Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
CAGL0M06897g2.289ON24824812191e-171
KNAG0H019802.289ON2492487571e-101
Smik_14.3072.289ON2462437434e-99
YNL024C2.289ON2462497373e-98
NDAI0G006802.289ON2552567331e-97
NCAS0G03850singletonON2512507243e-96
NCAS0G037702.289ON2512507243e-96
Skud_14.3052.289ON2492437243e-96
SAKL0E07612g2.289ON2522547235e-96
Suva_14.3232.289ON2532437089e-94
KAFR0H032902.289ON2452517043e-93
KLTH0G10428g2.289ON2512436662e-87
Kwal_27.115132.289ON2512436472e-84
Ecym_33282.289ON2542516472e-84
ADL212W2.289ON2512426411e-83
KLLA0E08295g2.289ON2662425891e-75
KNAG0C018001.325ON42166850.025
SAKL0D06798g1.325ON42181810.089
TPHA0L003404.352ON341120780.18
ZYRO0D14542g6.79ON26388730.62
ZYRO0G20548g1.325ON39766721.0
CAGL0C01331g2.259ON37473721.1
Suva_2.617.374ON46754692.2
KAFR0C042501.325ON391141692.4
Suva_4.5321.325ON41666692.8
YBR271W (EFM2)1.325ON41966683.2
Skud_2.4031.325ON41766683.5
Suva_12.2204.352ON337216674.3
Smik_12.3626.79ON284123657.7
KNAG0B067204.352ON283107649.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0M06897g
         (248 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0M06897g Chr13 complement(702211..702957) [747 bp, 248 aa] {...   474   e-171
KNAG0H01980 Chr8 complement(348806..349555) [750 bp, 249 aa] {ON...   296   e-101
Smik_14.307 Chr14 complement(549501..550241) [741 bp, 246 aa] {O...   290   4e-99
YNL024C Chr14 complement(587107..587847) [741 bp, 246 aa] {ON} P...   288   3e-98
NDAI0G00680 Chr7 (150212..150979) [768 bp, 255 aa] {ON} Anc_2.28...   286   1e-97
NCAS0G03850 Chr7 (713255..714010) [756 bp, 251 aa] {ON}               283   3e-96
NCAS0G03770 Chr7 complement(694471..695226) [756 bp, 251 aa] {ON...   283   3e-96
Skud_14.305 Chr14 complement(557846..558595) [750 bp, 249 aa] {O...   283   3e-96
SAKL0E07612g Chr5 complement(614835..615593) [759 bp, 252 aa] {O...   283   5e-96
Suva_14.323 Chr14 complement(569944..570705) [762 bp, 253 aa] {O...   277   9e-94
KAFR0H03290 Chr8 complement(626525..627262) [738 bp, 245 aa] {ON...   275   3e-93
KLTH0G10428g Chr7 (883191..883946) [756 bp, 251 aa] {ON} similar...   261   2e-87
Kwal_27.11513 s27 complement(832028..832783) [756 bp, 251 aa] {O...   253   2e-84
Ecym_3328 Chr3 (629428..630192) [765 bp, 254 aa] {ON} similar to...   253   2e-84
ADL212W Chr4 (332487..333242) [756 bp, 251 aa] {ON} Syntenic hom...   251   1e-83
KLLA0E08295g Chr5 complement(746166..746966) [801 bp, 266 aa] {O...   231   1e-75
KNAG0C01800 Chr3 (352309..353574) [1266 bp, 421 aa] {ON} Anc_1.3...    37   0.025
SAKL0D06798g Chr4 complement(564525..565790) [1266 bp, 421 aa] {...    36   0.089
TPHA0L00340 Chr12 (45910..46935) [1026 bp, 341 aa] {ON} Anc_4.35...    35   0.18 
ZYRO0D14542g Chr4 (1231299..1232090) [792 bp, 263 aa] {ON} simil...    33   0.62 
ZYRO0G20548g Chr7 complement(1693797..1694990) [1194 bp, 397 aa]...    32   1.0  
CAGL0C01331g Chr3 (141275..142399) [1125 bp, 374 aa] {ON} simila...    32   1.1  
Suva_2.61 Chr2 (111101..112504) [1404 bp, 467 aa] {ON} YBL056W (...    31   2.2  
KAFR0C04250 Chr3 (844020..845195) [1176 bp, 391 aa] {ON} Anc_1.3...    31   2.4  
Suva_4.532 Chr4 (916493..917743) [1251 bp, 416 aa] {ON} YBR271W ...    31   2.8  
YBR271W Chr2 (744852..746111) [1260 bp, 419 aa] {ON}  EFM2S-aden...    31   3.2  
Skud_2.403 Chr2 (713779..715032) [1254 bp, 417 aa] {ON} YBR271W ...    31   3.5  
Suva_12.220 Chr12 complement(343489..344502) [1014 bp, 337 aa] {...    30   4.3  
Smik_12.362 Chr12 (645535..646389) [855 bp, 284 aa] {ON} YLR285W...    30   7.7  
KNAG0B06720 Chr2 complement(1329424..1330275) [852 bp, 283 aa] {...    29   9.8  

>CAGL0M06897g Chr13 complement(702211..702957) [747 bp, 248 aa] {ON}
           similar to uniprot|P53970 Saccharomyces cerevisiae
           YNL024c
          Length = 248

 Score =  474 bits (1219), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 233/248 (93%), Positives = 233/248 (93%)

Query: 1   MEDILGFGDLIESRPVEHMGQSDLTFNGMLVPGLKIYEDGGESGCGGKVWIAGELLCEFI 60
           MEDILGFGDLIESRPVEHMGQSDLTFNGMLVPGLKIYEDGGESGCGGKVWIAGELLCEFI
Sbjct: 1   MEDILGFGDLIESRPVEHMGQSDLTFNGMLVPGLKIYEDGGESGCGGKVWIAGELLCEFI 60

Query: 61  LEKSRDGELLKDWINDDSVSFGNVLEXXXXXXXXXXXXXXXTKKQSQRMVKTYITDIDQL 120
           LEKSRDGELLKDWINDDSVSFGNVLE               TKKQSQRMVKTYITDIDQL
Sbjct: 61  LEKSRDGELLKDWINDDSVSFGNVLELGSGTGLVGLCVGLVTKKQSQRMVKTYITDIDQL 120

Query: 121 VPLMEKNVELNLIDQQVFAKELLWGEALPIEFAPVKTGHATTSSLDLVLAADCVYLEKAF 180
           VPLMEKNVELNLIDQQVFAKELLWGEALPIEFAPVKTGHATTSSLDLVLAADCVYLEKAF
Sbjct: 121 VPLMEKNVELNLIDQQVFAKELLWGEALPIEFAPVKTGHATTSSLDLVLAADCVYLEKAF 180

Query: 181 PLLEKTLLDLTECDNPPVILMAYRKRRKADKHFFQKIRKNFNVIVINDFKNYDQYLKQRT 240
           PLLEKTLLDLTECDNPPVILMAYRKRRKADKHFFQKIRKNFNVIVINDFKNYDQYLKQRT
Sbjct: 181 PLLEKTLLDLTECDNPPVILMAYRKRRKADKHFFQKIRKNFNVIVINDFKNYDQYLKQRT 240

