Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
CAGL0M04301g8.325ON38938920750.0
Skud_12.1998.325ON42241312351e-169
Smik_12.1938.325ON42241312271e-167
YLR130C (ZRT2)8.325ON42242112091e-165
Suva_10.2238.325ON42042112001e-163
KAFR0H022508.325ON37938711741e-160
NDAI0G025708.325ON42943111711e-159
KNAG0G024608.325ON40340211591e-157
Kpol_543.648.325ON42441511591e-157
NCAS0B035808.325ON34738311501e-157
TBLA0H012708.325ON40138611461e-156
NCAS0C032508.325ON42943011391e-154
KAFR0B057308.325ON37239011271e-153
SAKL0H15510g8.325ON39939411181e-151
TPHA0A015508.325ON41141011191e-151
NDAI0J010108.325ON38438410831e-146
SAKL0H14388gna 1ON38037810821e-146
CAGL0E01353g8.325ON43341710831e-145
TPHA0D00970na 2ON38338310751e-145
KLTH0F09064gna 1ON36137910491e-141
TBLA0F02390singletonON42741510511e-141
KLLA0D16434g8.325ON41438610291e-138
KNAG0A051808.325ON39538710071e-134
Ecym_4202na 1ON3753839441e-125
Kpol_1006.10na 2ON3913959411e-125
AGL143Cna 1ON3743898951e-118
SAKL0F16346gsingletonON3793948781e-115
Suva_7.6na 3ON3723806157e-76
Smik_7.6na 3ON3723806009e-74
YGL255W (ZRT1)na 3ON3763805931e-72
ZYRO0F02200gsingletonON3813775862e-71
Skud_7.12na 3ON3723795852e-71
Kwal_14.824singletonON3743655652e-68
KLTH0C00374gsingletonON3763795618e-68
KLTH0A07722gna 4ON3923775601e-67
TDEL0D06550singletonON3813985471e-65
Kwal_23.6522na 4ON3893775392e-64
ZYRO0D17732gsingletonON3993755271e-62
Kwal_33.15638singletonON535262741.3
KLTH0G12716g8.303ON150080705.0
Kwal_33.135981.134ON141245695.6
Kpol_1008.167.519ON141845687.1
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0M04301g
         (389 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0M04301g Chr13 complement(472227..473396) [1170 bp, 389 aa] ...   803   0.0  
Skud_12.199 Chr12 complement(385437..386705) [1269 bp, 422 aa] {...   480   e-169
Smik_12.193 Chr12 complement(384118..385386) [1269 bp, 422 aa] {...   477   e-167
YLR130C Chr12 complement(402794..404062) [1269 bp, 422 aa] {ON} ...   470   e-165
Suva_10.223 Chr10 complement(411354..412616) [1263 bp, 420 aa] {...   466   e-163
KAFR0H02250 Chr8 (429002..430141) [1140 bp, 379 aa] {ON} Anc_8.3...   456   e-160
NDAI0G02570 Chr7 (588135..589424) [1290 bp, 429 aa] {ON} Anc_8.325    455   e-159
KNAG0G02460 Chr7 complement(560626..561837) [1212 bp, 403 aa] {O...   451   e-157
Kpol_543.64 s543 complement(147560..148834) [1275 bp, 424 aa] {O...   451   e-157
NCAS0B03580 Chr2 complement(635005..636048) [1044 bp, 347 aa] {O...   447   e-157
TBLA0H01270 Chr8 (286413..287618) [1206 bp, 401 aa] {ON} Anc_8.3...   446   e-156
NCAS0C03250 Chr3 (638559..639848) [1290 bp, 429 aa] {ON} Anc_8.325    443   e-154
KAFR0B05730 Chr2 complement(1182121..1183239) [1119 bp, 372 aa] ...   438   e-153
SAKL0H15510g Chr8 (1350297..1351496) [1200 bp, 399 aa] {ON} simi...   435   e-151
TPHA0A01550 Chr1 (310086..311321) [1236 bp, 411 aa] {ON} Anc_8.3...   435   e-151
NDAI0J01010 Chr10 (230625..231779) [1155 bp, 384 aa] {ON} Anc_8....   421   e-146
SAKL0H14388g Chr8 (1247106..1248248) [1143 bp, 380 aa] {ON} simi...   421   e-146
CAGL0E01353g Chr5 (127845..129146) [1302 bp, 433 aa] {ON} simila...   421   e-145
TPHA0D00970 Chr4 complement(195530..196681) [1152 bp, 383 aa] {O...   418   e-145
KLTH0F09064g Chr6 (779431..780516) [1086 bp, 361 aa] {ON} simila...   408   e-141
TBLA0F02390 Chr6 (588534..589817) [1284 bp, 427 aa] {ON}              409   e-141
KLLA0D16434g Chr4 complement(1384826..1386070) [1245 bp, 414 aa]...   400   e-138
KNAG0A05180 Chr1 (764235..765422) [1188 bp, 395 aa] {ON} Anc_8.3...   392   e-134
Ecym_4202 Chr4 (419650..420777) [1128 bp, 375 aa] {ON} similar t...   368   e-125
Kpol_1006.10 s1006 complement(43032..44207) [1176 bp, 391 aa] {O...   367   e-125
AGL143C Chr7 complement(431959..433083) [1125 bp, 374 aa] {ON} N...   349   e-118
SAKL0F16346g Chr6 complement(1331198..1332337) [1140 bp, 379 aa]...   342   e-115
Suva_7.6 Chr7 (15340..16458) [1119 bp, 372 aa] {ON} YGL255W (REAL)    241   7e-76
Smik_7.6 Chr7 (15678..16796) [1119 bp, 372 aa] {ON} YGL255W (REAL)    235   9e-74
YGL255W Chr7 (20978..22108) [1131 bp, 376 aa] {ON}  ZRT1High-aff...   233   1e-72
ZYRO0F02200g Chr6 (178997..180142) [1146 bp, 381 aa] {ON} simila...   230   2e-71
Skud_7.12 Chr7 (25081..26199) [1119 bp, 372 aa] {ON} YGL255W (REAL)   229   2e-71
Kwal_14.824 s14 complement(65415..66539) [1125 bp, 374 aa] {ON} ...   222   2e-68
KLTH0C00374g Chr3 complement(32017..33147) [1131 bp, 376 aa] {ON...   220   8e-68
KLTH0A07722g Chr1 (650427..651605) [1179 bp, 392 aa] {ON} simila...   220   1e-67
TDEL0D06550 Chr4 (1177932..1179077) [1146 bp, 381 aa] {ON}            215   1e-65
Kwal_23.6522 s23 (1624044..1625213) [1170 bp, 389 aa] {ON} YGL25...   212   2e-64
ZYRO0D17732g Chr4 complement(1471224..1472423) [1200 bp, 399 aa]...   207   1e-62
Kwal_33.15638 s33 complement(1203012..1204619) [1608 bp, 535 aa]...    33   1.3  
KLTH0G12716g Chr7 (1080818..1085320) [4503 bp, 1500 aa] {ON} hig...    32   5.0  
Kwal_33.13598 s33 (312325..316563) [4239 bp, 1412 aa] {ON} YLR31...    31   5.6  
Kpol_1008.16 s1008 (29788..34044) [4257 bp, 1418 aa] {ON} (29788...    31   7.1  

>CAGL0M04301g Chr13 complement(472227..473396) [1170 bp, 389 aa]
           {ON} similar to uniprot|Q12436 Saccharomyces cerevisiae
           YLR130c ZRT2 or uniprot|P32804 Saccharomyces cerevisiae
           YGL255w ZRT1
          Length = 389

 Score =  803 bits (2075), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 389/389 (100%), Positives = 389/389 (100%)

Query: 1   MHNELLGRSVDTCSTENDYNGEQNLRILAVFIVMISSGLGAYFPILSSQYSFIRLPNWCF 60
           MHNELLGRSVDTCSTENDYNGEQNLRILAVFIVMISSGLGAYFPILSSQYSFIRLPNWCF
Sbjct: 1   MHNELLGRSVDTCSTENDYNGEQNLRILAVFIVMISSGLGAYFPILSSQYSFIRLPNWCF 60

Query: 61  FVAKFFGSGVIIATAFIHLLQPAAEALTDDCLGGTFEDYPWAFGICLMSLFMLFLAEIVA 120
           FVAKFFGSGVIIATAFIHLLQPAAEALTDDCLGGTFEDYPWAFGICLMSLFMLFLAEIVA
Sbjct: 61  FVAKFFGSGVIIATAFIHLLQPAAEALTDDCLGGTFEDYPWAFGICLMSLFMLFLAEIVA 120

Query: 121 HHFVDKKFNHSHAETDNANALPDIILKDIQISTDDLSEGMLNCAGHQDSLQDSKKIETGV 180
           HHFVDKKFNHSHAETDNANALPDIILKDIQISTDDLSEGMLNCAGHQDSLQDSKKIETGV
Sbjct: 121 HHFVDKKFNHSHAETDNANALPDIILKDIQISTDDLSEGMLNCAGHQDSLQDSKKIETGV 180

Query: 181 STNLKRVDDSGFEGQYEYKRESTDETWIDENTLTTGNSEHKFSADYVSKVFVLCVLEFGI 240
           STNLKRVDDSGFEGQYEYKRESTDETWIDENTLTTGNSEHKFSADYVSKVFVLCVLEFGI
Sbjct: 181 STNLKRVDDSGFEGQYEYKRESTDETWIDENTLTTGNSEHKFSADYVSKVFVLCVLEFGI 240

Query: 241 IFHSVFVGLSLAVAGSEFKVLFIVITFHQMFEGLGLGTRIAETEWPPSKWYTPWIMAFAF 300
           IFHSVFVGLSLAVAGSEFKVLFIVITFHQMFEGLGLGTRIAETEWPPSKWYTPWIMAFAF
Sbjct: 241 IFHSVFVGLSLAVAGSEFKVLFIVITFHQMFEGLGLGTRIAETEWPPSKWYTPWIMAFAF 300

Query: 301 TITSPIAIAIGIGVRHSWVPGSRKALIANGVFDSISSGILIYTGLIELMAHEFIFSNQFK 360
           TITSPIAIAIGIGVRHSWVPGSRKALIANGVFDSISSGILIYTGLIELMAHEFIFSNQFK
Sbjct: 301 TITSPIAIAIGIGVRHSWVPGSRKALIANGVFDSISSGILIYTGLIELMAHEFIFSNQFK 360

Query: 361 GEHSLRNMLTAYFIMCCGAALMALLGRWA 389
           GEHSLRNMLTAYFIMCCGAALMALLGRWA
Sbjct: 361 GEHSLRNMLTAYFIMCCGAALMALLGRWA 389

>Skud_12.199 Chr12 complement(385437..386705) [1269 bp, 422 aa] {ON}
           YLR130C (REAL)
          Length = 422

 Score =  480 bits (1235), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 238/413 (57%), Positives = 290/413 (70%), Gaps = 32/413 (7%)

Query: 9   SVDTCSTENDYNGEQNLRILAVFIVMISSGLGAYFPILSSQYSFIRLPNWCFFVAKFFGS 68
           S D+C   NDYNG   LRILAVFI++ISSGLG YFPILSS+YSFIRLPNWCFF+AKFFGS
Sbjct: 10  STDSCQASNDYNGHAGLRILAVFIILISSGLGVYFPILSSRYSFIRLPNWCFFIAKFFGS 69

Query: 69  GVIIATAFIHLLQPAAEALTDDCLGGTFEDYPWAFGICLMSLFMLFLAEIVAHHFVDKKF 128
           GVI+ATAF+HLLQPAAEAL D+CLGGTF +YPWAFGICLMSLF+LF  EI+ H+FV K  
Sbjct: 70  GVIVATAFVHLLQPAAEALGDECLGGTFAEYPWAFGICLMSLFLLFFTEIITHYFVAKTL 129

Query: 129 NHSHAETDNANAL-PDIILKDIQISTDDLSEGMLNCAG----HQDSLQDSKKIETGVSTN 183
            H H + +    +  DI   +  +     +   LN       H + +  + + E  V T 
Sbjct: 130 GHDHGDNEGVGTVDADIASSESAVRNGGPNPASLNNEAVYSIHNNKIPYTTRNEEIVGTP 189

Query: 184 LKRVDDSGFEGQYEYKRESTD---------------------------ETWIDENTLTTG 216
           +K  D +     Y+ +  +T+                           E +  + +    
Sbjct: 190 VKEKDPNSNVINYDLETGNTESIANGLIPMNSHATNLTSVPGKDHYSHENYHQDASELGK 249

Query: 217 NSEHKFSADYVSKVFVLCVLEFGIIFHSVFVGLSLAVAGSEFKVLFIVITFHQMFEGLGL 276
             E +    Y++++  + +LEFGIIFHSVFVGLSL+VAG EF+ LFIV+TFHQMFEGLGL
Sbjct: 250 GIEEEDKEQYLNQMLAVFILEFGIIFHSVFVGLSLSVAGEEFETLFIVLTFHQMFEGLGL 309

Query: 277 GTRIAETEWPPSKWYTPWIMAFAFTITSPIAIAIGIGVRHSWVPGSRKALIANGVFDSIS 336
           GTR+AET WP SK YTPW+M  AFT+TSPIA+AIGIGVRHSWVPGSR+ALIANGVFDSIS
Sbjct: 310 GTRVAETNWPESKRYTPWLMGLAFTLTSPIAVAIGIGVRHSWVPGSRRALIANGVFDSIS 369

Query: 337 SGILIYTGLIELMAHEFIFSNQFKGEHSLRNMLTAYFIMCCGAALMALLGRWA 389
           SGILIYTGL+ELMAHEF++SNQFKG   L+ ML+AYFIMCCGAALMALLG+WA
Sbjct: 370 SGILIYTGLVELMAHEFLYSNQFKGPDGLKKMLSAYFIMCCGAALMALLGKWA 422

>Smik_12.193 Chr12 complement(384118..385386) [1269 bp, 422 aa] {ON}
           YLR130C (REAL)
          Length = 422

 Score =  477 bits (1227), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 238/413 (57%), Positives = 292/413 (70%), Gaps = 32/413 (7%)

Query: 9   SVDTCSTENDYNGEQNLRILAVFIVMISSGLGAYFPILSSQYSFIRLPNWCFFVAKFFGS 68
           S D+C   NDYNG   LRILAVFI++ISSGLG YFPILSS+YSFIRLPNWCFF+AKFFGS
Sbjct: 10  STDSCQASNDYNGHAGLRILAVFIILISSGLGVYFPILSSRYSFIRLPNWCFFIAKFFGS 69

Query: 69  GVIIATAFIHLLQPAAEALTDDCLGGTFEDYPWAFGICLMSLFMLFLAEIVAHHFVDKKF 128
           GVI+ATAF+HLLQPAAEAL D+CLGGTF +YPWAFGICLMSLF+LF  EI+ H++V K  
Sbjct: 70  GVIVATAFVHLLQPAAEALGDECLGGTFAEYPWAFGICLMSLFLLFFTEIITHYYVAKTL 129

Query: 129 NHSHAE-TDNANALPDIILKDIQISTDDLSEGMLNCAG----HQDSLQDSKKIETGVSTN 183
            H H +  +N +   D+   D+ +S  D      N       H +    + + E   +T 
Sbjct: 130 GHDHGDHGENTSIDVDVPSSDLAVSNIDSQPASFNNEAVYFIHNNKTPYTTRNEEIGATP 189

Query: 184 LKRVDDSGFEGQYEYKRESTD----------------------ETWIDENTLTTGNS--- 218
           +K  + S     Y+ +  +T+                      + +  EN     +    
Sbjct: 190 IKEKEPSSNITNYDLEAGNTESIANELFPMSSHATNIPSVPGKDHFSHENDHQDASQLGT 249

Query: 219 --EHKFSADYVSKVFVLCVLEFGIIFHSVFVGLSLAVAGSEFKVLFIVITFHQMFEGLGL 276
             E +    Y++++  + +LEFGIIFHSVFVGLSL+VAG EF+ LFIV+TFHQMFEGLGL
Sbjct: 250 RIEEEDKEQYLNQMLAVFILEFGIIFHSVFVGLSLSVAGEEFETLFIVLTFHQMFEGLGL 309

Query: 277 GTRIAETEWPPSKWYTPWIMAFAFTITSPIAIAIGIGVRHSWVPGSRKALIANGVFDSIS 336
           GTR+AET WP SK YTPW+M  AFT+TSPIA+A+GIGVRHSW+PGSRKALIANGVFDSIS
Sbjct: 310 GTRVAETNWPESKRYTPWLMGLAFTLTSPIAVAVGIGVRHSWIPGSRKALIANGVFDSIS 369

