Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
CAGL0M04279g8.324ON94094050060.0
SAKL0H15532g8.324ON94194535580.0
Suva_10.2228.324ON94394035510.0
Skud_12.1988.324ON94394235380.0
NCAS0C032608.324ON98395835190.0
Smik_12.1928.324ON94394435030.0
YLR129W (DIP2)8.324ON94394234550.0
Kpol_1036.698.324ON93694334230.0
NDAI0G025808.324ON95896133930.0
TDEL0F045008.324ON93894133900.0
KLTH0G12276g8.324ON93794133840.0
ZYRO0F10406g8.324ON93894133690.0
Kwal_56.239208.324ON93794233460.0
KAFR0H022608.324ON93894633440.0
TPHA0C008108.324ON93794233380.0
Ecym_42558.324ON93794033340.0
TBLA0A039508.324ON93693633250.0
KNAG0G024508.324ON94294432960.0
AGL196C8.324ON93594032820.0
KLLA0D16390g8.324ON93694430300.0
Skud_12.2858.435ON8176443452e-32
Suva_10.3168.435ON8186403391e-31
NDAI0E034408.435ON8576573372e-31
Smik_12.2798.435ON8176413282e-30
CAGL0C00737g8.435ON8166513264e-30
TDEL0B020108.435ON8056453221e-29
ZYRO0A09636g8.435ON8086693131e-28
Kwal_27.115858.435ON8236753113e-28
TBLA0I025708.435ON8486703079e-28
YLR222C (UTP13)8.435ON8176793051e-27
NCAS0C027108.435ON8156462916e-26
Ecym_41348.435ON8102302792e-24
CAGL0C03608g6.363ON6433702744e-24
SAKL0H12760g8.435ON8411992712e-23
TDEL0A077806.363ON6572862692e-23
KAFR0H017508.435ON7832252693e-23
Ecym_25236.363ON6462812673e-23
TPHA0M020006.363ON6993512674e-23
KNAG0A025108.435ON8492182675e-23
TBLA0F042406.363ON7273442666e-23
KLLA0F10263g6.363ON6822942648e-23
KLTH0E10120g8.435ON8262262641e-22
SAKL0A00660g6.363ON6603002621e-22
AGR180W8.435ON8062822632e-22
YCR084C (TUP1)6.363ON7132822612e-22
AGL234W6.363ON6292812602e-22
NCAS0A055206.363ON6713832584e-22
Kpol_1028.236.363ON7442842585e-22
Skud_3.1566.363ON7132822576e-22
Smik_3.1836.363ON7092822569e-22
Kwal_23.64296.363ON7503362551e-21
KNAG0D002506.363ON6553882522e-21
KLLA0F13244g8.435ON8142182533e-21
Suva_3.1216.363ON7002582523e-21
KLTH0A07282g6.363ON7252862504e-21
NCAS0D047806.363ON6212772486e-21
KNAG0A037008.544ON8173012481e-20
KAFR0C047406.363ON6652842452e-20
CAGL0E00561g6.363ON8363652462e-20
Kpol_1031.498.435ON7602132452e-20
TBLA0H036208.544ON8123062425e-20
NDAI0K023506.363ON7933452416e-20
ZYRO0D17292g6.363ON7182832381e-19
TBLA0F005206.363ON6632982381e-19
TPHA0L010808.435ON8352142362e-19
SAKL0F15972g7.534ON4702992313e-19
KLTH0D04466g2.431ON3192202211e-18
AEL246C8.544ON8152942283e-18
KAFR0E031808.544ON8143012264e-18
ZYRO0D01122g7.534ON4663142207e-18
Ecym_70388.544ON8001882221e-17
Kwal_23.53517.534ON4742452181e-17
TDEL0H003707.534ON4652512172e-17
NDAI0C054908.544ON8592162193e-17
TDEL0B030208.544ON8313012193e-17
AEL269C7.534ON4552692153e-17
YBR198C (TAF5)8.544ON7982162174e-17
Smik_2.3388.544ON8002162166e-17
Ecym_24986.340ON5424362146e-17
Kpol_1013.377.534ON4682742136e-17
SAKL0H09988g8.544ON7493002157e-17
TPHA0I018808.544ON10342092168e-17
CAGL0M05335g8.544ON8063032158e-17
Skud_2.3248.544ON8022952141e-16
KAFR0A005102.431ON3192232061e-16
Kpol_1024.428.544ON8432552131e-16
Suva_4.4528.544ON8002162112e-16
ZYRO0A12980g8.544ON8243142103e-16
KLLA0C08547g6.340ON5152872083e-16
Kwal_27.120538.544ON7552162094e-16
TPHA0L016908.544ON8322192085e-16
AER263C6.340ON5134362065e-16
TPHA0I032407.534ON4772952056e-16
NCAS0A151707.534ON4743072048e-16
KLTH0E12606g8.544ON7552162068e-16
ZYRO0E04620g1.399ON3032541989e-16
Suva_14.3421.399ON3032541981e-15
AFR199C2.431ON3342191991e-15
Kwal_23.63246.340ON5142862022e-15
NCAS0B022008.544ON8222292042e-15
Kpol_487.71.399ON3032601962e-15
NCAS0A042702.431ON3182381962e-15
TPHA0G023802.431ON3182221953e-15
NCAS0F018502.431ON3182381953e-15
ZYRO0D08206g6.340ON5152891994e-15
TDEL0A075506.340ON5154391994e-15
Suva_13.2952.431ON3191531944e-15
Skud_13.2752.431ON3191531944e-15
Smik_13.3052.431ON3191531944e-15
YMR116C (ASC1)2.431ON3191531944e-15
KLLA0E23453g8.544ON8262132005e-15
Skud_14.3211.399ON3032541925e-15
Ecym_28087.534ON4653211976e-15
TBLA0F041306.340ON5144251977e-15
SAKL0E03960g2.431ON3202071927e-15
TDEL0B059701.399ON3032571917e-15
Smik_14.3221.399ON3032541918e-15
YNL006W (LST8)1.399ON3032541918e-15
Suva_3.1096.340ON5152831968e-15
Kpol_297.72.431ON3181571918e-15
NCAS0B078401.247ON5892041951e-14
KNAG0I028406.340ON5192831941e-14
CAGL0J03476g6.340ON5174351932e-14
NDAI0I003506.340ON5152841932e-14
NCAS0D046106.340ON5152831932e-14
TPHA0M018306.340ON5154381923e-14
KNAG0E023102.431ON3192231873e-14
KLTH0A06754g6.340ON5142861913e-14
KLTH0A00880g7.534ON4712451913e-14
KAFR0F043506.340ON5154361913e-14
TDEL0H021307.231ON5843311914e-14
CAGL0H03729g1.399ON3032751854e-14
SAKL0A01276g6.340ON5154401904e-14
Kpol_1070.117.231ON6662831914e-14
KNAG0F018406.239ON9112861925e-14
TBLA0B091002.431ON3172391846e-14
CAGL0I03718g7.322ON12011591917e-14
Smik_3.1726.340ON5154331888e-14
KLLA0E07085g3.25ON4522131878e-14
Skud_3.1456.340ON5153421888e-14
Ecym_60982.431ON3181571831e-13
YCR072C (RSA4)6.340ON5154331871e-13
SAKL0A03872g6.239ON8782861891e-13
Kpol_1048.598.544ON8503041881e-13
KNAG0H016901.399ON3032751811e-13
KNAG0F038707.534ON4652501861e-13
SAKL0F08404g7.231ON6431821871e-13
NDAI0H027102.431ON3181681812e-13
NDAI0G038303.25ON5102581852e-13
ZYRO0D16742g7.231ON6082761852e-13
SAKL0D08756g1.399ON3032311793e-13
Kpol_1028.416.340ON5124381833e-13
KAFR0L013907.322ON12061591854e-13
Suva_9.1547.231ON6381851835e-13
TPHA0D045007.322ON12081721845e-13
NDAI0A020907.322ON12001591845e-13
Ecym_24018.672ON4261571805e-13
KNAG0B027207.322ON12041591835e-13
Skud_9.1237.231ON6391851826e-13
KAFR0A033801.247ON6661211826e-13
Kwal_23.62406.325ON9133911818e-13
AFL118W6.239ON8322861819e-13
TDEL0A020702.431ON3192231751e-12
KLLA0F04884g7.322ON12121981811e-12
CAGL0G09845g7.534ON5003211791e-12
TPHA0J025406.239ON8663471811e-12
Kpol_2001.657.322ON12061721811e-12
TBLA0F022307.322ON12161841811e-12
KNAG0D016907.231ON6542861801e-12
KAFR0H031401.399ON3032311741e-12
TBLA0A060606.239ON8882861792e-12
TDEL0C022407.322ON12011591802e-12
NDAI0C026001.399ON3032721722e-12
YIL046W (MET30)7.231ON6401851772e-12
Smik_9.1447.231ON6301821772e-12
YDL145C (COP1)7.322ON12011971782e-12
KLTH0H03608g6.239ON8752861782e-12
ADL082C7.231ON5692791762e-12
Skud_4.1097.322ON12011591783e-12
ADR077C7.322ON12041831783e-12
TBLA0I022806.325ON9271601773e-12
TPHA0G016108.672ON4142171743e-12
Kpol_1028.546.325ON9051561773e-12
ZYRO0G20152g2.431ON3191531713e-12
Smik_4.907.322ON12011591773e-12
Suva_14.223.25ON4692081743e-12
TPHA0C011507.231ON6872881763e-12
Ecym_80901.247ON7162441763e-12
Suva_4.997.322ON12011591764e-12
Kwal_56.245267.322ON12101591764e-12
KLTH0H01892g7.322ON12091591764e-12
Skud_14.223.25ON4672081744e-12
SAKL0F10648g7.322ON12031591764e-12
KLLA0E12277g2.431ON3262321704e-12
SAKL0H06666g8.672ON4412191734e-12
Skud_11.2711.247ON6462261745e-12
KAFR0I018807.231ON5911821745e-12
Suva_16.5107.534ON4653101725e-12
KAFR0B003707.534ON4612491726e-12
NCAS0A134307.231ON6083671736e-12