Query: 241 HLFQLVRK 248
           HLFQLVRK
Sbjct: 241 HLFQLVRK 248

>KNAG0H01980 Chr8 complement(348806..349555) [750 bp, 249 aa] {ON}
           Anc_2.289 YNL024C
          Length = 249

 Score =  296 bits (757), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 143/248 (57%), Positives = 178/248 (71%), Gaps = 1/248 (0%)

Query: 1   MEDILG-FGDLIESRPVEHMGQSDLTFNGMLVPGLKIYEDGGESGCGGKVWIAGELLCEF 59
           M +I G FGDL+ +RP+EH G  D++F G L P L+I+EDGGESGCGGKVW+AGELLC++
Sbjct: 1   MNEIFGSFGDLVVARPIEHCGSHDMSFGGRLNPALQIHEDGGESGCGGKVWVAGELLCDY 60

Query: 60  ILEKSRDGELLKDWINDDSVSFGNVLEXXXXXXXXXXXXXXXTKKQSQRMVKTYITDIDQ 119
           I+EKS + +LL +W       F N++E                K+   + +K  ITDIDQ
Sbjct: 61  IVEKSDEDDLLANWDTSKVQKFRNIIELGSGTGLVGLCVALLEKQFFHKGIKVTITDIDQ 120

Query: 120 LVPLMEKNVELNLIDQQVFAKELLWGEALPIEFAPVKTGHATTSSLDLVLAADCVYLEKA 179
           LVPLM+KN+ELN ++ ++ A+EL WGE L   FAP   G +  +S+DL+LAADCVYLEKA
Sbjct: 121 LVPLMQKNIELNCVNTEMIAEELWWGEPLSGAFAPHSEGLSKVTSVDLILAADCVYLEKA 180

Query: 180 FPLLEKTLLDLTECDNPPVILMAYRKRRKADKHFFQKIRKNFNVIVINDFKNYDQYLKQR 239
           FPLLEKTLLDLT C  PPVILMAYRKRR ADK FF+KI K+F V  I DF  YDQYLKQR
Sbjct: 181 FPLLEKTLLDLTNCSKPPVILMAYRKRRNADKRFFRKIGKHFTVREITDFSTYDQYLKQR 240

Query: 240 THLFQLVR 247
           THLF+L+R
Sbjct: 241 THLFELIR 248

>Smik_14.307 Chr14 complement(549501..550241) [741 bp, 246 aa] {ON}
           YNL024C (REAL)
          Length = 246

 Score =  290 bits (743), Expect = 4e-99,   Method: Compositional matrix adjust.
 Identities = 146/243 (60%), Positives = 180/243 (74%), Gaps = 3/243 (1%)

Query: 6   GFGDLIESRPVEHMGQSDLTFNGMLVPGLKIYEDGGESGCGGKVWIAGELLCEFILEKSR 65
           GFGDL+  RP EH+GQ+DL+F+G L+P LKI EDGGESGCGGKVWIAGELLCE+ILEKS 
Sbjct: 7   GFGDLVVPRPKEHLGQTDLSFSGKLLPALKICEDGGESGCGGKVWIAGELLCEYILEKSV 66

Query: 66  DGELLKDWINDDSVSFGNVLEXXXXXXXXXXXXXXXTKKQSQRMVKTYITDIDQLVPLME 125
           D  L K    D    F  VLE                K       K Y+TDID+LVPL++
Sbjct: 67  DHLLSK--TVDGKKRFKKVLELGSGTGLVGLCVGLLEKNVYHDGTKVYVTDIDKLVPLLK 124

Query: 126 KNVELNLIDQQVFAKELLWGEALPIEFAPVKTGHATTSSLDLVLAADCVYLEKAFPLLEK 185
           +N+EL+ +  +V A+EL WGE L  +F+P + G   T+++DLVLAADCVYLEKAFPLLEK
Sbjct: 125 RNIELDKVQYEVLARELCWGEPLSADFSP-QEGDLQTNNVDLVLAADCVYLEKAFPLLEK 183

Query: 186 TLLDLTECDNPPVILMAYRKRRKADKHFFQKIRKNFNVIVINDFKNYDQYLKQRTHLFQL 245
           TLLDLT+C +PPVILMAY+KRRKADKHFF KI++NF+V+ I++F  +D YLKQRTHLFQL
Sbjct: 184 TLLDLTDCVSPPVILMAYKKRRKADKHFFNKIKRNFDVLEISNFSKFDYYLKQRTHLFQL 243

Query: 246 VRK 248
           +RK
Sbjct: 244 IRK 246

>YNL024C Chr14 complement(587107..587847) [741 bp, 246 aa] {ON}
           Putative methyltransferase; has seven beta-strand
           methyltransferase motif; green fluorescent protein
           (GFP)-fusion protein localizes to the cytoplasm; despite
           similarity to methyltransferases, null mutant does not
           display alterations in lysine methylation pattern
          Length = 246

 Score =  288 bits (737), Expect = 3e-98,   Method: Compositional matrix adjust.
 Identities = 146/249 (58%), Positives = 181/249 (72%), Gaps = 4/249 (1%)

Query: 1   MEDILG-FGDLIESRPVEHMGQSDLTFNGMLVPGLKIYEDGGESGCGGKVWIAGELLCEF 59
           ME I G FGDL+  RP EH+GQ+DL+F G L+P LKI EDGGESGCGGKVWIAGELLCE+
Sbjct: 1   MESIFGGFGDLVVPRPKEHLGQTDLSFGGKLLPALKICEDGGESGCGGKVWIAGELLCEY 60

Query: 60  ILEKSRDGELLKDWINDDSVSFGNVLEXXXXXXXXXXXXXXXTKKQSQRMVKTYITDIDQ 119
           ILEKS D  LL   +N  +  F  VLE                K       K Y+TDID+
Sbjct: 61  ILEKSVD-HLLSKTVNG-TKQFKKVLELGSGTGLVGLCVGLLEKNTFHDGTKVYVTDIDK 118

Query: 120 LVPLMEKNVELNLIDQQVFAKELLWGEALPIEFAPVKTGHATTSSLDLVLAADCVYLEKA 179
           L+PL+++N+EL+ +  +V A+EL WGE L  +F+P + G    +++DLVLAADCVYLE+A
Sbjct: 119 LIPLLKRNIELDEVQYEVLARELWWGEPLSADFSP-QEGAMQANNVDLVLAADCVYLEEA 177

Query: 180 FPLLEKTLLDLTECDNPPVILMAYRKRRKADKHFFQKIRKNFNVIVINDFKNYDQYLKQR 239
           FPLLEKTLLDLT C NPPVILMAY+KRRKADKHFF KI++NF+V+ I DF  ++ YLK+R
Sbjct: 178 FPLLEKTLLDLTHCINPPVILMAYKKRRKADKHFFNKIKRNFDVLEITDFSKFEHYLKER 237