Query: 337 SGILIYTGLIELMAHEFIFSNQFKGEHSLRNMLTAYFIMCCGAALMALLGRWA 389
           SGILIYTGL+ELMAHEF++SNQFKG   L+ ML+AYFIMCCGAALMALLG+WA
Sbjct: 370 SGILIYTGLVELMAHEFLYSNQFKGPGGLKKMLSAYFIMCCGAALMALLGKWA 422

>YLR130C Chr12 complement(402794..404062) [1269 bp, 422 aa] {ON}
           ZRT2Low-affinity zinc transporter of the plasma
           membrane; transcription is induced under low-zinc
           conditions by the Zap1p transcription factor
          Length = 422

 Score =  470 bits (1209), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 239/421 (56%), Positives = 290/421 (68%), Gaps = 36/421 (8%)

Query: 4   ELLGR--SVDTCSTENDYNGEQNLRILAVFIVMISSGLGAYFPILSSQYSFIRLPNWCFF 61
           +L+ R  SVDTC   N YNG   LRILAVFI++ISSGLG YFPILSS+YSFIRLPNWCFF
Sbjct: 3   DLIARDDSVDTCQASNGYNGHAGLRILAVFIILISSGLGVYFPILSSRYSFIRLPNWCFF 62

Query: 62  VAKFFGSGVIIATAFIHLLQPAAEALTDDCLGGTFEDYPWAFGICLMSLFMLFLAEIVAH 121
           +AKFFGSGVI+ATAF+HLLQPAAEAL D+CLGGTF +YPWAFGICLMSLF+LF  EI+ H
Sbjct: 63  IAKFFGSGVIVATAFVHLLQPAAEALGDECLGGTFAEYPWAFGICLMSLFLLFFTEIITH 122

Query: 122 HFVDKKFNHSHAETDNANALP-DIILKDIQISTDDLSEGMLNCAG----HQDSLQDSKKI 176
           +FV K   H H +     ++  D       I   D      N       H D    + + 
Sbjct: 123 YFVAKTLGHDHGDHGEVTSIDVDAPSSGFVIRNMDSDPVSFNNEAAYSIHNDKTPYTTRN 182

Query: 177 ETGVSTNLKRVDDSGFEGQYEYKRESTDETWIDENTLTTGNS------------------ 218
           E  V+T +K  +       Y+ +   T E+  +E   T+ ++                  
Sbjct: 183 EEIVATPIKEKEPGSNVTNYDLEPGKT-ESLANELVPTSSHATNLASVPGKDHYSHENDH 241

Query: 219 ----------EHKFSADYVSKVFVLCVLEFGIIFHSVFVGLSLAVAGSEFKVLFIVITFH 268
                     E +    Y++++  + +LEFGIIFHSVFVGLSL+VAG EF+ LFIV+TFH
Sbjct: 242 QDVSQLATRIEEEDKEQYLNQILAVFILEFGIIFHSVFVGLSLSVAGEEFETLFIVLTFH 301

Query: 269 QMFEGLGLGTRIAETEWPPSKWYTPWIMAFAFTITSPIAIAIGIGVRHSWVPGSRKALIA 328
           QMFEGLGLGTR+AET WP SK Y PW+M  AFT+TSPIA+A+GIGVRHSW+PGSR+ALIA
Sbjct: 302 QMFEGLGLGTRVAETNWPESKKYMPWLMGLAFTLTSPIAVAVGIGVRHSWIPGSRRALIA 361

Query: 329 NGVFDSISSGILIYTGLIELMAHEFIFSNQFKGEHSLRNMLTAYFIMCCGAALMALLGRW 388
           NGVFDSISSGILIYTGL+ELMAHEF++SNQFKG   L+ ML+AY IMCCGAALMALLG+W
Sbjct: 362 NGVFDSISSGILIYTGLVELMAHEFLYSNQFKGPDGLKKMLSAYLIMCCGAALMALLGKW 421

Query: 389 A 389
           A
Sbjct: 422 A 422

>Suva_10.223 Chr10 complement(411354..412616) [1263 bp, 420 aa] {ON}
           YLR130C (REAL)
          Length = 420

 Score =  466 bits (1200), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 239/421 (56%), Positives = 296/421 (70%), Gaps = 50/421 (11%)

Query: 9   SVDTCSTENDYNGEQNLRILAVFIVMISSGLGAYFPILSSQYSFIRLPNWCFFVAKFFGS 68
           S D+C   NDYNG   LRILAVFI++ISSGLG YFPILSS+YSFIRLP+ CFF+AKFFGS
Sbjct: 10  STDSCQASNDYNGHSGLRILAVFIILISSGLGVYFPILSSRYSFIRLPDCCFFIAKFFGS 69

Query: 69  GVIIATAFIHLLQPAAEALTDDCLGGTFEDYPWAFGICLMSLFMLFLAEIVAHHFVDKKF 128
           GVI+ATAFIHLLQPAAEAL ++CLGGTF +YPWAFGICL+SLF+LF  EI+ H+FV K  
Sbjct: 70  GVIVATAFIHLLQPAAEALGNECLGGTFAEYPWAFGICLISLFLLFFTEIITHYFVAKTL 129

Query: 129 NHSHAETDNANALPDIILKDIQISTDDLSEGML--NCAGHQD----SLQDSK-----KIE 177
            H H +     A+      D ++ + + + G L  + A   D    S+ ++K     K E
Sbjct: 130 GHDHGDHGEVAAI------DSRVPSSEYTIGNLHSDTASFNDEAVYSIHNNKNSYTAKNE 183

Query: 178 TGVSTNLKRVDD-----------------------------SGFEGQYEYKRESTDETWI 208
             V+T++K  +                              +   G+  Y  E+  +   
Sbjct: 184 ELVATSVKEKESDMLKYDLEVGKTESIANGIVPSSSHMSNFASVPGKDHYSHENDHQ--- 240

Query: 209 DENTLTTGNSEHKFSADYVSKVFVLCVLEFGIIFHSVFVGLSLAVAGSEFKVLFIVITFH 268
           D + L T   E +    Y++++  + +LEFGIIFHSVFVGLSL+VAG EF+ LFIV+TFH
Sbjct: 241 DASQLGT-QIEEEDKEQYINQMLAVFILEFGIIFHSVFVGLSLSVAGEEFETLFIVLTFH 299

Query: 269 QMFEGLGLGTRIAETEWPPSKWYTPWIMAFAFTITSPIAIAIGIGVRHSWVPGSRKALIA 328
           QMFEGLGLGTR+AET WP SK YTPW+M  AFT+TSPIA+A+GIGVRHSW+PGSR+ALIA
Sbjct: 300 QMFEGLGLGTRVAETNWPDSKRYTPWLMGLAFTLTSPIAVAVGIGVRHSWIPGSRRALIA 359

Query: 329 NGVFDSISSGILIYTGLIELMAHEFIFSNQFKGEHSLRNMLTAYFIMCCGAALMALLGRW 388
           NG+FDSISSGILIYTGL+ELMAHEF++SNQFKG   LR ML+AYFIMCCGAALMALLG+W
Sbjct: 360 NGIFDSISSGILIYTGLVELMAHEFLYSNQFKGPDGLRKMLSAYFIMCCGAALMALLGKW 419

Query: 389 A 389
           A
Sbjct: 420 A 420

>KAFR0H02250 Chr8 (429002..430141) [1140 bp, 379 aa] {ON} Anc_8.325
           YLR130C
          Length = 379

 Score =  456 bits (1174), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 229/387 (59%), Positives = 286/387 (73%), Gaps = 12/387 (3%)

Query: 3   NELLGRSVDTCSTENDYNGEQNLRILAVFIVMISSGLGAYFPILSSQYSFIRLPNWCFFV 62
            EL+ R++DTCST NDY+G  NLRIL+VFI++IS+ +G +FPIL+S+YSFI LP WCFF+
Sbjct: 5   TELIPRAIDTCSTSNDYDGNNNLRILSVFILLISASIGVFFPILASRYSFINLPGWCFFI 64

Query: 63  AKFFGSGVIIATAFIHLLQPAAEALTDDCLGGTFEDYPWAFGICLMSLFMLFLAEIVAHH 122
           AKFFGSGVI+ATAFIHLL+PA+E L DDCLGGTF +YPWAFGICLMSLF LFL EI++H+
Sbjct: 65  AKFFGSGVIVATAFIHLLEPASEELGDDCLGGTFAEYPWAFGICLMSLFFLFLVEIISHY 124

Query: 123 FVDKKFNHSHAETDNANALPDIILKDIQISTDDLSEGMLNCAGHQDSLQDSKKIETGVST 182
           FV+K F H H   +    +  I     +   ++ S       G  +S Q S  I T    
Sbjct: 125 FVNKNFGHDHGHDETGTIVHHI--PREEDEEEEDSLDEDFKKGDIES-QTSPDIRT---H 178

Query: 183 NLKRVDDSGFEGQYEYKRESTDETWIDENTLTTGNSEHKFSADYVSKVFVLCVLEFGIIF 242
            L R+  +   G+  +  +ST +   D + L T   E +    Y++++  L +LE GIIF
Sbjct: 179 KLDRL--ASILGKDHFSHDSTHQ---DPSQLGTSTEEFQ-KEQYLNQIVALFILESGIIF 232

Query: 243 HSVFVGLSLAVAGSEFKVLFIVITFHQMFEGLGLGTRIAETEWPPSKWYTPWIMAFAFTI 302
           HS+F+GLSLAV G+EFK LFIV+TFHQMFEGLGLGTRI+E  WP SK Y PW+M  AF +
Sbjct: 233 HSIFIGLSLAVTGAEFKTLFIVLTFHQMFEGLGLGTRISEANWPQSKKYIPWLMGLAFAL 292

Query: 303 TSPIAIAIGIGVRHSWVPGSRKALIANGVFDSISSGILIYTGLIELMAHEFIFSNQFKGE 362
           T+ IA+AIGIGVRHSWVPGSR ALIA+G+FDSIS+GILIYTGL+ELMAHEF++SNQFKG 
Sbjct: 293 TTAIAVAIGIGVRHSWVPGSRNALIASGIFDSISAGILIYTGLVELMAHEFLYSNQFKGP 352

Query: 363 HSLRNMLTAYFIMCCGAALMALLGRWA 389
              + ML AYFIMCCGAALMALLG+WA
Sbjct: 353 DGFKRMLFAYFIMCCGAALMALLGKWA 379

>NDAI0G02570 Chr7 (588135..589424) [1290 bp, 429 aa] {ON} Anc_8.325
          Length = 429

 Score =  455 bits (1171), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 239/431 (55%), Positives = 287/431 (66%), Gaps = 49/431 (11%)

Query: 4   ELLGRS-VDTCSTENDYNGEQNLRILAVFIVMISSGLGAYFPILSSQYSFIRLPNWCFFV 62
           ELL R     C   NDYNG   LRILAVFI++ISSGLG YFPILSS+YSFIRLP+WCFF+
Sbjct: 3   ELLARDDAVVCEISNDYNGHSGLRILAVFIILISSGLGVYFPILSSRYSFIRLPSWCFFL 62

Query: 63  AKFFGSGVIIATAFIHLLQPAAEALTDDCLGGTFEDYPWAFGICLMSLFMLFLAEIVAHH 122
           AKFFGSGVI++TAFIHLL PAAEAL ++CLGGTF +YPWAFGICLMSLF+LF  EIV H+
Sbjct: 63  AKFFGSGVIVSTAFIHLLDPAAEALGNECLGGTFVEYPWAFGICLMSLFLLFFVEIVTHY 122

Query: 123 FVDKKFNHSHAE------------------------TDNANALPDIILKDI----QISTD 154
           FV K F   H +                         D+   LP     DI    Q S  
Sbjct: 123 FVAKSFGDEHHDHGNNINSVHDDDADSSDESITSYTEDHPVILPRRSHNDIENQFQKSNC 182

Query: 155 DLSEGMLN----------------CAGHQDSLQDSKKIETGVSTNLKRVDDSGFEGQYEY 198
            L++   N                    +++LQD + I      N      +   G+  +
Sbjct: 183 KLAQSAQNPDDDDDDEEEEDDKLKEEKEREALQDRQNISGNNKNNDNMTRFNSIPGKDHF 242

Query: 199 KRESTDETWIDENTLTTGNSEHKFSADYVSKVFVLCVLEFGIIFHSVFVGLSLAVAGSEF 258
             ++  +   D+  L T   E      Y++++F + +LEFGIIFHSVFVGLSL+V+G EF
Sbjct: 243 SHDTDHQ---DQTQLGTPIEEED-KEQYLNQMFAVFILEFGIIFHSVFVGLSLSVSGEEF 298

Query: 259 KVLFIVITFHQMFEGLGLGTRIAETEWPPSKWYTPWIMAFAFTITSPIAIAIGIGVRHSW 318
           + LFIV+TFHQMFEGLGLGTR+AET WP ++ YTPW+M  AFTITSPIA+AIGIGVRHSW
Sbjct: 299 ETLFIVLTFHQMFEGLGLGTRVAETNWPSNRRYTPWLMGLAFTITSPIAVAIGIGVRHSW 358

Query: 319 VPGSRKALIANGVFDSISSGILIYTGLIELMAHEFIFSNQFKGEHSLRNMLTAYFIMCCG 378
           +PGSRKALIANGVFDSISSGILIYTGL+ELMAHEF++SNQFKG    + ML AYFIMC G
Sbjct: 359 IPGSRKALIANGVFDSISSGILIYTGLVELMAHEFLYSNQFKGPDGFKKMLAAYFIMCLG 418

Query: 379 AALMALLGRWA 389
           A LMALLG+WA
Sbjct: 419 AGLMALLGKWA 429

>KNAG0G02460 Chr7 complement(560626..561837) [1212 bp, 403 aa] {ON}
           Anc_8.325 YLR130C
          Length = 403

 Score =  451 bits (1159), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 230/402 (57%), Positives = 286/402 (71%), Gaps = 24/402 (5%)

Query: 5   LLGRSVD---TCSTENDYNGEQNLRILAVFIVMISSGLGAYFPILSSQYSFIRLPNWCFF 61
           LL R  D    C+  N YNG   LRILAVFI++ISSG+G +FPI++S+YSFIRLP+WCFF
Sbjct: 9   LLPRDDDDVVACAVSNSYNGHNGLRILAVFIILISSGVGVFFPIMASRYSFIRLPDWCFF 68

Query: 62  VAKFFGSGVIIATAFIHLLQPAAEALTDDCLGGTFEDYPWAFGICLMSLFMLFLAEIVAH 121
           +AKFFGSGVI+ATAFIHLLQPA+EAL D CLGGTF +YPWAFGICLMSLFMLF  EIV+H
Sbjct: 69  IAKFFGSGVIVATAFIHLLQPASEALGDPCLGGTFAEYPWAFGICLMSLFMLFFTEIVSH 128

Query: 122 HFVDKKFNHSHAETDNANAL--PDIILKDIQISTDDLSEGMLNCAGH---QDSLQDSKKI 176
           HF+ K    SH     A+++   D    D + S     E + +  G    +D  +    +
Sbjct: 129 HFISKSLGDSHESHGGADSVYGDD---DDSEFSVSKQREIVDSQKGELFIKDKFEQEVDL 185

Query: 177 ETGVST--------NLKRVD-DSGFEGQYEYKRESTDETWIDENTLTTGNSEHKFSADYV 227
             G++T        NL   + +    G+  +  ++  +   D + L T   E      Y+
Sbjct: 186 SQGITTVPSTRDYANLTSTELEPTIPGKDHFAHDTEHQ---DPSQLGTPVQEQD-KEQYL 241

Query: 228 SKVFVLCVLEFGIIFHSVFVGLSLAVAGSEFKVLFIVITFHQMFEGLGLGTRIAETEWPP 287
           +++  + +LE GIIFHSVFVGLSL+V+G EF+ LFIV+TFHQMFEGLGLGTR+AET WP 
Sbjct: 242 NQIVAVTILEAGIIFHSVFVGLSLSVSGEEFETLFIVLTFHQMFEGLGLGTRVAETNWPE 301

Query: 288 SKWYTPWIMAFAFTITSPIAIAIGIGVRHSWVPGSRKALIANGVFDSISSGILIYTGLIE 347
           ++  TPW+M  AF +TSPIA+AIGIGVRHSWVPGSRK+LIANGVFD+ISSGILIYTGL+E
Sbjct: 302 NRKNTPWLMGLAFMLTSPIAVAIGIGVRHSWVPGSRKSLIANGVFDAISSGILIYTGLVE 361