Ecym_12931.399ON3032311687e-12
TBLA0D041307.231ON5741161728e-12
NCAS0A139407.322ON12051591748e-12
NDAI0A026107.231ON7671841738e-12
TPHA0B011201.247ON7191271729e-12
Kpol_1014.193.25ON4522821709e-12
KNAG0C062405.631ON3552481689e-12
KLTH0A06380g6.325ON9151551731e-11
Kpol_1031.361.247ON7062181711e-11
KLLA0F27511g7.231ON6231821711e-11
KLTH0H12122g1.399ON3032311661e-11
KLTH0A04114g7.231ON6582811702e-11
Smik_7.1356.239ON8873471712e-11
CAGL0L00781g7.231ON6731821702e-11
KLLA0E04819g7.534ON4592591682e-11
ZYRO0F11110g7.322ON12011781702e-11
TDEL0D013101.247ON7092221702e-11
YCR057C (PWP2)6.325ON9231561702e-11
KAFR0A069906.239ON8852861702e-11
TBLA0A018706.177ON10041571702e-11
TBLA0B043908.585ON3361801652e-11
Ecym_43437.231ON5832821692e-11
YNL317W (PFS2)3.25ON4652081672e-11
TDEL0E054806.239ON8813471692e-11
TPHA0B020804.275ON9414621693e-11
TPHA0P014903.25ON4592081663e-11
SAKL0A01738g6.325ON9091491683e-11
NCAS0G036001.399ON3272711633e-11
Smik_14.143.25ON4662081663e-11
Suva_11.2681.247ON6452251673e-11
Kpol_1055.644.275ON9382161683e-11
Skud_12.4934.275ON9392151674e-11
Skud_3.1336.325ON9161511674e-11
SAKL0C13266g3.25ON4592081654e-11
Kwal_23.57697.231ON6272831664e-11
Ecym_80727.322ON12011591674e-11
ZYRO0E07392g6.239ON8973471675e-11
ZYRO0C03124g3.25ON4452091645e-11
YGL137W (SEC27)6.239ON8893471665e-11
Suva_7.1276.239ON8912861665e-11
KLLA0B01958g6.239ON8902931666e-11
Smik_11.2981.247ON6622261656e-11
ACR137W8.672ON4251441636e-11
Smik_12.4954.275ON9392151657e-11
Smik_3.1576.325ON9241511657e-11
KLTH0F19294g3.25ON4512241637e-11
NDAI0J003307.534ON4722761637e-11
TDEL0A004403.25ON4512091638e-11
KNAG0J016808.672ON3981531628e-11
TPHA0O007101.399ON3042691599e-11
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0M04279g
         (940 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0M04279g Chr13 (469040..471862) [2823 bp, 940 aa] {ON} highl...  1932   0.0  
SAKL0H15532g Chr8 complement(1351712..1354537) [2826 bp, 941 aa]...  1375   0.0  
Suva_10.222 Chr10 (408217..411048) [2832 bp, 943 aa] {ON} YLR129...  1372   0.0  
Skud_12.198 Chr12 (382439..385270) [2832 bp, 943 aa] {ON} YLR129...  1367   0.0  
NCAS0C03260 Chr3 complement(640108..643059) [2952 bp, 983 aa] {O...  1360   0.0  
Smik_12.192 Chr12 (380993..383824) [2832 bp, 943 aa] {ON} YLR129...  1353   0.0  
YLR129W Chr12 (399657..402488) [2832 bp, 943 aa] {ON}  DIP2Nucle...  1335   0.0  
Kpol_1036.69 s1036 (189457..192267) [2811 bp, 936 aa] {ON} (1894...  1323   0.0  
NDAI0G02580 Chr7 complement(590030..592906) [2877 bp, 958 aa] {O...  1311   0.0  
TDEL0F04500 Chr6 (843307..846123) [2817 bp, 938 aa] {ON} Anc_8.3...  1310   0.0  
KLTH0G12276g Chr7 complement(1042617..1045430) [2814 bp, 937 aa]...  1308   0.0  
ZYRO0F10406g Chr6 (843429..846245) [2817 bp, 938 aa] {ON} simila...  1302   0.0  
Kwal_56.23920 s56 (776647..779460) [2814 bp, 937 aa] {ON} YLR129...  1293   0.0  
KAFR0H02260 Chr8 complement(430272..433088) [2817 bp, 938 aa] {O...  1292   0.0  
TPHA0C00810 Chr3 complement(158582..161395) [2814 bp, 937 aa] {O...  1290   0.0  
Ecym_4255 Chr4 (529455..532268) [2814 bp, 937 aa] {ON} similar t...  1288   0.0  
TBLA0A03950 Chr1 (986923..989733) [2811 bp, 936 aa] {ON} Anc_8.3...  1285   0.0  
KNAG0G02450 Chr7 (557570..560398) [2829 bp, 942 aa] {ON} Anc_8.3...  1274   0.0  
AGL196C Chr7 complement(328838..331645) [2808 bp, 935 aa] {ON} S...  1268   0.0  
KLLA0D16390g Chr4 (1378884..1381694) [2811 bp, 936 aa] {ON} simi...  1171   0.0  
Skud_12.285 Chr12 complement(525831..528284) [2454 bp, 817 aa] {...   137   2e-32
Suva_10.316 Chr10 complement(551612..554068) [2457 bp, 818 aa] {...   135   1e-31
NDAI0E03440 Chr5 complement(735469..738042) [2574 bp, 857 aa] {O...   134   2e-31
Smik_12.279 Chr12 complement(526367..528820) [2454 bp, 817 aa] {...   130   2e-30
CAGL0C00737g Chr3 complement(75028..77478) [2451 bp, 816 aa] {ON...   130   4e-30
TDEL0B02010 Chr2 complement(355418..357835) [2418 bp, 805 aa] {O...   128   1e-29
ZYRO0A09636g Chr1 (779501..781927) [2427 bp, 808 aa] {ON} highly...   125   1e-28
Kwal_27.11585 s27 (859952..862423) [2472 bp, 823 aa] {ON} YLR222...   124   3e-28
TBLA0I02570 Chr9 (597481..600027) [2547 bp, 848 aa] {ON} Anc_8.7...   122   9e-28
YLR222C Chr12 complement(579318..581771) [2454 bp, 817 aa] {ON} ...   122   1e-27
NCAS0C02710 Chr3 complement(505852..508299) [2448 bp, 815 aa] {O...   116   6e-26
Ecym_4134 Chr4 complement(280146..282578) [2433 bp, 810 aa] {ON}...   112   2e-24
CAGL0C03608g Chr3 (360681..362612) [1932 bp, 643 aa] {ON} simila...   110   4e-24
SAKL0H12760g Chr8 complement(1089272..1091797) [2526 bp, 841 aa]...   108   2e-23
TDEL0A07780 Chr1 complement(1352017..1353990) [1974 bp, 657 aa] ...   108   2e-23
KAFR0H01750 Chr8 complement(322707..325058) [2352 bp, 783 aa] {O...   108   3e-23
Ecym_2523 Chr2 complement(1021566..1023506) [1941 bp, 646 aa] {O...   107   3e-23
TPHA0M02000 Chr13 complement(414262..416361) [2100 bp, 699 aa] {...   107   4e-23
KNAG0A02510 Chr1 complement(253245..255794) [2550 bp, 849 aa] {O...   107   5e-23
TBLA0F04240 Chr6 (1043577..1045760) [2184 bp, 727 aa] {ON} Anc_6...   107   6e-23
KLLA0F10263g Chr6 (949926..951974) [2049 bp, 682 aa] {ON} unipro...   106   8e-23
KLTH0E10120g Chr5 (916575..919055) [2481 bp, 826 aa] {ON} highly...   106   1e-22
SAKL0A00660g Chr1 (71855..73837) [1983 bp, 660 aa] {ON} some sim...   105   1e-22
AGR180W Chr7 (1090641..1093061) [2421 bp, 806 aa] {ON} Syntenic ...   105   2e-22
YCR084C Chr3 complement(260311..262452) [2142 bp, 713 aa] {ON}  ...   105   2e-22
AGL234W Chr7 (257969..259858) [1890 bp, 629 aa] {ON} Syntenic ho...   104   2e-22
NCAS0A05520 Chr1 complement(1085200..1087215) [2016 bp, 671 aa] ...   103   4e-22
Kpol_1028.23 s1028 (63032..65266) [2235 bp, 744 aa] {ON} (63032....   103   5e-22
Skud_3.156 Chr3 complement(244873..247014) [2142 bp, 713 aa] {ON...   103   6e-22
Smik_3.183 Chr3 complement(259959..262088) [2130 bp, 709 aa] {ON...   103   9e-22
Kwal_23.6429 s23 complement(1577398..1579650) [2253 bp, 750 aa] ...   102   1e-21
KNAG0D00250 Chr4 (32581..34548) [1968 bp, 655 aa] {ON} Anc_6.363...   101   2e-21
KLLA0F13244g Chr6 (1224178..1226622) [2445 bp, 814 aa] {ON} high...   102   3e-21
Suva_3.121 Chr3 complement(177765..179864) [2100 bp, 700 aa] {ON...   101   3e-21
KLTH0A07282g Chr1 complement(604949..607126) [2178 bp, 725 aa] {...   100   4e-21
NCAS0D04780 Chr4 (916321..918186) [1866 bp, 621 aa] {ON} Anc_6.363    100   6e-21
KNAG0A03700 Chr1 complement(477870..480323) [2454 bp, 817 aa] {O...   100   1e-20
KAFR0C04740 Chr3 complement(941929..943926) [1998 bp, 665 aa] {O...    99   2e-20
CAGL0E00561g Chr5 (49987..52497) [2511 bp, 836 aa] {ON} some sim...    99   2e-20