Query: 240 THLFQLVRK 248
           THLFQL+RK
Sbjct: 238 THLFQLIRK 246

>NDAI0G00680 Chr7 (150212..150979) [768 bp, 255 aa] {ON} Anc_2.289
           YNL024C
          Length = 255

 Score =  286 bits (733), Expect = 1e-97,   Method: Compositional matrix adjust.
 Identities = 147/256 (57%), Positives = 181/256 (70%), Gaps = 9/256 (3%)

Query: 1   MEDILG--FGDLIESRPVEHMGQSDLTFNGMLVPGLKIYEDGGESGCGGKVWIAGELLCE 58
           M+DI G  F DL+ +RP+EH+G SDL+F G L   LKI+EDGGESGCGGKVWIAGELLCE
Sbjct: 1   MDDIFGSGFDDLVVARPLEHLGNSDLSFGGRLKNPLKIHEDGGESGCGGKVWIAGELLCE 60

Query: 59  FILEKSRDGELLKDWINDDSVSFGNVLEXXXXXXXXXXXXXXXTKKQSQRMVKTYITDID 118
           FILEKS   +LL  W ++ S  F  ++E                K    + +  YITDID
Sbjct: 61  FILEKSNSDDLLNGWASN-SKQFRKIVELGSGTGLVGLCIGLLEKNNFHKDIDAYITDID 119

Query: 119 QLVPLMEKNVELNLIDQQVFAKELLWGEALPIEFAPVKTGH------ATTSSLDLVLAAD 172
           Q+VPLM++N++LN I+ +V A+EL WGE L   FAP +              +DL+LAAD
Sbjct: 120 QIVPLMKQNIQLNGIENEVSAEELWWGEPLRKTFAPSEHSRDKEEDFREEKKVDLILAAD 179

Query: 173 CVYLEKAFPLLEKTLLDLTECDNPPVILMAYRKRRKADKHFFQKIRKNFNVIVINDFKNY 232
           CVYLEKAFPLLEKTLLDLTE + PP ILMAYRKRRKADKHFFQKI+KNF+++ I DF+ Y
Sbjct: 180 CVYLEKAFPLLEKTLLDLTEGETPPTILMAYRKRRKADKHFFQKIKKNFDIVEIKDFEKY 239

Query: 233 DQYLKQRTHLFQLVRK 248
           + YLKQRTHLFQL+R+
Sbjct: 240 EYYLKQRTHLFQLIRQ 255

>NCAS0G03850 Chr7 (713255..714010) [756 bp, 251 aa] {ON}
          Length = 251

 Score =  283 bits (724), Expect = 3e-96,   Method: Compositional matrix adjust.
 Identities = 145/250 (58%), Positives = 176/250 (70%), Gaps = 2/250 (0%)

Query: 1   MEDILG-FGDLIESRPVEHMGQSDLTFNGMLVPGLKIYEDGGESGCGGKVWIAGELLCEF 59
           M+ I G F  L+  RPVEH+G SDL+F G L   LKI+EDGGESGCGGKVWIAGELLC+F
Sbjct: 1   MDGIFGDFEGLVVPRPVEHLGNSDLSFGGKLRSPLKIHEDGGESGCGGKVWIAGELLCDF 60

Query: 60  ILEKSRDGELLKDWINDDSVSFGNVLEXXXXXXXXXXXXXXXTKKQSQRMVKTYITDIDQ 119
           ILEKS   +LL  W +D    F NVLE                K +  + +  +ITDIDQ
Sbjct: 61  ILEKSGTEDLLNKWPHDGERRFRNVLELGSGTGLVGLCVGLLEKNRFHKNIGVHITDIDQ 120

Query: 120 LVPLMEKNVELNLIDQQVFAKELLWGEALPIEFAPVKTGH-ATTSSLDLVLAADCVYLEK 178
           LVPLM++N+ELN + ++V A+ L WGE L   FAP    +   T+ +DL+LAADCVYLE 
Sbjct: 121 LVPLMQRNIELNGVSKEVVAEGLWWGEPLLESFAPSTVDNLPKTNVVDLILAADCVYLED 180

Query: 179 AFPLLEKTLLDLTECDNPPVILMAYRKRRKADKHFFQKIRKNFNVIVINDFKNYDQYLKQ 238
           AFPLLE+TLLDLTE + PPVILM+YRKRRKADKHFF KI+KNF+VI + DF  Y+ YLK 
Sbjct: 181 AFPLLERTLLDLTESETPPVILMSYRKRRKADKHFFNKIKKNFDVIEVKDFTKYEMYLKM 240

Query: 239 RTHLFQLVRK 248
           RTHLFQL R+
Sbjct: 241 RTHLFQLARR 250

>NCAS0G03770 Chr7 complement(694471..695226) [756 bp, 251 aa] {ON}
           Anc_2.289 YNL024C
          Length = 251

 Score =  283 bits (724), Expect = 3e-96,   Method: Compositional matrix adjust.
 Identities = 145/250 (58%), Positives = 176/250 (70%), Gaps = 2/250 (0%)

Query: 1   MEDILG-FGDLIESRPVEHMGQSDLTFNGMLVPGLKIYEDGGESGCGGKVWIAGELLCEF 59
           M+ I G F  L+  RPVEH+G SDL+F G L   LKI+EDGGESGCGGKVWIAGELLC+F
Sbjct: 1   MDGIFGDFEGLVVPRPVEHLGNSDLSFGGKLRSPLKIHEDGGESGCGGKVWIAGELLCDF 60

Query: 60  ILEKSRDGELLKDWINDDSVSFGNVLEXXXXXXXXXXXXXXXTKKQSQRMVKTYITDIDQ 119
           ILEKS   +LL  W +D    F NVLE                K +  + +  +ITDIDQ
Sbjct: 61  ILEKSGTEDLLNKWPHDGERRFRNVLELGSGTGLVGLCVGLLEKNRFHKNIGVHITDIDQ 120

Query: 120 LVPLMEKNVELNLIDQQVFAKELLWGEALPIEFAPVKTGH-ATTSSLDLVLAADCVYLEK 178
           LVPLM++N+ELN + ++V A+ L WGE L   FAP    +   T+ +DL+LAADCVYLE 
Sbjct: 121 LVPLMQRNIELNGVSKEVVAEGLWWGEPLLESFAPSTVDNLPKTNVVDLILAADCVYLED 180

Query: 179 AFPLLEKTLLDLTECDNPPVILMAYRKRRKADKHFFQKIRKNFNVIVINDFKNYDQYLKQ 238
           AFPLLE+TLLDLTE + PPVILM+YRKRRKADKHFF KI+KNF+VI + DF  Y+ YLK 
Sbjct: 181 AFPLLERTLLDLTESETPPVILMSYRKRRKADKHFFNKIKKNFDVIEVKDFTKYEMYLKM 240

Query: 239 RTHLFQLVRK 248
           RTHLFQL R+
Sbjct: 241 RTHLFQLARR 250

>Skud_14.305 Chr14 complement(557846..558595) [750 bp, 249 aa] {ON}
           YNL024C (REAL)
          Length = 249

