Anc_2.288 YNL023C
          Length = 966

 Score = 1083 bits (2802), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 532/960 (55%), Positives = 657/960 (68%), Gaps = 19/960 (1%)

Query: 3   DGRTEVTQDEYRHYDDHPDNSSLVIGLSEDESEIETNMGAXXXXXXXXXXXXXXKDMAYY 62
           D  +  + DE  +   HPD  SLV+  SED++       A               DM YY
Sbjct: 2   DDSSADSVDETLNLHTHPDPKSLVLEFSEDDTS-----SAASSDDEEMDVLSDNDDMMYY 56

Query: 63  EKAVQEIVKGDSYSCLICTVELDYTCKLYACEKCYRVYDYECIREWAEKSTSKRTDKLWA 122
           E+A+QEI  GDSY C+ICTVE+DYTCK+YAC+KC R++DY+CIREWA KST K  +++W 
Sbjct: 57  ERAIQEIAAGDSYICMICTVEMDYTCKMYACKKCCRIFDYDCIREWALKSTEKTKERIWK 116

Query: 123 CPNCFYTKKAIPKKNRPTCWCGEQVNPEPNPLNPNSCGQTCNAKICSHGCSQICHLGPHQ 182
           CPNC++  K +P KNR TCWCG+ VNPE NPLNPNSCGQTCNA +C HGCS+ICHLGPH 
Sbjct: 117 CPNCYHVNKKVPTKNRATCWCGKVVNPEKNPLNPNSCGQTCNAPVCIHGCSKICHLGPHP 176

Query: 183 ECTRMMSIKCSCGKVTKDIVCFQRRLYS---KGFNCETVCDKLLPCGIHKCNRKCHTGLC 239
           EC R +++KC CGK  + I CFQ +  S     F+CE  C   L CGIH C +KCH+GLC
Sbjct: 177 ECLRTITMKCDCGKHERQISCFQSKSQSGRRNRFSCEEECGLPLSCGIHTCKKKCHSGLC 236

Query: 240 GSCPETI-ISKNTNMKIRCYCGQTSKDKIKCKDVRFPANAAYSKDDKGQRWIGVFMCDKI 298
           GSCPE + +++     I+CYCG  +K    CKDV+ P     S+D +G +W+GVF C+KI
Sbjct: 237 GSCPELLEVNEEKCATIKCYCGLETKKSFPCKDVKAPT--TLSRDAEGNKWVGVFSCNKI 294

Query: 299 RKVPYECGEHSFYEKCKAPPSISGRLICEFSPKKLKTCPCGKNELTDLSKPRSKCTDAIP 358
           R V Y C +HSF E C APP++SG   C FSP  LKTCPCG+  L  LSKPR KCTD +P
Sbjct: 295 RNVEYSCQKHSFVESCVAPPTVSGTKQCPFSPNLLKTCPCGRTPLNALSKPRLKCTDPVP 354

Query: 359 TCGQVCGKMLKCGKHKCPFACHLGDCMDPCTQIEKVRCACEQKQFTIPCGFNDHARCNLK 418
           TC   C K LKCGKH+CPF CH G CMDPC QI+K  C+C Q  F  PC F     CN+K
Sbjct: 355 TCEACCNKPLKCGKHRCPFTCHNGPCMDPCIQIDKKPCSCHQSFFLTPCQFEGEPHCNIK 414

Query: 419 CESLMSCRRHRCTERCCAGRPLAERRRKTMKINVRDLADESTIEPIHICLKDCNLTLSCG 478
           CESLMSCRRHRCTERCC+GRPLAE+R+KT+     D+ DE+ +E  H+CLK+CNL LSCG
Sbjct: 415 CESLMSCRRHRCTERCCSGRPLAEKRKKTL-FRSSDINDETLVEAQHVCLKECNLMLSCG 473

Query: 479 IHKCNRKCHAGKCPPCLESDSNDLVCPCGKTIVEAPVRCGTKLPNCPYPCIRVVRGETDC 538
            H+C RKCH GKCPPCLESDSNDLVCPCGKT+VEAPVRCGTKL  C +PCI+V+R E+ C
Sbjct: 474 KHRCQRKCHPGKCPPCLESDSNDLVCPCGKTVVEAPVRCGTKLSPCLFPCIKVIRNESVC 533

Query: 539 GHSPMPHECHPPDIPCPDCTATVFKPCKCGKEQRVRTVCFMKDVSCGKVCGERLQTCYHK 598
           GH P+PH CHP D PCP CTATVFKPCKCGK  +VRTVCF KDVSCGK+CG  L TC+HK
Sbjct: 534 GHPPVPHSCHPLDQPCPPCTATVFKPCKCGKRDKVRTVCFQKDVSCGKICGLPLLTCHHK 593

Query: 599 CQKKCHEPGACQTVCKQTCNMPRLYCNHRCPKPCHKFEECPDIPCTALVKITCPCGRIEK 658
           CQK CH  G CQ  CKQ C   R+ C H C K CH   EC D PC    KI+CPCGR E 
Sbjct: 594 CQKVCHPNGECQVKCKQVCRKKRVNCVHECLKSCHGSTECSDSPCPVSTKISCPCGRRES 653

Query: 659 EVTCGVYSKNKEAQDSTRIVCDEECAVLQRHMQLKEAFGIVDK--PQNTHNEEMARLEQV 716
            VTC   S    A   TR+ C+EEC V++RH +L+EAFGIV+K  P+N   E   RL+  
Sbjct: 654 YVTCNATSTIDSAALITRLDCNEECEVVKRHRELREAFGIVEKEEPENLGTE---RLQSF 710

Query: 717 ISTASTFADLDLPFTEPVITTYIRHENWCTDIENTLNKLIDDNNRTSLHFKPMRPPQRYF 776
             +A+ + DL LP+TEP +  Y +  NWC  IE  L K +DDN+R SLHFKPMRPPQRYF
Sbjct: 711 AQSATNYDDLQLPYTEPALVAYTKQPNWCEQIEELLIKFMDDNSRPSLHFKPMRPPQRYF 770

Query: 777 IRELAKAYNLYSESQDPEPNRSVFVKKNLDGSSTKPILSISEAAPLYQSYKKLEKEKKQA 836
           I E+AKA+NLY+ESQD EP RSVF+KKN DG+S KP L +S+  P+YQ++KKLEKE+K  
Sbjct: 771 IHEIAKAFNLYAESQDREPKRSVFLKKNDDGTSLKPALRLSDVLPVYQNFKKLEKERKAK 830

Query: 837 NFESMTTTRLINFTPEMSPELESAARFNGFLVTNVGEFTSTDDLQNLFAPYLKSTLVVEP 896
            FE+ TT RL+N T + + E       NG ++ N+    + + L   F  + KSTL+  P
Sbjct: 831 QFEARTTARLMNITLDDTLEERKKFENNGLIIKNLSNGITLEFLSEFFNKFFKSTLIKNP 890

Query: 897 QFQILPERKQAVIYPNKYKEISINVERDMETLVQHFDFLIKESLLAGGVELCNIENVLAE 956
           Q+ I+      +IYP  + EI+  V  D++ LV HF+ ++KE L+   VE+CNIEN L E
Sbjct: 891 QYLII--ENNGLIYPESHNEITQGVYNDLDMLVGHFNVIVKEELIGDSVEMCNIENELPE 948

>TBLA0B05950 Chr2 (1404509..1407496) [2988 bp, 995 aa] {ON}
           Anc_2.288 YNL023C
          Length = 995

 Score = 1055 bits (2727), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 510/931 (54%), Positives = 648/931 (69%), Gaps = 16/931 (1%)

Query: 27  IGLSEDESEIETNMGAXXXXXXXXXXXXXXKDMAYYEKAVQEIVKGDSYSCLICTVELDY 86
           +   EDES+++T+                 +D+ YYE+AV+EI KGDSY C+ICTVE+D+
Sbjct: 50  LSRDEDESDVDTD-------------NEYEEDLMYYERAVREIAKGDSYQCMICTVEMDH 96

Query: 87  TCKLYACEKCYRVYDYECIREWAEKSTSKRTDKLWACPNCFYTKKAIPKKNRPTCWCGEQ 146
           TCK+YAC  CYRV+DY+CIREWA KST K  DK W CPNC+++ K +P K+RPTCWCG+ 
Sbjct: 97  TCKMYACRHCYRVFDYDCIREWALKSTQKTVDKTWKCPNCYHSSKKVPLKDRPTCWCGKV 156

Query: 147 VNPEPNPLNPNSCGQTCNAKICSHGCSQICHLGPHQECTRMMSIKCSCGKVTKDIVCFQR 206
           VNP+PNPL+PNSCGQTCNA IC H C + CHLG H ECT+++ I C CG+ TKDI C + 
Sbjct: 157 VNPDPNPLDPNSCGQTCNANICPHKCLKQCHLGSHPECTQLLKITCRCGRETKDIYCHES 216

Query: 207 RLYSKGFNCETVCDKLLPCGIHKCNRKCHTGLCGSCPETIISKNTNMKIRCYCGQTSKDK 266
           R     F+C+  C   LPCGIHKC RKCH+GLCGSCPE +I +N + KI+CYCG  S  +
Sbjct: 217 RRQKSIFHCDQECGLTLPCGIHKCRRKCHSGLCGSCPELLIDENVSGKIKCYCGLHSLKE 276

Query: 267 IKCKDVRFPANAAYSKDDKGQRWIGVFMCDKIRKVPYECGEHSFYEKCKAPPSISGRLIC 326
           + CKDV FP++   S++ + + W+G+F C ++R V Y C EH F E C APP++   ++C
Sbjct: 277 MNCKDVAFPSSGKISRNQEDKEWVGIFDCKEMRSVSYTCNEHVFVEGCIAPPTLPSTVVC 336

Query: 327 EFSPKKLKTCPCGKNELTDLSKPRSKCTDAIPTCGQVCGKMLKCGKHKCPFACHLGDCMD 386
            FSP  LKTCPCGK  L D+   R+KCTD IPTC  VC K+LKCGKH+CPF CH G CMD
Sbjct: 337 PFSPNLLKTCPCGKTALQDMDCERTKCTDPIPTCDNVCNKILKCGKHRCPFTCHTGKCMD 396