Kpol_1031.49 s1031 (132811..133005,133055..133063,133288..133320...    99   2e-20
TBLA0H03620 Chr8 (882587..885025) [2439 bp, 812 aa] {ON} Anc_8.5...    98   5e-20
NDAI0K02350 Chr11 complement(524551..526932) [2382 bp, 793 aa] {...    97   6e-20
ZYRO0D17292g Chr4 complement(1424965..1427121) [2157 bp, 718 aa]...    96   1e-19
TBLA0F00520 Chr6 complement(134791..136782) [1992 bp, 663 aa] {O...    96   1e-19
TPHA0L01080 Chr12 (226790..229297) [2508 bp, 835 aa] {ON} Anc_8....    96   2e-19
SAKL0F15972g Chr6 (1291625..1293037) [1413 bp, 470 aa] {ON} simi...    94   3e-19
KLTH0D04466g Chr4 (413024..413560,413816..414238) [960 bp, 319 a...    90   1e-18
AEL246C Chr5 complement(172849..175296) [2448 bp, 815 aa] {ON} S...    92   3e-18
KAFR0E03180 Chr5 (637055..639499) [2445 bp, 814 aa] {ON} Anc_8.5...    92   4e-18
ZYRO0D01122g Chr4 complement(86927..88327) [1401 bp, 466 aa] {ON...    89   7e-18
Ecym_7038 Chr7 (80529..82931) [2403 bp, 800 aa] {ON} similar to ...    90   1e-17
Kwal_23.5351 s23 (1122565..1123989) [1425 bp, 474 aa] {ON} YPR17...    89   1e-17
TDEL0H00370 Chr8 complement(57487..58884) [1398 bp, 465 aa] {ON}...    88   2e-17
NDAI0C05490 Chr3 (1275046..1277625) [2580 bp, 859 aa] {ON}             89   3e-17
TDEL0B03020 Chr2 complement(534847..537342) [2496 bp, 831 aa] {O...    89   3e-17
AEL269C Chr5 complement(134760..136127) [1368 bp, 455 aa] {ON} S...    87   3e-17
YBR198C Chr2 complement(616127..618523) [2397 bp, 798 aa] {ON}  ...    88   4e-17
Smik_2.338 Chr2 complement(602610..605012) [2403 bp, 800 aa] {ON...    88   6e-17
Ecym_2498 Chr2 complement(974601..976229) [1629 bp, 542 aa] {ON}...    87   6e-17
Kpol_1013.37 s1013 complement(88637..88936,88986..88994,89037..9...    87   6e-17
SAKL0H09988g Chr8 complement(853060..855309) [2250 bp, 749 aa] {...    87   7e-17
TPHA0I01880 Chr9 complement(418620..421724) [3105 bp, 1034 aa] {...    88   8e-17
CAGL0M05335g Chr13 complement(569132..571552) [2421 bp, 806 aa] ...    87   8e-17
Skud_2.324 Chr2 complement(583774..586182) [2409 bp, 802 aa] {ON...    87   1e-16
KAFR0A00510 Chr1 (93452..93988,94240..94662) [960 bp, 319 aa] {O...    84   1e-16
Kpol_1024.42 s1024 complement(112044..114575) [2532 bp, 843 aa] ...    87   1e-16
Suva_4.452 Chr4 complement(786121..788523) [2403 bp, 800 aa] {ON...    86   2e-16
ZYRO0A12980g Chr1 (1025863..1028337) [2475 bp, 824 aa] {ON} simi...    86   3e-16
KLLA0C08547g Chr3 (749737..751284) [1548 bp, 515 aa] {ON} highly...    85   3e-16
Kwal_27.12053 s27 (1065073..1067340) [2268 bp, 755 aa] {ON} YBR1...    85   4e-16
TPHA0L01690 Chr12 (355859..358357) [2499 bp, 832 aa] {ON} Anc_8....    85   5e-16
AER263C Chr5 complement(1118228..1119769) [1542 bp, 513 aa] {ON}...    84   5e-16
TPHA0I03240 Chr9 (714446..715879) [1434 bp, 477 aa] {ON} Anc_7.5...    84   6e-16
NCAS0A15170 Chr1 (2984221..2985645) [1425 bp, 474 aa] {ON} Anc_7...    83   8e-16
KLTH0E12606g Chr5 (1120419..1122686) [2268 bp, 755 aa] {ON} simi...    84   8e-16
ZYRO0E04620g Chr5 (348647..349558) [912 bp, 303 aa] {ON} highly ...    81   9e-16
Suva_14.342 Chr14 (600032..600943) [912 bp, 303 aa] {ON} YNL006W...    81   1e-15
AFR199C Chr6 complement(799873..800295,800490..801071) [1005 bp,...    81   1e-15
Kwal_23.6324 s23 complement(1531252..1532796) [1545 bp, 514 aa] ...    82   2e-15
NCAS0B02200 Chr2 complement(359080..361548) [2469 bp, 822 aa] {O...    83   2e-15
Kpol_487.7 s487 complement(37021..37932) [912 bp, 303 aa] {ON} c...    80   2e-15
NCAS0A04270 Chr1 (862892..863425,863734..864156) [957 bp, 318 aa...    80   2e-15
TPHA0G02380 Chr7 (484477..485010,485373..485795) [957 bp, 318 aa...    80   3e-15
NCAS0F01850 Chr6 complement(371372..371794,372104..372637) [957 ...    80   3e-15
ZYRO0D08206g Chr4 (711937..713484) [1548 bp, 515 aa] {ON} highly...    81   4e-15
TDEL0A07550 Chr1 complement(1314676..1316223) [1548 bp, 515 aa] ...    81   4e-15
Suva_13.295 Chr13 complement(480518..480940,481217..481753) [960...    79   4e-15
Skud_13.275 Chr13 complement(474770..475192,475471..476007) [960...    79   4e-15
Smik_13.305 Chr13 complement(482912..483334,483612..484148) [960...    79   4e-15
YMR116C Chr13 complement(499456..499878,500152..500688) [960 bp,...    79   4e-15
KLLA0E23453g Chr5 (2088516..2090996) [2481 bp, 826 aa] {ON} simi...    82   5e-15
Skud_14.321 Chr14 (586864..587775) [912 bp, 303 aa] {ON} YNL006W...    79   5e-15
Ecym_2808 Chr2 (1568103..1569500) [1398 bp, 465 aa] {ON} similar...    80   6e-15
TBLA0F04130 Chr6 complement(1021035..1022579) [1545 bp, 514 aa] ...    80   7e-15
SAKL0E03960g Chr5 complement(319708..320130,320346..320885) [963...    79   7e-15
TDEL0B05970 Chr2 (1055359..1056270) [912 bp, 303 aa] {ON} Anc_1....    78   7e-15
Smik_14.322 Chr14 (578426..579337) [912 bp, 303 aa] {ON} YNL006W...    78   8e-15
YNL006W Chr14 (620067..620978) [912 bp, 303 aa] {ON}  LST8Protei...    78   8e-15
Suva_3.109 Chr3 complement(158211..159758) [1548 bp, 515 aa] {ON...    80   8e-15
Kpol_297.7 s297 (10035..10568,10902..11324) [957 bp, 318 aa] {ON...    78   8e-15
NCAS0B07840 Chr2 complement(1486900..1488669) [1770 bp, 589 aa] ...    80   1e-14
KNAG0I02840 Chr9 (554645..556204) [1560 bp, 519 aa] {ON} Anc_6.3...    79   1e-14
CAGL0J03476g Chr10 (334536..336089) [1554 bp, 517 aa] {ON} highl...    79   2e-14
NDAI0I00350 Chr9 (71116..72663) [1548 bp, 515 aa] {ON} Anc_6.340       79   2e-14
NCAS0D04610 Chr4 (881005..882552) [1548 bp, 515 aa] {ON} Anc_6.340     79   2e-14
TPHA0M01830 Chr13 complement(378923..380470) [1548 bp, 515 aa] {...    79   3e-14
KNAG0E02310 Chr5 (463866..464402,464772..465194) [960 bp, 319 aa...    77   3e-14
KLTH0A06754g Chr1 complement(560921..562465) [1545 bp, 514 aa] {...    78   3e-14
KLTH0A00880g Chr1 complement(90125..91540) [1416 bp, 471 aa] {ON...    78   3e-14
KAFR0F04350 Chr6 (853842..855389) [1548 bp, 515 aa] {ON} Anc_6.3...    78   3e-14
TDEL0H02130 Chr8 (362711..364465) [1755 bp, 584 aa] {ON} Anc_7.2...    78   4e-14
CAGL0H03729g Chr8 (342948..343859) [912 bp, 303 aa] {ON} highly ...    76   4e-14
SAKL0A01276g Chr1 (124778..126325) [1548 bp, 515 aa] {ON} highly...    78   4e-14
Kpol_1070.11 s1070 (30012..32012) [2001 bp, 666 aa] {ON} (30012....    78   4e-14
KNAG0F01840 Chr6 (348492..351227) [2736 bp, 911 aa] {ON} Anc_6.2...    79   5e-14
TBLA0B09100 Chr2 complement(2156320..2156742,2157014..2157544) [...    75   6e-14
CAGL0I03718g Chr9 complement(317565..321170) [3606 bp, 1201 aa] ...    78   7e-14
Smik_3.172 Chr3 complement(240515..242062) [1548 bp, 515 aa] {ON...    77   8e-14
KLLA0E07085g Chr5 (645766..647124) [1359 bp, 452 aa] {ON} simila...    77   8e-14
Skud_3.145 Chr3 complement(225459..227006) [1548 bp, 515 aa] {ON...    77   8e-14