 Score =  283 bits (724), Expect = 3e-96,   Method: Compositional matrix adjust.
 Identities = 143/243 (58%), Positives = 176/243 (72%), Gaps = 3/243 (1%)

Query: 6   GFGDLIESRPVEHMGQSDLTFNGMLVPGLKIYEDGGESGCGGKVWIAGELLCEFILEKSR 65
           GF DL+  R  EH+GQ+DL+F G L+P LKI EDGGESGCGGKVWIAGELLCE+ILEKS 
Sbjct: 7   GFEDLVVPRATEHLGQTDLSFGGKLLPALKICEDGGESGCGGKVWIAGELLCEYILEKSL 66

Query: 66  DGELLKDWINDDSVSFGNVLEXXXXXXXXXXXXXXXTKKQSQRMVKTYITDIDQLVPLME 125
              LL +  +     F  VLE                K       K Y+TDID+LVPL+E
Sbjct: 67  H-HLLSEATHGRR-QFKKVLELGSGTGLVGLCVGLLEKNTFHDGSKVYVTDIDKLVPLLE 124

Query: 126 KNVELNLIDQQVFAKELLWGEALPIEFAPVKTGHATTSSLDLVLAADCVYLEKAFPLLEK 185
           +N+EL+ +  +V A+EL WGE L ++F+P + G   T+++DLVLAADCVYLEKAFPLLE+
Sbjct: 125 RNIELDKVQYEVLARELWWGEPLSVDFSP-QEGDLQTNNVDLVLAADCVYLEKAFPLLER 183

Query: 186 TLLDLTECDNPPVILMAYRKRRKADKHFFQKIRKNFNVIVINDFKNYDQYLKQRTHLFQL 245
           TLLDLT C +PPVILMAY+KRRKADKHFF KI++NF+V+ I DF  +D YLKQRTHLFQL
Sbjct: 184 TLLDLTNCISPPVILMAYKKRRKADKHFFSKIKRNFDVLEITDFSKFDHYLKQRTHLFQL 243

Query: 246 VRK 248
           +RK
Sbjct: 244 IRK 246

>SAKL0E07612g Chr5 complement(614835..615593) [759 bp, 252 aa] {ON}
           similar to uniprot|P53970 Saccharomyces cerevisiae
           YNL024C Putative S-adenosylmethionine-dependent
           methyltransferase of the seven beta-strand family
          Length = 252

 Score =  283 bits (723), Expect = 5e-96,   Method: Compositional matrix adjust.
 Identities = 144/254 (56%), Positives = 178/254 (70%), Gaps = 10/254 (3%)

Query: 1   MEDILGF----GDLIESRPVEHMGQSDLTFNGMLVPGLKIYEDGGESGCGGKVWIAGELL 56
           MED+L F     DL+ SRP EH+G SDL+F G L P LKI+EDGGESGCGGKVWIAGELL
Sbjct: 1   MEDVLQFTACFNDLVPSRPTEHLGDSDLSFGGKLSPPLKIHEDGGESGCGGKVWIAGELL 60

Query: 57  CEFILEKSRDGELLKDWINDDSVS--FGNVLEXXXXXXXXXXXXXXXTKKQSQRMVKTYI 114
           CEF+LEKS    L   W +D         ++E                K+   + V  Y+
Sbjct: 61  CEFLLEKSDQQGLFSQWNSDTRFQSPIKKIVELGSGTGLVGLCLGLLNKQNKLKDVDIYV 120

Query: 115 TDIDQLVPLMEKNVELNLIDQQVFAKELLWGEALPIEFAPVKTGHATTSSLDLVLAADCV 174
           TDIDQLV LM++N++LN + + VF KEL WGE L  EFAP ++       +DL+LAADCV
Sbjct: 121 TDIDQLVTLMDRNIKLNEL-EHVFPKELWWGEPLKPEFAPTRSNQ---RQVDLILAADCV 176

Query: 175 YLEKAFPLLEKTLLDLTECDNPPVILMAYRKRRKADKHFFQKIRKNFNVIVINDFKNYDQ 234
           YLEKAFPLLE TLLDLT C +PP+ILM+Y+KRRKADKHFF++I+KNF+V+ IN+F  +D 
Sbjct: 177 YLEKAFPLLEVTLLDLTSCKDPPIILMSYKKRRKADKHFFKQIKKNFDVLEINEFTRFDH 236

Query: 235 YLKQRTHLFQLVRK 248
           YLKQ+THLFQLVRK
Sbjct: 237 YLKQKTHLFQLVRK 250

>Suva_14.323 Chr14 complement(569944..570705) [762 bp, 253 aa] {ON}
           YNL024C (REAL)
          Length = 253

 Score =  277 bits (708), Expect = 9e-94,   Method: Compositional matrix adjust.
 Identities = 144/243 (59%), Positives = 176/243 (72%), Gaps = 3/243 (1%)

Query: 6   GFGDLIESRPVEHMGQSDLTFNGMLVPGLKIYEDGGESGCGGKVWIAGELLCEFILEKSR 65
           GF DL+  R  EH GQ+DL+F G L+P LKI EDGGESGCGGKVWIAGELLCE+ILEKS 
Sbjct: 7   GFEDLVVPRLKEHFGQTDLSFGGKLLPALKICEDGGESGCGGKVWIAGELLCEYILEKSD 66

Query: 66  DGELLKDWINDDSVSFGNVLEXXXXXXXXXXXXXXXTKKQSQRMVKTYITDIDQLVPLME 125
           D  LL + +++    F  VLE                K +     K Y+TDID+LVPLME
Sbjct: 67  D-HLLSETVHEKR-PFMKVLELGSGTGLVGLCVGLLEKNKFHDNTKVYVTDIDRLVPLME 124

Query: 126 KNVELNLIDQQVFAKELLWGEALPIEFAPVKTGHATTSSLDLVLAADCVYLEKAFPLLEK 185
           +N+EL+ +  +V A+EL WGE L  +F+P + G    +++DLVLAADCVYLEKAFPLLEK
Sbjct: 125 RNIELDKVQYEVLARELWWGEPLSGDFSP-QEGDLQVNNVDLVLAADCVYLEKAFPLLEK 183

Query: 186 TLLDLTECDNPPVILMAYRKRRKADKHFFQKIRKNFNVIVINDFKNYDQYLKQRTHLFQL 245
           TLLDLT C +PPVILMAY+KRRKADK FF KI++NF+V+ I DF  +D YLKQ+THLFQL
Sbjct: 184 TLLDLTNCISPPVILMAYKKRRKADKQFFNKIKRNFDVLEIKDFIKFDYYLKQKTHLFQL 243

Query: 246 VRK 248
           VRK
Sbjct: 244 VRK 246

>KAFR0H03290 Chr8 complement(626525..627262) [738 bp, 245 aa] {ON}
           Anc_2.289 YNL024C
          Length = 245

 Score =  275 bits (704), Expect = 3e-93,   Method: Compositional matrix adjust.
 Identities = 139/251 (55%), Positives = 176/251 (70%), Gaps = 9/251 (3%)