Query: 387 PCTQIEKVRCACEQKQFTIPCGFNDHARCNLKCESLMSCRRHRCTERCCAGRPLAERRRK 446
           PC QI+K+ CACE++ F +PC F     C  KCESLMSCRRHRC E CC+GRP AERR+K
Sbjct: 397 PCIQIDKMDCACERRTFLVPCQFKGKPVCKFKCESLMSCRRHRCMEYCCSGRPYAERRKK 456

Query: 447 TMKINVRDLADESTIEPIHICLKDCNLTLSCGIHKCNRKCHAGKCPPCLESDSNDLVCPC 506
           T+ +   D  DE+ +E  H+CLKDCNL LSCGIH C RKCH G CPPCLESDSNDLVCPC
Sbjct: 457 TI-LRSSDRNDETLVEAEHVCLKDCNLKLSCGIHTCQRKCHPGPCPPCLESDSNDLVCPC 515

Query: 507 GKTIVEAPVRCGTKLPNCPYPCIRVVRGETDCGHSPMPHECHPPDIPCPDCTATVFKPCK 566
           GKT++ APVRCGT LP C YPCI+V+RGE+DCGH PMPH CH  D PCP CTA VFKPCK
Sbjct: 516 GKTVIPAPVRCGTTLPPCKYPCIKVIRGESDCGHKPMPHSCHSLDQPCPVCTAPVFKPCK 575

Query: 567 CGKEQRVRTVCFMKDVSCGKVCGERLQTCYHKCQKKCHEPGACQTVCKQTCNMPRLYCNH 626
           CGK+ +VRT+CF +DVSCG  CG  L+ CYHKCQK+CH PG CQ  C Q CN  R  C+H
Sbjct: 576 CGKKDKVRTMCFQEDVSCGLPCGLPLKDCYHKCQKRCHLPGECQNTCIQICNAKRSNCSH 635

Query: 627 RCPKPCHKFEECPDIPCTALVKITCPCGRIEKEVTCGVYSKNKEAQDSTRIVCDEECAVL 686
            C + CHK   CPDIPCT  V + C CGR +    C   S       ++ + CDEEC +L
Sbjct: 636 GCTQRCHKNAPCPDIPCTVPVTVVCDCGRRKLVKPCSSTSTIDSVTITSHLECDEECMLL 695

Query: 687 QRHMQLKEAFGIVDKPQNTHNE-EMARLEQVISTASTFADLDLPFTEPVITTYIRHENWC 745
            R M+LK AFGIV+   +      + R++  IS A  + +L+LPF E V+T Y +   WC
Sbjct: 696 LRRMELKAAFGIVNGLGDDKTSVAIERIQNRISVAKAYEELELPFVEAVLTVYAKQPKWC 755

Query: 746 TDIENTLNKLIDDNNRTSLHFKPMRPPQRYFIRELAKAYNLYSESQDPEPNRSVFVKKNL 805
           + IE  LNK +D+  ++SLHFK M+ PQR F+  LA AY +YSESQDPEP RSVFVKK  
Sbjct: 756 SQIEGILNKFMDEKLKSSLHFKHMKAPQRSFVHNLADAYKIYSESQDPEPVRSVFVKKLT 815

Query: 806 DGSSTKPILSISEAAPLYQSYKKLEKEKKQANFESMTTTRLINFTPEMSPELESAARFNG 865
           +G+S+KPIL++ EA PLY+S+K+++KEKK+  +E+ T   LIN   E   + +SA ++NG
Sbjct: 816 NGTSSKPILTLEEALPLYESFKEVQKEKKKQEYEARTHKTLINVEAETQTQ-QSATKYNG 874

Query: 866 FLVTNVGEFTSTDDLQNLFAPYLKSTLVVEPQFQILPERKQAVIYPNKYKEISINVERDM 925
           FL+ N+ + T+ +DL+ +F   LK TLV +PQ+ ++ E     I P  Y EISINVERDM
Sbjct: 875 FLIKNLVKGTTEEDLERIFGESLKPTLVKDPQYLVMDESHHGFICPADYAEISINVERDM 934

Query: 926 ETLVQHFDFLIKESLLAGGVELCNIENVLAE 956
           E L+  FD L KE  +   VELCNI+  L +
Sbjct: 935 EQLIGFFDSLCKEHFIGDIVELCNIDEALLQ 965

>ZYRO0A01936g Chr1 (159749..162610) [2862 bp, 953 aa] {ON} similar
           to uniprot|P53971 Saccharomyces cerevisiae YNL023C
          Length = 953

 Score = 1040 bits (2690), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 500/901 (55%), Positives = 632/901 (70%), Gaps = 17/901 (1%)

Query: 59  MAYYEKAVQEIVKGDSYSCLICTVELDYTCKLYACEKCYRVYDYECIREWAEKSTSKRTD 118
           M YYE+AV+EI +GD+Y C+ICTVE+DYTCK++AC KCYRV+DY+CIREWA KST +  D
Sbjct: 56  MMYYERAVKEIARGDTYVCMICTVEMDYTCKMFACSKCYRVFDYDCIREWALKSTGRTMD 115

Query: 119 KLWACPNCFYTKKAIPKKNRPTCWCGEQVNPEPNPLNPNSCGQTCNAKICSHGCSQICHL 178
           K W CPNC      +P+K+RPTCWCG+ VNP+PNPL+PNSCGQTC+A IC HGCS++CHL
Sbjct: 116 KTWKCPNCLDESNKVPRKSRPTCWCGKVVNPDPNPLDPNSCGQTCDAPICEHGCSKVCHL 175

Query: 179 GPHQECTRMMSIKCSCGKVTKDIVCFQ-RRLYSKGFNCETVCDKLLPCGIHKCNRKCHTG 237
           GPH ECTR++SIKC CG+ T+D+ C +     ++ F CE  C  LLPCG+HKC++KCH+G
Sbjct: 176 GPHPECTRIISIKCKCGRHTRDVRCSEVGSGRNQQFTCEESCGLLLPCGVHKCSKKCHSG 235

Query: 238 LCGSCPETIISK-NTNMKIRCYCGQTSKDKIKCKDVRFPANAAYSKDDKGQRWIGVFMCD 296
           LCG C ET+ SK +    I+CYCG      I+C DVR       S DD+G  WIGVF C 
Sbjct: 236 LCGGCNETLHSKPDKGAVIKCYCGLHESPSIRCGDVRVADRD--SVDDQGNGWIGVFRCK 293

Query: 297 KIRKVPYECGEHSFYEKCKAPPSISGRLICEFSPKKLKTCPCGKNELTDLSKPRSKCTDA 356
            +R V Y CG+HSF E CK  PS+  ++ C FSP  L++CPCG+  L  L + R KCTD 
Sbjct: 294 DVRVVEYACGQHSFVESCKPAPSLPKQIGCPFSPNVLRSCPCGRTPLNKLGQARVKCTDH 353

Query: 357 IPTCGQVCGKMLKCGKHKCPFACHLGDCMDPCTQIEKVRCACEQKQFTIPCGFNDHARCN 416
           IPTC   CGK L CGKH CP+ CH GDCMDPC Q EK  C CE + F +PC F +  RCN
Sbjct: 354 IPTCESKCGKKLACGKHTCPYKCHEGDCMDPCVQFEKTNCLCEARSFLVPCQFREDPRCN 413

Query: 417 LKCESLMSCRRHRCTERCCAGRPLAERRRKTMKINVRDLADESTIEPIHICLKDCNLTLS 476
            KCESLMSCRRHRCTE+CC+G+P AERR+KT     R+L DES +E  H+CLK CNLTL+
Sbjct: 414 TKCESLMSCRRHRCTEKCCSGKPGAERRKKT-PFTSRELLDESLVEAEHVCLKSCNLTLT 472

Query: 477 CGIHKCNRKCHAGKCPPCLESDSNDLVCPCGKTIVEAPVRCGTKLPNCPYPCIRVVRGET 536
           CG HKC RKCH G+CPPCLESD NDLVCPCGKT+VEAPVRCGTKLP CPY CI VVR   
Sbjct: 473 CGRHKCQRKCHPGRCPPCLESDPNDLVCPCGKTVVEAPVRCGTKLPPCPYSCISVVRDGY 532

Query: 537 DCGHSPMPHECHPPDIPCPDCTATVFKPCKCGKEQRVRTVCFMKDVSCGKVCGERLQTCY 596
            CGH+PMPH CHPP+  CP CTA V KPCKCGK+  VRT+CF +DVSCG++C + L +C 
Sbjct: 533 PCGHTPMPHLCHPPEEKCPPCTANVKKPCKCGKKSDVRTLCFQQDVSCGQICNKPLGSCR 592

Query: 597 HKCQKKCHEPGACQTVCKQTCNMPRLYCNHRCPKPCHKFEECPDIPCTALVKITCPCGRI 656
           H CQKKCH+ G CQ  C+Q C   R+ C+H+CPKPCH  E CPD PC   V I C CGR 
Sbjct: 593 HTCQKKCHD-GGCQVKCRQICGKKRVNCDHKCPKPCHGGEPCPDFPCPFSVVIKCACGRK 651

Query: 657 EKEVTCGVYSKNKEAQDSTRIVCDEECAVLQRHMQLKEAFGIVDKPQNTHNEEMARLEQV 716
           E    CG  S+   A  +  + CDEEC  ++R  QLK+A G+ +   ++       +E  
Sbjct: 652 ESTEPCGTNSQTLSASVTRELSCDEECERVKRCAQLKDALGLKENGDSS-------VENT 704

Query: 717 IS---TASTFADLDLPFTEPVITTYIRHENWCTDIENTLNKLIDDNNRTSLHFKPMRPPQ 773
           +S    AS F +L LPF E V+  Y R + +C +IE+ LN  IDD  ++SLHFKPM+P Q
Sbjct: 705 VSNALVASNFEELGLPFRETVLAIYSRQQRYCDNIESVLNNFIDDEKKSSLHFKPMKPAQ 764