Ecym_6098 Chr6 (185368..185901,186107..186529) [957 bp, 318 aa] ...    75   1e-13
YCR072C Chr3 complement(240805..242352) [1548 bp, 515 aa] {ON}  ...    77   1e-13
SAKL0A03872g Chr1 (361507..361524,361720..364338) [2637 bp, 878 ...    77   1e-13
Kpol_1048.59 s1048 complement(166721..169273) [2553 bp, 850 aa] ...    77   1e-13
KNAG0H01690 Chr8 (301564..302475) [912 bp, 303 aa] {ON} Anc_1.39...    74   1e-13
KNAG0F03870 Chr6 complement(731884..733281) [1398 bp, 465 aa] {O...    76   1e-13
SAKL0F08404g Chr6 complement(640436..642367) [1932 bp, 643 aa] {...    77   1e-13
NDAI0H02710 Chr8 complement(668900..669322,669678..670211) [957 ...    74   2e-13
NDAI0G03830 Chr7 (919944..921476) [1533 bp, 510 aa] {ON} Anc_3.25      76   2e-13
ZYRO0D16742g Chr4 complement(1385330..1387156) [1827 bp, 608 aa]...    76   2e-13
SAKL0D08756g Chr4 complement(728765..729676) [912 bp, 303 aa] {O...    74   3e-13
Kpol_1028.41 s1028 (100720..102258) [1539 bp, 512 aa] {ON} (1007...    75   3e-13
KAFR0L01390 Chr12 (257344..260964) [3621 bp, 1206 aa] {ON} Anc_7...    76   4e-13
Suva_9.154 Chr9 (257284..259200) [1917 bp, 638 aa] {ON} YIL046W ...    75   5e-13
TPHA0D04500 Chr4 (978756..982382) [3627 bp, 1208 aa] {ON} Anc_7....    75   5e-13
NDAI0A02090 Chr1 complement(466744..470346) [3603 bp, 1200 aa] {...    75   5e-13
Ecym_2401 Chr2 complement(781043..782323) [1281 bp, 426 aa] {ON}...    74   5e-13
KNAG0B02720 Chr2 complement(523885..527499) [3615 bp, 1204 aa] {...    75   5e-13
Skud_9.123 Chr9 (237466..239385) [1920 bp, 639 aa] {ON} YIL046W ...    75   6e-13
KAFR0A03380 Chr1 (690272..692272) [2001 bp, 666 aa] {ON} Anc_1.2...    75   6e-13
Kwal_23.6240 s23 complement(1503990..1506731) [2742 bp, 913 aa] ...    74   8e-13
AFL118W Chr6 (216252..216269,216423..218903) [2499 bp, 832 aa] {...    74   9e-13
TDEL0A02070 Chr1 (372046..372582,372798..373220) [960 bp, 319 aa...    72   1e-12
KLLA0F04884g Chr6 complement(478044..481682) [3639 bp, 1212 aa] ...    74   1e-12
CAGL0G09845g Chr7 (940598..942100) [1503 bp, 500 aa] {ON} simila...    74   1e-12
TPHA0J02540 Chr10 complement(561110..563710) [2601 bp, 866 aa] {...    74   1e-12
Kpol_2001.65 s2001 (178299..181919) [3621 bp, 1206 aa] {ON} (178...    74   1e-12
TBLA0F02230 Chr6 (551746..555396) [3651 bp, 1216 aa] {ON} Anc_7....    74   1e-12
KNAG0D01690 Chr4 (286791..288755) [1965 bp, 654 aa] {ON} Anc_7.2...    74   1e-12
KAFR0H03140 Chr8 complement(600224..601135) [912 bp, 303 aa] {ON...    72   1e-12
TBLA0A06060 Chr1 (1493832..1493849,1494107..1496755) [2667 bp, 8...    74   2e-12
TDEL0C02240 Chr3 complement(388060..391665) [3606 bp, 1201 aa] {...    74   2e-12
NDAI0C02600 Chr3 complement(605643..606554) [912 bp, 303 aa] {ON}      71   2e-12
YIL046W Chr9 (268651..270573) [1923 bp, 640 aa] {ON}  MET30F-box...    73   2e-12
Smik_9.144 Chr9 (242718..244610) [1893 bp, 630 aa] {ON} YIL046W ...    73   2e-12
YDL145C Chr4 complement(194571..198176) [3606 bp, 1201 aa] {ON} ...    73   2e-12
KLTH0H03608g Chr8 (327747..327764,327941..330550) [2628 bp, 875 ...    73   2e-12
ADL082C Chr4 complement(538945..540654) [1710 bp, 569 aa] {ON} S...    72   2e-12
Skud_4.109 Chr4 complement(190191..193796) [3606 bp, 1201 aa] {O...    73   3e-12
ADR077C Chr4 complement(843169..846783) [3615 bp, 1204 aa] {ON} ...    73   3e-12
TBLA0I02280 Chr9 complement(523331..526114) [2784 bp, 927 aa] {O...    73   3e-12
TPHA0G01610 Chr7 complement(332529..333773) [1245 bp, 414 aa] {O...    72   3e-12
Kpol_1028.54 s1028 (125940..128657) [2718 bp, 905 aa] {ON} (1259...    73   3e-12
ZYRO0G20152g Chr7 complement(1669233..1669655,1669872..1670408) ...    70   3e-12
Smik_4.90 Chr4 complement(171469..175074) [3606 bp, 1201 aa] {ON...    73   3e-12
Suva_14.22 Chr14 (36853..38262) [1410 bp, 469 aa] {ON} YNL317W (...    72   3e-12
TPHA0C01150 Chr3 (263944..266007) [2064 bp, 687 aa] {ON} Anc_7.2...    72   3e-12
Ecym_8090 Chr8 (194643..196793) [2151 bp, 716 aa] {ON} similar t...    72   3e-12
Suva_4.99 Chr4 complement(182425..186030) [3606 bp, 1201 aa] {ON...    72   4e-12
Kwal_56.24526 s56 (1036575..1040207) [3633 bp, 1210 aa] {ON} YDL...    72   4e-12
KLTH0H01892g Chr8 complement(167262..170891) [3630 bp, 1209 aa] ...    72   4e-12
Skud_14.22 Chr14 (34087..35490) [1404 bp, 467 aa] {ON} YNL317W (...    72   4e-12
SAKL0F10648g Chr6 (827399..831010) [3612 bp, 1203 aa] {ON} highl...    72   4e-12
KLLA0E12277g Chr5 (1086778..1087329,1087730..1088158) [981 bp, 3...    70   4e-12
SAKL0H06666g Chr8 complement(586110..587435) [1326 bp, 441 aa] {...    71   4e-12
Skud_11.271 Chr11 complement(490869..492809) [1941 bp, 646 aa] {...    72   5e-12
KAFR0I01880 Chr9 (386694..388469) [1776 bp, 591 aa] {ON} Anc_7.2...    72   5e-12
Suva_16.510 Chr16 (874866..876263) [1398 bp, 465 aa] {ON} YPR178...    71   5e-12
KAFR0B00370 Chr2 complement(83264..84649) [1386 bp, 461 aa] {ON}...    71   6e-12
NCAS0A13430 Chr1 complement(2641588..2643414) [1827 bp, 608 aa] ...    71   6e-12
Ecym_1293 Chr1 (595329..596240) [912 bp, 303 aa] {ON} similar to...    69   7e-12
TBLA0D04130 Chr4 (1027726..1029450) [1725 bp, 574 aa] {ON} Anc_7...    71   8e-12
NCAS0A13940 Chr1 (2740150..2743767) [3618 bp, 1205 aa] {ON} Anc_...    72   8e-12
NDAI0A02610 Chr1 (585697..588000) [2304 bp, 767 aa] {ON} Anc_7.231     71   8e-12
TPHA0B01120 Chr2 (254017..256176) [2160 bp, 719 aa] {ON} Anc_1.2...    71   9e-12
Kpol_1014.19 s1014 complement(30466..31824) [1359 bp, 452 aa] {O...    70   9e-12
KNAG0C06240 Chr3 complement(1212466..1213533) [1068 bp, 355 aa] ...    69   9e-12
KLTH0A06380g Chr1 complement(532367..535114) [2748 bp, 915 aa] {...    71   1e-11
Kpol_1031.36 s1031 complement(87105..89225) [2121 bp, 706 aa] {O...    70   1e-11
KLLA0F27511g Chr6 (2546533..2548404) [1872 bp, 623 aa] {ON} simi...    70   1e-11
KLTH0H12122g Chr8 (1034092..1035003) [912 bp, 303 aa] {ON} highl...    69   1e-11
KLTH0A04114g Chr1 complement(344618..346594) [1977 bp, 658 aa] {...    70   2e-11
Smik_7.135 Chr7 (244035..244445,244446..246698) [2664 bp, 887 aa...    70   2e-11
CAGL0L00781g Chr12 (97503..99524) [2022 bp, 673 aa] {ON} similar...    70   2e-11
KLLA0E04819g Chr5 (428278..429657) [1380 bp, 459 aa] {ON} simila...    69   2e-11
ZYRO0F11110g Chr6 (908737..912342) [3606 bp, 1201 aa] {ON} highl...    70   2e-11
TDEL0D01310 Chr4 complement(251119..253248) [2130 bp, 709 aa] {O...    70   2e-11
YCR057C Chr3 complement(220457..223228) [2772 bp, 923 aa] {ON}  ...    70   2e-11
KAFR0A06990 Chr1 complement(1405904..1408543,1408655..1408672) [...    70   2e-11
TBLA0A01870 Chr1 (455007..458021) [3015 bp, 1004 aa] {ON} Anc_6....    70   2e-11
TBLA0B04390 Chr2 (1014987..1015997) [1011 bp, 336 aa] {ON} Anc_8...    68   2e-11