Query: 1   MEDILG-FGDLIESRPVEHMGQSDLTFNGMLVPGLKIYEDGGESGCGGKVWIAGELLCEF 59
           M ++ G +  LI++RP+EH+G +DL+F+G L P +KIYEDGG SGCGGKVWIAGELLCE+
Sbjct: 1   MNEVFGEYVGLIDTRPIEHLGSADLSFDGQLSPAMKIYEDGGASGCGGKVWIAGELLCEY 60

Query: 60  ILEKSRDGELLKDWINDDSVSFGNVLEXXXXXXXXXXXXXXXTKKQSQRMVKTYITDIDQ 119
           ++EKS    LL D       S  N+LE                K++  + +K  ITDI  
Sbjct: 61  LIEKSDSENLLCDG------SIKNILELGSGTGLVGICVGLMEKQRFHKDIKVSITDIGG 114

Query: 120 LVPLMEKNVELNLIDQQVFAKELLWGEALPIEF--APVKTGHATTSSLDLVLAADCVYLE 177
           LVPLME+N+ LN I     AKEL+WG+ LP E+    V       S++DLV+AADCVY E
Sbjct: 115 LVPLMERNILLNKIADATVAKELMWGQQLPSEYMTTSVDGNCDNVSNVDLVVAADCVYAE 174

Query: 178 KAFPLLEKTLLDLTECDNPPVILMAYRKRRKADKHFFQKIRKNFNVIVINDFKNYDQYLK 237
           KAFPLLEK LLDLT CDNPP+ILMAYRKRRKADK FF +IRKNF+VI I+DF ++++Y+K
Sbjct: 175 KAFPLLEKILLDLTNCDNPPIILMAYRKRRKADKRFFVRIRKNFDVIEIDDFSSHEKYMK 234

Query: 238 QRTHLFQLVRK 248
           QRTHLF+L RK
Sbjct: 235 QRTHLFELKRK 245

>KLTH0G10428g Chr7 (883191..883946) [756 bp, 251 aa] {ON} similar to
           uniprot|P53970 Saccharomyces cerevisiae YNL024C Putative
           S-adenosylmethionine-dependent methyltransferase of the
           seven beta-strand family
          Length = 251

 Score =  261 bits (666), Expect = 2e-87,   Method: Compositional matrix adjust.
 Identities = 137/243 (56%), Positives = 163/243 (67%), Gaps = 7/243 (2%)

Query: 7   FGDLIESRPVEHMGQSDLTFNGMLVPGLKIYEDGGESGCGGKVWIAGELLCEFILEKSRD 66
           F DL+ SRP+EH G SDLTF G + P LKI+EDGGESGCGGK+WIAGELLCE++LE S D
Sbjct: 11  FTDLVPSRPLEHFGDSDLTFGGRIFPALKIHEDGGESGCGGKLWIAGELLCEYLLENSDD 70

Query: 67  GELLKDWIN--DDSVSFGNVLEXXXXXXXXXXXXXXXTKKQSQRMVKTYITDIDQLVPLM 124
             +L   +N       F N+LE                +       K +ITDIDQLV LM
Sbjct: 71  NGILSKQMNLLGRDKPFVNILELGSGTGLVGLCAGSLARANGGN-AKVHITDIDQLVRLM 129

Query: 125 EKNVELNLIDQQVFAKELLWGEALPIEFAPVKTGHATTSSLDLVLAADCVYLEKAFPLLE 184
           E NVELN +   V A++L WGE L  EF P     A ++  DLVLAADCVYLE AFPLLE
Sbjct: 130 EGNVELNGLASVVSAEKLWWGEPLKYEFGP----DAISNKTDLVLAADCVYLETAFPLLE 185

Query: 185 KTLLDLTECDNPPVILMAYRKRRKADKHFFQKIRKNFNVIVINDFKNYDQYLKQRTHLFQ 244
           KTLLDLT+ + PPV+LM+YRKRRKAD+ FF+ IRKNF V+ I  F   D +LKQRTHLFQ
Sbjct: 186 KTLLDLTKGETPPVVLMSYRKRRKADRIFFKAIRKNFKVVPITSFDRCDDFLKQRTHLFQ 245

Query: 245 LVR 247
           L+R
Sbjct: 246 LIR 248

>Kwal_27.11513 s27 complement(832028..832783) [756 bp, 251 aa] {ON}
           YNL024C - Hypothetical ORF [contig 27] FULL
          Length = 251

 Score =  253 bits (647), Expect = 2e-84,   Method: Compositional matrix adjust.
 Identities = 135/243 (55%), Positives = 164/243 (67%), Gaps = 7/243 (2%)

Query: 7   FGDLIESRPVEHMGQSDLTFNGMLVPGLKIYEDGGESGCGGKVWIAGELLCEFILEKS-R 65
           F DL+ SRPVEH+G SDL+F G + P LKI+EDGGE+GCGGK+W+AGELLC+++LE S  
Sbjct: 11  FIDLVPSRPVEHLGDSDLSFGGQVEPALKIHEDGGENGCGGKLWVAGELLCDYLLENSDA 70

Query: 66  DGELLKDWIN-DDSVSFGNVLEXXXXXXXXXXXXXXXTKKQSQRMVKTYITDIDQLVPLM 124
            G L K  +  D    F N+LE                +    R  K YITDID+LV LM
Sbjct: 71  KGILSKRMVEMDVKAPFLNILELGSGTGLVGLCAGSVAQLHGDR-TKVYITDIDRLVGLM 129

Query: 125 EKNVELNLIDQQVFAKELLWGEALPIEFAPVKTGHATTSSLDLVLAADCVYLEKAFPLLE 184
           E NV LN + + V  + L WGE L  +F P     A    +DLVLAADCVYLE AFPLLE
Sbjct: 130 ETNVNLNHLAETVSVEILSWGEPLKEKFGP----DAKADKVDLVLAADCVYLETAFPLLE 185

Query: 185 KTLLDLTECDNPPVILMAYRKRRKADKHFFQKIRKNFNVIVINDFKNYDQYLKQRTHLFQ 244
           KTLLDLTE D PP +LM+YRKRRKADK+FF+ IRKNF ++ I +F  YD YLK++THLFQ
Sbjct: 186 KTLLDLTEGDTPPAVLMSYRKRRKADKNFFRLIRKNFKIVPITNFIRYDYYLKKQTHLFQ 245

Query: 245 LVR 247
           LVR
Sbjct: 246 LVR 248

>Ecym_3328 Chr3 (629428..630192) [765 bp, 254 aa] {ON} similar to
           Ashbya gossypii ADL212W
          Length = 254

 Score =  253 bits (647), Expect = 2e-84,   Method: Compositional matrix adjust.
 Identities = 132/251 (52%), Positives = 167/251 (66%), Gaps = 10/251 (3%)

Query: 1   MEDILG--FGDLIESRPVEHMGQSDLTFNGMLVPGLKIYEDGGESGCGGKVWIAGELLCE 58
           M D+    F +L+ + P+EH+G SDL+F G L P LKIYEDGGESGCGGKVWIAGELLC+
Sbjct: 1   MTDVFASVFEELVPTPPIEHLGASDLSFQGRLDPPLKIYEDGGESGCGGKVWIAGELLCD 60