Query: 348 LMAHEFIFSNQFKGEHSLRNMLTAYFIMCCGAALMALLGRWA 389
           LMAHEF+FSNQFKG   L+ ML AYFIMC GA LMALLG+WA
Sbjct: 362 LMAHEFLFSNQFKGPGGLKKMLYAYFIMCLGAGLMALLGKWA 403

>Kpol_543.64 s543 complement(147560..148834) [1275 bp, 424 aa] {ON}
           complement(147560..148834) [1275 nt, 425 aa]
          Length = 424

 Score =  451 bits (1159), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 228/415 (54%), Positives = 290/415 (69%), Gaps = 40/415 (9%)

Query: 10  VDTCSTENDYNGEQNLRILAVFIVMISSGLGAYFPILSSQYSFIRLPNWCFFVAKFFGSG 69
           VDTC   ND++G  NLR+L++F++MISSGLG +FP+L+S+YSFIRLP WCFF+AKFFGSG
Sbjct: 15  VDTCEATNDFDGRINLRVLSIFMIMISSGLGVFFPLLASRYSFIRLPEWCFFIAKFFGSG 74

Query: 70  VIIATAFIHLLQPAAEALTDDCLGGTFEDYPWAFGICLMSLFMLFLAEIVAHHFVDKKFN 129
           VI++TAFIHLL PAAEAL +DCLGGTF +YPWAFGICLMSLF+LF  EI+ H+F+ K  +
Sbjct: 75  VIVSTAFIHLLVPAAEALGNDCLGGTFVEYPWAFGICLMSLFLLFFTEIITHYFMSKSLD 134

Query: 130 HSHAETDNANALPDIILKDIQIST-----------DDLSEGMLNCAGHQDSLQDSKKIET 178
           + H ++ ++++      KDI+I++            D+SE       +   L D+KK+  
Sbjct: 135 NDHGDSGHSHSHFGNQNKDIEINSHFSSDEDEVDNKDISEERTYQMKYDFEL-DTKKVNE 193

Query: 179 GVS------------------------TNLKRVDDSGFEGQYEYKRESTDETWIDENTLT 214
             S                        TN+K        G+  Y   S D+   D + L 
Sbjct: 194 QTSPLYSVSSYAQVGTSSSKNSILPKETNIKLKQLESIPGKNHY---SHDKNHQDPSQLG 250

Query: 215 TGNSEHKFSADYVSKVFVLCVLEFGIIFHSVFVGLSLAVAGSEFKVLFIVITFHQMFEGL 274
           T   E      Y+ ++  + +LE G+IFHS+FVGLSLAV+G EF  LFIV+ FHQMFEGL
Sbjct: 251 TPVEEID-KEQYLGQIVGVTILEIGVIFHSIFVGLSLAVSGEEFITLFIVLVFHQMFEGL 309

Query: 275 GLGTRIAETEWPPSKWYTPWIMAFAFTITSPIAIAIGIGVRHSWVPGSRKALIANGVFDS 334
           GLGTR+AE  WP SK YTPW+MA  FT+T+PIAIAIGIGVR+SW+PGSRK+LIANGVFD+
Sbjct: 310 GLGTRLAEANWPHSKRYTPWLMALGFTLTTPIAIAIGIGVRYSWIPGSRKSLIANGVFDA 369

Query: 335 ISSGILIYTGLIELMAHEFIFSNQFKGEHSLRNMLTAYFIMCCGAALMALLGRWA 389
           ISSGILIYTGL+ELMAHEF+FSNQFKG    + ML+AYF+MCCGAALMA+LGRWA
Sbjct: 370 ISSGILIYTGLVELMAHEFLFSNQFKGPGGFKRMLSAYFVMCCGAALMAVLGRWA 424

>NCAS0B03580 Chr2 complement(635005..636048) [1044 bp, 347 aa] {ON}
           Anc_8.325
          Length = 347

 Score =  447 bits (1150), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 223/383 (58%), Positives = 278/383 (72%), Gaps = 40/383 (10%)

Query: 10  VDTCSTENDYNGEQNLRILAVFIVMISSGLGAYFPILSSQYSFIRLPNWCFFVAKFFGSG 69
            DTC  +NDYNGE N+RIL+VF++MISSGLG +FP+L+S+YSFIRLP+WCFF+AKFFGSG
Sbjct: 2   TDTCQAQNDYNGETNIRILSVFMIMISSGLGVFFPLLASKYSFIRLPDWCFFLAKFFGSG 61

Query: 70  VIIATAFIHLLQPAAEALTDDCLGGTFEDYPWAFGICLMSLFMLFLAEIVAHHFVDKKFN 129
           VI+ATAF+HLLQPA+EAL+D CLGGTF DYPWAFGICLMSLF LF  EI +H+++ K F+
Sbjct: 62  VIVATAFVHLLQPASEALSDPCLGGTFADYPWAFGICLMSLFFLFFTEIFSHYYISKAFS 121

Query: 130 HSHAETDNANALPDIILKDIQISTDDLSEGMLNCAGHQDSLQDSKKIETGVSTNLKRVDD 189
               E D++    D I KD    +D               L+ ++ I          V+D
Sbjct: 122 D---EKDSS----DTISKDSSYDSD---------------LEANQVIP---------VND 150

Query: 190 SGFEGQYEYKRESTDETWIDENTLTTGNSEHKFSADYVSKVFVLCVLEFGIIFHSVFVGL 249
           S   G+  +  E   +  I   T     ++ +    Y ++VF + +LEFGI+FHS+F+GL
Sbjct: 151 SR-PGKQHFSHEEDHQDAIQIGTPANDKAKEQ----YTNQVFAVFILEFGILFHSIFIGL 205

Query: 250 SLAVAGSEFKVLFIVITFHQMFEGLGLGTRIAETEWP---PSKWYTPWIMAFAFTITSPI 306
           SLAV+G EF  LFIV+ FHQMFEGLGLGTR+AET WP   P KW TPW+M  AFT  +P+
Sbjct: 206 SLAVSGDEFHTLFIVLIFHQMFEGLGLGTRVAETNWPDSGPKKW-TPWLMGLAFTFVTPV 264

Query: 307 AIAIGIGVRHSWVPGSRKALIANGVFDSISSGILIYTGLIELMAHEFIFSNQFKGEHSLR 366
           AIAIG+GVRHSWVPGSR+ALIANGVFDS+SSGILIYTGL+ELMAHEF++SNQFKG    +
Sbjct: 265 AIAIGLGVRHSWVPGSRRALIANGVFDSLSSGILIYTGLVELMAHEFLYSNQFKGPGGFK 324

Query: 367 NMLTAYFIMCCGAALMALLGRWA 389
            ML AYF MCCGA +MALLG+WA
Sbjct: 325 KMLYAYFFMCCGAGIMALLGKWA 347

>TBLA0H01270 Chr8 (286413..287618) [1206 bp, 401 aa] {ON} Anc_8.325
           YLR130C
          Length = 401

 Score =  446 bits (1146), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 219/386 (56%), Positives = 282/386 (73%), Gaps = 14/386 (3%)

Query: 10  VDTCSTENDYNGEQNLRILAVFIVMISSGLGAYFPILSSQYSFIRLPNWCFFVAKFFGSG 69
           V  C T NDY+G  NLRIL+VFI++ISSG+G  FPIL+SQYSFIRLP WCFF+AKFFGSG
Sbjct: 24  VPACETSNDYDGRMNLRILSVFILLISSGIGVNFPILASQYSFIRLPKWCFFIAKFFGSG 83

Query: 70  VIIATAFIHLLQPAAEALTDDCLGGTFEDYPWAFGICLMSLFMLFLAEIVAHHFVDKKF- 128
           VIIATAF+HLL+PAA+AL + CLGGTF +YPWAFGICLMSLF LF  EI++HH +D++  
Sbjct: 84  VIIATAFVHLLEPAADALGNACLGGTFAEYPWAFGICLMSLFFLFFTEIISHHIIDQRLA 143

Query: 129 ---NHSHAETDNANALPDIILKDIQISTDDLSEGMLNCAGHQDSLQDSKKIETGVSTNLK 185
               H H E   A    D I    + S D+    M+        +Q+     T + +  K
Sbjct: 144 KEHGHGHDEEHAAIERVDTIECCEENSCDEEPNPMV--------IQEENSATTYIDSKNK 195

Query: 186 RVDDSGFEGQYEYKRESTDETWID-ENTLTTGNSEHKFSAD-YVSKVFVLCVLEFGIIFH 243
               +      E+ +  + E  +D EN+++  +   +   + Y++++  + VLE G+I H
Sbjct: 196 DEKKAADVQINEHLQYDSQEKTVDLENSISHHDGMTRAEREQYLNQLVAVMVLEAGVIVH 255

Query: 244 SVFVGLSLAVAGSEFKVLFIVITFHQMFEGLGLGTRIAETEWPPSKWYTPWIMAFAFTIT 303
           SVF+GLSLAV G  F  LFIV+TFHQMFEGLGLGTR+AET WP SK  TPW+MA AFT+T
Sbjct: 256 SVFIGLSLAVTGDNFVTLFIVLTFHQMFEGLGLGTRVAETPWPKSKRMTPWLMALAFTLT 315

Query: 304 SPIAIAIGIGVRHSWVPGSRKALIANGVFDSISSGILIYTGLIELMAHEFIFSNQFKGEH 363
           +P+A+AIG+GVR+SWVPGSR +LIANG+FD+IS+GILIYTGL+ELMAHEF++S QFKGE+
Sbjct: 316 TPVAVAIGLGVRNSWVPGSRTSLIANGIFDAISAGILIYTGLVELMAHEFLYSGQFKGEN 375

Query: 364 SLRNMLTAYFIMCCGAALMALLGRWA 389
            L+ ML+AYF+MCCGAALMALLG+WA
Sbjct: 376 GLKQMLSAYFVMCCGAALMALLGKWA 401

>NCAS0C03250 Chr3 (638559..639848) [1290 bp, 429 aa] {ON} Anc_8.325
          Length = 429

 Score =  443 bits (1139), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 235/430 (54%), Positives = 283/430 (65%), Gaps = 42/430 (9%)

Query: 1   MHNELLGRSVDTCSTENDYNGEQNLRILAVFIVMISSGLGAYFPILSSQYSFIRLPNWCF 60
           M + +L R VDTC   N YNG   LRILA+FI++ISSGLG +FPI++S+YSFI LP WCF
Sbjct: 1   MIDIILARDVDTCEVSNTYNGHAGLRILAIFIILISSGLGVFFPIMASRYSFIHLPEWCF 60

Query: 61  FVAKFFGSGVIIATAFIHLLQPAAEALTDDCLGGTFEDYPWAFGICLMSLFMLFLAEIVA 120
           F+AKFFGSGVI+ATAFIHLL PAAEAL + CLGGTF +YPWAFGICLMSLFMLFL EIV 
Sbjct: 61  FLAKFFGSGVIVATAFIHLLDPAAEALGNSCLGGTFTEYPWAFGICLMSLFMLFLMEIVT 120

Query: 121 HHFVDKKF-NHSHAETDNANALPDIILKDIQISTD-DLSEGMLNCAGH------------ 166
           H++V K F +H H    + +   DI   +    TD +   G++    H            
Sbjct: 121 HYYVAKSFGDHDHDGGHSNHHEDDITSFEADGFTDLERQNGIVRSTDHNNNSNNNNVLPM 180

Query: 167 --------------------------QDSLQDSKKIETGVSTNLKRVDDSGFEGQYEYKR 200
                                      + L  S +I    +      + S F      K 
Sbjct: 181 KKNQVDEKSIDEDDDGDDEDKEQDPASNDLASSSRINNNDNLVNTNTNISRFVSSVPGKD 240

Query: 201 E-STDETWIDENTLTTGNSEHKFSADYVSKVFVLCVLEFGIIFHSVFVGLSLAVAGSEFK 259
               D+   D + + T   E      Y++++  + +LEFGIIFHSVFVGLSL+V+G EF+
Sbjct: 241 HFGHDDVHQDSSQIGTPVEEEN-KEQYLNQMMAVFILEFGIIFHSVFVGLSLSVSGEEFE 299

Query: 260 VLFIVITFHQMFEGLGLGTRIAETEWPPSKWYTPWIMAFAFTITSPIAIAIGIGVRHSWV 319
            LFIV+ FHQMFEGLGLGTR+AET WP SK YTPW+M  AFTITSPIA+AIGIGVR SW+
Sbjct: 300 TLFIVLIFHQMFEGLGLGTRVAETNWPKSKRYTPWLMGLAFTITSPIAVAIGIGVRKSWI 359

Query: 320 PGSRKALIANGVFDSISSGILIYTGLIELMAHEFIFSNQFKGEHSLRNMLTAYFIMCCGA 379
           PGSR ALIANGVFDSISSGILIYTGL+ELMAHEF++SNQFKG   L+ MLTAYFIMC GA
Sbjct: 360 PGSRNALIANGVFDSISSGILIYTGLVELMAHEFLYSNQFKGPGGLKKMLTAYFIMCMGA 419

Query: 380 ALMALLGRWA 389
            LMALLG+WA
Sbjct: 420 GLMALLGKWA 429

>KAFR0B05730 Chr2 complement(1182121..1183239) [1119 bp, 372 aa]
           {ON} Anc_8.325 YLR130C
          Length = 372

 Score =  438 bits (1127), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 220/390 (56%), Positives = 288/390 (73%), Gaps = 22/390 (5%)

Query: 3   NELLGRSVDTCSTENDYNGEQNLRILAVFIVMISSGLGAYFPILSSQYSFIRLPNWCFFV 62
           +EL+ R  DTC T NDYNG  NLRILAVF+++ISS LGA+FP+LSS+YSFI+LPNWCFF+
Sbjct: 2   SELIPR--DTCQTSNDYNGSDNLRILAVFMILISSALGAFFPLLSSKYSFIKLPNWCFFI 59

Query: 63  AKFFGSGVIIATAFIHLLQPAAEALTDDCLGGTFEDYPWAFGICLMSLFMLFLAEIVAHH 122
           AKFFGSGVI+ATAFIHLL+PA++ALT+DCLGGTF DYPWAFGICLMSLF LF +EI +H+
Sbjct: 60  AKFFGSGVIVATAFIHLLEPASDALTNDCLGGTFADYPWAFGICLMSLFFLFFSEICSHY 119

Query: 123 FVDKKF---NHSHAETDNANALPDIILKDIQISTDDLSEGMLNCAGHQDSLQDSKKIETG 179
           F+ + +   +HSH  + N ++      K   + +D  +E  +  + H+D    S   + G
Sbjct: 120 FILRAYGNEDHSHFPSGNDDS------KLSDVDSDKNTETRI--SNHRDIESGSFIRDAG 171

Query: 180 VSTNLKRVDDSGFEGQYEYKRESTDETWIDENTLTTGNSEHKFSADYVSKVFVLCVLEFG 239
            ++      +S   G+  Y  ++  +   D + L T  +E     +Y +++F + +LEFG
Sbjct: 172 PTSG-----NSFIPGRDHYSHDAVHQ---DPSQLGT-PAESSDKENYANQIFAVSILEFG 222

Query: 240 IIFHSVFVGLSLAVAGSEFKVLFIVITFHQMFEGLGLGTRIAETEWPPSKWYTPWIMAFA 299
           I+FHSVF+GLSLAVAG EFK LF+V+ FHQMFEGLGLGTR+AET WP SK  TPWIMA  
Sbjct: 223 IVFHSVFIGLSLAVAGEEFKTLFVVLIFHQMFEGLGLGTRLAETNWPKSKKLTPWIMALG 282

Query: 300 FTITSPIAIAIGIGVRHSWVPGSRKALIANGVFDSISSGILIYTGLIELMAHEFIFSNQF 359
           ++IT+PI+ AIGIGVRHS++P SRKALI NGVFD+ S+GILIYTGL+ELMAHEF++S+ F
Sbjct: 283 YSITTPISTAIGIGVRHSFLPESRKALIVNGVFDAFSAGILIYTGLVELMAHEFLYSSTF 342

Query: 360 KGEHSLRNMLTAYFIMCCGAALMALLGRWA 389
           K +  L+ ML AY  M  GA +MALLG+WA
Sbjct: 343 KQKDGLKRMLLAYLCMATGAGIMALLGKWA 372

>SAKL0H15510g Chr8 (1350297..1351496) [1200 bp, 399 aa] {ON} similar
           to uniprot|Q12436 Saccharomyces cerevisiae YLR130C ZRT2
           Low-affinity zinc transporter of the plasma membrane
           transcription is induced under low-zinc conditions by
           the Zap1p transcription factor
          Length = 399