Query: 774 RYFIRELAKAYNLYSESQDPEPNRSVFVKKNLDGSSTKPILSISEAAPLYQSYKKLEKEK 833
           R+F+ ELAKAY LYSESQDPEP RSV+VKK L+G S KP +++ EA P+YQ++K+ EKE 
Sbjct: 765 RHFVHELAKAYKLYSESQDPEPKRSVYVKKELNGESNKPSITLQEALPIYQAFKQREKET 824

Query: 834 KQANFESMTTTRLINFTPEMSPELESAARFNGFLVTNVGEFTSTDDLQNLFAPYLKSTLV 893
           K   +E    T L+NF P+  P +E  A++NGFL+ N+ + T+ +DLQ ++  +LK TLV
Sbjct: 825 KIRRYEMQNVTNLVNFVPKFEPTVE-LAKYNGFLIRNLTDGTNGEDLQRIYGEHLKPTLV 883

Query: 894 VEPQFQILPERKQAVIYPNKYKEISINVERDMETLVQHFDFLIKESLLAGGVELCNIENV 953
             P ++ LP+R  A+I+P  Y ++++N E DME LV HFDF+ KE  +  GVELC +   
Sbjct: 884 RNPVYKALPDRNIALIFPESYSDVTVNTECDMERLVGHFDFICKEMFIGDGVELCQVGEY 943

Query: 954 L 954
           L
Sbjct: 944 L 944

>Kpol_1039.45 s1039 (135833..138739) [2907 bp, 968 aa] {ON}
           (135833..138739) [2907 nt, 969 aa]
          Length = 968

 Score =  997 bits (2578), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 489/903 (54%), Positives = 628/903 (69%), Gaps = 17/903 (1%)

Query: 57  KDMAYYEKAVQEIVKGDSYSCLICTVELDYTCKLYACEKCYRVYDYECIREWAEKSTSKR 116
           +D+ +YE+A+++I KGD Y+C+ICT+ELD T K+YAC  CYRV+DY+CIREWA KS+ K 
Sbjct: 64  EDLMHYERAIKDIAKGDFYTCMICTIELDSTSKMYACSHCYRVFDYDCIREWAVKSSQKS 123

Query: 117 TDKLWACPNCFYTKKAIPKKNRPTCWCGEQVNPEPNPLNPNSCGQTCNAKICSHGCSQIC 176
            DK+W CPNC +T   IP +NRPTCWCG+ VNP+PNP  PNSCGQTCNAK C H CS  C
Sbjct: 124 LDKVWKCPNCNHTSNKIPLQNRPTCWCGKTVNPDPNPFYPNSCGQTCNAKSCIHRCSHFC 183

Query: 177 HLGPHQECTRMMSIKCSCGKVTKDIVCF---QRRLYSKGFNCETVCDKLLPCGIHKCNRK 233
           HLGPH +C R  +I C CGK TKD+ C+     +  +K FNC   C+  L CGIHKC+R 
Sbjct: 184 HLGPHPQCHRTTTIHCECGKHTKDVFCYLLDHGKNRNKKFNCGEKCNMTLSCGIHKCSRV 243

Query: 234 CHTGLCGSCPETIISKNTNMKIRCYCGQTSKDKIKCKDVRFPANAAYSKDDKGQRWIGVF 293
           CH+G CG CPE I  K     + CYCG T+ DKI+C +V+   +   SKD +G  WIGVF
Sbjct: 244 CHSGSCGPCPELITKK-----VNCYCGSTTMDKIRCSNVKIHDSGKKSKDQEGNTWIGVF 298

Query: 294 MCDKIRKVPYECGEHSFYEKCKAPPSISGRLICEFSPKKLKTCPCGKNELTDLSKPRSKC 353
            C+KIR V Y C  HSF+E C +PP+ISG  IC +SPK LKTCPCGK  L D    R KC
Sbjct: 299 KCNKIRTVEYACKNHSFFETCTSPPTISGTKICPYSPKLLKTCPCGKTNLDDFENKRQKC 358

Query: 354 TDAIPTCGQVCGKMLKCGKHKCPFACHLGDCMDPCTQIEKVRCACEQKQFTIPCGFNDHA 413
           TD I TC   C K LKCGKHKCPF CH G CMDPCTQIE  +C+C  K+F++PC F++  
Sbjct: 359 TDPISTCENRCDKPLKCGKHKCPFTCHNGPCMDPCTQIELRKCSCNYKEFSVPCQFHEKP 418

Query: 414 RCNLKCESLMSCRRHRCTERCCAGRPLAERRRKTMKINVRDLADESTIEPIHICLKDCNL 473
           RCN+KCESLMSCRRHRCT RCC+G+P+A++R+K M  +  DL DES +E  HICLKDCNL
Sbjct: 419 RCNMKCESLMSCRRHRCTRRCCSGKPMADKRKK-MLFSQADLLDESLVEAEHICLKDCNL 477

Query: 474 TLSCGIHKCNRKCHAGKCPPCLESDSNDLVCPCGKTIVEAPVRCGTKLPNCPYPCIRVVR 533
            LSCGIH C RKCHAGKCPPCLESDS+DLVCPCGKT+VEAPVRCGTKLP C +PCI+ + 
Sbjct: 478 KLSCGIHNCTRKCHAGKCPPCLESDSSDLVCPCGKTVVEAPVRCGTKLPECIFPCIKYIE 537

Query: 534 GETDCGHSPMPHECHPPDIPCPDCTATVFKPCKCGKEQRVRTVCFMKDVSCGKVCGERLQ 593
           G   CGH P  H CHP DIPCP CT  VFKPCKCGKEQ+ + +CF +  SCGK+C ++L 
Sbjct: 538 GSYPCGHKPGNHYCHPADIPCPPCTEVVFKPCKCGKEQKAKALCFQETASCGKLCEKKLD 597

Query: 594 TCYHKCQKKCHEPGACQTVCKQTCNMPRLYCNHRCPKPCHKFEECPDIPCTALVKITCPC 653
            C+H CQ KCH PG CQ  C Q CN  R+ C+H C + CH    CPDIPC    ++ C C
Sbjct: 598 GCHHYCQLKCHLPGECQKKCTQICNKRRVNCSHTCDQKCHGDSNCPDIPCKVKCEVYCGC 657

Query: 654 GRIEKEVTCGVYSKNKEAQDSTRIVCDEECAVLQRHMQLKEAFGIVDKPQNTHNEEMARL 713
           GR ++ + CG  S  +  + +  + CD+ C   QR  +L+ AFG+    ++  + E+ RL
Sbjct: 658 GRRKELLLCGATSTTQSVELTKVLPCDDACLKYQRLEELRNAFGMKSSSEDPES-ELERL 716

Query: 714 EQVISTASTFADLDLPFTEPVITTYIRHENWCTDIENTLNKLIDDNNRTSLHFKPMRPPQ 773
           ++++   +++ +L+LPF+E V++ Y +  NWC  IE  +NK ++D N+ SLHFKPM  PQ
Sbjct: 717 KKIVEKVTSYEELELPFSETVLSVYSKQTNWCNQIEELINKFVNDKNKPSLHFKPMPAPQ 776

Query: 774 RYFIRELAKAYNLYSESQDPEPNRSVFVKKNLDGSSTKPILSISEAAPLYQSYKKLEKEK 833
           R FI  L +AY +YSESQD EP RSV++KKN    +  P +S+ EA PLYQSYKK+EKE+
Sbjct: 777 RNFIHALVEAYEMYSESQDREPKRSVYLKKN--KYTRIPNISLEEALPLYQSYKKIEKER 834

Query: 834 KQANFESMTTTRLINFTPEMSPE--LESAARFNGFLVTNVGEFTSTDDLQNLFAPYLKST 891
           K  +FES      +N+ P   PE  L    ++NGFL+  +   T+TDDL  LF  +LK T
Sbjct: 835 KVQSFESKKNVTYLNYQP---PERSLTPDVKYNGFLIKGITFGTTTDDLNTLFGVHLKPT 891

Query: 892 LVVEPQFQILPERKQAVIYPNKYKEISINVERDMETLVQHFDFLIKESLLAGGVELCNIE 951
           L+ + Q+ ILP+ K A++YP  Y  IS NVERD+E+L  HFD++ KE++L   VE+CNI 
Sbjct: 892 LIKDAQYSILPDGKSAIVYPKDYLTISENVERDIESLAGHFDYMTKEAMLGESVEMCNIT 951

Query: 952 NVL 954
           ++L
Sbjct: 952 DIL 954

>KLTH0G10406g Chr7 (880042..882933) [2892 bp, 963 aa] {ON} similar
           to uniprot|P53971 Saccharomyces cerevisiae YNL023C
          Length = 963

 Score =  994 bits (2569), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 493/968 (50%), Positives = 630/968 (65%), Gaps = 37/968 (3%)

Query: 1   MQDGRTEVTQDEYRHYDDHPDNSSLVIGLSEDESEIETNMGAXXXXXXXXXXXXXXK--- 57
           M  G+ ++ + E+       D   +V+    + SE   N+G                   
Sbjct: 1   MTSGQDQIAEAEF-------DEGYVVVRADSETSEAFENVGEDLDEQDEQDEQDEQDELD 53

Query: 58  ------DMAYYEKAVQEIVKGDSYSCLICTVELDYTCKLYACEKCYRVYDYECIREWAEK 111
                 D  YYEK ++EI KGD Y C+ICTVE+D+TC +YAC +CYRV+DYECIREWA K
Sbjct: 54  EQGDTYDQPYYEKTIKEIAKGDRYPCMICTVEMDFTCHMYACPECYRVFDYECIREWAVK 113