Query: 59  FILEKSRDGELLKDWINDDSVSFGNVLEXXXXXXXXXXXXXXXTKKQSQRMVKTYITDID 118
           F+LEKS+DG+LL  ++ +    F  VLE                       +  YITDID
Sbjct: 61  FLLEKSKDGQLLSKFVKNGK-QFNKVLELGSGTGLVGLCIGMHNIMHEVNDMDVYITDID 119

Query: 119 QLVPLMEKNVELNLIDQQVFAKELLWGEALPIEFAPVKTGHATTSSLDLVLAADCVYLEK 178
            L PLM +NV +N ++ +V  +EL WG+ LP EF          S +DL+LAADCVYLEK
Sbjct: 120 TLCPLMARNVRMNNLEGRVHPRELFWGDELPAEF------RNKDSPVDLILAADCVYLEK 173

Query: 179 AFPLLEKTLLDLTECDN-PPVILMAYRKRRKADKHFFQKIRKNFNVIVINDFKNYDQYLK 237
           AFPLLE  LL+LT      PV+LM+YRKRRKADK FF KI+K+F +  + DFK YD+Y+K
Sbjct: 174 AFPLLEMKLLELTANQEVQPVVLMSYRKRRKADKKFFLKIKKHFVITELTDFKRYDEYIK 233

Query: 238 QRTHLFQLVRK 248
           QRTH+FQLVR+
Sbjct: 234 QRTHIFQLVRR 244

>ADL212W Chr4 (332487..333242) [756 bp, 251 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YNL024C
          Length = 251

 Score =  251 bits (641), Expect = 1e-83,   Method: Compositional matrix adjust.
 Identities = 137/242 (56%), Positives = 167/242 (69%), Gaps = 9/242 (3%)

Query: 7   FGDLIESRPVEHMGQSDLTFNGMLVPGLKIYEDGGESGCGGKVWIAGELLCEFILEKSRD 66
           F DL+E RP+EH+GQSDL++ G L P LKI+EDGGESGCGGKVWIAG LLCEFILEKS+D
Sbjct: 9   FEDLVEPRPIEHLGQSDLSYQGQLDPPLKIHEDGGESGCGGKVWIAGNLLCEFILEKSKD 68

Query: 67  GELLKDWINDDSVSFGNVLEXXXXXXXXXXXXXXXTKKQSQRMVKTYITDIDQLVPLMEK 126
           G +L  +   +   F N++E                K         YITDI+ L PLM+K
Sbjct: 69  GRVLSQFPGYER-QFKNIIELGSGTGLVGLCVGLHGKYNGATDTNVYITDIEGLCPLMQK 127

Query: 127 NVELNLIDQQVFAKELLWGEALPIEFAPVKTGHATTSSLDLVLAADCVYLEKAFPLLEKT 186
           NVELN +D  V  + L WGE L  EF        T   +DLVLAADCVYLEKAFPLLEKT
Sbjct: 128 NVELNGLDGMVHPRPLFWGEPLSDEF--------TRQPIDLVLAADCVYLEKAFPLLEKT 179

Query: 187 LLDLTECDNPPVILMAYRKRRKADKHFFQKIRKNFNVIVINDFKNYDQYLKQRTHLFQLV 246
           LLDLT  ++ P++LM+Y+KRRKADK FF KI+K F++I I DFK+Y+ Y +QRT+LFQLV
Sbjct: 180 LLDLTAGESQPLVLMSYKKRRKADKKFFIKIKKEFDIIEIKDFKSYEDYRRQRTYLFQLV 239

Query: 247 RK 248
           RK
Sbjct: 240 RK 241

>KLLA0E08295g Chr5 complement(746166..746966) [801 bp, 266 aa] {ON}
           similar to uniprot|P53970 Saccharomyces cerevisiae
           YNL024C Putative S-adenosylmethionine-dependent
           methyltransferase of the seven beta-strand family
          Length = 266

 Score =  231 bits (589), Expect = 1e-75,   Method: Compositional matrix adjust.
 Identities = 131/242 (54%), Positives = 166/242 (68%), Gaps = 10/242 (4%)

Query: 7   FGDLIESRPVEHMGQSDLTFNGMLVPGLKIYEDGGESGCGGKVWIAGELLCEFILEKSRD 66
           F +L+ +RP+EH+G+ D++FNG L   L I EDGGESGCGGKVWIAGELLCE+ILEKS  
Sbjct: 34  FEELVPARPIEHLGKIDMSFNGKLPSPLIINEDGGESGCGGKVWIAGELLCEYILEKSDK 93

Query: 67  GELLKDWINDDSVSFGNVLEXXXXXXXXXXXXXXXTKKQSQRMVKTYITDIDQLVPLMEK 126
             LL     D + +  +VLE                +       + YI+DIDQL+ LME 
Sbjct: 94  EHLLSHLFPDGNCN--SVLELGSGTGLVGLCVGLMDQANEYSDREVYISDIDQLLGLMES 151

Query: 127 NVELNLIDQQVFAKELLWGEALPIEFAPVKTGHATTSSLDLVLAADCVYLEKAFPLLEKT 186
           N+++N +D +V A+ L WG  LP  F            +DLVLAADCVYLE AFPLLEKT
Sbjct: 152 NIQVNGLDDKVHAEVLWWGNPLPDVF--------VKKPVDLVLAADCVYLEAAFPLLEKT 203

Query: 187 LLDLTECDNPPVILMAYRKRRKADKHFFQKIRKNFNVIVINDFKNYDQYLKQRTHLFQLV 246
           LL+LT+ +N P+ILMAY+KRRKADKHFFQKI+KNF ++ I DF N+D+YLKQRTHLFQL+
Sbjct: 204 LLELTDGENVPIILMAYKKRRKADKHFFQKIKKNFKIVEIRDFINFDKYLKQRTHLFQLM 263

Query: 247 RK 248
           R+
Sbjct: 264 RE 265

>KNAG0C01800 Chr3 (352309..353574) [1266 bp, 421 aa] {ON} Anc_1.325
           YBR271W
          Length = 421

 Score = 37.4 bits (85), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 23/66 (34%), Positives = 36/66 (54%), Gaps = 5/66 (7%)

Query: 110 VKTYITDIDQLVPLMEKNVELNLIDQQVFAKELLWGEALPIEFAPVKTGHATTSSLDLVL 169
           ++ Y+TD+ ++V  ++KNV+LN ++  V A  L W    P  F     G     S DL+L
Sbjct: 285 LQIYLTDLPEIVDNLKKNVQLNKLEHAVVADVLDWTN--PYNFIERYNGE---QSFDLIL 339

Query: 170 AADCVY 175
            AD +Y
Sbjct: 340 VADPIY 345

>SAKL0D06798g Chr4 complement(564525..565790) [1266 bp, 421 aa] {ON}
           similar to uniprot|P38347 YBR271W Saccharomyces
           cerevisiae Putative S-adenosylmethionine-dependent
           methyltransferase of the seven beta-strand family
          Length = 421