 Score =  435 bits (1118), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 223/394 (56%), Positives = 271/394 (68%), Gaps = 18/394 (4%)

Query: 10  VDTCSTENDYNGEQNLRILAVFIVMISSGLGAYFPILSSQYSFIRLPNWCFFVAKFFGSG 69
           VD C  +N+Y+G  +LRILAVF+++ISSGLGA+FPILSS+YS IRLP WCFF+AKFFGSG
Sbjct: 10  VDVCDNDNEYDGRDSLRILAVFMILISSGLGAFFPILSSRYSVIRLPAWCFFIAKFFGSG 69

Query: 70  VIIATAFIHLLQPAAEALTDDCLGGTFEDYPWAFGICLMSLFMLFLAEIVAHHFVDK--- 126
           VI+AT FIHLL+PA + L + CLGGTF DYPWAFGICLMSLF LF +EI+ HHF  K   
Sbjct: 70  VIVATGFIHLLKPATDNLGNTCLGGTFADYPWAFGICLMSLFALFFSEIITHHFFIKANG 129

Query: 127 --KFNHSHAETDNANALPDIILKDIQISTDDLSEGMLNCAGHQDSLQ-----DSKKIETG 179
                +SH+     N        D     DD  E  + CA     L+     D +++   
Sbjct: 130 NSDHTNSHSHFGEPNHTTHQQFPDESEKKDDEEEADVECAAEYIPLKVGYFKDDEELRCS 189

Query: 180 VSTNLKRVDDS----GFEGQYEYKRESTDETWIDENTLTTGNSEHKFSADYVSKVFVLCV 235
            S  + R  D        G+  +  E   +      TL       K    Y+S+VF + +
Sbjct: 190 ASQGVSRKSDRKPSVSVPGKDHFSHEQDHQDLSQLGTLV----RQKEREQYLSQVFAVFI 245

Query: 236 LEFGIIFHSVFVGLSLAVAGSEFKVLFIVITFHQMFEGLGLGTRIAETEWPPSKWYTPWI 295
           LEFG++FHSVFVGLSLAVAG EF  LFIV+ FHQMFEGLGLGTRIAET WP SK YTPW+
Sbjct: 246 LEFGVVFHSVFVGLSLAVAGDEFNTLFIVLVFHQMFEGLGLGTRIAETTWPASKRYTPWL 305

Query: 296 MAFAFTITSPIAIAIGIGVRHSWVPGSRKALIANGVFDSISSGILIYTGLIELMAHEFIF 355
           +   +T+++PIAIAIGIGVRHS+ PGS+KALI NGVFDSIS+GILIYTGL+ELMAHEF++
Sbjct: 306 LGLGYTLSTPIAIAIGIGVRHSFAPGSKKALITNGVFDSISAGILIYTGLVELMAHEFLY 365

Query: 356 SNQFKGEHSLRNMLTAYFIMCCGAALMALLGRWA 389
           S QFKGE   + M+ AYFIMC GA LMALLGRWA
Sbjct: 366 SQQFKGEGGCKRMIGAYFIMCLGAGLMALLGRWA 399

>TPHA0A01550 Chr1 (310086..311321) [1236 bp, 411 aa] {ON} Anc_8.325
           YLR130C
          Length = 411

 Score =  435 bits (1119), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 223/410 (54%), Positives = 281/410 (68%), Gaps = 38/410 (9%)

Query: 7   GRSVDTCSTENDYNGEQNLRILAVFIVMISSGLGAYFPILSSQYSFIRLPNWCFFVAKFF 66
           G S DTC T++ YNG  N+R+LA+FI++ISSGLG++FPIL+S YSFIRLP+ CFFVAKFF
Sbjct: 13  GDSTDTCDTQSSYNGSTNMRVLALFIILISSGLGSFFPILASTYSFIRLPDCCFFVAKFF 72

Query: 67  GSGVIIATAFIHLLQPAAEALTDDCLGGTFEDYPWAFGICLMSLFMLFLAEIVAHHFV-- 124
           GSGVI+ATAFIHLL PA EAL++ CLGGTF +YPWAFGICLMSLF+LFL EI+ HH +  
Sbjct: 73  GSGVIVATAFIHLLDPAVEALSNTCLGGTFTEYPWAFGICLMSLFLLFLIEIMTHHMLTH 132

Query: 125 DKKFNHSHAETDNANALPDIILKDIQISTDDLSEGMLNCAGHQDSLQDSKKIETGVSTNL 184
           D+  +  H+  D+ +            S DD     ++    +D+  DS  I + +  N 
Sbjct: 133 DEHGDGGHSHGDDTSYTAS--------SIDDKEADSIDADVRKDANDDSYDINSIL--NF 182

Query: 185 KRVDDSGFEG-QYEYKRESTDETWIDE----NTLTTGNSEHKFSAD-------------- 225
            +  D   E   YE   E  + T +D      T +T   +H FS D              
Sbjct: 183 DKNKDYDIEANHYEVSMEDRNNTKMDNYKISQTKSTPGQDH-FSHDSEHQDLVQLGTPVE 241

Query: 226 ------YVSKVFVLCVLEFGIIFHSVFVGLSLAVAGSEFKVLFIVITFHQMFEGLGLGTR 279
                 Y+ ++  + +LEFG+IFHS+F GLSLAV+G EF+ LFIV+ FHQMFEGLGLGTR
Sbjct: 242 QLDKEKYMGQIVSVIILEFGVIFHSIFTGLSLAVSGDEFETLFIVLVFHQMFEGLGLGTR 301

Query: 280 IAETEWPPSKWYTPWIMAFAFTITSPIAIAIGIGVRHSWVPGSRKALIANGVFDSISSGI 339
           IAET WP SK  TPW++A  FTI++PIAI IGIGVR++++PGSR ALI NG+FDSISSGI
Sbjct: 302 IAETNWPKSKKNTPWLLALGFTISTPIAIGIGIGVRYTFIPGSRTALITNGIFDSISSGI 361

Query: 340 LIYTGLIELMAHEFIFSNQFKGEHSLRNMLTAYFIMCCGAALMALLGRWA 389
           LIYTGL+ELMAHEF+FS QF G    + M+ AY IMCCGAALMALLG+WA
Sbjct: 362 LIYTGLVELMAHEFLFSKQFSGRDGFKKMIFAYVIMCCGAALMALLGKWA 411

>NDAI0J01010 Chr10 (230625..231779) [1155 bp, 384 aa] {ON} Anc_8.325
          Length = 384

 Score =  421 bits (1083), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 206/384 (53%), Positives = 277/384 (72%), Gaps = 5/384 (1%)

Query: 10  VDTCSTENDYNGEQNLRILAVFIVMISSGLGAYFPILSSQYSFIRLPNWCFFVAKFFGSG 69
            DTC   ND+NG  N+RIL++F++++SS +G +FP+LS++YS+IRLP WCFF+AKFFGSG
Sbjct: 2   TDTCLNTNDFNGRTNIRILSIFMILLSSAIGTFFPLLSTRYSYIRLPPWCFFLAKFFGSG 61

Query: 70  VIIATAFIHLLQPAAEALTDDCLGGTFEDYPWAFGICLMSLFMLFLAEIVAHHFVDKKF- 128
           VI+ATAFIHLL+PA++AL D CLGGTF DYPWAFGICLMSLF LF  EIV+H +V+K F 
Sbjct: 62  VIVATAFIHLLEPASDALGDPCLGGTFADYPWAFGICLMSLFFLFFTEIVSHFYVNKAFE 121

Query: 129 --NHSHAETDNANALPDIILKDIQISTDDLSEGMLNCAGHQDSLQDSKKIETGVSTNLKR 186
             +HS +   ++++  D    D    + D+           +SLQ +     G++T   R
Sbjct: 122 TVSHSASGNIHSHSNEDDDDHDHDKDSVDIKNKHTTTNNDLESLQSTSPGIIGLAT-FTR 180

Query: 187 VDDSGFEGQYEYKRESTDETWIDENTLTTGNSEHKFSAD-YVSKVFVLCVLEFGIIFHSV 245
             D+  +          D   + ++    G S +  + + Y +++  + +LEFGI+FHSV
Sbjct: 181 SHDNVNKQMGTIGSNHYDHALVHQDPGQMGTSLNDSAKEQYANQLLAVTILEFGIVFHSV 240

Query: 246 FVGLSLAVAGSEFKVLFIVITFHQMFEGLGLGTRIAETEWPPSKWYTPWIMAFAFTITSP 305
           F+GLSLAV+G EF  LFIV+ FHQMFEGLGLGTR+AE  W  SK +TPW+MA  F++T+P
Sbjct: 241 FIGLSLAVSGEEFTTLFIVLIFHQMFEGLGLGTRLAEVPWDKSKRFTPWLMALGFSLTTP 300

Query: 306 IAIAIGIGVRHSWVPGSRKALIANGVFDSISSGILIYTGLIELMAHEFIFSNQFKGEHSL 365
           IAIAIG+GVRHS+VP SR+ALI+NG FD+IS+GILIYTGL+ELMAHEF++SNQFKGE+  
Sbjct: 301 IAIAIGLGVRHSFVPTSRRALISNGCFDAISAGILIYTGLVELMAHEFLYSNQFKGENGF 360

Query: 366 RNMLTAYFIMCCGAALMALLGRWA 389
           + M++AY  MC GA LMALLG+WA
Sbjct: 361 KKMISAYICMCFGAGLMALLGKWA 384

>SAKL0H14388g Chr8 (1247106..1248248) [1143 bp, 380 aa] {ON} similar
           to uniprot|Q12436 Saccharomyces cerevisiae YLR130C ZRT2
           Low-affinity zinc transporter of the plasma membrane
           transcription is induced under low-zinc conditions by
           the Zap1p transcription factor
          Length = 380

 Score =  421 bits (1082), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 206/378 (54%), Positives = 269/378 (71%), Gaps = 28/378 (7%)

Query: 12  TCSTENDYNGEQNLRILAVFIVMISSGLGAYFPILSSQYSFIRLPNWCFFVAKFFGSGVI 71
            C  +NDY+G  NLRILAVF+++ISS LG +FPILSS+YSFIRLP+WCFF+AK+FGSGVI
Sbjct: 31  ACPIDNDYDGRDNLRILAVFMILISSALGTFFPILSSRYSFIRLPDWCFFIAKYFGSGVI 90

Query: 72  IATAFIHLLQPAAEALTDDCLGGTFEDYPWAFGICLMSLFMLFLAEIVAHHFVDKKFNHS 131
           +AT FIHLL+PA++AL ++CLGGTF DYPWAFGICLMSLF LF  EI+ H+F  K     
Sbjct: 91  VATGFIHLLEPASDALGEECLGGTFADYPWAFGICLMSLFALFFVEIITHYFAAKA---- 146

Query: 132 HAETDNANALPDIILKDIQISTDDLSEGMLNCAGHQDSLQDSKKIETGVSTNLKRVDDSG 191
            A  D++N   +  +KD +  +      ++     Q+              N+  V  + 
Sbjct: 147 -AGNDSSNYSDEKSVKDEEADSQLAYSAVIKVDQQQE--------------NVNSVPGAD 191

Query: 192 FEGQYEYKRESTDETWIDENTLTTGNSEHKFSADYVSKVFVLCVLEFGIIFHSVFVGLSL 251
             G  E  ++        +N ++  + E      Y++++  + +LEFG++FHSVFVGLSL
Sbjct: 192 HYGHDEVHQDPAQA----QNLVSQKDKEK-----YLNQIVAVFILEFGVVFHSVFVGLSL 242

Query: 252 AVAGSEFKVLFIVITFHQMFEGLGLGTRIAETEWPPSKWYTPWIMAFAFTITSPIAIAIG 311
           AVAG EF  LFIV+ FHQMFEGLGLGTRIAET WP S+ +TPW++A  +TI +PIAIAIG
Sbjct: 243 AVAGDEFNTLFIVLVFHQMFEGLGLGTRIAETPWPESERFTPWLLALGYTIATPIAIAIG 302

Query: 312 IGVRHSWVPGSRKALIANGVFDSISSGILIYTGLIELMAHEFIFSNQFKGEHSLRNMLTA 371
           IGVRHS+ PGSRKALI+NG FD+IS+GILIYTGL+ELMAHEF+++N FKG +  + M+ A
Sbjct: 303 IGVRHSFAPGSRKALISNGCFDAISAGILIYTGLVELMAHEFLYANSFKGPNGFKWMMLA 362

Query: 372 YFIMCCGAALMALLGRWA 389
           +FIMC GA LMALLG+WA
Sbjct: 363 FFIMCLGAGLMALLGKWA 380

>CAGL0E01353g Chr5 (127845..129146) [1302 bp, 433 aa] {ON} similar
           to uniprot|Q12436 Saccharomyces cerevisiae YLR130c ZRT2
           or uniprot|P32804 Saccharomyces cerevisiae YGL255w ZRT1
          Length = 433

 Score =  421 bits (1083), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 217/417 (52%), Positives = 281/417 (67%), Gaps = 41/417 (9%)

Query: 12  TCSTENDYNGEQNLRILAVFIVMISSGLGAYFPILSSQYSFIRLPNWCFFVAKFFGSGVI 71
            C+ +ND+NG  NLRIL+VF+V+ISS +G YFP+L+S+YSFI LP+W FF+AKFFGSGVI
Sbjct: 19  ACAVDNDFNGHTNLRILSVFMVLISSAIGVYFPLLASRYSFINLPSWVFFIAKFFGSGVI 78

Query: 72  IATAFIHLLQPAAEALTDDCLGGTFEDYPWAFGICLMSLFMLFLAEIVAHHFVDKKF--- 128
           +ATAFIHLL+PA+++L + CLGGTF +YPWAFGICLM+LF LFL EIV+HH+V K     
Sbjct: 79  VATAFIHLLEPASDSLGNPCLGGTFANYPWAFGICLMALFALFLIEIVSHHYVGKTMGGG 138

Query: 129 -NHSH------AETDNANALPDIILKD--------IQISTDD-----LSEGMLNCAGHQD 168
            NHSH       +T       D++ +D          ++ DD     +     N     D
Sbjct: 139 HNHSHNMPTTFGQTHMHGVEDDMVDEDGSSSTHSHSHVAMDDKYGDVVKNNNYNYDDGSD 198

Query: 169 SLQDSKKIETGVSTNLKRVDDS---------------GFEGQYEYKRESTDETWIDENTL 213
            ++  K+    V+    R D +                 E    +   S DE   D   +
Sbjct: 199 DIESQKRPAFNVAQQKVRNDSNENDSLVGHVHNTTVDPLEHMPGHNHFSHDEVHQDITQI 258

Query: 214 -TTGNSEHKFSADYVSKVFVLCVLEFGIIFHSVFVGLSLAVAGSEFKVLFIVITFHQMFE 272
            +  N + K    Y++++  L +LEFGI+FHSVFVGLSL+V+G EFK LF+VI FHQMFE
Sbjct: 259 GSKANDQQK--EQYLNQLTSLFILEFGILFHSVFVGLSLSVSGDEFKTLFVVIVFHQMFE 316

Query: 273 GLGLGTRIAETEWPPSKWYTPWIMAFAFTITSPIAIAIGIGVRHSWVPGSRKALIANGVF 332
           G+GLG RI E  WP SK + P+++ F +TIT+PIAIAIGIGVRHS+VPGSR++LI NGVF
Sbjct: 317 GMGLGARITECYWPHSKRWLPYLLGFGYTITTPIAIAIGIGVRHSFVPGSRRSLIVNGVF 376

Query: 333 DSISSGILIYTGLIELMAHEFIFSNQFKGEHSLRNMLTAYFIMCCGAALMALLGRWA 389
           D+IS+GIL+Y GL+ELMAHEF+F+NQFKGEH LRNML AYF+M  GA LMALLGRWA
Sbjct: 377 DAISAGILVYAGLVELMAHEFLFTNQFKGEHGLRNMLAAYFVMALGAGLMALLGRWA 433

>TPHA0D00970 Chr4 complement(195530..196681) [1152 bp, 383 aa] {ON} 
          Length = 383

 Score =  418 bits (1075), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 213/383 (55%), Positives = 269/383 (70%), Gaps = 28/383 (7%)

Query: 13  CSTENDYNGEQ-NLRILAVFIVMISSGLGAYFPILSSQYSFIRLPNWCFFVAKFFGSGVI 71
           C  E+DY+G+  NLRILAVF+V+ISSGLG++FPILSS+YS IRLPNWCFF+AKFFGSGVI
Sbjct: 23  CDIESDYDGQSDNLRILAVFMVLISSGLGSFFPILSSKYSVIRLPNWCFFIAKFFGSGVI 82