Ecym_4343 Chr4 (733111..734862) [1752 bp, 583 aa] {ON} similar t...    70   2e-11
YNL317W Chr14 (40619..42016) [1398 bp, 465 aa] {ON}  PFS2Integra...    69   2e-11
TDEL0E05480 Chr5 complement(1002913..1005540,1005640..1005657) [...    70   2e-11
TPHA0B02080 Chr2 (477775..480600) [2826 bp, 941 aa] {ON} Anc_4.2...    70   3e-11
TPHA0P01490 Chr16 complement(302996..304375) [1380 bp, 459 aa] {...    69   3e-11
SAKL0A01738g Chr1 (157360..160089) [2730 bp, 909 aa] {ON} highly...    69   3e-11
NCAS0G03600 Chr7 complement(672904..673887) [984 bp, 327 aa] {ON...    67   3e-11
Smik_14.14 Chr14 (25114..26514) [1401 bp, 466 aa] {ON} YNL317W (...    69   3e-11
Suva_11.268 Chr11 complement(492639..494576) [1938 bp, 645 aa] {...    69   3e-11
Kpol_1055.64 s1055 (170524..173340) [2817 bp, 938 aa] {ON} (1705...    69   3e-11
Skud_12.493 Chr12 complement(874622..877441) [2820 bp, 939 aa] {...    69   4e-11
Skud_3.133 Chr3 complement(204741..207488) [2748 bp, 916 aa] {ON...    69   4e-11
SAKL0C13266g Chr3 complement(1171961..1173340) [1380 bp, 459 aa]...    68   4e-11
Kwal_23.5769 s23 complement(1311598..1313481) [1884 bp, 627 aa] ...    69   4e-11
Ecym_8072 Chr8 (157039..160644) [3606 bp, 1201 aa] {ON} similar ...    69   4e-11
ZYRO0E07392g Chr5 complement(564166..566841,567011..567028) [269...    69   5e-11
ZYRO0C03124g Chr3 complement(240321..241658) [1338 bp, 445 aa] {...    68   5e-11
YGL137W Chr7 (249869..249886,250087..252738) [2670 bp, 889 aa] {...    69   5e-11
Suva_7.127 Chr7 (246249..246659,246660..248924) [2676 bp, 891 aa...    69   5e-11
KLLA0B01958g Chr2 (170646..170663,170896..173550) [2673 bp, 890 ...    69   6e-11
Smik_11.298 Chr11 complement(497968..499956) [1989 bp, 662 aa] {...    68   6e-11
ACR137W Chr3 (590077..591354) [1278 bp, 425 aa] {ON} Syntenic ho...    67   6e-11
Smik_12.495 Chr12 complement(873068..875887) [2820 bp, 939 aa] {...    68   7e-11
Smik_3.157 Chr3 complement(218522..221296) [2775 bp, 924 aa] {ON...    68   7e-11
KLTH0F19294g Chr6 complement(1560167..1561522) [1356 bp, 451 aa]...    67   7e-11
NDAI0J00330 Chr10 (54580..55998) [1419 bp, 472 aa] {ON} Anc_7.534      67   7e-11
TDEL0A00440 Chr1 (78820..80175) [1356 bp, 451 aa] {ON} Anc_3.25 ...    67   8e-11
KNAG0J01680 Chr10 (307280..308476) [1197 bp, 398 aa] {ON} Anc_8....    67   8e-11
TPHA0O00710 Chr15 (135136..136050) [915 bp, 304 aa] {ON} Anc_1.3...    66   9e-11
AAL009C Chr1 complement(325785..326696) [912 bp, 303 aa] {ON} Sy...    66   1e-10
KLLA0D04840g Chr4 (413362..414273) [912 bp, 303 aa] {ON} highly ...    66   1e-10
KLLA0F21406g Chr6 complement(1996260..1998377) [2118 bp, 705 aa]...    67   1e-10
CAGL0G04345g Chr7 (408842..410977) [2136 bp, 711 aa] {ON} simila...    67   1e-10
TBLA0D04870 Chr4 complement(1194448..1195431) [984 bp, 327 aa] {...    66   1e-10
Suva_6.187 Chr6 complement(344709..346853) [2145 bp, 714 aa] {ON...    67   1e-10
KLTH0D11132g Chr4 (910259..911572) [1314 bp, 437 aa] {ON} simila...    67   1e-10
Smik_10.126 Chr10 (196821..198959) [2139 bp, 712 aa] {ON} YJL112...    67   1e-10
Kwal_55.22067 s55 complement(1094600..1095955) [1356 bp, 451 aa]...    67   1e-10
KNAG0C01410 Chr3 (277054..279015) [1962 bp, 653 aa] {ON} Anc_1.2...    67   1e-10
Kwal_0.212 s0 (105364..106275) [912 bp, 303 aa] {ON} YNL006W (LS...    65   1e-10
CAGL0K09284g Chr11 (915766..918501) [2736 bp, 911 aa] {ON} highl...    67   1e-10
Ecym_3619 Chr3 (1183531..1185666) [2136 bp, 711 aa] {ON} similar...    67   1e-10
NCAS0C04450 Chr3 (912688..914073) [1386 bp, 461 aa] {ON} Anc_3.25      66   2e-10
CAGL0L03201g Chr12 complement(368792..370531) [1740 bp, 579 aa] ...    67   2e-10
Suva_3.93 Chr3 complement(133524..136286) [2763 bp, 920 aa] {ON}...    67   2e-10
Kpol_1016.11 s1016 (27192..29201) [2010 bp, 669 aa] {ON} (27192....    67   2e-10
SAKL0D04796g Chr4 (372598..374907) [2310 bp, 769 aa] {ON} simila...    67   2e-10
TDEL0A07400 Chr1 complement(1292494..1295199) [2706 bp, 901 aa] ...    67   2e-10
KNAG0B01610 Chr2 (294433..296457) [2025 bp, 674 aa] {ON} Anc_1.2...    67   2e-10
KAFR0E00180 Chr5 complement(35535..37721) [2187 bp, 728 aa] {ON}...    67   2e-10
KNAG0B06260 Chr2 complement(1228060..1230876) [2817 bp, 938 aa] ...    67   2e-10
ZYRO0F07282g Chr6 (590095..591378) [1284 bp, 427 aa] {ON} simila...    66   2e-10
ZYRO0D03828g Chr4 (310049..312229) [2181 bp, 726 aa] {ON} simila...    66   2e-10
NDAI0A03310 Chr1 (750920..753373) [2454 bp, 817 aa] {ON} Anc_4.106     66   3e-10
Kwal_26.8776 s26 (938508..939809) [1302 bp, 433 aa] {ON} YPL151C...    65   3e-10
Suva_10.525 Chr10 complement(900164..902983) [2820 bp, 939 aa] {...    66   3e-10
TBLA0C02090 Chr3 complement(495831..498683) [2853 bp, 950 aa] {O...    66   3e-10
Skud_7.135 Chr7 (254246..254263,254479..257154) [2694 bp, 897 aa...    66   3e-10
YPR178W Chr16 (892332..893729) [1398 bp, 465 aa] {ON}  PRP4Splic...    65   3e-10
TBLA0E00760 Chr5 (158338..159492) [1155 bp, 384 aa] {ON}               65   3e-10
CAGL0M08646g Chr13 (861488..862501) [1014 bp, 337 aa] {ON} simil...    65   3e-10
ADL184W Chr4 (375530..376879) [1350 bp, 449 aa] {ON} Syntenic ho...    65   3e-10
Ecym_2093 Chr2 (165578..168349) [2772 bp, 923 aa] {ON} similar t...    66   3e-10
KAFR0H02450 Chr8 complement(468767..470020) [1254 bp, 417 aa] {O...    65   4e-10
TDEL0F00270 Chr6 complement(40832..42949) [2118 bp, 705 aa] {ON}...    65   5e-10
CAGL0H08932g Chr8 (871668..871685,872089..874779) [2709 bp, 902 ...    65   5e-10
Smik_16.442 Chr16 (754983..756395) [1413 bp, 470 aa] {ON} YPR178...    65   6e-10
TBLA0B08730 Chr2 complement(2077729..2079114) [1386 bp, 461 aa] ...    65   6e-10
Ecym_2026 Chr2 (42179..43534) [1356 bp, 451 aa] {ON} similar to ...    64   6e-10
CAGL0M04081g Chr13 complement(450572..451939) [1368 bp, 455 aa] ...    64   7e-10
YLR409C Chr12 complement(934414..937233) [2820 bp, 939 aa] {ON} ...    65   7e-10
TPHA0D03830 Chr4 complement(802754..805492) [2739 bp, 912 aa] {O...    65   8e-10
Kpol_1072.17 s1072 complement(40550..41851) [1302 bp, 433 aa] {O...    64   8e-10
NDAI0J02410 Chr10 complement(586395..589244) [2850 bp, 949 aa] {...    65   9e-10
KLTH0F16764g Chr6 complement(1358483..1359478) [996 bp, 331 aa] ...    63   9e-10
KNAG0A01250 Chr1 (23559..24917) [1359 bp, 452 aa] {ON} Anc_3.25 ...    64   1e-09
KLTH0A02750g Chr1 complement(239284..241545) [2262 bp, 753 aa] {...    64   1e-09
ZYRO0C11242g Chr3 complement(871160..872170) [1011 bp, 336 aa] {...    63   1e-09
AEL314W Chr5 (52978..55125) [2148 bp, 715 aa] {ON} Syntenic homo...    64   1e-09
KAFR0I02840 Chr9 complement(570039..571409) [1371 bp, 456 aa] {O...    64   1e-09
Skud_10.102 Chr10 (173179..175305) [2127 bp, 708 aa] {ON} YJL112...    64   1e-09
Ecym_5501 Chr5 (1021675..1022658) [984 bp, 327 aa] {ON} similar ...    62   1e-09