Query: 112 STSKRTDKLWACPNCFYTKKAIPKKNRPTCWCGEQVNPEPNPLNPNSCGQTCNAKICSHG 171
           ST K   K W CPNC++ KK +P KNRPTCWCG+ ++PEPNPLNPNSCGQTC+A IC HG
Sbjct: 114 STQKSVTKTWKCPNCYFEKKDVPLKNRPTCWCGKNIHPEPNPLNPNSCGQTCDAPICVHG 173

Query: 172 CSQICHLGPHQECTRMMSIKCSCGKVTKDIVCFQRRLYSKGFNCETVCDKLLPCGIHKCN 231
           CS  CHLGPH  C RM+  KC CGK +KD+ C + R + + F C   C   LPCG+HKC 
Sbjct: 174 CSSTCHLGPHPTCMRMVQTKCRCGKKSKDVFCSEARKHQELFRCGNPCGLTLPCGVHKCQ 233

Query: 232 RKCHTGLCGSCPETIISKNTNMKIRCYCGQTSKDKIKCKDVRFPANAAYSKDDKGQRWIG 291
           R+CH G+CG CPETI  +     I CYCG  S   IKC+DV+  +    S+D  G++WIG
Sbjct: 234 RECHNGVCGECPETIAKE-----INCYCGLESLPSIKCQDVKIQSK---SQDGSGKKWIG 285

Query: 292 VFMCDKIRKVPYECGEHSFYEKCKAPPSISGRLICEFSPKKLKTCPCGKNELTDLSKPRS 351
            F C +IR V Y C EHSF E CKAPPSI+GR+ C +SPK LKTCPCG+  L ++  PR+
Sbjct: 286 AFACSRIRTVEYSCREHSFAEPCKAPPSIAGRIPCPYSPKALKTCPCGETPLENMETPRT 345

Query: 352 KCTDAIPTCGQVCGKMLKCGKHKCPFACHLGDCMDPCTQIEKVRCACEQKQFTIPCGFND 411
           KCTD IPTC   CGK+L CG+H+CPF CH G CM+ CT  +K++C+C  + F +PC F  
Sbjct: 346 KCTDPIPTCDATCGKLLSCGRHRCPFKCHTGTCMEICTCSDKIKCSCNSRPFIVPCKFQG 405

Query: 412 HARCNLKCESLMSCRRHRCTERCCAGRPLAERRRKTMKINVRDLADESTIEPIHICLKDC 471
             RCN KCESLMSCRRHRC ERCC GR LA+ R K + +  RD  DES +E  HICLK C
Sbjct: 406 PPRCNTKCESLMSCRRHRCAERCCDGRSLAQVREKKVFL-TRDKLDESLVEAQHICLKKC 464

Query: 472 NLTLSCGIHKCNRKCHAGKCPPCLESDSNDLVCPCGKTIVEAPVRCGTKLPNCPYPCIRV 531
           NL LSCG H C RKCH G CPPCLESDSNDLVCPCGKT+  APVRCGT LP C  PCI+ 
Sbjct: 465 NLKLSCGRHFCQRKCHPGNCPPCLESDSNDLVCPCGKTVAPAPVRCGTVLPPCRNPCIKT 524

Query: 532 VRGETDCGHSPMPHECHPPDIPCPDCTATVFKPCKCGKEQRVRTVCFMKDVSCGKVCGER 591
           ++G  DCGH PMPH CH  D PCP CTA VFK CKCGK ++VRT+CF  +VSCG+VCG++
Sbjct: 525 LQGPLDCGHPPMPHACHSLDEPCPSCTAPVFKQCKCGKNKKVRTLCFQNNVSCGRVCGKQ 584

Query: 592 LQTCYHKCQKKCHEPGACQTVCKQTCNMPRLYCNHRCPKPCHKFEECPDIPCTALVKITC 651
           L +C+H C K CH  G CQ++CKQ C + R  C+H C   CH    CPD+PC   V++ C
Sbjct: 585 LVSCHHSCTKTCHREGECQSICKQVCGISRSNCSHICRFKCHTGSPCPDVPCNVTVEVKC 644

Query: 652 PCGRIEKEVTCGVYSKNKEAQDSTRIVCDEECAVLQRHMQLKEAFGI-VDKPQNTHNEEM 710
            CG      TC  + + ++  D   + C E+CA  +R ++L EAFG+  +  Q T  E +
Sbjct: 645 GCGHRSSFATCAAH-EGQDPADQRPLECTEDCAAARRRLELMEAFGMNTETVQPT--EGI 701

Query: 711 ARLEQVISTASTFADLDLPFTEPVITTYIRHENWCTDIENTLNKLIDDNNRTSLHFKPMR 770
             L  +    +TF +L LPFTE  ++ + +  NWC+ IE  LN+L+ D ++ SLHFKPM+
Sbjct: 702 VDLAALAEKVTTFQELMLPFTEASLSIFAKQSNWCSQIEEHLNRLMSDISKPSLHFKPMK 761

Query: 771 PPQRYFIRELAKAYNLYSESQDPEPNRSVFVKKNLDGSSTKPILSISEAAPLYQSYKKLE 830
           PPQR+FI ELA+AY LY ESQD EP RSV+VKK +D  S KP LS+ EA PLYQS+K  +
Sbjct: 762 PPQRHFIHELAQAYKLYCESQDKEPKRSVYVKKTVD--SRKPSLSLKEALPLYQSFKNAQ 819

Query: 831 KEKKQANFESMTTTRLINFTP--EMSPELESAARFNGFLVTNVGEFTSTDDLQNLFAPYL 888
           KE+K    E  TTTR++N+T   E SP +   A+ NG L+  V E T    ++  FA YL
Sbjct: 820 KERKLKELERSTTTRILNYTSTGESSPPV---AQINGLLIQKVFEGTDEKTIEACFADYL 876

Query: 889 KSTLVVEPQFQILPERKQAVIYPNKYKEISINVERDMETLVQHFDFLIKESLLAGGVELC 948
           K TL+ +P +  L +    +++   Y   SINVERD+  +V H D + K+S LA GV +C
Sbjct: 877 KHTLIKDPNYLKL-DSGDVMVFAENYATASINVERDINRVVGHLDLIAKDSFLAEGVTVC 935

Query: 949 NIENVLAE 956
            +E V+AE
Sbjct: 936 RVEQVMAE 943

>SAKL0E07634g Chr5 complement(616444..619368) [2925 bp, 974 aa] {ON}
           similar to uniprot|P53971 Saccharomyces cerevisiae
           YNL023C
          Length = 974

 Score =  987 bits (2551), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 487/896 (54%), Positives = 608/896 (67%), Gaps = 15/896 (1%)

Query: 59  MAYYEKAVQEIVKGDSYSCLICTVELDYTCKLYACEKCYRVYDYECIREWAEKSTSKRTD 118
           + YYEK + EI KGDSY+C+ICT+E+DYTC +YAC +CYRVYD+ECIREWA KS+ K  D
Sbjct: 48  LPYYEKTIHEIQKGDSYACMICTMEMDYTCHMYACPECYRVYDHECIREWALKSSQKSLD 107

Query: 119 KLWACPNCFYTKKAIPKKNRPTCWCGEQVNPEPNPLNPNSCGQTCNAKICSHGCSQICHL 178
           K W CPNC+Y    IP KNR TCWCG+ V+PE NP++PNSCGQTCNA ICSHGCS+ CHL
Sbjct: 108 KTWKCPNCYYVNSEIPVKNRHTCWCGKVVHPESNPIDPNSCGQTCNAPICSHGCSKPCHL 167

Query: 179 GPHQECTRMMSIKCSCGKVTKDIVCFQRRLYSKGFNCETVCDKLLPCGIHKCNRKCHTGL 238
           GPH EC R   +KC CGK TKD+ C+Q       + C   C+ LLPCG+HKC RKCH+G 
Sbjct: 168 GPHPECMRTTKVKCLCGKHTKDMFCYQSEEEKASYQCGEPCNLLLPCGVHKCQRKCHSGP 227

Query: 239 CGSCPETIISKNTNMKIRCYCGQTSKDKIKCKDVRFPANAAYSKDDKGQRWIGVFMCDKI 298
           CG+C ETI     + KI CYCG  ++++I CKDV+   + A SK+  G+ WIGVF C  +
Sbjct: 228 CGNCEETI-----SGKIMCYCGMETREQIICKDVK---SVAKSKNKSGEIWIGVFSCAHL 279

Query: 299 RKVPYECGEHSFYEKCKAPPSISGRLICEFSPKKLKTCPCGKNELTDLSKPRSKCTDAIP 358
           R V Y CG HSF E C APP+ SG L C FSP+ LKTCPCG   L  L  PR KCTD IP
Sbjct: 280 RSVEYSCGHHSFQESCTAPPTNSGELACPFSPRLLKTCPCGSTPLKLLEAPRKKCTDPIP 339

Query: 359 TCGQVCGKMLKCGKHKCPFACHLGDCMDPCTQIEKVRCACEQKQFTIPCGFNDHARCNLK 418
           TC   C K LKCGKH CPF CH G CMDPC  ++KV C+C  K F +PC F+D A CN K
Sbjct: 340 TCENRCNKPLKCGKHSCPFVCHDGPCMDPCVSVDKVSCSCHSKSFLVPCQFHDEAHCNTK 399

Query: 419 CESLMSCRRHRCTERCCAGRPLAERRRKTMKINVRDLADESTIEPIHICLKDCNLTLSCG 478
           CESLMSCRRHRCTERCC+GR LA +R KT+ +  RD  DES +E  HICLK CNL LSCG
Sbjct: 400 CESLMSCRRHRCTERCCSGRSLAIKREKTIFL-ARDRLDESLVEAQHICLKPCNLKLSCG 458

Query: 479 IHKCNRKCHAGKCPPCLESDSNDLVCPCGKTIVEAPVRCGTKLPNCPYPCIRVVRGETDC 538
           IH C RKCH GKC PCLESDSNDL CPCGKT+V APVRCGTKLP C +PCI+ ++ +T C
Sbjct: 459 IHYCRRKCHPGKCSPCLESDSNDLSCPCGKTVVPAPVRCGTKLPPCRHPCIKTLQADTVC 518