Query: 72  IATAFIHLLQPAAEALTDDCLGGTFEDYPWAFGICLMSLFMLFLAEIVAHHFVDKKFNHS 131
            ATAFIHLL+PA + L +DCLGGTF +YPWAFGICLMSLF LFL EIV HH ++K     
Sbjct: 83  TATAFIHLLEPATDELGNDCLGGTFAEYPWAFGICLMSLFTLFLVEIVTHHLMEKNV--- 139

Query: 132 HAETDNANALPD-IILKDIQISTDDLSEGMLNCAGHQDSLQDSKKIETG----VSTNLKR 186
                 A   P+ ++    +IS+ D  EG        D + D  ++E       + +  R
Sbjct: 140 ------AGVTPNKVVHMHDEISSSD--EGF-------DKVDDVNELEVTNTQLTTASEDR 184

Query: 187 VDDSGFEGQYEYKRESTDETWIDENTLTTGNSEHKFSADYVSKVFVLCVLEFGIIFHSVF 246
           +D +   G   Y      +     N+      +  +S+  VS    L +LEFG+IFHS+F
Sbjct: 185 IDFNPIIGANHYSHAEHHQDIEQMNSALEETGKESYSSQIVS----LLILEFGVIFHSIF 240

Query: 247 VGLSLAVAGSEFKVLFIVITFHQMFEGLGLGTRIAETEWPPSKWYTPWIMAFAFTITSPI 306
           VGLSLAV+G EFK LF+VI FHQMFEGLGLG+RIAE  W     YTPW++A  FT+ +PI
Sbjct: 241 VGLSLAVSGDEFKTLFVVIIFHQMFEGLGLGSRIAEQNWGVRNTYTPWLLALGFTVATPI 300

Query: 307 AIAIGIGVRHSWVPGSRKALIANGVFDSISSGILIYTGLIELMAHEFIFSNQFKGEHSLR 366
           AIAIGIGVR+S+ PGSR ALI++G+FDS+S+GILIYTGL+ELMAHEF+FS QF+GE+  +
Sbjct: 301 AIAIGIGVRYSYFPGSRNALISSGIFDSLSAGILIYTGLVELMAHEFLFSKQFQGENGFK 360

Query: 367 NMLTAYFIMCCGAALMALLGRWA 389
            ML AY  MCCG ALMAL+G+WA
Sbjct: 361 KMLLAYVCMCCGCALMALIGKWA 383

>KLTH0F09064g Chr6 (779431..780516) [1086 bp, 361 aa] {ON} similar
           to uniprot|Q12436 Saccharomyces cerevisiae YLR130C ZRT2
           Low-affinity zinc transporter of the plasma membrane
           transcription is induced under low- zinc conditions by
           the Zap1p transcription factor
          Length = 361

 Score =  408 bits (1049), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 209/379 (55%), Positives = 264/379 (69%), Gaps = 31/379 (8%)

Query: 11  DTCSTENDYNGEQNLRILAVFIVMISSGLGAYFPILSSQYSFIRLPNWCFFVAKFFGSGV 70
           + CST N+++G + LR+ A+F++M SS LGA+FPI++S YS + LP+WCFFVAKFFGSGV
Sbjct: 14  EQCSTSNEFDGREGLRVGALFVIMASSALGAFFPIMASNYSAVSLPDWCFFVAKFFGSGV 73

Query: 71  IIATAFIHLLQPAAEALTDDCLGGTFEDYPWAFGICLMSLFMLFLAEIVAHHFVDKKFNH 130
           IIAT F+HLLQPA EALTD CL GTF+DYPWAFGICLMSL+ +FL EIV HH + +    
Sbjct: 74  IIATGFVHLLQPANEALTDPCLTGTFQDYPWAFGICLMSLYAIFLVEIVTHHMLSRVAPA 133

Query: 131 SHAETDNANALPDIILKDIQISTDDLSEGMLNCAGHQDSLQDSKKIETGVSTNLKRVDDS 190
             A    A++  D    D ++    LSE           LQD +       +  + +   
Sbjct: 134 YSATEARAHSGSDATCMDDEL---RLSE-----------LQDLR-------SKPQEMSKP 172

Query: 191 GFEGQYEYKRESTDETWIDENTLTTGNSEHKFSADYVSKVFVLCVLEFGIIFHSVFVGLS 250
           G +G   Y+ E+        +T+T G         ++S+V  + +LEFG+IFHSVF+GLS
Sbjct: 173 GSDGDAVYQ-EAHRVLSASSSTVTEG---------FLSQVVTVFILEFGVIFHSVFIGLS 222

Query: 251 LAVAGSEFKVLFIVITFHQMFEGLGLGTRIAETEWPPSKWYTPWIMAFAFTITSPIAIAI 310
           LAV+GSEF  LFIV+ FHQMFEGLGLGTRIAE  WP +K YTPWI+A  F+I++PIAIAI
Sbjct: 223 LAVSGSEFITLFIVLIFHQMFEGLGLGTRIAEISWPANKRYTPWILALGFSISTPIAIAI 282

Query: 311 GIGVRHSWVPGSRKALIANGVFDSISSGILIYTGLIELMAHEFIFSNQFKGEHSLRNMLT 370
           G+GVRHS    SR  LIANG FD+ISSGILIYTGL+ELMAHEFIFS+QFKG   L+ ML 
Sbjct: 283 GLGVRHSLSTNSRSGLIANGCFDAISSGILIYTGLVELMAHEFIFSSQFKGPGGLKKMLF 342

Query: 371 AYFIMCCGAALMALLGRWA 389
           A+ +MC G+ LMALLGRWA
Sbjct: 343 AFTMMCAGSGLMALLGRWA 361

>TBLA0F02390 Chr6 (588534..589817) [1284 bp, 427 aa] {ON} 
          Length = 427

 Score =  409 bits (1051), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 206/415 (49%), Positives = 280/415 (67%), Gaps = 43/415 (10%)

Query: 12  TCSTENDYNGEQNLRILAVFIVMISSGLGAYFPILSSQYSFIRLPNWCFFVAKFFGSGVI 71
            C T+NDY+G  NLRILAVF+++ISS +G +FPIL+S+YSFIR+P   FF+AKFFGSGVI
Sbjct: 19  ACPTQNDYDGRDNLRILAVFMLLISSSIGVFFPILASRYSFIRIPPIFFFIAKFFGSGVI 78

Query: 72  IATAFIHLLQPAAEALTDDCLGGTFEDYPWAFGICLMSLFMLFLAEIVAHHFVDKKFNHS 131
           +ATAFIHLLQPA + L D CLGG +++YPWAFGICLM+LF++F +E++AH+F+++     
Sbjct: 79  VATAFIHLLQPAYDELNDPCLGGVWQEYPWAFGICLMALFLIFFSELMAHYFIERN---- 134

Query: 132 HAETDNANALPD------------------------IILKDIQI--STDDLSEGMLNC-- 163
             E  N   +PD                        ++ K+ Q+   +DDL     +   
Sbjct: 135 --ERKNGGKVPDPHASHFRNPEFRGHKHGADNESGEMMEKEDQVGSPSDDLESQENDSIV 192

Query: 164 ---AGHQDSLQ---DSKKIETGVSTNLKRVDDSGFEGQY--EYKRESTDETWIDENTLTT 215
              AG  D  +   + + ++ G   N+  V D   E     E+  E ++++   +     
Sbjct: 193 ERDAGASDEYRFYNEEEDVKRGDRENVHSVADGKNENLVFSEHNVEVSEDSEDSDGLFAA 252

Query: 216 GNSEHKFS-ADYVSKVFVLCVLEFGIIFHSVFVGLSLAVAGSEFKVLFIVITFHQMFEGL 274
                  S ++YV ++  + +LE GII HS+F+GLSL+VAG EF  LF+V+ FHQMFEGL
Sbjct: 253 ERKPEDVSNSEYVRELVSVMILESGIIAHSIFIGLSLSVAGKEFDTLFVVLIFHQMFEGL 312

Query: 275 GLGTRIAETEWPPSKWYTPWIMAFAFTITSPIAIAIGIGVRHSWVPGSRKALIANGVFDS 334
           GLGTR+AE EWP SK YTPWI+   F +T+PI+ AIGIGVRHSWVPGSR ALI NG+FDS
Sbjct: 313 GLGTRVAEVEWPYSKRYTPWILGACFGVTTPISAAIGIGVRHSWVPGSRSALIVNGIFDS 372

Query: 335 ISSGILIYTGLIELMAHEFIFSNQFKGEHSLRNMLTAYFIMCCGAALMALLGRWA 389
           IS+GILIYTGL+ELMAHEF+++N F+G++SL+ +L AYF+MCCG  LMALLG+WA
Sbjct: 373 ISAGILIYTGLVELMAHEFLYANNFEGKNSLKKLLLAYFVMCCGCGLMALLGKWA 427

>KLLA0D16434g Chr4 complement(1384826..1386070) [1245 bp, 414 aa]
           {ON} similar to uniprot|Q12436 Saccharomyces cerevisiae
           YLR130C ZRT2 Low-affinity zinc transporter of the plasma
           membrane transcription is induced under low-zinc
           conditions by the Zap1p transcription factor
          Length = 414

 Score =  400 bits (1029), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 202/386 (52%), Positives = 270/386 (69%), Gaps = 27/386 (6%)

Query: 15  TENDYNGEQNLRILAVFIVMISSGLGAYFPILSSQYSFIRLPNWCFFVAKFFGSGVIIAT 74
           ++NDY+G+ N+R+ A+FI++IS GLG+YFPILSS+YSFIRLP+WCFF+AKFFGSGVI+AT
Sbjct: 45  SDNDYDGKDNMRVCALFIILISGGLGSYFPILSSRYSFIRLPDWCFFIAKFFGSGVIVAT 104

Query: 75  AFIHLLQPAAEALTDDCLGGTFEDYPWAFGICLMSLFMLFLAEIVAHHFVDKKF----NH 130
            FIHLL+PAA+AL ++CLGGTF DYPWAFGICLMSLF LFL+E VA ++ +K +    +H
Sbjct: 105 GFIHLLEPAADALGEECLGGTFADYPWAFGICLMSLFALFLSECVARYYTNKSYGFQNDH 164

Query: 131 SHAETDNANALPDIILKDIQISTDDLSEGMLNCAGHQDSLQDSKKIETGVSTNLKRVDDS 190
            H+   ++        KD +     L +     +   + + D + +   V+ N    + +
Sbjct: 165 VHSHFPSS--------KDQK----SLEDEDDEDSDKYNQVVDEENVSLTVANNNNGAEIT 212

Query: 191 G------FEGQYEYKRESTDETWIDENTLTTGNSEHKFSADYVSKVFVLCVLEFGIIFHS 244
                    G   +  + + +      T     S+ K    Y +++  + +LEFGIIFHS
Sbjct: 213 ATNPHPSMPGSNHFSHDKSHQDLATIGTPAQMTSKEK----YQNQLLSVFILEFGIIFHS 268

Query: 245 VFVGLSLAVAGS-EFKVLFIVITFHQMFEGLGLGTRIAETEWPPSKWYTPWIMAFAFTIT 303
           VF+GL+LAV G+ EF  LFIV+ FHQMFEG+GLG RIAE  W     +TPW++A  FT+T
Sbjct: 269 VFIGLALAVTGNDEFNTLFIVLVFHQMFEGMGLGARIAEVSWAKKHRFTPWLLAAGFTLT 328

Query: 304 SPIAIAIGIGVRHSWVPGSRKALIANGVFDSISSGILIYTGLIELMAHEFIFSNQFKGEH 363
           +PIAIAIGIGVRHS+ PGSR ALIANG FD+IS+GILIYTGL+ELMAHEF++S+ FKGE+
Sbjct: 329 TPIAIAIGIGVRHSYAPGSRTALIANGCFDAISAGILIYTGLVELMAHEFLYSDNFKGEN 388

Query: 364 SLRNMLTAYFIMCCGAALMALLGRWA 389
            L+ ML A+F MC GA LMALLG+WA
Sbjct: 389 GLKKMLWAFFTMCWGAGLMALLGKWA 414

>KNAG0A05180 Chr1 (764235..765422) [1188 bp, 395 aa] {ON} Anc_8.325
           YLR130C
          Length = 395

 Score =  392 bits (1007), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 218/387 (56%), Positives = 281/387 (72%), Gaps = 20/387 (5%)

Query: 12  TCSTENDYNGEQNLRILAVFIVMISSGLGAYFPILSSQYSFIRLPNWCFFVAKFFGSGVI 71
            C+  N+Y+G  NLRIL++FI++ISS +G++FPILSS+YSFIRLP+WCFF+AKFFGSGVI
Sbjct: 20  ACADTNEYDGRSNLRILSIFIILISSAMGSFFPILSSKYSFIRLPDWCFFLAKFFGSGVI 79

Query: 72  IATAFIHLLQPAAEALTDDCLGGTFEDYPWAFGICLMSLFMLFLAEIVAHHFVDKKFNHS 131
           +ATAF+HLLQPA EALTD+CL GTF+ YPWAFGICLMSLF+LFL E+V+H+ + K F H+
Sbjct: 80  VATAFVHLLQPANEALTDECLTGTFQSYPWAFGICLMSLFLLFLMELVSHYLIAKTFGHA 139

Query: 132 -HAETDNANALPDIILKDIQISTDD-----LSEGMLNCAGHQDSLQDSKKIETGVSTNLK 185
            H  +D  N     + KD +   D+     L +G L    + +S  + + IE    T L 
Sbjct: 140 AHDHSDFGN----FVRKDSKELIDESDSESLHKGSLRFEVNSNSAPE-EDIEENPHTILG 194

Query: 186 RVDDSGF---EGQYEYKRESTDETWIDENTLTTGNSEHKFSADYVSKVFVLCVLEFGIIF 242
             D       +G Y++     D   +  + L   N E      Y +++  +  LEFGI+F
Sbjct: 195 NSDKMASMPGKGHYDHAVFHQDPAQLG-SPLEEPNKE-----KYANQIMAVLFLEFGILF 248

Query: 243 HSVFVGLSLAVAGSEFKVLFIVITFHQMFEGLGLGTRIAETEWPPSKWYTPWIMAFAFTI 302
           HSVF+GLSLAVAG EFK LFIV+ FHQMFEGLGLGTRIAET+WP ++  TPW++A  FT+
Sbjct: 249 HSVFIGLSLAVAGDEFKTLFIVLVFHQMFEGLGLGTRIAETKWPENRRLTPWMLALGFTL 308

Query: 303 TSPIAIAIGIGVRHSWVPGSRKALIANGVFDSISSGILIYTGLIELMAHEFIFSNQFKGE 362
           T+P+AIAIG+GVRHS++PGSRKAL++NGVFDSISSGILIYTGL+ELMAHEF++SNQF G 
Sbjct: 309 TTPVAIAIGLGVRHSFIPGSRKALVSNGVFDSISSGILIYTGLVELMAHEFLYSNQFNGA 368

Query: 363 HSLRNMLTAYFIMCCGAALMALLGRWA 389
              + M+ AY IMC G  LMALLG+WA
Sbjct: 369 DGFKKMILAYVIMCFGVGLMALLGKWA 395

>Ecym_4202 Chr4 (419650..420777) [1128 bp, 375 aa] {ON} similar to
           Ashbya gossypii AGL143C
          Length = 375

 Score =  368 bits (944), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 183/383 (47%), Positives = 251/383 (65%), Gaps = 35/383 (9%)

Query: 8   RSVDTCSTENDYNGEQNLRILAVFIVMISSGLGAYFPILSSQYSFIRLPNWCFFVAKFFG 67
             V  C   N Y+G+ +LR++A+F+++I+S +G  FP+LS+ YS IRLP++CFF AK+FG
Sbjct: 27  EEVPQCEVGNSYDGQDHLRVVAIFVILITSAIGTIFPLLSTNYSRIRLPSYCFFFAKYFG 86

Query: 68  SGVIIATAFIHLLQPAAEALTDDCLGGTFEDYPWAFGICLMSLFMLFLAEIVAHHFVDKK 127
           SGVI+AT FIHLLQPA E L+++CLGG F  YPWAF IC+M+LF LF  EI  HHFV K 
Sbjct: 87  SGVIVATGFIHLLQPANENLSNECLGGVFAQYPWAFAICMMALFSLFFVEINTHHFVHK- 145