Skud_11.7 Chr11 complement(15413..17566) [2154 bp, 717 aa] {ON} ...    64   1e-09
NDAI0B05190 Chr2 complement(1269217..1271223) [2007 bp, 668 aa] ...    64   2e-09
YKR036C Chr11 complement(508702..510633) [1932 bp, 643 aa] {ON} ...    64   2e-09
CAGL0M09845g Chr13 (975007..977817) [2811 bp, 936 aa] {ON} highl...    64   2e-09
KLLA0B02827g Chr2 (254447..257275) [2829 bp, 942 aa] {ON} highly...    64   2e-09
SAKL0G15994g Chr7 complement(1374780..1377614) [2835 bp, 944 aa]...    64   2e-09
SAKL0G02398g Chr7 complement(200123..201538) [1416 bp, 471 aa] {...    63   2e-09
Kwal_23.4118 s23 (579251..582070) [2820 bp, 939 aa] {ON} YLR409C...    64   2e-09
Kpol_1032.61 s1032 (141357..143825) [2469 bp, 822 aa] {ON} (1413...    63   2e-09
KLLA0B14410g Chr2 (1264616..1266736) [2121 bp, 706 aa] {ON} simi...    63   2e-09
TBLA0C01840 Chr3 (435021..436292) [1272 bp, 423 aa] {ON} Anc_8.6...    62   3e-09
TDEL0A06180 Chr1 (1082208..1083512) [1305 bp, 434 aa] {ON} Anc_8...    62   3e-09
KLTH0D14960g Chr4 complement(1223765..1226584) [2820 bp, 939 aa]...    63   3e-09
KAFR0I01050 Chr9 complement(205792..208320) [2529 bp, 842 aa] {O...    63   3e-09
Kwal_55.21559 s55 complement(889630..890685) [1056 bp, 351 aa] {...    62   3e-09
AFL056C Chr6 complement(329216..332146) [2931 bp, 976 aa] {ON} S...    63   3e-09
ZYRO0F09922g Chr6 complement(805666..807033) [1368 bp, 455 aa] {...    62   3e-09
ZYRO0G02420g Chr7 (184509..186686) [2178 bp, 725 aa] {ON} simila...    63   3e-09
NCAS0D04480 Chr4 complement(851440..854187) [2748 bp, 915 aa] {O...    63   4e-09
TBLA0A09610 Chr1 (2369818..2370978) [1161 bp, 386 aa] {ON} Anc_5...    62   4e-09
CAGL0C02937g Chr3 (290289..291692) [1404 bp, 467 aa] {ON} simila...    62   4e-09
CAGL0L02629g Chr12 complement(309320..311707) [2388 bp, 795 aa] ...    62   4e-09
CAGL0M02277g Chr13 complement(271836..273119) [1284 bp, 427 aa] ...    62   4e-09
ZYRO0D08558g Chr4 (736975..739713) [2739 bp, 912 aa] {ON} highly...    62   5e-09
KAFR0J02550 Chr10 complement(484360..487080) [2721 bp, 906 aa] {...    62   5e-09
NDAI0I00460 Chr9 (91809..94562) [2754 bp, 917 aa] {ON} Anc_6.325       62   5e-09
TDEL0E00950 Chr5 (197384..200206) [2823 bp, 940 aa] {ON} Anc_4.2...    62   5e-09
ZYRO0B12980g Chr2 complement(1045283..1048102) [2820 bp, 939 aa]...    62   5e-09
Smik_2.112 Chr2 (202544..205069) [2526 bp, 841 aa] {ON} YBL008W ...    62   5e-09
Kwal_27.12667 s27 complement(1325822..1327987) [2166 bp, 721 aa]...    62   5e-09
Suva_2.117 Chr2 (203652..206174) [2523 bp, 840 aa] {ON} YBL008W ...    62   5e-09
NCAS0C01680 Chr3 (309670..310965) [1296 bp, 431 aa] {ON} Anc_8.672     61   6e-09
KLLA0F11231g Chr6 complement(1034708..1036012) [1305 bp, 434 aa]...    61   6e-09
YJL112W Chr10 (205305..207449) [2145 bp, 714 aa] {ON}  MDV1Perip...    62   6e-09
ZYRO0G03586g Chr7 (285054..287969) [2916 bp, 971 aa] {ON} simila...    62   6e-09
Ecym_2239 Chr2 complement(467139..470081) [2943 bp, 980 aa] {ON}...    62   6e-09
TDEL0F01740 Chr6 complement(322088..325102) [3015 bp, 1004 aa] {...    62   6e-09
NDAI0G05340 Chr7 (1301733..1303889) [2157 bp, 718 aa] {ON} Anc_1...    62   6e-09
Kwal_27.12239 s27 complement(1143763..1144713) [951 bp, 316 aa] ...    60   6e-09
NDAI0G00150 Chr7 complement(18719..20887) [2169 bp, 722 aa] {ON}...    62   7e-09
YBL008W Chr2 (209653..212175) [2523 bp, 840 aa] {ON}  HIR1Subuni...    62   7e-09
NCAS0C03990 Chr3 complement(804313..806505) [2193 bp, 730 aa] {O...    62   7e-09
CAGL0E02805g Chr5 complement(265374..267896) [2523 bp, 840 aa] {...    62   8e-09
KLLA0E21781g Chr5 complement(1944865..1945866) [1002 bp, 333 aa]...    60   8e-09
Skud_2.103 Chr2 (193155..195677) [2523 bp, 840 aa] {ON} YBL008W ...    62   8e-09
KNAG0G00130 Chr7 complement(8702..10888) [2187 bp, 728 aa] {ON} ...    61   8e-09
NDAI0A02880 Chr1 (644069..647938) [3870 bp, 1289 aa] {ON} Anc_7....    62   9e-09
NDAI0E02400 Chr5 (499223..500527) [1305 bp, 434 aa] {ON} Anc_8.672     60   9e-09
SAKL0A10406g Chr1 (910452..912587) [2136 bp, 711 aa] {ON} simila...    61   1e-08
KLLA0E18899g Chr5 (1680775..1683747) [2973 bp, 990 aa] {ON} simi...    61   1e-08
KNAG0I02540 Chr9 (489509..492265) [2757 bp, 918 aa] {ON} Anc_6.3...    61   1e-08
SAKL0B02244g Chr2 (212226..214547) [2322 bp, 773 aa] {ON} simila...    61   1e-08
TPHA0C00320 Chr3 (53120..54184) [1065 bp, 354 aa] {ON} Anc_5.631...    60   1e-08
KLTH0E15576g Chr5 complement(1384027..1386198) [2172 bp, 723 aa]...    61   1e-08
KNAG0C02890 Chr3 (571926..574418) [2493 bp, 830 aa] {ON} Anc_4.1...    61   1e-08
AER448W Chr5 (1497416..1499560) [2145 bp, 714 aa] {ON} Syntenic ...    61   1e-08
AER081C Chr5 complement(785301..788372) [3072 bp, 1023 aa] {ON} ...    61   1e-08
KLTH0E08162g Chr5 complement(749584..751254) [1671 bp, 556 aa] {...    60   1e-08
Kwal_47.17555 s47 complement(453984..455237) [1254 bp, 417 aa] {...    60   1e-08
TBLA0H03060 Chr8 complement(748221..750413) [2193 bp, 730 aa] {O...    61   1e-08
Kpol_1050.33 s1050 complement(78024..80390) [2367 bp, 788 aa] {O...    61   1e-08
SAKL0G01760g Chr7 (147664..148656) [993 bp, 330 aa] {ON} highly ...    59   1e-08
Ecym_3243 Chr3 (460611..463448) [2838 bp, 945 aa] {ON} similar t...    61   1e-08
NDAI0I00880 Chr9 complement(203097..205763) [2667 bp, 888 aa] {O...    60   2e-08
Suva_16.159 Chr16 complement(275378..276733) [1356 bp, 451 aa] {...    60   2e-08
KLTH0E13552g Chr5 complement(1202406..1203356) [951 bp, 316 aa] ...    59   2e-08
NCAS0G04300 Chr7 (799388..801565) [2178 bp, 725 aa] {ON} Anc_1.5...    60   2e-08
NDAI0G03310 Chr7 complement(777538..780195) [2658 bp, 885 aa] {O...    60   2e-08
KAFR0A05800 Chr1 (1177423..1180245) [2823 bp, 940 aa] {ON} Anc_4...    60   2e-08
TBLA0C04110 Chr3 complement(994729..997278) [2550 bp, 849 aa] {O...    60   2e-08
NCAS0J01650 Chr10 complement(294247..297069) [2823 bp, 940 aa] {...    60   2e-08
NDAI0H00820 Chr8 (185870..186940) [1071 bp, 356 aa] {ON} Anc_5.6...    59   2e-08
KLTH0D04950g Chr4 complement(449060..451402) [2343 bp, 780 aa] {...    60   2e-08
TPHA0A03680 Chr1 complement(804355..806004) [1650 bp, 549 aa] {O...    60   3e-08
TPHA0F00550 Chr6 complement(127250..129736) [2487 bp, 828 aa] {O...    60   3e-08
Smik_2.243 Chr2 (432627..434252) [1626 bp, 541 aa] {ON} YBR103W ...    59   3e-08
AGR168W Chr7 (1061516..1063993) [2478 bp, 825 aa] {ON} Syntenic ...    60   3e-08
NDAI0I01520 Chr9 complement(358776..360710) [1935 bp, 644 aa] {O...    59   3e-08
KLTH0B00924g Chr2 complement(79302..81446) [2145 bp, 714 aa] {ON...    59   3e-08
Kwal_26.7570 s26 (423448..424104) [657 bp, 218 aa] {ON} YMR116C ...    57   3e-08
TBLA0D05560 Chr4 complement(1366222..1367991) [1770 bp, 589 aa] ...    59   3e-08