Query: 539 GHSPMPHECHPPDIPCPDCTATVFKPCKCGKEQRVRTVCFMKDVSCGKVCGERLQTCYHK 598
           GH PMPHECH  + PCP CTA ++K CKC K ++VRT+CF  DVSCGK+CG  L+ C H 
Sbjct: 519 GHPPMPHECHSLEQPCPQCTAPIYKKCKCNKVEKVRTLCFQNDVSCGKICGLPLKNCSHT 578

Query: 599 CQKKCHEPGACQTVCKQTCNMPRLYCNHRCPKPCHKFEECPDIPCTALVKITCPCGRIEK 658
           C++ CHEPG CQT+CKQ C +PR +C H+C   CH  ++CPD  C   VK+TC CGR E 
Sbjct: 579 CKRTCHEPGQCQTICKQICGLPRKFCEHKCFARCHPGKDCPDEACQVKVKVTCSCGRKES 638

Query: 659 EVTCGVYSKNKEAQDSTRIVCDEECAVLQRHMQLKEAFGIVDKPQNTHNEEMARLEQVIS 718
            + C  ++    ++    + CD++C   +RH  L EAFGI +K        +  L  ++ 
Sbjct: 639 ILPCDAHADQPSSKLLITLPCDDKCEESKRHRMLMEAFGIKEK----LTAPVEELRDLVE 694

Query: 719 TASTFADLDLPFTEPVITTYIRHENWCTDIENTLNKLIDDNNRTSLHFKPMRPPQRYFIR 778
           +A +F +L LPFTE  ++ Y +   WC  IE+ L+KL+ D  RTSLHFKPM+ PQR FI 
Sbjct: 695 SAKSFDELHLPFTESTLSVYSKQRAWCNQIESFLSKLMRDVTRTSLHFKPMKLPQRRFIH 754

Query: 779 ELAKAYNLYSESQDPEPNRSVFVKKNLDGSSTKPILSISEAAPLYQSYKKLEKEKKQANF 838
           ELA AY LYSESQD EP RSVFVKK ++  S  P+L + EA PLY S+K+L+KE+K    
Sbjct: 755 ELANAYALYSESQDREPKRSVFVKK-VENKSHIPLLCLGEALPLYHSFKQLQKERKVKEL 813

Query: 839 ESMTTTRLINFTPEMSPELESAARFNGFLVTNVGEFTSTDDLQNLFAPYLKSTLVVEPQF 898
           E  TT RL N+T + + ++   A FN FLV  V    + D+L +  A YL+ TL+  P +
Sbjct: 814 EKSTTRRLFNYTVDDANDVPHNAEFNCFLVKGVAPGVTKDELSDCLAEYLQFTLIQNPSY 873

Query: 899 QILPERKQAVIYPNKYKEISINVERDMETLVQHFDFLIKESLLAGGVELCNIENVL 954
           Q L E    +IYP  +  IS NVE D++ L  +   + KE  ++ GV+L  I+  L
Sbjct: 874 QTL-ENGDFLIYPEDHMSISENVENDIKRLAPYISSICKEKQISEGVKLYKIDENL 928

>TPHA0D01530 Chr4 complement(313063..315951) [2889 bp, 962 aa] {ON}
           Anc_2.288 YNL023C
          Length = 962

 Score =  978 bits (2528), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 461/907 (50%), Positives = 616/907 (67%), Gaps = 17/907 (1%)

Query: 59  MAYYEKAVQEIVKGDSYSCLICTVELDYTCKLYACEKCYRVYDYECIREWAEKSTSKRTD 118
           + YYE+ +++I KGD Y+C+ICT+E+DYTCK+YAC+ CYRV+DYECI+EWAEKS SK  D
Sbjct: 45  LVYYEQTIRDISKGDRYTCMICTIEMDYTCKMYACQSCYRVFDYECIQEWAEKSASKTID 104

Query: 119 KLWACPNCFYTKKAIPKKNRPTCWCGEQVNPEPNPLNPNSCGQTCNAKICSHGCSQICHL 178
           K+W CPNC ++ K IP +NRPTCWCG+ +NP+PN L+PNSCGQTCN K C HGC   CHL
Sbjct: 105 KVWKCPNCSHSSKQIPLRNRPTCWCGKVINPDPNELSPNSCGQTCNKKTCVHGCKNFCHL 164

Query: 179 GPHQECTRMMSIKCSCGKVTKDIVCFQRRLYSKG--FNCETVCDKLLPCGIHKCNRKCHT 236
           GPH EC+ + ++KC CG+  KDI C Q +  +K   + C  VC   L CG+HKC R CH+
Sbjct: 165 GPHGECSVITTLKCKCGRNEKDIFCHQLKKSNKNNVYQCNEVCQLPLACGVHKCKRVCHS 224

Query: 237 GLCGSCPETI-------ISKNTNMKIRCYCGQTSKDKIKCKDVRFPANAAYSKDDKGQRW 289
           GLCG+CPE +       +  N N K +CYCG+ SK++I CK  +      +SK+ +G +W
Sbjct: 225 GLCGACPEILSSEQIQSVESNENRKFKCYCGENSKNEIMCK--KLAITGTFSKNSEGDKW 282

Query: 290 IGVFMCDKIRKVPYECGEHSFYEKCKAPPSISGRLICEFSPKKLKTCPCGKNELTDLSKP 349
           IG F C   R V Y C EHSF E C+A  SISG+ IC ++PK L +CPCGK  L  L++ 
Sbjct: 283 IGTFACKTRRIVFYACNEHSFIEPCQAQLSISGKKICPYTPKLLNSCPCGKTSLKQLAQK 342

Query: 350 RSKCTDAIPTCGQVCGKMLKCGKHKCPFACHLGDCMDPCTQIEKVRCACEQKQFTIPCGF 409
           R KCTD IPTC   CGK LKCGKH CP+ CH G CMDPC Q+E   C+C QK F +PC F
Sbjct: 343 RKKCTDPIPTCENRCGKALKCGKHTCPYICHNGSCMDPCIQLEVTNCSCLQKHFLVPCNF 402

Query: 410 NDHARCNLKCESLMSCRRHRCTERCCAGRPLAERRRKTMKINVRDLADESTIEPIHICLK 469
               +C  KCESLMSCRRHRC ++CC G+P A++R+K M +   +L DES +E +HICLK
Sbjct: 403 EQTPKCTFKCESLMSCRRHRCPKKCCTGKPEADKRKK-MLLTREELNDESLVEAVHICLK 461

Query: 470 DCNLTLSCGIHKCNRKCHAGKCPPCLESDSNDLVCPCGKTIVEAPVRCGTKLPNCPYPCI 529
           +CNL LSCGIH C RKCH G+CP CL SDSNDLVCPCGKT++EAPVRCG+KLP CP+ CI
Sbjct: 462 ECNLKLSCGIHDCTRKCHPGRCPSCLISDSNDLVCPCGKTVIEAPVRCGSKLPPCPFECI 521

Query: 530 RVVRGETDCGHSPMPHECHPPDIPCPDCTATVFKPCKCGKEQRVRTVCFMKDVSCGKVCG 589
           +V+     CGH P PH+CHP   PCP CTA V +PCKCGK   V+ VCF +  SCG++C 
Sbjct: 522 KVIERSYPCGHKPPPHQCHPSTEPCPPCTAVVERPCKCGKHHAVKAVCFQEFGSCGEICN 581

Query: 590 ERLQTCYHKCQKKCHEPGACQTVCKQTCNMPRLYCNHRCPKPCHKFEECPDIPCTALVKI 649
           + L+ C+HKCQ KCHE G CQ  CKQ CN  R  CNH+C   CH    CPD+PC  + K+
Sbjct: 582 KELENCHHKCQYKCHEIGQCQKSCKQVCNKDRANCNHQCKSKCHGSSPCPDVPCNEVTKV 641

Query: 650 TCPCGRIEKEVTCGVYSKNKEAQDSTRIVCDEECAVLQRHMQLKEAFGIVDKPQNTHNEE 709
           +C CGR ++   C     N  A     + CDE+C    RH+QL++AFG  D   +T N+ 
Sbjct: 642 SCKCGRKQEYRKCYATLDNSSASIEL-LPCDEDCEAHARHLQLRDAFG-YDSSLDTSNKN 699

Query: 710 MARLEQVISTASTFADLDLPFTEPVITTYIRHENWCTDIENTLNKLIDDNNRTSLHFKPM 769
           +  ++ ++   ST+ +L LP+ + VI+TY +   WC+ IE+ L K + D  + +LHFKPM
Sbjct: 700 IQDIQSLMEKVSTYEELRLPYPQSVISTYSKQIKWCSQIEDILRKFVLDKAKNNLHFKPM 759

Query: 770 RPPQRYFIRELAKAYNLYSESQDPEPNRSVFVKKNLDGSSTKPILSISEAAPLYQSYKKL 829
           +P QR+F+REL+ ++NLYSESQDPEP RSVFVK+ +D  +  P +S+ E  PL+  +KKL
Sbjct: 760 KPAQRHFVRELSTSFNLYSESQDPEPKRSVFVKRKVD--TRIPNISLEEVLPLWTGFKKL 817

Query: 830 EKEKKQANFESMTTTRLINFTPEMSPELESAARFNGFLVTNVGEFTSTDDLQNLFAPYLK 889
           EKE+K  +FES +  + IN+ P+    ++S+   NGF +  +    + +DL  +F   LK
Sbjct: 818 EKERKIQHFESTSQRKYINYEPKEVI-VKSSNDTNGFFIKKISPGITEEDLSEVFGKALK 876

Query: 890 STLVVEPQFQILPERKQAVIYPNKYKEISINVERDMETLVQHFDFLIKESLLAGGVELCN 949
           STL+    ++ILPE   A+IYP +Y  I+ +V +D+E LV HFDF+ KE+L+   + LCN
Sbjct: 877 STLIKNVCYKILPESSDAIIYPEQYNSITESVHQDLEVLVGHFDFIGKEALIFDSIMLCN 936