Query: 128 FNHSHAETDNANALPDIILKDIQISTDDLSEGMLNCAGHQDSLQDSKKIETGVSTNLKRV 187
              S+   +N N           +S   L +        +DS  DSK  +   S      
Sbjct: 146 ---SNRLAENGN-----------VSGKSLKD--------EDSQLDSKAADAPTSV----- 178

Query: 188 DDSGFEGQYEYKRESTDETWIDENTLTTGNSEHKFSADYVSKVFVLCVLEFGIIFHSVFV 247
              G  G   +  +   +     N L T  ++ ++S   +S    L +LEFG++FHS+ +
Sbjct: 179 --LGPPGNKHFSHDEYHQDIEQANGLATNPNKEQYSNQLIS----LFILEFGVVFHSILI 232

Query: 248 GLSLAVAGSE-FKVLFIVITFHQMFEGLGLGTRIAETEWPPSKWYTPWIMAFAFTITSPI 306
           GL+LAV+ SE F  LF+V+ FHQMFEGLGLGTRIAE  W   K  TPW++AF +++ +P+
Sbjct: 233 GLALAVSSSEEFVTLFVVLIFHQMFEGLGLGTRIAEASWGSGKSLTPWLLAFGYSLATPL 292

Query: 307 AIAIGIGVRHSWVPGSRKALIANGVFDSISSGILIYTGLIELMAHEFIFSNQFKGEHSLR 366
           AIA+G+G++HS+ P SR++LI NG+FD+IS+G+LIYTGLIELMAHEF+FSN FKGE+   
Sbjct: 293 AIAVGLGIKHSFAPESRQSLIVNGIFDAISAGVLIYTGLIELMAHEFLFSNSFKGENGYT 352

Query: 367 NMLTAYFIMCCGAALMALLGRWA 389
            M+  + IMC GA  M+LLGRWA
Sbjct: 353 KMMYGFIIMCFGAGSMSLLGRWA 375

>Kpol_1006.10 s1006 complement(43032..44207) [1176 bp, 391 aa] {ON}
           complement(43032..44207) [1176 nt, 392 aa]
          Length = 391

 Score =  367 bits (941), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 185/395 (46%), Positives = 255/395 (64%), Gaps = 37/395 (9%)

Query: 10  VDTCSTENDYNGEQNLRILAVFIVMISSGLGAYFPILSSQYSFIRLPNWCFFVAKFFGSG 69
           V  C+  N+YNG+ NLRIL+VF+++ISS +G++ P++ S      +P+W FF+AKFFGSG
Sbjct: 19  VPVCAANNEYNGDLNLRILSVFMILISSAIGSFAPLILSNTKMFNVPSWFFFIAKFFGSG 78

Query: 70  VIIATAFIHLLQPAAEALTDDCLGGTFEDYPWAFGICLMSLFMLFLAEIVAHHFVDKKFN 129
           VIIAT+FIHLL PA +AL++DCLG  F DYPW+F I L+SLF+LF  E++ +H++ K   
Sbjct: 79  VIIATSFIHLLSPATDALSNDCLGPGFTDYPWSFAIALISLFVLFFVELIVYHYMSKADR 138

Query: 130 ---------------HSHAETDNANALPDIILKDIQISTDDLSEGMLNCAGHQDSLQDSK 174
                          +SH  TD+ + L     K+I+   +D+    +N         +  
Sbjct: 139 LLQSPDVHYHKHSSMNSHGCTDDQSDLASKKSKNIEKVNEDIESCNIN--------DNQD 190

Query: 175 KIETGVSTNLKRVDDSGFEGQYEYKRESTDETWIDENTLTTGNSEHKFSADYVSKVFVLC 234
           +I T  +  L +         + +K    D    + +     N++  F    V+ +F   
Sbjct: 191 EINTNFNPMLGK-------DHFSHKDTHQDR---NPSNPPLNNTDEGFYNQLVAVLF--- 237

Query: 235 VLEFGIIFHSVFVGLSLAVAGSEFKVLFIVITFHQMFEGLGLGTRIAETEWPPSKWYTPW 294
             E GI+FHSVF+GLSLAVAGSEFK LF+V+ FHQMFE LGLG R+ E EW   K + PW
Sbjct: 238 -FESGIVFHSVFIGLSLAVAGSEFKTLFVVLVFHQMFEALGLGARLVEVEWKKDKRWMPW 296

Query: 295 IMAFAFTITSPIAIAIGIGVRHSWVPGSRKALIANGVFDSISSGILIYTGLIELMAHEFI 354
           ++A  F++ +PIAIAIGIGVR+SW P S+ ALI NG+FDSIS+GILIYTGL+EL+AHEF+
Sbjct: 297 LLALGFSLCTPIAIAIGIGVRNSWTPESKGALITNGIFDSISAGILIYTGLVELIAHEFL 356

Query: 355 FSNQFKGEHSLRNMLTAYFIMCCGAALMALLGRWA 389
           FSNQFK  +  + M+ AYF+MC GA LMALLG+WA
Sbjct: 357 FSNQFKNPNGFKQMMLAYFVMCIGAGLMALLGKWA 391

>AGL143C Chr7 complement(431959..433083) [1125 bp, 374 aa] {ON}
           Non-syntenic homolog of Saccharomyces cerevisiae YLR130C
           (ZRT2) and YGL255W (ZRT1)
          Length = 374

 Score =  349 bits (895), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 181/389 (46%), Positives = 245/389 (62%), Gaps = 32/389 (8%)

Query: 2   HNELLGRSVDTCSTENDYNGEQNLRILAVFIVMISSGLGAYFPILSSQYSFIRLPNWCFF 61
           H+       + C TEN+Y+G   +RIL+VFI++++S +G +FP+L S++S +RLP W FF
Sbjct: 17  HSHSHSEEPEECPTENEYDGSDGIRILSVFIILLASAIGTFFPMLGSRFSRVRLPTWAFF 76

Query: 62  VAKFFGSGVIIATAFIHLLQPAAEALTDDCLGGTFEDYPWAFGICLMSLFMLFLAEIVAH 121
            AK+FGSGVI+AT FIHLL    E+L++ CLGG   +YPWAF IC+MSLF LF  EI +H
Sbjct: 77  FAKYFGSGVIVATGFIHLLLHGHESLSNPCLGGVLSEYPWAFAICMMSLFTLFFVEINSH 136

Query: 122 HFVDKKFNHSHAETDNANALPDIILKDIQISTDDLSEGMLNCAGHQDSLQDSKKIETGVS 181
           HFV+K      A    A A+      +  I  D+ +E                K  T VS
Sbjct: 137 HFVNK------AARSTAVAVAG---DEKSIKEDESTE------------DTPPKPNTAVS 175

Query: 182 TNLKRVDDSGFEGQYEYKRESTDETWIDENTLTTGNSEHKFSADYVSKVFVLCVLEFGII 241
                  +S    Q+    E   +    ++     N E      Y++++  L +LEFG++
Sbjct: 176 GA-----NSAVVSQHFAHDECHQDLEQAKSLAADPNRE-----QYLNQLISLFILEFGVV 225

Query: 242 FHSVFVGLSLAV-AGSEFKVLFIVITFHQMFEGLGLGTRIAETEWPPSKWYTPWIMAFAF 300
           FHSV +GLSLAV A   F  LF+V+ FHQMFEG+GLG RIAETEW   + +TPW++   +
Sbjct: 226 FHSVLIGLSLAVTAEDHFTTLFVVLIFHQMFEGMGLGARIAETEWGVHRKWTPWLLGLGY 285

Query: 301 TITSPIAIAIGIGVRHSWVPGSRKALIANGVFDSISSGILIYTGLIELMAHEFIFSNQFK 360
            +++PIAIAIG+GVRHS+ P SR +LI NGVFDS+S+GI++YTGLIELMAHEF+FSN FK
Sbjct: 286 CLSTPIAIAIGLGVRHSFAPESRPSLIVNGVFDSLSAGIMLYTGLIELMAHEFLFSNSFK 345

Query: 361 GEHSLRNMLTAYFIMCCGAALMALLGRWA 389
           GE     M+  +  MC GA LMALLG+WA
Sbjct: 346 GEGGFNKMMQGFVYMCLGAGLMALLGKWA 374

>SAKL0F16346g Chr6 complement(1331198..1332337) [1140 bp, 379 aa]
           {ON} similar to uniprot|Q12436 Saccharomyces cerevisiae
           YLR130C ZRT2 Low-affinity zinc transporter of the plasma
           membrane transcription is induced under low-zinc
           conditions by the Zap1p transcription factor
          Length = 379

 Score =  342 bits (878), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 184/394 (46%), Positives = 253/394 (64%), Gaps = 41/394 (10%)

Query: 2   HNELLGRSVD----TCSTENDYNGEQNLRILAVFIVMISSGLGAYFPILSSQYSFIRLPN 57
           H+   G S D     C   + YNG   +RILAVFI++ISS +G++ P+L S+YSFIRLP+
Sbjct: 21  HSHSHGTSTDGDSSACPGGSGYNGNDGIRILAVFILLISSAIGSFSPLLGSKYSFIRLPD 80

Query: 58  WCFFVAKFFGSGVIIATAFIHLLQPAAEALTDDCLGGTFEDYPWAFGICLMSLFMLFLAE 117
           W FF+AK+FGSGVIIAT FIHLL  ++ +L ++CLG  F  YPWA+ ICL S+F +F  E
Sbjct: 81  WFFFIAKYFGSGVIIATGFIHLLFHSSHSLGEECLGDGFTSYPWAYLICLASIFTVFFVE 140

Query: 118 IVAHHFVDKKFNHSHAETDNANALPDIILKDIQISTDDLSEGMLNCAGHQDSLQDSKKIE 177
           ++AH    K      A +D+A+               DL     N    ++  ++S  + 
Sbjct: 141 LLAHRLFIK------ASSDSAS---------------DLEFAESNNTSEENYPKNSAVM- 178

Query: 178 TGVSTNLKRVDDSG--FEGQYEYKRESTDETWIDENTLTTGNSEHKFSADYVSKVFVLCV 235
             VS +  + DD+    +     K E ++ +   EN        +K +  + +++  + V
Sbjct: 179 --VSKSETQQDDTSSVLDNGLPLKDEQSESS---EN--------YKNNGSHSTQLIAIFV 225

Query: 236 LEFGIIFHSVFVGLSLAVAGSEFKVLFIVITFHQMFEGLGLGTRIAETEWPPSKWYTPWI 295
           LEFG++FHSVFVGLSLAVAG EF  LFIV+ FHQMFEGLGLG RIAET WP  + +TPW+
Sbjct: 226 LEFGVLFHSVFVGLSLAVAGDEFNTLFIVLIFHQMFEGLGLGARIAETNWPHKRRFTPWM 285

Query: 296 MAFAFTITSPIAIAIGIGVRHSWVPGSRKALIANGVFDSISSGILIYTGLIELMAHEFIF 355
           +A AF + +PI+IAIGIGV+ S+ P S ++LI  GVFD+IS+GILIY G++ELMAHEF  
Sbjct: 286 LALAFAVCTPISIAIGIGVKKSYAPYSSRSLIFTGVFDAISAGILIYAGIVELMAHEFFH 345

Query: 356 SNQFKGEHSLRNMLTAYFIMCCGAALMALLGRWA 389
              F+G   L++ML A+FIMC GA LM+LLG+WA
Sbjct: 346 ETTFQGPGKLKSMLWAFFIMCLGAGLMSLLGKWA 379

>Suva_7.6 Chr7 (15340..16458) [1119 bp, 372 aa] {ON} YGL255W (REAL)
          Length = 372

 Score =  241 bits (615), Expect = 7e-76,   Method: Compositional matrix adjust.
 Identities = 141/380 (37%), Positives = 215/380 (56%), Gaps = 53/380 (13%)

Query: 16  ENDYNGEQNLRILAVFIVMISSGLGAYFPILSSQYSFIRLPNWCFFVAKFFGSGVIIATA 75
           EN+YNG    RI ++F++ + S     FP++S +    ++P + +  AK+FGSGVI+ATA
Sbjct: 40  ENEYNGNLGARISSIFVIFVVSTFFTLFPLISLRVKRFKIPLYAYLFAKYFGSGVIVATA 99

Query: 76  FIHLLQPAAEALT-DDCLG--GTFEDYPWAFGICLMSLFMLFLAEIVAHHFVDKKFNHSH 132
           FIHL+ PA  A+  + C+G  G +  Y W   I L SLF  FL ++ +  +V++K+  +H
Sbjct: 100 FIHLVDPAYSAIGGNSCVGQTGDWSLYAWCPAIMLTSLFFTFLTDLFSSVWVERKYGVAH 159

Query: 133 AETDNANALPDIILKDIQISTDDLSEGMLNCAGHQDSLQDSKKIETGVSTNLKRVDDSGF 192
             T +   + D ++ D   ++D+   G  N      S  D  K+E               
Sbjct: 160 DHTHDT--IKDTVVNDAANTSDE--NGTAN-----RSYDDKNKVE--------------- 195

Query: 193 EGQYEYKRESTDETWIDENTLTTGNSEHKFSADYVSKVFVLCVLEFGIIFHSVFVGLSLA 252
                Y  ES      D +TL T  S       + S+ +   +LEFG+IFHSV +GL+L 
Sbjct: 196 -----YFEES------DASTLDTVQS-------FQSQFYAFLILEFGVIFHSVMIGLNLG 237

Query: 253 VAGSEFKVLFIVITFHQMFEGLGLGTRIAETEWPPSKWYTPWIMAFAFTITSPIAIAIGI 312
             G EF  L+ V+ FHQ FEGLG+G R++  E+P SK + PW +  A+ +T+PI +AIG+
Sbjct: 238 STGEEFATLYPVLVFHQSFEGLGMGARLSGIEFPKSKRWWPWALCIAYGLTTPICVAIGL 297

Query: 313 GVRHSWVPGSRKALIANGVFDSISSGILIYTGLIELMAHEFIFSNQFKGEHSLRNMLTAY 372
           G+R  +V GS  A + +GV D+IS+GILIYTGL+EL+A +F+F+      H  ++M    
Sbjct: 298 GIRTKYVSGSYTASVVSGVLDAISAGILIYTGLVELLARDFLFN-----PHRTKDMKELS 352

Query: 373 FIMCC---GAALMALLGRWA 389
           F + C   GA +MAL+G+WA
Sbjct: 353 FNVLCTLFGAGIMALIGKWA 372

>Smik_7.6 Chr7 (15678..16796) [1119 bp, 372 aa] {ON} YGL255W (REAL)
          Length = 372

 Score =  235 bits (600), Expect = 9e-74,   Method: Compositional matrix adjust.
 Identities = 142/380 (37%), Positives = 219/380 (57%), Gaps = 53/380 (13%)

Query: 16  ENDYNGEQNLRILAVFIVMISSGLGAYFPILSSQYSFIRLPNWCFFVAKFFGSGVIIATA 75
           EN+YNG    RI +VF+++  S     FP++S++   +++P + +  A++FGSGVI+ATA
Sbjct: 40  ENEYNGNLGARISSVFVILFVSTFFTMFPLISTKVKKLKIPLYAYLFARYFGSGVIVATA 99

Query: 76  FIHLLQPAAEALT-DDCLG--GTFEDYPWAFGICLMSLFMLFLAEIVAHHFVDKKFNHSH 132
           FIHL+ PA  A+  + C+G  G +  Y W   I L SL + FL ++ +  +V+KK+  SH
Sbjct: 100 FIHLMDPAYGAIGGNTCVGQTGNWGIYAWCPAIMLTSLTITFLTDLFSSVWVEKKYGLSH 159

Query: 133 AETDNANALPDIILKDIQISTDDLSEGMLNCAGHQDSLQDSKKIETGVSTNLKRVDDSGF 192
             T +   + D ++ +  +S+ +      NC  +     DSK    GV            
Sbjct: 160 DHTHDD--VKDTVVNNEVVSSPE------NCTANGS--HDSKN---GV------------ 194

Query: 193 EGQYEYKRESTDETWIDENTLTTGNSEHKFSADYVSKVFVLCVLEFGIIFHSVFVGLSLA 252
               EY  ES      D ++L    S       + ++ +   +LEFG+IFHSV +GL+L 
Sbjct: 195 ----EYFEES------DVSSLDVVQS-------FQAQFYAFLILEFGVIFHSVMIGLNLG 237

Query: 253 VAGSEFKVLFIVITFHQMFEGLGLGTRIAETEWPPSKWYTPWIMAFAFTITSPIAIAIGI 312
             G EF  L+ V+ FHQ FEGLG+G R++  E+P SK + PW +  A+ +T+PI +AIG+
Sbjct: 238 STGEEFATLYPVLVFHQSFEGLGIGARLSAIEFPRSKRWWPWALCIAYGLTTPICVAIGL 297