 Score = 35.8 bits (81), Expect = 0.089,   Method: Compositional matrix adjust.
 Identities = 26/81 (32%), Positives = 42/81 (51%), Gaps = 11/81 (13%)

Query: 113 YITDIDQLVPLMEKNVELNLIDQQ----VFAKELLWGEALPIEFAPVKTGHATTSSLDLV 168
           Y+TD+ ++VP ++KNVE+N ++ Q    V A  L W    P+ F    T        D++
Sbjct: 282 YLTDLPEIVPNLQKNVEINNLNSQSGLAVCADVLDWTN--PVSF----TEKYGDDKFDVI 335

Query: 169 LAADCVYLEKAFPLLEKTLLD 189
           L AD +Y     P+   T++D
Sbjct: 336 LIADPIY-SPQHPVWVVTMID 355

>TPHA0L00340 Chr12 (45910..46935) [1026 bp, 341 aa] {ON} Anc_4.352
           YJR129C
          Length = 341

 Score = 34.7 bits (78), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 35/120 (29%), Positives = 52/120 (43%), Gaps = 18/120 (15%)

Query: 103 KKQSQRMVKTYITDIDQ--LVPLMEKNVELNLIDQQ--VFAKELLWGEALPIEFAPVKTG 158
           KK   ++   YITD D   L   + +NV LN ID    V  ++L W E    +  P    
Sbjct: 186 KKYKDQITTLYITDGDSQLLEGQLSRNVMLNGIDSSDSVKLQKLRWNE----DHIP---- 237

Query: 159 HATTSSLDLVLAADCVYLEKAFPLLEKTLLDLTECDN--PPVILMAYRKRRKADKHFFQK 216
                +LDL++AAD  Y     P L   +LD  +  N    V  +A  +R +     F++
Sbjct: 238 ----DNLDLIVAADVTYDSSVIPSLCHCILDCFKSSNKCSTVCYLAATRRNQETIAVFEQ 293

>ZYRO0D14542g Chr4 (1231299..1232090) [792 bp, 263 aa] {ON} similar
           to uniprot|Q05874 Saccharomyces cerevisiae YLR285W NNT1
           Putative nicotinamide N-methyltransferase has a role in
           rDNA silencing and in lifespan determination
          Length = 263

 Score = 32.7 bits (73), Expect = 0.62,   Method: Compositional matrix adjust.
 Identities = 21/88 (23%), Positives = 42/88 (47%), Gaps = 7/88 (7%)

Query: 134 DQQVFAKELLWGEALPIEFAPVKTGHATTSSLDLVLAADCVYLEKAFPLLEKTLLDLTEC 193
           D++V  +  +WG     E+ P+ + H   S  DL++ +DCV+       L + + DL   
Sbjct: 141 DRKVVVEGYIWGN----EYEPILS-HTGGSKFDLIILSDCVFNHTEHRKLLRCIKDLLAN 195

Query: 194 DNPPVILMAYRKRR--KADKHFFQKIRK 219
           D   +++ +  + R    D  FF+  ++
Sbjct: 196 DGKALVVFSPHRPRLLDVDLSFFETAKE 223

>ZYRO0G20548g Chr7 complement(1693797..1694990) [1194 bp, 397 aa]
           {ON} similar to uniprot|P38347 YBR271W Saccharomyces
           cerevisiae Putative S-adenosylmethionine-dependent
           methyltransferase of the seven beta-strand family
          Length = 397

 Score = 32.3 bits (72), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 17/66 (25%), Positives = 33/66 (50%), Gaps = 6/66 (9%)

Query: 110 VKTYITDIDQLVPLMEKNVELNLIDQQVFAKELLWGEALPIEFAPVKTGHATTSSLDLVL 169
           ++ + TD+ ++VP + KNVE+N I        L W    P +F        ++   D+++
Sbjct: 261 IEMFFTDLQEIVPNLRKNVEINGISDNSVVDTLDW--TCPEDFV----DKYSSEKFDIII 314

Query: 170 AADCVY 175
            +D +Y
Sbjct: 315 VSDPIY 320

>CAGL0C01331g Chr3 (141275..142399) [1125 bp, 374 aa] {ON} similar
           to uniprot|P40481 Saccharomyces cerevisiae YIL110w
          Length = 374

 Score = 32.3 bits (72), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 20/73 (27%), Positives = 36/73 (49%), Gaps = 11/73 (15%)

Query: 123 LMEKNVELNLIDQQVFAKELLWGEALPIEFAPVKTGHATTSSLDLVLAADCVYLEKAFPL 182
           L  + +++NLI          WG      F+ +   H T +   LV +++ +Y  +  P+
Sbjct: 253 LSARKIKINLISGS-------WGRV----FSNLVRHHVTPTRPLLVFSSETIYQPENLPV 301

Query: 183 LEKTLLDLTECDN 195
           + +TLLDL + DN
Sbjct: 302 VAETLLDLYQGDN 314

>Suva_2.61 Chr2 (111101..112504) [1404 bp, 467 aa] {ON} YBL056W
           (REAL)
          Length = 467

 Score = 31.2 bits (69), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 14/54 (25%), Positives = 31/54 (57%), Gaps = 9/54 (16%)

Query: 193 CDNPPVILMAYRKRRKADKHFFQKIR-KNFNVIVINDFKNYDQYLKQRTHLFQL 245
           CDN  + ++A  K  +++  +F++IR KN+N+        Y  ++++R ++F  
Sbjct: 283 CDNMSISIVALLKEDESETQWFERIRSKNYNI--------YTSFVQRRKNIFDF 328

>KAFR0C04250 Chr3 (844020..845195) [1176 bp, 391 aa] {ON} Anc_1.325
           YBR271W
          Length = 391

 Score = 31.2 bits (69), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 31/141 (21%), Positives = 64/141 (45%), Gaps = 11/141 (7%)

Query: 113 YITDIDQLVPLMEKNVELNLIDQQVFAKELLWGEALPIEFAPVKTGHATTSSLDLVLAAD 172
           Y+TD+ ++V  +EKN+ +N +  +V +  L W    P  F      +   +  D++L +D
Sbjct: 255 YLTDLPEIVTNLEKNISINQLANRVVSDVLDWTN--PESFV----SNYGDTRFDVLLISD 308

Query: 173 CVYLEKAFPLLEKTLLDLTECDNPPV---ILMAYRKRRKADKHFFQK--IRKNFNVIVIN 227
            +Y  K    +   + +    DN      + +  R +   ++   +K  + KNF V+   
Sbjct: 309 PIYSSKHPQWVVNMIDNFLSQDNHQARCYLQIPIRDKFANERENLKKLLVDKNFEVVKEM 368

Query: 228 DFKNYDQYLKQRTHLFQLVRK 248
             K +D + + + +  +L RK
Sbjct: 369 YSKGFDDWGEVKYYYRELKRK 389

>Suva_4.532 Chr4 (916493..917743) [1251 bp, 416 aa] {ON} YBR271W
           (REAL)
          Length = 416

 Score = 31.2 bits (69), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 22/66 (33%), Positives = 37/66 (56%), Gaps = 5/66 (7%)