Skud_16.482 Chr16 (834842..836239) [1398 bp, 465 aa] {ON} YPR178...    59   3e-08
AAR057W Chr1 (442821..445589) [2769 bp, 922 aa] {ON} Syntenic ho...    60   3e-08
Kwal_33.15591 s33 (1174119..1176263) [2145 bp, 714 aa] {ON} YKL2...    59   3e-08
AER255C Chr5 complement(1107932..1109335) [1404 bp, 467 aa] {ON}...    59   4e-08
NDAI0B05630 Chr2 complement(1376242..1377549) [1308 bp, 435 aa] ...    59   4e-08
Kwal_23.5035 s23 (975572..977806) [2235 bp, 744 aa] {ON} YFL009W...    59   4e-08
KAFR0H00550 Chr8 (97619..98683) [1065 bp, 354 aa] {ON} Anc_5.631...    58   4e-08
NCAS0I01170 Chr9 complement(210377..212017) [1641 bp, 546 aa] {O...    59   4e-08
NCAS0A03470 Chr1 (684361..686811) [2451 bp, 816 aa] {ON} Anc_4.106     59   4e-08
Kpol_1054.60 s1054 (148854..151013) [2160 bp, 719 aa] {ON} (1488...    59   5e-08
YPL151C Chr16 complement(266180..267535) [1356 bp, 451 aa] {ON} ...    58   5e-08
Suva_16.126 Chr16 complement(209255..212296) [3042 bp, 1013 aa] ...    59   6e-08
KAFR0A06480 Chr1 complement(1312834..1314540) [1707 bp, 568 aa] ...    59   6e-08
Smik_6.348 Chr6 (556719..558074) [1356 bp, 451 aa] {ON} YPL151C ...    58   7e-08
KNAG0G01080 Chr7 (235280..237520) [2241 bp, 746 aa] {ON}  YER066W      58   7e-08
CAGL0A02772g Chr1 complement(293966..295291) [1326 bp, 441 aa] {...    58   7e-08
KLLA0E24487g Chr5 complement(2175775..2176758) [984 bp, 327 aa] ...    57   7e-08
TDEL0C00940 Chr3 (150797..152719) [1923 bp, 640 aa] {ON} Anc_8.6...    58   8e-08
NCAS0B01910 Chr2 (312479..313456) [978 bp, 325 aa] {ON} Anc_8.585      57   9e-08
TDEL0F02230 Chr6 (407699..409369) [1671 bp, 556 aa] {ON} Anc_4.1...    58   9e-08
Kwal_33.13515 s33 (259533..260729) [1197 bp, 398 aa] {ON} YNL253...    57   9e-08
Skud_4.530 Chr4 complement(945231..946247) [1017 bp, 338 aa] {ON...    57   9e-08
TDEL0F02410 Chr6 complement(447058..449568) [2511 bp, 836 aa] {O...    58   1e-07
Smik_2.315 Chr2 (568572..569519) [948 bp, 315 aa] {ON} YBR175W (...    57   1e-07
KLTH0D15840g Chr4 (1305121..1305125,1305195..1307283) [2094 bp, ...    58   1e-07
KAFR0E03900 Chr5 complement(771649..772968) [1320 bp, 439 aa] {O...    57   1e-07
NDAI0C05770 Chr3 complement(1328677..1329684) [1008 bp, 335 aa] ...    57   1e-07
Skud_16.96 Chr16 complement(172716..175757) [3042 bp, 1013 aa] {...    58   1e-07
Suva_4.427 Chr4 (751909..752856) [948 bp, 315 aa] {ON} YBR175W (...    56   1e-07
KLLA0C08976g Chr3 (784536..787271) [2736 bp, 911 aa] {ON} highly...    58   1e-07
NCAS0A09610 Chr1 complement(1920171..1922258) [2088 bp, 695 aa] ...    57   1e-07
TPHA0G02840 Chr7 (604491..605033) [543 bp, 180 aa] {ON} Anc_2.43...    54   1e-07
KLLA0A04928g Chr1 (439349..441934) [2586 bp, 861 aa] {ON} simila...    57   1e-07
TPHA0J02160 Chr10 (484299..487313) [3015 bp, 1004 aa] {ON} Anc_6...    57   1e-07
Smik_6.70 Chr6 (129582..131933) [2352 bp, 783 aa] {ON} YFL009W (...    57   1e-07
KLTH0E08096g Chr5 complement(743809..745041) [1233 bp, 410 aa] {...    57   1e-07
Skud_16.131 Chr16 complement(237797..239152) [1356 bp, 451 aa] {...    57   2e-07
KAFR0C03190 Chr3 complement(639680..641698) [2019 bp, 672 aa] {O...    57   2e-07
TDEL0C04860 Chr3 (881043..882584) [1542 bp, 513 aa] {ON} Anc_3.3...    57   2e-07
NCAS0H01060 Chr8 complement(197867..200875) [3009 bp, 1002 aa] {...    57   2e-07
SAKL0H22396g Chr8 complement(1949474..1951141) [1668 bp, 555 aa]...    57   2e-07
Smik_6.388 Chr6 (622104..625145) [3042 bp, 1013 aa] {ON} YPL183C...    57   2e-07
NDAI0F02240 Chr6 (542551..545610) [3060 bp, 1019 aa] {ON} Anc_6....    57   2e-07
Suva_5.178 Chr5 (266333..267301) [969 bp, 322 aa] {ON} YFL009W (...    55   2e-07
Ecym_5528 Chr5 complement(1070598..1072013) [1416 bp, 471 aa] {O...    56   2e-07
Kwal_27.11126 s27 (651113..654103) [2991 bp, 996 aa] {ON} YPL183...    57   3e-07
ZYRO0G10472g Chr7 complement(844939..846621) [1683 bp, 560 aa] {...    56   3e-07
NDAI0F04030 Chr6 complement(958364..959839) [1476 bp, 491 aa] {O...    56   3e-07
NCAS0F03340 Chr6 complement(675569..676915) [1347 bp, 448 aa] {O...    55   4e-07
TPHA0D00580 Chr4 (100671..102869) [2199 bp, 732 aa] {ON} Anc_8.6...    56   4e-07
Suva_11.7 Chr11 complement(15456..17615) [2160 bp, 719 aa] {ON} ...    56   4e-07
Ecym_7301 Chr7 (634995..637349) [2355 bp, 784 aa] {ON} similar t...    56   4e-07
TBLA0D02630 Chr4 (645439..648027) [2589 bp, 862 aa] {ON} Anc_8.6...    56   4e-07
KAFR0A00600 Chr1 (108157..110841) [2685 bp, 894 aa] {ON} Anc_2.4...    56   4e-07
TPHA0E01790 Chr5 (359679..361004) [1326 bp, 441 aa] {ON} Anc_5.4...    55   4e-07
TPHA0G02570 Chr7 (531221..532261) [1041 bp, 346 aa] {ON} Anc_2.3...    55   4e-07
Skud_6.63 Chr6 (118478..120823) [2346 bp, 781 aa] {ON} YFL009W (...    56   4e-07
KAFR0B06670 Chr2 (1390238..1393234) [2997 bp, 998 aa] {ON} Anc_6...    56   5e-07
TPHA0G02030 Chr7 (417868..418911) [1044 bp, 347 aa] {ON} Anc_2.3...    55   5e-07
Kpol_1011.6 s1011 complement(17489..19777) [2289 bp, 762 aa] {ON...    55   5e-07
ZYRO0G10054g Chr7 (802784..805312) [2529 bp, 842 aa] {ON} simila...    55   5e-07
NDAI0A07830 Chr1 (1802204..1804156) [1953 bp, 650 aa] {ON} Anc_3...    55   6e-07
Smik_4.518 Chr4 complement(935380..936372) [993 bp, 330 aa] {ON}...    54   6e-07
KLTH0F16192g Chr6 (1312331..1313719) [1389 bp, 462 aa] {ON} simi...    55   6e-07
CAGL0F06853g Chr6 (671942..673108) [1167 bp, 388 aa] {ON} highly...    55   6e-07
SAKL0A05412g Chr1 complement(489032..492025) [2994 bp, 997 aa] {...    55   6e-07
YBR103W Chr2 (447709..449316) [1608 bp, 535 aa] {ON}  SIF2WD40 r...    55   6e-07
TDEL0A04970 Chr1 complement(877816..878817) [1002 bp, 333 aa] {O...    54   7e-07
ZYRO0F09284g Chr6 (754433..755767) [1335 bp, 444 aa] {ON} simila...    55   7e-07
Kwal_26.8953 s26 (1017811..1019187) [1377 bp, 458 aa] {ON} YOR26...    55   7e-07
YBR175W Chr2 (582408..583355) [948 bp, 315 aa] {ON}  SWD3Essenti...    54   7e-07
Kpol_1064.35 s1064 (64223..65584) [1362 bp, 453 aa] {ON} (64223....    55   7e-07
YPL183C Chr16 complement(199495..202536) [3042 bp, 1013 aa] {ON}...    55   7e-07
TDEL0E01960 Chr5 (369744..371102) [1359 bp, 452 aa] {ON} Anc_5.4...    55   8e-07
Smik_5.200 Chr5 (297829..299004) [1176 bp, 391 aa] {ON} YFL009W ...    54   8e-07
KAFR0G01710 Chr7 (373483..375048) [1566 bp, 521 aa] {ON} Anc_3.3...    55   9e-07
AGL024W Chr7 (667533..669803) [2271 bp, 756 aa] {ON} Syntenic ho...    55   9e-07
CAGL0M06193g Chr13 (643917..644867) [951 bp, 316 aa] {ON} simila...    54   9e-07
KLLA0D07546g Chr4 complement(647984..649927) [1944 bp, 647 aa] {...    55   1e-06
CAGL0K12188g Chr11 (1192017..1193624) [1608 bp, 535 aa] {ON} sim...    54   1e-06
TBLA0G01490 Chr7 (389958..392156) [2199 bp, 732 aa] {ON} Anc_4.1...    55   1e-06