Query: 950 IENVLAE 956
           +E  + +
Sbjct: 937 VEGYINQ 943

>Kwal_27.11518 s27 complement(832986..835847) [2862 bp, 953 aa] {ON}
           YNL023C (FAP1) - Transcription factor homolog;
           similarity to Drosophila melanogaster shuttle craft
           protein; similarity to human NFX1 protein; similarity to
           human DNA-binding protein tenascin [contig 27] FULL
          Length = 953

 Score =  971 bits (2511), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 485/898 (54%), Positives = 606/898 (67%), Gaps = 14/898 (1%)

Query: 57  KDMAYYEKAVQEIVKGDSYSCLICTVELDYTCKLYACEKCYRVYDYECIREWAEKSTSKR 116
           +D  YYEK V+EI KGD Y C+ICTVE+D+TC +YAC  CYRV+D+ECIREWA KST K 
Sbjct: 41  EDQPYYEKTVKEIEKGDRYPCMICTVEMDFTCHMYACPDCYRVFDFECIREWALKSTQKS 100

Query: 117 TDKLWACPNCFYTKKAIPKKNRPTCWCGEQVNPEPNPLNPNSCGQTCNAKICSHGCSQIC 176
             K W CPNC++ +K +P KNRPTCWCG+ V PEPNPLNPNSCGQTC+A+IC HGCS IC
Sbjct: 101 VSKTWKCPNCYFERKEVPMKNRPTCWCGKSVQPEPNPLNPNSCGQTCDAQICEHGCSSIC 160

Query: 177 HLGPHQECTRMMSIKCSCGKVTKDIVCFQRRLYSKGFNCETVCDKLLPCGIHKCNRKCHT 236
           HLGPH  C RM+ +KC+CGK  K + C +   +   F C++ C   LPCGIHKC RKCH+
Sbjct: 161 HLGPHPTCMRMVQVKCNCGKKNKSVFCHEAGKFVDSFICDSPCGLTLPCGIHKCQRKCHS 220

Query: 237 GLCGSCPETIISKNTNMKIRCYCGQTSKDKIKCKDVRFPANAAYSKDDKGQRWIGVFMCD 296
           G+CG CPE+I        I CYC   SK  +KC +VR       S+D  G +W+G F C+
Sbjct: 221 GICGECPESIYGT-----INCYCKLESKPSLKCTEVRIEGR---SRDSSGNKWVGAFSCE 272

Query: 297 KIRKVPYECGEHSFYEKCKAPPSISGRLICEFSPKKLKTCPCGKNELTDLSKPRSKCTDA 356
            IR V + C +HSF E CKAPPSISG++ C FSP+ LKTCPCG++ L ++   RS+CTD 
Sbjct: 273 NIRTVEHSCKKHSFAEPCKAPPSISGQVPCPFSPRTLKTCPCGRSPLREMDVSRSQCTDP 332

Query: 357 IPTCGQVCGKMLKCGKHKCPFACHLGDCMDPCTQIEKVRCACEQKQFTIPCGFNDHARCN 416
           IPTC  VCGKML+CGKHKCPF CH G CM+ C   +KV+C+C  +QF +PC F + ARCN
Sbjct: 333 IPTCDSVCGKMLRCGKHKCPFKCHTGSCMEECLCTDKVKCSCHARQFIVPCKFQEKARCN 392

Query: 417 LKCESLMSCRRHRCTERCCAGRPLAERRRKTMKINVRDLADESTIEPIHICLKDCNLTLS 476
            KCE+LMSCRRHRC ERCC GR LA+ R K + +  RD  DES +E  HICLK CNL LS
Sbjct: 393 TKCEALMSCRRHRCIERCCDGRSLAQSREKKVFL-TRDKLDESLVEAQHICLKQCNLKLS 451

Query: 477 CGIHKCNRKCHAGKCPPCLESDSNDLVCPCGKTIVEAPVRCGTKLPNCPYPCIRVVRGET 536
           CG H C RKCH G C PCLESDSNDLVCPCGKT+V APVRCGT LP C +PCI+ ++G  
Sbjct: 452 CGKHFCKRKCHPGNCAPCLESDSNDLVCPCGKTVVPAPVRCGTVLPRCLHPCIKTLQGPA 511

Query: 537 DCGHSPMPHECHPPDIPCPDCTATVFKPCKCGKEQRVRTVCFMKDVSCGKVCGERLQTCY 596
            CGH PMPH CHP + PCP CTA VFK CKC K  +VRT+CF  DVSCG+VCG++L  C 
Sbjct: 512 PCGHPPMPHPCHPLEEPCPSCTAPVFKSCKCRKNDKVRTLCFQNDVSCGRVCGKQLAGCQ 571

Query: 597 HKCQKKCHEPGACQTVCKQTCNMPRLYCNHRCPKPCHKFEECPDIPCTALVKITCPCGRI 656
           H CQK CH+ G CQT CKQ C   R  C HRC   CH    CPD PC  LV I C CG  
Sbjct: 572 HICQKACHKEGECQTSCKQPCGKTRENCEHRCRALCHSGTPCPDKPCLNLVDIKCNCGHR 631

Query: 657 EKEVTCGVYSKNKEAQDSTRIVCDEECAVLQRHMQLKEAFGIVDKPQNTHNEEMARLEQV 716
              VTCG  ++N+   + T + C+ +C V +RH +L EAFGI +   N  ++ +  LE +
Sbjct: 632 STTVTCGA-NENRAPAEETALECNNDCDVARRHHELMEAFGIKND-ANQGSKSLEDLEAL 689

Query: 717 ISTASTFADLDLPFTEPVITTYIRHENWCTDIENTLNKLIDDNNRTSLHFKPMRPPQRYF 776
               STF +L LPF+E  ++ + +   WCT IE  L +L++D N+ SLHFKPMRPPQR+F
Sbjct: 690 AEKVSTFQELLLPFSEATLSIFSKQTTWCTQIEECLERLMNDKNKPSLHFKPMRPPQRHF 749

Query: 777 IRELAKAYNLYSESQDPEPNRSVFVKKNLDGSSTKPILSISEAAPLYQSYKKLEKEKKQA 836
           I EL +AY+LY ESQD EP RSVFVKK  D  S +P +S+  A PLY S+K  ++EKK  
Sbjct: 750 IHELGQAYHLYCESQDQEPKRSVFVKKTAD--SQRPSISLKVALPLYYSFKSAQREKKLK 807

Query: 837 NFESMTTTRLINFTPEMSPELESAARFNGFLVTNVGEFTSTDDLQNLFAPYLKSTLVVEP 896
             E  TTTR+IN+      +   AARFNG LV NV    +   +Q  F+ YLK TL+ +P
Sbjct: 808 ETERHTTTRIINYAVTDQAQTPPAARFNGLLVQNVLNGINEKAIQESFSEYLKHTLLKDP 867

Query: 897 QFQILPERKQAVIYPNKYKEISINVERDMETLVQHFDFLIKESLLAGGVELCNIENVL 954
            + +L      ++Y + Y   S+NVE D+E +V H D ++KE LLA GV    +++ L
Sbjct: 868 HYLLLAS-GDVLVYCDDYSTASVNVENDIERIVGHLDHIVKEQLLAEGVYATRVQSFL 924

>KLLA0E08317g Chr5 complement(747272..750037) [2766 bp, 921 aa] {ON}
           similar to uniprot|P53971 Saccharomyces cerevisiae
           YNL023C
          Length = 921

 Score =  921 bits (2380), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 455/900 (50%), Positives = 585/900 (65%), Gaps = 16/900 (1%)

Query: 58  DMAYYEKAVQEIVKGDSYSCLICTVELDYTCKLYACEKCYRVYDYECIREWAEKSTSKRT 117
           ++ YYE+ V+EI  GD Y C+ICTVELD TC++YAC+ CYRV+DYEC+REWA KST+K  
Sbjct: 31  NIPYYEQTVKEIKDGDQYVCMICTVELDSTCRMYACDSCYRVFDYECVREWALKSTNKTL 90

Query: 118 DKLWACPNCFYTKKAIPKKNRPTCWCGEQVNPEPNPLNPNSCGQTCNAKICSHGCSQICH 177
           DK W CPNC+     IPK+ R TCWCG+ VNP+ N L+PNSCGQTCNA  C HGCS++CH
Sbjct: 91  DKSWKCPNCYKINHKIPKQKRSTCWCGKVVNPDVNELDPNSCGQTCNAYSCVHGCSKVCH 150

Query: 178 LGPHQECTRMMSIKCSCGKVTKDIVCFQRRLYSKGFNCETVCDKLLPCGIHKCNRKCHTG 237
           LGPH EC   + IKC CGK  K I C + ++    +NC  VC  LLPCG H C + CHTG
Sbjct: 151 LGPHPECLIPVQIKCKCGKHCKQIPCSRSKVLGNSYNCGDVCGLLLPCGKHTCQKTCHTG 210

Query: 238 LCGSCPETIISKNTNMKIRCYCGQTSKDKIKCKDVRFPANAAYSKDDKGQRWIGVFMCDK 297
            CG C E+II      ++ CYCG   K  I+C D+R      YSKD  G++WIGV+ C +
Sbjct: 211 FCGPC-ESII----KTELPCYCGSDVKSGIQCSDLRV---LDYSKDVSGKKWIGVYSCGE 262

Query: 298 IRKVPYECGEHSFYEKCKAPPSISGRLICEFSPKKLKTCPCGKNELTDLSKPRSKCTDAI 357
           +R + Y C  H++ E+C AP  I     C FSPK LKTCPCGK  L +L KPR KCTD I
Sbjct: 263 VRTLHYSCDHHTYVEQCLAPAGIDRSRPCPFSPKTLKTCPCGKTMLKELDKPRRKCTDTI 322

Query: 358 PTCGQVCGKMLKCGKHKCPFACHLGDCMDPCTQIEKVRCACEQKQFTIPCGFNDHARCNL 417
           PTC  VCGK L CGKH CPF+CH GDCMDPC  I K  C C  K F  PC  +D  RCN+
Sbjct: 323 PTCSNVCGKQLSCGKHTCPFSCHTGDCMDPCLIITKTPCTCHSKTFLTPCQLHDTPRCNI 382