Query: 110 VKTYITDIDQLVPLMEKNVELNLIDQQVFAKELLWGEALPIEFAPVKTGHATTSSLDLVL 169
           ++ Y+TD+ ++V  ++KNV LN ++  V A+ L W    P  F   + GH      D++L
Sbjct: 281 IEIYVTDLPEIVTNLKKNVLLNNLEDFVQAEVLDWTN--PQNFIN-QFGHEM--DFDIIL 335

Query: 170 AADCVY 175
            AD +Y
Sbjct: 336 VADPIY 341

>YBR271W Chr2 (744852..746111) [1260 bp, 419 aa] {ON}
           EFM2S-adenosylmethionine-dependent methyltransferase;
           methylates translation elongation factors EF2 (Eft1p and
           Eft2p) and EF3A (Yef3p); belongs to the seven
           beta-strand family; green fluorescent protein
           (GFP)-fusion protein localizes to the cytoplasm;
           predicted to be involved in ribosome biogenesis
          Length = 419

 Score = 30.8 bits (68), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 22/66 (33%), Positives = 38/66 (57%), Gaps = 5/66 (7%)

Query: 110 VKTYITDIDQLVPLMEKNVELNLIDQQVFAKELLWGEALPIEFAPVKTGHATTSSLDLVL 169
           ++ ++TD+ ++V  ++KNV LN +   V A+ L W    P +F   K GH   +  D++L
Sbjct: 284 IEIFVTDLPEIVTNLKKNVSLNNLGDFVQAEILDWTN--PHDFID-KFGHE--NEFDVIL 338

Query: 170 AADCVY 175
            AD +Y
Sbjct: 339 IADPIY 344

>Skud_2.403 Chr2 (713779..715032) [1254 bp, 417 aa] {ON} YBR271W
           (REAL)
          Length = 417

 Score = 30.8 bits (68), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 21/66 (31%), Positives = 38/66 (57%), Gaps = 5/66 (7%)

Query: 110 VKTYITDIDQLVPLMEKNVELNLIDQQVFAKELLWGEALPIEFAPVKTGHATTSSLDLVL 169
           ++ ++TD+ ++V  ++KNV LN +   V A+ L W    P +F   + GH   +  D++L
Sbjct: 282 MEIFVTDLPEIVTNLKKNVSLNNLQDFVQAEILDWTN--PQDFID-RFGHE--NEFDIIL 336

Query: 170 AADCVY 175
            AD +Y
Sbjct: 337 VADPIY 342

>Suva_12.220 Chr12 complement(343489..344502) [1014 bp, 337 aa] {ON}
           YJR129C (REAL)
          Length = 337

 Score = 30.4 bits (67), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 48/216 (22%), Positives = 86/216 (39%), Gaps = 32/216 (14%)

Query: 40  GGESGCGGKVWIAGELLCEFILEKSRDGELLKDWINDDSVSFGNVLEXXXXXXXXXXXXX 99
              S  G + W A   + +F++      E L + ++ D     NVLE             
Sbjct: 129 SAASTTGFRTWEAALYMGDFLMH-----EPLLELVHGDDKKKLNVLEIGAGTGIVSLVLL 183

Query: 100 XXTKKQSQRMVKTYITDIDQ--LVPLMEKNVELNLIDQQ----VFAKELLWG-EALPIEF 152
               K  + + K Y+TD D   +   + +N ELN   ++    +  + L WG + +P E 
Sbjct: 184 ---HKYREYVSKMYVTDGDSDLVETQLRRNFELNDAWREQSPDIRLQRLWWGSDRVPDE- 239

Query: 153 APVKTGHATTSSLDLVLAADCVYLEKAFPLLEKTLLDLTECDNPPVILMAYRKRR-KADK 211
                       ++LV+AAD  Y    FP L + L +     +  V L++   R    DK
Sbjct: 240 ------------VNLVVAADVTYDSTIFPELCQCLAECLAMSHCKVCLLSATIRSYSTDK 287

Query: 212 HFFQKIRK---NFNVIVINDFKNYDQYLKQRTHLFQ 244
            F Q+  K    ++V+   ++    +   + + LF+
Sbjct: 288 EFAQECHKVGLKYSVVTSTEYDRNSEARMEESLLFK 323

>Smik_12.362 Chr12 (645535..646389) [855 bp, 284 aa] {ON} YLR285W
           (REAL)
          Length = 284

 Score = 29.6 bits (65), Expect = 7.7,   Method: Compositional matrix adjust.
 Identities = 31/123 (25%), Positives = 55/123 (44%), Gaps = 5/123 (4%)

Query: 106 SQRMVKTYITDIDQLVPLMEKNVELNLIDQ--QVFAKELLWGEALPIEFAPVKTGHATTS 163
           +Q +V T   D D L+  +E N++ N+ ++   V  +  +WG       A ++   +   
Sbjct: 127 AQMVVSTDYPDPD-LMENIEYNIKSNVPEEFGNVSTENYIWGNDYSPLLAHIEKVKSNIG 185

Query: 164 SLDLVLAADCVYLEKAFPLLEKTLLD-LTECDNPPVILMAYR-KRRKADKHFFQKIRKNF 221
             DL++ +D V+       L +T  D L E     V+   +R K  K D  FFQ     F
Sbjct: 186 KFDLIILSDLVFNHTEHHKLLQTTKDLLAENGKALVVFSPHRPKLLKKDLEFFQLANDEF 245

Query: 222 NVI 224
           +++
Sbjct: 246 HLV 248

>KNAG0B06720 Chr2 complement(1329424..1330275) [852 bp, 283 aa] {ON}
           Anc_4.352 YJR129C
          Length = 283

 Score = 29.3 bits (64), Expect = 9.8,   Method: Compositional matrix adjust.
 Identities = 29/107 (27%), Positives = 45/107 (42%), Gaps = 19/107 (17%)

Query: 111 KTYITDIDQ--LVPLMEKNVELNLIDQQVFAKELLWGEALPIEFAPVKTGHATTSSLDLV 168
           K Y+TD D   L  +   N+ LN +++ V  + L+W            +       +D+V
Sbjct: 155 KLYVTDGDTGILSEVTTPNLSLNKVERDVQCQRLVWA-----------SEDRVPGDIDVV 203

Query: 169 LAADCVYLEKAFPLLEKTLLDLTECDNPP---VILMAYRKRRKADKH 212
           + AD  Y    FP L  T LD  EC   P     ++A  +R +   H
Sbjct: 204 VGADITYDPTVFPEL-CTCLD--ECLQQPKCQCAILACTERNRETVH 247

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.321    0.140    0.414 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 25,568,813
Number of extensions: 1042881
Number of successful extensions: 2703
Number of sequences better than 10.0: 40
Number of HSP's gapped: 2719
Number of HSP's successfully gapped: 40
Length of query: 248
Length of database: 53,481,399
Length adjustment: 107
Effective length of query: 141
Effective length of database: 41,212,137
Effective search space: 5810911317
Effective search space used: 5810911317
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 64 (29.3 bits)