Query: 313 GVRHSWVPGSRKALIANGVFDSISSGILIYTGLIELMAHEFIFSNQFKGEHSLRNMLTAY 372
           GVR  +V GS  AL+ +GV D+IS+GIL+YTGL+EL+A +FIF+ Q       +N+    
Sbjct: 298 GVRTRYVSGSYTALVISGVLDAISAGILLYTGLVELLARDFIFNPQ-----RTKNLKELS 352

Query: 373 FIMCC---GAALMALLGRWA 389
           F + C   GA +MAL+G+WA
Sbjct: 353 FNVICTLFGAGIMALIGKWA 372

>YGL255W Chr7 (20978..22108) [1131 bp, 376 aa] {ON}
           ZRT1High-affinity zinc transporter of the plasma
           membrane, responsible for the majority of zinc uptake;
           transcription is induced under low-zinc conditions by
           the Zap1p transcription factor
          Length = 376

 Score =  233 bits (593), Expect = 1e-72,   Method: Compositional matrix adjust.
 Identities = 138/380 (36%), Positives = 215/380 (56%), Gaps = 51/380 (13%)

Query: 17  NDYNGEQNLRILAVFIVMISSGLGAYFPILSSQYSFIRLPNWCFFVAKFFGSGVIIATAF 76
           N+YNG    RI +VF+++  S     FP++S++   +R+P + +  AK+FGSGVI+ATAF
Sbjct: 41  NEYNGNLGARISSVFVILFVSTFFTMFPLISTKVKRLRIPLYVYLFAKYFGSGVIVATAF 100

Query: 77  IHLLQPAAEALT-DDCLG--GTFEDYPWAFGICLMSLFMLFLAEIVAHHFVDKKFNHSHA 133
           IHL+ PA  A+    C+G  G +  Y W   I L SL   FL ++ +  +V++K+  SH 
Sbjct: 101 IHLMDPAYGAIGGTTCVGQTGNWGLYSWCPAIMLTSLTFTFLTDLFSSVWVERKYGLSHD 160

Query: 134 ETDNANALPDIILKDIQI--STDDLSEGMLNCAGHQDSLQDSKKIETGVSTNLKRVDDSG 191
            T +   + D ++++     S +D   G  N  G  D+    +  E   +T++  V    
Sbjct: 161 HTHDE--IKDTVVRNTAAVSSENDNENGTAN--GSHDTKNGVEYYEDSDATSMDVVQS-- 214

Query: 192 FEGQYEYKRESTDETWIDENTLTTGNSEHKFSADYVSKVFVLCVLEFGIIFHSVFVGLSL 251
           F+ Q+                                  +   +LEFG+IFHSV +GL+L
Sbjct: 215 FQAQF----------------------------------YAFLILEFGVIFHSVMIGLNL 240

Query: 252 AVAGSEFKVLFIVITFHQMFEGLGLGTRIAETEWPPSKWYTPWIMAFAFTITSPIAIAIG 311
              G EF  L+ V+ FHQ FEGLG+G R++  E+P SK + PW +  A+ +T+PI +AIG
Sbjct: 241 GSVGDEFSSLYPVLVFHQSFEGLGIGARLSAIEFPRSKRWWPWALCVAYGLTTPICVAIG 300

Query: 312 IGVRHSWVPGSRKALIANGVFDSISSGILIYTGLIELMAHEFIFSNQFKGEHSLRNMLTA 371
           +GVR  +V GS  AL+ +GV D+IS+GIL+YTGL+EL+A +FIF+ Q   +  LR +  +
Sbjct: 301 LGVRTRYVSGSYTALVISGVLDAISAGILLYTGLVELLARDFIFNPQRTKD--LREL--S 356

Query: 372 YFIMCC--GAALMALLGRWA 389
           + ++C   GA +MAL+G+WA
Sbjct: 357 FNVICTLFGAGIMALIGKWA 376

>ZYRO0F02200g Chr6 (178997..180142) [1146 bp, 381 aa] {ON} similar
           to uniprot|P32804 Saccharomyces cerevisiae YGL255W ZRT1
           High-affinity zinc transporter of the plasma membrane
           responsible for the majority of zinc uptake
           transcription is induced under low-zinc conditions by
           the Zap1p transcription factor
          Length = 381

 Score =  230 bits (586), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 131/377 (34%), Positives = 219/377 (58%), Gaps = 41/377 (10%)

Query: 16  ENDYNGEQNLRILAVFIVMISSGLGAYFPILSSQYSFIRLPNWCFFVAKFFGSGVIIATA 75
           EN+YNG    RI ++F+++++S     FP+++ + S++R+  + +  A+ FG+GVI+ATA
Sbjct: 43  ENEYNGNLGARISSIFVILVTSSALTLFPLIAKKVSWLRVHKYVYLFARSFGTGVILATA 102

Query: 76  FIHLLQPAAEALTD-DCLG--GTFEDYPWAFGICLMSLFMLFLAEIVAHHFVDKKFNHSH 132
           FIHL+ PA + +    C+   G +  Y W   I L +++  FL ++    +V++K+  +H
Sbjct: 103 FIHLMDPAYQEIGGFSCVAQVGNWSLYSWCPAIMLTTVYFTFLVDLFGGVYVERKYGIAH 162

Query: 133 AETDNANALPDIILKDIQISTDDLSEGMLNCAGHQDSLQDSKKIETGVSTNLKRVDDSGF 192
           +E D+ +A+  +I   +                H DS   +   ET        VDDS  
Sbjct: 163 SE-DHDHAMDAVIAPHV----------------HDDSHLHNMNKET--------VDDSSL 197

Query: 193 EGQYEYKRESTDETWIDENTLTTGNSEHKFSADYVSKVFVLCVLEFGIIFHSVFVGLSLA 252
                 K++S     +D +  ++ ++  K    + S+     VLEFG++FHSV +GL+L 
Sbjct: 198 S-----KKDS-----VDVSVRSSQDTLEKV-ISFKSEFSAFLVLEFGVLFHSVMIGLNLG 246

Query: 253 VAGSEFKVLFIVITFHQMFEGLGLGTRIAETEWPPSKWYTPWIMAFAFTITSPIAIAIGI 312
             G EF  L+ V+ FHQ FEGLG+G R++  ++P +K + P+++  A+ +T+PIAIAIG+
Sbjct: 247 TTGDEFSTLYPVLVFHQAFEGLGIGARLSAIDFPHNKRWWPYVLCMAYGLTTPIAIAIGL 306

Query: 313 GVRHSWVPGSRKALIANGVFDSISSGILIYTGLIELMAHEFIFSNQFKGEHSLRNMLTAY 372
           GVR S+   S    + +GV D+IS+GIL+YTGL+EL+A +F+F+ Q     +LR ++   
Sbjct: 307 GVRKSYQSNSYAVNVVSGVLDAISAGILLYTGLVELLARDFLFNRQ--RAKTLRELIFNL 364

Query: 373 FIMCCGAALMALLGRWA 389
           F +  G  LMALLG+WA
Sbjct: 365 FCLSWGVGLMALLGKWA 381

>Skud_7.12 Chr7 (25081..26199) [1119 bp, 372 aa] {ON} YGL255W (REAL)
          Length = 372

 Score =  229 bits (585), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 135/379 (35%), Positives = 211/379 (55%), Gaps = 53/379 (13%)

Query: 17  NDYNGEQNLRILAVFIVMISSGLGAYFPILSSQYSFIRLPNWCFFVAKFFGSGVIIATAF 76
           N+YNG    RI +VF+++  S     FP++S +   +R+P + +  AK+FGSGVI+ATAF
Sbjct: 41  NEYNGNLGARISSVFVILFVSTFFTMFPLISKKVKKLRIPLYAYLFAKYFGSGVILATAF 100

Query: 77  IHLLQPAAEALT-DDCLG--GTFEDYPWAFGICLMSLFMLFLAEIVAHHFVDKKFNHSHA 133
           IHL+ PA  A+  + C+G  G +  Y W   I L SL   FL ++ +  +V++K+  SH 
Sbjct: 101 IHLMDPAYGAIGGNTCVGQTGNWGIYSWCPAIMLTSLTFTFLTDLFSSVWVERKYGVSHD 160

Query: 134 ETDNANALPDIILKDIQISTDDLSEGMLNCAGHQDSLQDSKKIETGVSTNLKRVDDSGFE 193
            T +   + D ++ D  +           C+    +   S + + GV             
Sbjct: 161 HTHDE--IKDTVVNDAAV-----------CSTEHGTASGSHESKNGV------------- 194

Query: 194 GQYEYKRESTDETWIDENTLTTGNSEHKFSADYVSKVFVLCVLEFGIIFHSVFVGLSLAV 253
              EY  ES      D +++    S       + ++ +   +LEFG+IFHSV +GL+L  
Sbjct: 195 ---EYFEES------DASSMDVVQS-------FQAQFYAFLILEFGVIFHSVMIGLNLGS 238

Query: 254 AGSEFKVLFIVITFHQMFEGLGLGTRIAETEWPPSKWYTPWIMAFAFTITSPIAIAIGIG 313
            G EF  L+ V+ FHQ FEGLG+G R++  E+P SK + PW +  A+ +T+PI +AIG+G
Sbjct: 239 VGEEFSTLYPVLVFHQSFEGLGIGARLSAIEFPRSKRWWPWALCVAYGLTTPICVAIGLG 298

Query: 314 VRHSWVPGSRKALIANGVFDSISSGILIYTGLIELMAHEFIFSNQFKGEHSLRNMLTAYF 373
           VR  +  GS  AL+ +G+ D+IS+GIL+YTGL+EL+A +FIF+         +N+    F
Sbjct: 299 VRTRYNSGSYTALVVSGILDAISAGILLYTGLVELLARDFIFN-----PDRTKNLKELSF 353

Query: 374 IMCC---GAALMALLGRWA 389
            + C   GA +MAL+G+WA
Sbjct: 354 NVLCTLFGAGIMALIGKWA 372

>Kwal_14.824 s14 complement(65415..66539) [1125 bp, 374 aa] {ON}
           YGL255W (ZRT1) - high-affinity zinc transport protein
           [contig 245] FULL
          Length = 374

 Score =  222 bits (565), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 128/365 (35%), Positives = 205/365 (56%), Gaps = 48/365 (13%)

Query: 3   NELLGRSVDTCST------ENDYNGEQNLRILAVFIVMISSGLGAYFPILSSQYSFIRLP 56
           +E +  +  TC+       EN+YNG    RI ++F++   S L   FP+++++   IR+P
Sbjct: 20  DESVSEAWKTCTIAGVYFGENEYNGSMGARISSIFVIFFVSTLFTLFPVVAARVKSIRIP 79

Query: 57  NWCFFVAKFFGSGVIIATAFIHLLQPA-AEALTDDCLG--GTFEDYPWAFGICLMSLFML 113
            + +  A++FG+GVI+ATAFIHLL PA  E   D C+G  G + DY W   I L+++F++
Sbjct: 80  KYVYLFARYFGTGVIVATAFIHLLDPAYGEIGGDSCVGKTGHWADYSWCPAIVLLTIFII 139

Query: 114 FLAEIVAHHFVDKKFNHSHAETDNANALPDIILKDIQISTDDLSEGMLNCAGHQDSLQDS 173
           FL ++ +  +V ++F  +H   ++ + + D ++K    + +DL     N   H DS   S
Sbjct: 140 FLVDLASDVYVKRRFGVAH---NHGDVIEDAVVKRQGDAHEDLESH--NNHMHADSDDKS 194

Query: 174 KKIETGVSTNLKRVDDSGFEGQYEYKRESTDETWIDENTLTTGNSEHKFSADYVSKVFVL 233
           KK                    Y+   +++ E       + T + E +F+A         
Sbjct: 195 KK-------------------SYDVISDASSE-------IATESFESQFAA--------F 220

Query: 234 CVLEFGIIFHSVFVGLSLAVAGSEFKVLFIVITFHQMFEGLGLGTRIAETEWPPSKWYTP 293
            +LEFG+IFHSV +GL+L   G EF VL+ V+ FHQ FEGLG+G R++   +P  K + P
Sbjct: 221 LILEFGVIFHSVMIGLNLGTVGDEFSVLYPVLVFHQSFEGLGIGARLSSIAFPKGKAWWP 280

Query: 294 WIMAFAFTITSPIAIAIGIGVRHSWVPGSRKALIANGVFDSISSGILIYTGLIELMAHEF 353
           + +   + + +PI +AIG+GVR S+   S    I +GV D+IS+GILIYTGL+EL+A +F
Sbjct: 281 YALCITYGLATPICVAIGLGVRTSYNGNSFTVNIVSGVLDAISAGILIYTGLVELLARDF 340

Query: 354 IFSNQ 358
           IF  +
Sbjct: 341 IFDEK 345

>KLTH0C00374g Chr3 complement(32017..33147) [1131 bp, 376 aa] {ON}
           similar to uniprot|P32804 Saccharomyces cerevisiae
           YGL255W ZRT1 High-affinity zinc transporter of the
           plasma membrane responsible for the majority of zinc
           uptake transcription is induced under low-zinc
           conditions by the Zap1p transcription factor
          Length = 376

 Score =  220 bits (561), Expect = 8e-68,   Method: Compositional matrix adjust.
 Identities = 125/379 (32%), Positives = 205/379 (54%), Gaps = 48/379 (12%)

Query: 17  NDYNGEQNLRILAVFIVMISSGLGAYFPILSSQYSFIRLPNWCFFVAKFFGSGVIIATAF 76
           N Y+G    RI ++F+++  S     FP+++++   +++P + +  A++FG+GVI+ATAF
Sbjct: 40  NSYSGSLGARISSIFVILFMSTFFTLFPVIAARSKRLKVPKYVYLFARYFGTGVIVATAF 99

Query: 77  IHLLQPA-AEALTDDCLG--GTFEDYPWAFGICLMSLFMLFLAEIVAHHFVDKKFNHSHA 133
           IHLL PA  E     C+G  G +  Y +   I L ++F +F+ ++ +  +V ++F  +H 
Sbjct: 100 IHLLDPAYGEIGPQSCVGMSGNWSKYSFCPAIILFTVFSIFIVDLASDVYVKRRFGITHG 159

Query: 134 ETDNANALPDIILKDIQISTDDLSEGMLNCAGHQDSLQDSKKIETGVSTNLKRVDDSGFE 193
             D    + + I+K  + + +++     N     DS   SKK    VS     +    FE
Sbjct: 160 HGDE---IENAIVKRQEATNNNVDIESHNLGHSADSDDKSKKSYDVVSNASTEIVTQSFE 216

Query: 194 GQYEYKRESTDETWIDENTLTTGNSEHKFSADYVSKVFVLCVLEFGIIFHSVFVGLSLAV 253
                                             S++    +LEFG+IFHSV +GL+L  
Sbjct: 217 ----------------------------------SQIGAFLILEFGVIFHSVMIGLNLGT 242

Query: 254 AGSEFKVLFIVITFHQMFEGLGLGTRIAETEWPPSKWYTPWIMAFAFTITSPIAIAIGIG 313
              EF  L+ V+ FHQ FEGLG+G R++  E+P +KW+ P+ +  A+ +T+PI +AIG+G
Sbjct: 243 TDDEFSTLYPVLVFHQSFEGLGIGARLSAIEFPKNKWWWPYALCVAYGLTTPICVAIGLG 302

Query: 314 VRHSWVPGSRKALIANGVFDSISSGILIYTGLIELMAHEFIFSNQFKGEHSLRNMLTAYF 373
           VR ++   S    + +GV D+IS+GIL+YTGL+EL+A +FIF      E+   ++    F
Sbjct: 303 VRTTYDGNSYTVNVVSGVLDAISAGILMYTGLVELLARDFIFD-----ENRTNDISKLLF 357

Query: 374 IMCC---GAALMALLGRWA 389
           ++ C   GA LMALLG+WA
Sbjct: 358 MVNCTLWGAGLMALLGKWA 376

>KLTH0A07722g Chr1 (650427..651605) [1179 bp, 392 aa] {ON} similar
           to uniprot|P32804 Saccharomyces cerevisiae YGL255W ZRT1
           High-affinity zinc transporter of the plasma membrane
           responsible for the majority of zinc uptake
           transcription is induced under low-zinc conditions by
           the Zap1p transcription factor
          Length = 392

 Score =  220 bits (560), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 134/377 (35%), Positives = 209/377 (55%), Gaps = 49/377 (12%)