Query: 418 KCESLMSCRRHRCTERCCAGRPLAERRRKTMKINVRDLADESTIEPIHICLKDCNLTLSC 477
           KCES MSCRRH+C E CC+G+P A++R KT+ +  RDL +E+ +EP H+CLK CNL LSC
Sbjct: 383 KCESNMSCRRHKCMEICCSGKPAAKKREKTLFLK-RDLNNETLVEPEHVCLKQCNLKLSC 441

Query: 478 GIHKCNRKCHAGKCPPCLESDSNDLVCPCGKTIVEAPVRCGTKLPNCPYPCIRVVRGETD 537
           GIH C  KCH GKCPPCLESD NDLVCPCGKT+V APVRCGTKLP CP PCI++  G   
Sbjct: 442 GIHDCTWKCHPGKCPPCLESDPNDLVCPCGKTVVPAPVRCGTKLPPCPNPCIKISEGPAP 501

Query: 538 CGHSPMPHECHPPDIPCPDCTATVFKPCKCGKEQRVRTVCFMKD--VSCGKVCGERLQTC 595
           CGH   PH+CHP    CP CTA V K C+C K+  +RT+C + D  V+CG  CG  L TC
Sbjct: 502 CGHRVGPHKCHPAGTDCPPCTANVIKKCRCYKKHDMRTLCLVPDSQVACGTECGLPLATC 561

Query: 596 YHKCQKKCHEPGACQTVCKQTCNMPRLYCNHRCPKPCHKFEECPDIPCTALVKITCPCGR 655
           +HKCQKKCH  G C+  C + C + R  C H C + CH    CP+  C   V ITC C R
Sbjct: 562 HHKCQKKCHVEGECEIKCAKPCGLKRSLCGHLCKEKCHGNSPCPEKVCHEKVVITCDCNR 621

Query: 656 IEKEVTCGVYSKNKEAQDSTRIVCDEECAVLQRHMQLKEAFGIVDKPQNTHNEEMARLEQ 715
             K+V CG     +   ++ ++ CDEECA LQRHM+L EAFG+ +KP+NT  +    LE 
Sbjct: 622 RTKQVECGATHDTQSRSETEKLPCDEECAKLQRHMELMEAFGMNEKPKNTKEQ----LES 677

Query: 716 VISTASTFADLDLPFTEPVITTYIRHENWCTDIENTLNKLIDDNNRTSLHFKPMRPPQRY 775
           ++  A  F DL++P++E V+  Y +  NWC  I    +K I+D  + SLH KPMR PQR 
Sbjct: 678 IVLVAKKFDDLNMPYSELVLNVYKKQVNWCDQICAVFDKFIEDTQKLSLHLKPMRVPQRQ 737

Query: 776 FIRELAKAYNLYSESQDPEPNRSVFVKKNLDGSSTKPILSISEAAPLYQSYKKLEKEKKQ 835
           FI+ELA AY LYSESQD EPNRSV++KK +   S KP L++ +A+ LYQ +K LEKE+ Q
Sbjct: 738 FIKELASAYALYSESQDREPNRSVYLKK-IQSQSKKPELTLKDASELYQLFKTLEKERMQ 796

Query: 836 ANFESMTTTRLINFTPEMSPELESAARFNGFLVTNVGEFTSTDDLQNLFAPYLKSTLVVE 895
            ++ +  T  LIN     +P        N  +++ V + +  D+++ L   +LK TLV  
Sbjct: 797 EHYSTKVTKTLINIPASETPLPAPYEGPNAIVISGVFDSSQIDNIEPLVHDFLKYTLVKT 856

Query: 896 PQFQILPERKQAVIYPNKYKEISINVERDMETLVQHFDFLIKESLLAGGVELCNIENVLA 955
           PQ++ L +    +I+P  Y  I+ N   DME ++      +++ +LA GVE+C ++  L+
Sbjct: 857 PQYRFLKDLNSVLIFPENYSGITKNTASDMEKVIPFIKTALQDQMLATGVEMCQVDENLS 916

>ADL213W Chr4 (329646..332372) [2727 bp, 908 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YNL023C (FAP1)
          Length = 908

 Score =  904 bits (2337), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 448/899 (49%), Positives = 579/899 (64%), Gaps = 21/899 (2%)

Query: 57  KDMAYYEKAVQEIVKGDSYSCLICTVELDYTCKLYACEKCYRVYDYECIREWAEKSTSKR 116
           + + YYE+ V E+  G++Y CLICTVE+D +C +YAC +CYRVYDYECIR WA K+TS  
Sbjct: 14  EGIPYYEQTVLELRDGETYQCLICTVEMDASCPMYACHQCYRVYDYECIRRWALKATSTT 73

Query: 117 TDKLWACPNCFYTKKAIPKKNRPTCWCGEQVNPEPNPLNPNSCGQTCNAKICSHGCSQIC 176
            D+ W CPNC++  + +P KNR TCWCG+QVN +PN +NPNSCGQTC A IC HGCS++C
Sbjct: 74  VDRTWKCPNCYHVNRKVPPKNRHTCWCGKQVNLDPNYINPNSCGQTCGAPICQHGCSKLC 133

Query: 177 HLGPHQECTRMMSIKCSCGKVTKDIVCFQRRLYSKGFNCETVCDKLLPCGIHKCNRKCHT 236
           HLGPH+EC   +  KC CGK+T++I C++ +   + F+C+  C   +PCGIHKC R CH 
Sbjct: 134 HLGPHEECMVRIDFKCRCGKLTEEIPCYEAKAAKRNFSCDQPCGLPMPCGIHKCERVCHN 193

Query: 237 GLCGSCPETIISKNTNMKIRCYCGQTSKDKIKCKDVRFPANAAYSKDDKGQRWIGVFMCD 296
           G CG C E I        I+CYCG T+++K+ C +V      A SK  K + WIG F CD
Sbjct: 194 GPCGPCKEEIAG-----DIKCYCGLTTRNKMVCSEVSV---VARSKVSKYKSWIGAFACD 245

Query: 297 KIRKVPYECGEHSFYEKCKAPPSISGRLICEFSPKKLKTCPCGKNELTDLSKPRSKCTDA 356
           ++R+VPY CG+HSF+EKC APPS+  R  C +SP+   TCPCGK +L +L   R+ CTD 
Sbjct: 246 RMREVPYSCGKHSFHEKCIAPPSLPKRTPCPYSPENCTTCPCGKTQLAELGSTRTACTDH 305

Query: 357 IPTCGQVCGKMLKCGKHKCPFACHLGDCMDPCTQIEKVRCACEQKQFTIPCGFNDHARCN 416
           I +CG+VCGK L CG H CP  CH G+CMDPC  I + +CACEQ++F +PC F     C 
Sbjct: 306 ISSCGKVCGKQLSCGNHTCPMTCHDGNCMDPCLVITEQKCACEQRRFLVPCQFPHSPSCT 365

Query: 417 LKCESLMSCRRHRCTERCCAGRPLAERRRKTMKINVRDLADESTIEPIHICLKDCNLTLS 476
            KCESLMSCRRHRC ERCC+GRP + +R    +    D  DES +E  H+CLKDCN  L 
Sbjct: 366 AKCESLMSCRRHRCAERCCSGRPHSVKRNSRRRRESPD--DESEVEAQHVCLKDCNRVLL 423

Query: 477 CGIHKCNRKCHAGKCPPCLESDSNDLVCPCGKTIVEAPVRCGTKLPNCPYPCIRVVRGET 536
           CGIH CN KCHAGKCPPCLESDSNDL+CPCGKTIV APVRCGTKLP C +PC   +    
Sbjct: 424 CGIHMCNYKCHAGKCPPCLESDSNDLICPCGKTIVPAPVRCGTKLPRCTHPCRNSLLDTW 483

Query: 537 DCGHSPMPHECHPPDIPCPDCTATVFKPCKCGKEQRVRTVCFMKDVSCGKVCGERLQTCY 596
            CGHSP  H CHP D PCP CT TV K C+CGK + +RT C+  DVSC + C + L  C 
Sbjct: 484 PCGHSPPSHNCHPLDEPCPPCTITVKKTCRCGKNE-IRTFCYNDDVSCSRPCKKPLSYCN 542

Query: 597 HKCQKKCHEPGACQTVCKQTCNMPRLYCNHRCPKPCHKFEECPDIPCTALVKITCPCGRI 656
           H CQ  CH  G CQ  CKQ C +PR  C H C   CH    CP+ PCT    ITC CG  
Sbjct: 543 HFCQVPCHSDGQCQQTCKQACGLPRKACEHVCKAKCHGHTACPESPCTEKKTITCSCGHK 602

Query: 657 EKEVTCGVYS-KNKEAQDSTRIVCDEECAVLQRHMQLKEAFGIVDKPQNTHNEEMARLEQ 715
                C  Y+ K+     S  + CDE+CA  QRH QL  AFG+V+K  +  +E +   ++
Sbjct: 603 SSTKICSEYAGKDDGIGASQHLSCDEDCAKFQRHQQLMRAFGVVEKATSEEDEALLLAQR 662

Query: 716 VISTASTFADLDLPFTEPVITTYIRHENWCTDIENTLNKLIDDNNRTSLHFKPMRPPQRY 775
               + +F DL LPFTE V++ + +   WCT IE  L KL+DD++  +LHFKPMR  QR 
Sbjct: 663 ----SQSFDDLHLPFTEYVLSVFTKQSQWCTQIEQYLIKLMDDSSPKALHFKPMRAAQRR 718

Query: 776 FIRELAKAYNLYSESQDPEPNRSVFVKKNLDGSSTKPILSISEAAPLYQSYKKLEKEKKQ 835
           F+ EL+ ++ LYSESQDPEP RSV+VKK   G S  P + +S+AAPLY S+KKLE+E K 
Sbjct: 719 FVHELSSSFGLYSESQDPEPKRSVYVKKT--GISRVPAIGLSKAAPLYTSFKKLEREFK- 775

Query: 836 ANFESMTTTRLINFTPEMSPELESAARFNGFLVTNVGEFTSTDDLQNLFAPYLKSTLVVE 895
           AN ES  T +L++   + SPE +  A  N  L++ +  F S   L++ FA Y   TL+  
Sbjct: 776 ANSESAVTKKLVSVHIDDSPESQHDAAINAILLSGLTSFASESALRDCFADYFSQTLLNC 835

Query: 896 PQFQILPERKQAVIYPNKYKEISINVERDMETLVQHFDFLIKESLLAGGVELCNIENVL 954
           PQ+ +     +  I+P  Y  +S N E+D+  L  +F  L +E  L   +  C +++ L
Sbjct: 836 PQYVV--RGTEGYIFPTDYLSLSANAEKDLTKLAGYFRLLFQEQNLWTDISTCKLDSNL 892

>Ecym_3327 Chr3 (626396..629176) [2781 bp, 926 aa] {ON} similar to
           Ashbya gossypii ADL213W
          Length = 926

 Score =  855 bits (2210), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 421/888 (47%), Positives = 561/888 (63%), Gaps = 18/888 (2%)

Query: 59  MAYYEKAVQEIVKGDSYSCLICTVELDYTCKLYACEKCYRVYDYECIREWAEKSTSKRTD 118
           + YYEKA+++I  G  Y CLICTVE+D TC++YAC  CYRVYDYECI EWA+KS+ +  D
Sbjct: 28  LPYYEKAIKDIQNGYLYQCLICTVEIDSTCRMYACSNCYRVYDYECIMEWAKKSSKRSAD 87

Query: 119 KLWACPNCFYTKKAIPKKNRPTCWCGEQVNPEPNPLNPNSCGQTCNAKICSHGCSQICHL 178
             W CPNC+++   +  K R TCWCG+Q+NPE N   PNSCGQTC A IC HGC+  CHL
Sbjct: 88  STWKCPNCYHSYNKVLPKKRSTCWCGKQINPEKNATYPNSCGQTCGASICKHGCASTCHL 147

Query: 179 GPHQECTRMMSIKCSCGKVTKDIVCFQRRLYSKGFNCETVCDKLLPCGIHKCNRKCHTGL 238
           GPH +C   + +KC CGK+T+ I C+Q +      +C+  C   LPCG+H C + CH+G 
Sbjct: 148 GPHPKCMVPVGLKCKCGKITEQISCYQTKAVKPKLSCKLPCGLPLPCGVHTCQKICHSGP 207

Query: 239 CGSCPETIISKNTNMKIRCYCGQTSKDKIKCKDVRFPANAAYSKDDKGQRWIGVFMCDKI 298
           CG C  T++S     K +CYCG    D I CKDV   A    S+  K ++WIGVF C  I
Sbjct: 208 CGRC-NTVMSG----KFKCYCGSNHLDSIICKDV---AVTKMSRSGKHKKWIGVFSCKNI 259

Query: 299 RKVPYECGEHSFYEKCKAPPSISGRLICEFSPKKLKTCPCGKNELTDLSKPRSKCTDAIP 358
           R+V Y C EHSF E CK  PS   R+ C +SP   KTC CG   L D+ + R KCTD IP
Sbjct: 260 REVRYRCKEHSFNESCKPSPSPDARIQCPYSPNICKTCCCGNTTLIDMQQKREKCTDPIP 319

Query: 359 TCGQVCGKMLKCGKHKCPFACHLGDCMDPCTQIEKVRCACEQKQFTIPCGFNDHARCNLK 418
           TC Q CGK L CGKH CP  CH G CMDPC QIE+ +C+C+++ F  PC F+    CN+K
Sbjct: 320 TCDQRCGKPLSCGKHTCPMTCHPGKCMDPCLQIEERKCSCQERTFLTPCQFDGKPSCNIK 379

Query: 419 CESLMSCRRHRCTERCCAGRPLAERRRKTMKINVRDLADESTIEPIHICLKDCNLTLSCG 478
           CE+LMSCRRHRC +RCC+G+PLA  R  T+   + D  DES IE  HIC K+CN  LSCG
Sbjct: 380 CENLMSCRRHRCIKRCCSGKPLALARSSTITPWL-DKNDESLIEAEHICFKNCNRKLSCG 438

Query: 479 IHKCNRKCHAGKCPPCLESDSNDLVCPCGKTIVEAPVRCGTKLPNCPYPCIRVVRGETDC 538
           +H C  KCH GKCPPCLESDSNDLVCPCGK+++ APVRCGT  PNC YPCI  +RG   C
Sbjct: 439 LHHCTNKCHPGKCPPCLESDSNDLVCPCGKSVILAPVRCGTVRPNCNYPCINTLRGSMPC 498

Query: 539 GHSPMPHECHPPDIPCPDCTATVFKPCKCGKEQRVRTVCFMKDVSCGKVCGERLQTCYHK 598
           GH    H+CHP    CP CTA V+KPCKCGK    RT+CF  D+SCG+ C  +L  C+H 
Sbjct: 499 GHRAPFHKCHPSTEDCPPCTAFVYKPCKCGKLTAARTICFQNDISCGRKCAAKLTNCHHL 558

Query: 599 CQKKCHEPGACQTVCKQTCNMPRLYCNHRCPKPCHKFEECPDIPCTALVKITCPCGRIEK 658
           CQK+CH PG C   C + C + R  C H C   CH  E CPD+PC   V ++C CGR   
Sbjct: 559 CQKQCHPPGECPNTCTEVCGLKRSACEHLCTANCHGDEICPDVPCLEEVVVSCGCGRRSL 618

Query: 659 EVTCGVYSKNKEAQDSTRIVCDEECAVLQRHMQLKEAFGIVDKPQNTHNEEMARLEQVIS 718
           +V CG Y   + A  +  ++CD++CA +Q+H  L +      +   + N+       VI+
Sbjct: 619 KVPCGAYKDKESATATQSLLCDDDCAKVQKHQMLLQTL----RSSESTNKAEHGSSSVIN 674

Query: 719 TASTFADLDLPFTEPVITTYIRHENWCTDIENTLNKLIDDNNRTSLHFKPMRPPQRYFIR 778
             +++ DL LP++E ++  + +   WC +I+++L +L++D +R SLHFKPM+ PQR F+ 
Sbjct: 675 KPTSYEDLGLPYSEQMMCVFSKQATWCKNIQDSLIRLLEDKSRKSLHFKPMKAPQRQFVH 734

Query: 779 ELAKAYNLYSESQDPEPNRSVFVKKNLDGSSTKPILSISEAAPLYQSYKKLEKEKKQANF 838
           EL+KA+ LYSESQD EP RSVFVK  +  +S  P + +SEA  LYQ  K  +KE++    
Sbjct: 735 ELSKAFGLYSESQDREPKRSVFVK--ILKTSKIPAIGLSEALLLYQRMKTFQKERRDLEL 792

Query: 839 ESMTTTRLINFTPEMSPELESA-ARFNGFLVTNVGEFTSTDDLQNLFAPYLKSTLVVEPQ 897
           +  TT  LI+   +   + ++  A  N  L+T V    + ++++  F   LK TL+ +PQ
Sbjct: 793 QHNTTKILISIPIDDGSDSKTLEASCNAILITGVPRTVTVENIKACFDECLKQTLLKDPQ 852

Query: 898 FQILPERKQAVIYPNKYKEISINVERDMETLVQHFDFLIKESLLAGGV 945
           F+++     A IYP+ + EIS NVE D++ LV +F  + +   +   V
Sbjct: 853 FRLI--NSNAYIYPSNFLEISANVETDIQRLVPYFSHVCERKQIGYNV 898

>Kwal_0.327 s0 complement(154643..157702) [3060 bp, 1019 aa] {ON}
            YCR011C (ADP1) - Active transport ATPase [contig 86] FULL
          Length = 1019

 Score = 34.3 bits (77), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 26/85 (30%), Positives = 43/85 (50%), Gaps = 7/85 (8%)

Query: 872  GEFTSTDDLQNLFAPYLKSTLVVEPQFQ--ILPERKQAVIYPNKYKEISINVERDMETLV 929
            G F +T D+ N+   YLK+  +    ++  I+ E K  V+   KY    +N+E    T++
Sbjct: 923  GLFINTKDISNVAFKYLKNLSIFYYAYESLIINEVKSLVLKERKY---GLNIEVPGATIL 979

Query: 930  QHFDFLIKESLLAGGVELCNIENVL 954
              F F+++  LL   V+L    NVL
Sbjct: 980  STFGFIVQNFLL--DVKLLVAFNVL 1002

>TPHA0C01000 Chr3 (214320..229025) [14706 bp, 4901 aa] {ON} Anc_8.295
            YLR106C
          Length = 4901

 Score = 33.5 bits (75), Expect = 3.5,   Method: Composition-based stats.
 Identities = 19/63 (30%), Positives = 31/63 (49%), Gaps = 9/63 (14%)

Query: 706  HNEEMARLEQVISTASTFADLDLPFTEPVITTYIRHENWC---------TDIENTLNKLI 756
            +N E   L++ + T +T     L F E V+   +R+ +W          TD+   LN+L+
Sbjct: 1114 NNHEHTDLQEYLGTYTTDDSGKLSFKEGVLVEALRNGHWIVLDELNLAPTDVLEALNRLL 1173

Query: 757  DDN 759
            DDN
Sbjct: 1174 DDN 1176

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.322    0.136    0.449 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 103,456,884
Number of extensions: 4543716
Number of successful extensions: 11684
Number of sequences better than 10.0: 65
Number of HSP's gapped: 10914
Number of HSP's successfully gapped: 73
Length of query: 956
Length of database: 53,481,399
Length adjustment: 119
Effective length of query: 837
Effective length of database: 39,836,145
Effective search space: 33342853365
Effective search space used: 33342853365
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 71 (32.0 bits)