Query: 17  NDYNGEQNLRILAVFIVMISSGLGAYFPILSSQYSFIRLPNWCFFVAKFFGSGVIIATAF 76
           ++Y G  N RI ++F+++  S      P++ ++   I++P  C+  A++FG+GVIIATAF
Sbjct: 61  SEYQGSLNARISSIFVILFVSTSFTLLPVIFTKVKGIKVPKACYLFARYFGTGVIIATAF 120

Query: 77  IHLLQPAAEAL-TDDCLG--GTFEDYPWAFGICLMSLFMLFLAEIVAHHFVDKKFNHSHA 133
           IHL++ +  ++ ++ C+G  G + DY W  GI L ++F++FL ++++  ++++KF     
Sbjct: 121 IHLMEHSYMSIGSNSCVGSSGRWADYSWCSGIVLTTVFVVFLVDLLSEVYIERKFG---- 176

Query: 134 ETDNANALPDIILKDIQISTDDLSEGMLNCAGHQDSLQDSKKIETGVSTNLKRVDDSGFE 193
                          I  S  DL EG ++    +    D+   ETG S  +   DD  ++
Sbjct: 177 ---------------ISCSHGDLVEGAISDNNPRLKENDA---ETG-SPVISNKDDVSYD 217

Query: 194 GQYEYKRESTDETWIDENTLTTGNSEHKFSADYVSKVFVLCVLEFGIIFHSVFVGLSLAV 253
                              + +G +       + S++    V+EFGIIFHSV +GL L  
Sbjct: 218 -------------------VVSGVNSEIAVKPFESQIGAFLVMEFGIIFHSVMIGLELGT 258

Query: 254 AGSEFKVLFIVITFHQMFEGLGLGTRIAETEWPPSKWYTPWIMAFAFTITSPIAIAIGIG 313
            G EF +L+ VI FHQ FEGLG+G R+    +P  K + P+ +   +  T+PIAIAIG+G
Sbjct: 259 TGEEFSILYPVIVFHQSFEGLGIGARLISIAFPEGKKWWPYALCILYGATTPIAIAIGLG 318

Query: 314 VRHSWVPGSRKALIANGVFDSISSGILIYTGLIELMAHEFIFS-NQFKGEHSLRNMLTAY 372
           VR S+   S K  I +GV D+I++GILIYTGL+EL+A +F+F  N+ K    L  M+   
Sbjct: 319 VRMSYNAHSFKMSIISGVLDAIAAGILIYTGLVELLARDFMFDPNRTKNLKKLTFMIICT 378

Query: 373 FIMCCGAALMALLGRWA 389
           F    GA LMALLGRWA
Sbjct: 379 F---SGAGLMALLGRWA 392

>TDEL0D06550 Chr4 (1177932..1179077) [1146 bp, 381 aa] {ON} 
          Length = 381

 Score =  215 bits (547), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 126/398 (31%), Positives = 225/398 (56%), Gaps = 44/398 (11%)

Query: 1   MHNELLGRSVDTCST------ENDYNGEQNLRILAVFIVMISSGLGAYFPILSSQYSFIR 54
           +H++ +  +  TC        EN+YNG    RI ++F++++ S     +P+++ +  +++
Sbjct: 19  IHDDDVSDAWKTCVLQGVYFGENEYNGWMGARISSIFVILVLSTCCTLYPVVAKRVKWLK 78

Query: 55  LPNWCFFVAKFFGSGVIIATAFIHLLQPA-AEALTDDCLG--GTFEDYPWAFGICLMSLF 111
           +  W +  A+ FG GVIIATAFIHLL PA AE     C+G  G +  Y W   I L+++F
Sbjct: 79  INKWFYSFARNFGIGVIIATAFIHLLDPAYAEIGGLSCVGMTGNWSIYAWCPAIMLLTIF 138

Query: 112 MLFLAEIVAHHFVDKKFNHSHAETDNANALPDIILKDIQISTDDLSEGMLNCAGHQDSLQ 171
           + FL ++ +  +V+KK+  +H                 Q   D++ + +++ A   + +Q
Sbjct: 139 LTFLTDLFSAVYVEKKYGKTH-----------------QHDFDEIEQTIVSPA---EPVQ 178

Query: 172 DSKKIETGVSTNLKRVDDSGFEGQYEYKRESTDETWIDENTLTTGNSEHKFSADYVSKVF 231
           D ++ +          +D   +     K + + +T+ D +  +T  ++  F +++ +   
Sbjct: 179 DFERSQVE--------EDCDHDHHSNTKDKKSIDTFTDSDVDST-TADMSFKSEFAA--- 226

Query: 232 VLCVLEFGIIFHSVFVGLSLAVAGSEFKVLFIVITFHQMFEGLGLGTRIAETEWPPSKWY 291
              +LEFG++FHSV +GL+L   G EF  L+ V+ FHQ FEGLG+G R++  ++P +K +
Sbjct: 227 -FLILEFGVLFHSVMIGLNLGSVGEEFSTLYPVLVFHQSFEGLGIGARLSAIDFPQNKRW 285

Query: 292 TPWIMAFAFTITSPIAIAIGIGVRHSWVPGSRKALIANGVFDSISSGILIYTGLIELMAH 351
            P+ +  A+ +T+PI +AIG+GVR ++   S    + +GV D+IS+G+LIYTGL+E++A 
Sbjct: 286 WPYALCLAYGLTTPICVAIGLGVRTTYNGESYVVNVVSGVLDAISAGVLIYTGLVEMLAR 345

Query: 352 EFIFSNQFKGEHSLRNMLTAYFIMCCGAALMALLGRWA 389
           +++F+     +  LR +      M  GA LMALLG+WA
Sbjct: 346 DYLFNPHRTKD--LRLLSFNVMSMLWGAGLMALLGKWA 381

>Kwal_23.6522 s23 (1624044..1625213) [1170 bp, 389 aa] {ON} YGL255W
           (ZRT1) - high-affinity zinc transport protein [contig
           18] FULL
          Length = 389

 Score =  212 bits (539), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 128/377 (33%), Positives = 211/377 (55%), Gaps = 51/377 (13%)

Query: 17  NDYNGEQNLRILAVFIVMISSGLGAYFPILSSQYSFIRLPNWCFFVAKFFGSGVIIATAF 76
           ++Y G    RI ++F+++  S      PI+ ++   +++P +C+  A++FG+GVI++TAF
Sbjct: 60  SEYQGSLPARISSIFVLLFVSTSFTLLPIVLNKIKGVKVPRYCYLFARYFGTGVIVSTAF 119

Query: 77  IHLLQPAAEAL-TDDCLG--GTFEDYPWAFGICLMSLFMLFLAEIVAHHFVDKKFNHSHA 133
           IHL++ +  ++ ++ C+G  G + DY W   I ++++F++FL ++++  ++++K+  +  
Sbjct: 120 IHLMEHSYMSIGSNSCVGMTGHWADYTWCSCIVMVTVFVIFLVDLLSDVYIERKYGLTGG 179

Query: 134 ETDNANALPDIILKDIQISTDDLSEGMLNCAGHQDSLQDSKKIETGVSTNLKRVDDSGFE 193
             D+       + KD         E  + CA                S  + + DD+ F+
Sbjct: 180 HGDSIEEAITDVHKD---------ENDVECA----------------SGEMTKSDDASFD 214

Query: 194 GQYEYKRESTDETWIDENTLTTGNSEHKFSADYVSKVFVLCVLEFGIIFHSVFVGLSLAV 253
             +                 ++G+S   F     S++    VLEFGIIFHSV +GL L  
Sbjct: 215 TLF---------------CASSGSSIKSFE----SQIGAFFVLEFGIIFHSVMIGLELGT 255

Query: 254 AGSEFKVLFIVITFHQMFEGLGLGTRIAETEWPPSKWYTPWIMAFAFTITSPIAIAIGIG 313
            GSEF VL+ VI FHQ FEGLGLG R+   ++P  K + P+ +   + IT+PIA+AIG+G
Sbjct: 256 TGSEFSVLYPVIVFHQSFEGLGLGARLMSIKFPEGKKWWPYALCGLYGITTPIAVAIGLG 315

Query: 314 VRHSWVPGSRKALIANGVFDSISSGILIYTGLIELMAHEFIFS-NQFKGEHSLRNMLTAY 372
           VR ++   S    I +G+ D+IS+GILIYTGL+EL+A +FIF+ N+ K    L  M+   
Sbjct: 316 VRLTYNAHSFTMSIISGILDAISAGILIYTGLVELLAKDFIFNPNRTKDMTKLSLMI--- 372

Query: 373 FIMCCGAALMALLGRWA 389
           F    GA LMA LG+WA
Sbjct: 373 FATLSGAGLMAFLGKWA 389

>ZYRO0D17732g Chr4 complement(1471224..1472423) [1200 bp, 399 aa]
           {ON} similar to uniprot|P32804 Saccharomyces cerevisiae
           YGL255W ZRT1 High-affinity zinc transporter of the
           plasma membrane responsible for the majority of zinc
           uptake transcription is induced under low-zinc
           conditions by the Zap1p transcription factor
          Length = 399

 Score =  207 bits (527), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 126/375 (33%), Positives = 210/375 (56%), Gaps = 25/375 (6%)

Query: 20  NGEQNLRILAVFIVMISSGLGAYFPILSSQYSFIRLPNWCFFVAKFFGSGVIIATAFIHL 79
           NG    RI ++F++ I+S   + FP+++ +  ++R+  + +  A+ FG+GVI++T++IHL
Sbjct: 45  NGVTGARISSIFVIFITSTALSLFPVVAQKVPWLRIHRYVYQFARSFGTGVIVSTSYIHL 104

Query: 80  LQPAAEALTD-DCLG--GTFEDYPWAFGICLMSLFMLFLAEIVAHHFVDKKFNHSHAETD 136
           + PA + +    C+   G +  Y W   I L ++F  FL ++ +  +V++K+   H E  
Sbjct: 105 MDPAYQEIGGYSCIAQTGNWSIYSWCPAIMLTTVFATFLVDLFSAVYVERKYGVVHEENG 164

Query: 137 N--ANALPDIILKDIQISTDDLSEGMLNCAGHQDSLQDSKKIETGVSTNLKRVDDSGFEG 194
           +  ANA+     K  Q   D       N     +SL +S    +GV T    +D++  + 
Sbjct: 165 DEVANAITHAAKKSNQSPVD-------NNQMELESLPNSGNPYSGVQT----MDNNDEKI 213

Query: 195 QYEYKRESTDETWIDENTLTTGNSEHKFSADYVSKVFVLCVLEFGIIFHSVFVGLSLAVA 254
             + +  +  E+   EN     + E +F AD    +    VLE G++FHSV +GL+L   
Sbjct: 214 STDTQSYALSESSRSENE---QDVERRFRAD----LGAFMVLEAGLLFHSVMIGLNLGTI 266

Query: 255 GSEFKVLFIVITFHQMFEGLGLGTRIAETEWPPSKWYTPWIMAFAFTITSPIAIAIGIGV 314
           G EF  L+ V+ FHQ FEGLG+G R+    +P  KW+ P+ +  A+ +T+PI +AIG+GV
Sbjct: 267 GDEFSTLYAVLVFHQSFEGLGIGARLCAITFPRDKWWWPYALCLAYGLTTPICVAIGLGV 326

Query: 315 RHSWVPGSRKALIANGVFDSISSGILIYTGLIELMAHEFIFSNQFKGEHSLRNMLTAYFI 374
           R S+   S    + +G+ DSIS+GIL+YTGL+EL+A +++F+     +  LR +      
Sbjct: 327 RKSYSSNSYSVNVVSGILDSISAGILMYTGLVELLARDYMFNAHRTKD--LRELFFNVAS 384

Query: 375 MCCGAALMALLGRWA 389
           +  GA LMALLG+WA
Sbjct: 385 ILTGAGLMALLGKWA 399

>Kwal_33.15638 s33 complement(1203012..1204619) [1608 bp, 535 aa]
           {ON} YML123C (PHO84) - inorganic phosphate transporter,
           transmembrane protein [contig 290] FULL
          Length = 535

 Score = 33.1 bits (74), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 52/262 (19%), Positives = 102/262 (38%), Gaps = 39/262 (14%)

Query: 22  EQNLRILAVFIVMISSGLGAYFPI--------LSSQYSFIRLPNWCFFVAKFFGSGVIIA 73
             N   L VF+   S G+G   P+        L S+Y+++        ++ F+  G I A
Sbjct: 156 SPNFAALGVFVAFWSFGVGGNLPVDSAIFIENLPSKYNYL-----LTVLSVFWAFGQIFA 210

Query: 74  TAFIHLLQPAAEALTDDCLGGTFEDYPWAFGICLMS--LFMLFLAEIVAHHFVDKKFNHS 131
                 L       TD    G   ++ W + +  M    F+LF+     + F   +F+ S
Sbjct: 211 NLLSWALITNYSCDTDVIRKGC--NWGWRYFLFAMGGFTFLLFVIRFAFNVFESPRFHIS 268

Query: 132 HAETDNANA----LPDIILKDIQISTDDLSEGMLNCAGHQDSLQDSKKIETGVSTNLKRV 187
             + + A A    +  I  K+  I+ DDL         ++   +    I+ GV  N    
Sbjct: 269 RGDNEAAVATLYKIAKINGKETTITLDDL---------NKIDARYGTPIDLGVKEN---- 315

Query: 188 DDSGFEGQYEYKRESTDETWIDENTLTTGNSEHKFSADYVSKVFVLCVLEFGIIFHSVFV 247
              G   + +  + S  E  ++   +  G+ +  +S+  V  +FV  ++      ++ F+
Sbjct: 316 ---GLLSRKQVFKNSLAEFRLERVRVVFGSRKQAYSSSLV--IFVWAIIGLAFPLYNAFL 370

Query: 248 GLSLAVAGSEFKVLFIVITFHQ 269
              L+  G+  + L + +T+  
Sbjct: 371 PTYLSERGNANQPLSVALTYRN 392

>KLTH0G12716g Chr7 (1080818..1085320) [4503 bp, 1500 aa] {ON} highly
            similar to uniprot|P39109 Saccharomyces cerevisiae
            YDR135C
          Length = 1500

 Score = 31.6 bits (70), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 21/80 (26%), Positives = 38/80 (47%), Gaps = 9/80 (11%)

Query: 14   STENDYNGEQNLRILAVFIVMISSGLGAYFPILSSQYSFIRLPNWCFFVAKFFGSGVIIA 73
            ST   YN  Q  R + +    + + + AY+P +++         W  F  +F GS +I+A
Sbjct: 1126 STIRGYN--QQKRFVHINQARVDNNMSAYYPSVNAN-------RWLAFRLEFIGSVIILA 1176

Query: 74   TAFIHLLQPAAEALTDDCLG 93
             + + +L+    ALT   +G
Sbjct: 1177 ASSLSVLRLKQGALTPGMIG 1196

>Kwal_33.13598 s33 (312325..316563) [4239 bp, 1412 aa] {ON} YLR310C
           (CDC25) - regulatory protein of adenylate cyclase
           [contig 114] FULL
          Length = 1412

 Score = 31.2 bits (69), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 14/45 (31%), Positives = 23/45 (51%)

Query: 136 DNANALPDIILKDIQISTDDLSEGMLNCAGHQDSLQDSKKIETGV 180
           DNA  + D ++    I  DD+    LN   H+D + +  KI+T +
Sbjct: 782 DNAPFVEDTVIDKYGIKEDDIEVSKLNIDNHRDVINNRNKIQTEI 826

>Kpol_1008.16 s1008 (29788..34044) [4257 bp, 1418 aa] {ON}
           (29788..34044) [4257 nt, 1419 aa]
          Length = 1418

 Score = 30.8 bits (68), Expect = 7.1,   Method: Composition-based stats.
 Identities = 16/45 (35%), Positives = 25/45 (55%), Gaps = 2/45 (4%)

Query: 171 QDSKKIETGVSTNLKRVDDSGFEGQYEYKRESTDETW--IDENTL 213
           Q+ KKIE+G  + L   DD  FE   E + +   ET+  + EN++
Sbjct: 149 QEDKKIESGPYSPLMETDDESFEEDTEQELDGFKETYLLVSENSI 193

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.325    0.139    0.430 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 39,649,490
Number of extensions: 1683889
Number of successful extensions: 5802
Number of sequences better than 10.0: 56
Number of HSP's gapped: 5912
Number of HSP's successfully gapped: 66
Length of query: 389
Length of database: 53,481,399
Length adjustment: 111
Effective length of query: 278
Effective length of database: 40,753,473
Effective search space: 11329465494
Effective search space used: 11329465494
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 67 (30.4 bits)