Ecym_2356 Chr2 complement(697428..698819) [1392 bp, 463 aa] {ON}...    54   1e-06
YDR267C Chr4 complement(1002510..1003502) [993 bp, 330 aa] {ON} ...    54   1e-06
ABL024W Chr2 (353682..355886) [2205 bp, 734 aa] {ON} Syntenic ho...    54   1e-06
Kpol_1061.36 s1061 (100800..102569) [1770 bp, 589 aa] {ON} (1008...    54   1e-06
Ecym_6169 Chr6 complement(314473..316128) [1656 bp, 551 aa] {ON}...    54   1e-06
Kwal_47.17572 s47 complement(461322..462626) [1305 bp, 434 aa] {...    54   1e-06
Kpol_1048.38 s1048 (104927..105949) [1023 bp, 340 aa] {ON} (1049...    54   1e-06
CAGL0C01441g Chr3 complement(156930..159947) [3018 bp, 1005 aa] ...    54   1e-06
YKL213C Chr11 complement(31960..34107) [2148 bp, 715 aa] {ON}  D...    54   1e-06
Kpol_1072.41 s1072 complement(90370..91632) [1263 bp, 420 aa] {O...    54   1e-06
TBLA0C00990 Chr3 (195791..196972) [1182 bp, 393 aa] {ON} Anc_2.6...    54   1e-06
NDAI0C00170 Chr3 complement(24683..25888) [1206 bp, 401 aa] {ON}...    54   1e-06
NCAS0J01100 Chr10 (187994..189307) [1314 bp, 437 aa] {ON} Anc_4....    54   2e-06
Ecym_7078 Chr7 complement(156495..157436) [942 bp, 313 aa] {ON} ...    53   2e-06
Suva_4.348 Chr4 (616802..618448) [1647 bp, 548 aa] {ON} YBR103W ...    54   2e-06
ZYRO0G10406g Chr7 complement(839502..840677) [1176 bp, 391 aa] {...    53   2e-06
Ecym_7229 Chr7 (475040..477529) [2490 bp, 829 aa] {ON} similar t...    54   2e-06
Kpol_1002.74 s1002 complement(195739..198756) [3018 bp, 1005 aa]...    54   2e-06
ZYRO0F03784g Chr6 (314914..317247) [2334 bp, 777 aa] {ON} simila...    54   2e-06
Suva_6.51 Chr6 (88465..90756) [2292 bp, 763 aa] {ON} YFL009W (REAL)    54   2e-06
TPHA0F00770 Chr6 (175091..176986) [1896 bp, 631 aa] {ON} Anc_4.1...    54   2e-06
KAFR0F02590 Chr6 complement(504740..506842) [2103 bp, 700 aa] {O...    54   2e-06
NCAS0B00480 Chr2 (69598..70968) [1371 bp, 456 aa] {ON} Anc_8.721       53   2e-06
KAFR0L01320 Chr12 complement(244228..247950) [3723 bp, 1240 aa] ...    54   2e-06
TDEL0A05290 Chr1 complement(933493..934452) [960 bp, 319 aa] {ON...    52   2e-06
KAFR0C03830 Chr3 complement(776653..777798) [1146 bp, 381 aa] {O...    53   2e-06
CAGL0L02761g Chr12 complement(322823..324082) [1260 bp, 419 aa] ...    53   2e-06
NDAI0A01560 Chr1 (352038..353129) [1092 bp, 363 aa] {ON} Anc_5.6...    53   2e-06
ZYRO0F14960g Chr6 complement(1228479..1229438) [960 bp, 319 aa] ...    52   2e-06
Skud_2.229 Chr2 (415869..417506) [1638 bp, 545 aa] {ON} YBR103W ...    53   2e-06
YDR364C Chr4 complement(1202843..1204210) [1368 bp, 455 aa] {ON}...    53   3e-06
NCAS0J01110 Chr10 (189535..191322) [1788 bp, 595 aa] {ON}              53   3e-06
KLTH0D12188g Chr4 (990209..991582) [1374 bp, 457 aa] {ON} simila...    53   3e-06
YFL009W Chr6 (116145..118484) [2340 bp, 779 aa] {ON}  CDC4F-box ...    53   3e-06
Kpol_1058.31 s1058 (85899..87926) [2028 bp, 675 aa] {ON} (85899....    53   3e-06
YGL116W Chr7 (289809..291641) [1833 bp, 610 aa] {ON}  CDC20Cell-...    53   3e-06
KNAG0I01050 Chr9 complement(200338..203817) [3480 bp, 1159 aa] {...    53   3e-06
NCAS0D03330 Chr4 (623172..625046) [1875 bp, 624 aa] {ON} Anc_6.135     53   3e-06
Kwal_26.7655 s26 complement(460957..463188) [2232 bp, 743 aa] {O...    53   3e-06
Suva_2.435 Chr2 complement(769135..770127) [993 bp, 330 aa] {ON}...    52   4e-06
AGR207C Chr7 complement(1146704..1147666) [963 bp, 320 aa] {ON} ...    52   4e-06
KNAG0H00180 Chr8 complement(26550..27719) [1170 bp, 389 aa] {ON}...    52   4e-06
SAKL0B07458g Chr2 (642864..644393) [1530 bp, 509 aa] {ON} simila...    52   4e-06
TPHA0G01840 Chr7 complement(379782..381077) [1296 bp, 431 aa] {O...    52   4e-06
KLLA0D02530g Chr4 complement(212703..214826) [2124 bp, 707 aa] {...    52   4e-06
TBLA0A03750 Chr1 complement(937167..938510) [1344 bp, 447 aa] {O...    52   4e-06
NCAS0H03530 Chr8 (671246..672400) [1155 bp, 384 aa] {ON} Anc_2.663     52   5e-06
SAKL0H08932g Chr8 (763703..764647) [945 bp, 314 aa] {ON} similar...    51   5e-06
KAFR0I00500 Chr9 complement(104685..106268) [1584 bp, 527 aa] {O...    52   5e-06
NDAI0J01850 Chr10 (461283..463010) [1728 bp, 575 aa] {ON} Anc_4....    52   5e-06
KLTH0D12276g Chr4 (998921..1000258) [1338 bp, 445 aa] {ON} highl...    52   5e-06
Skud_4.63 Chr4 (104587..108408) [3822 bp, 1273 aa] {ON} YDL195W ...    52   6e-06
KLTH0H05038g Chr8 complement(449230..452217) [2988 bp, 995 aa] {...    52   6e-06
ZYRO0C15994g Chr3 (1255015..1256529) [1515 bp, 504 aa] {ON} simi...    52   7e-06
KLLA0E11331g Chr5 complement(994770..996308) [1539 bp, 512 aa] {...    52   7e-06
CAGL0J04818g Chr10 (458449..460413) [1965 bp, 654 aa] {ON} highl...    52   7e-06
KAFR0A00700 Chr1 (126326..128149) [1824 bp, 607 aa] {ON} Anc_2.4...    52   8e-06
Smik_7.159 Chr7 (285146..286981) [1836 bp, 611 aa] {ON} YGL116W ...    52   8e-06
NCAS0E03750 Chr5 complement(736672..740502) [3831 bp, 1276 aa] {...    52   8e-06
Kwal_56.24163 s56 complement(879667..881856) [2190 bp, 729 aa] {...    52   8e-06
Suva_2.537 Chr2 complement(959258..960625) [1368 bp, 455 aa] {ON...    51   8e-06
KLLA0E07965g Chr5 (717476..718648) [1173 bp, 390 aa] {ON} simila...    51   9e-06
Skud_7.160 Chr7 (294214..296055) [1842 bp, 613 aa] {ON} YGL116W ...    51   9e-06
KLLA0E21187g Chr5 (1892524..1893813) [1290 bp, 429 aa] {ON} simi...    51   9e-06
ADL322C Chr4 complement(128828..130333) [1506 bp, 501 aa] {ON} S...    51   9e-06
KAFR0A00690 Chr1 complement(124349..125875) [1527 bp, 508 aa] {O...    51   1e-05
NCAS0A04400 Chr1 (888188..890743) [2556 bp, 851 aa] {ON} Anc_2.4...    51   1e-05
KNAG0G02820 Chr7 (623677..625050) [1374 bp, 457 aa] {ON} Anc_8.7...    51   1e-05
ACR091W Chr3 (520609..521595) [987 bp, 328 aa] {ON} Syntenic hom...    50   1e-05
Suva_7.152 Chr7 (284623..286461) [1839 bp, 612 aa] {ON} YGL116W ...    51   1e-05
Kpol_1065.30 s1065 complement(61425..62993) [1569 bp, 522 aa] {O...    51   1e-05
Ecym_7149 Chr7 (308042..309139) [1098 bp, 365 aa] {ON} similar t...    50   1e-05
Suva_13.325 Chr13 complement(536805..537848) [1044 bp, 347 aa] {...    50   1e-05
SAKL0E03520g Chr5 complement(283754..286654) [2901 bp, 966 aa] {...    51   1e-05
KNAG0A03450 Chr1 (439716..440648) [933 bp, 310 aa] {ON} Anc_8.58...    50   1e-05
Kpol_1062.32 s1062 (69674..71074) [1401 bp, 466 aa] {ON} (69674....    51   1e-05
KLLA0A08822g Chr1 (772565..774313) [1749 bp, 582 aa] {ON} simila...    51   1e-05
Smik_11.10 Chr11 complement(16139..18292) [2154 bp, 717 aa] {ON}...    51   1e-05
KAFR0A05610 Chr1 complement(1126349..1128211) [1863 bp, 620 aa] ...    51   2e-05
ZYRO0G10494g Chr7 complement(846835..848133) [1299 bp, 432 aa] {...    50   2e-05
Suva_7.278 Chr7 complement(482297..483559) [1263 bp, 420 aa] {ON...    50   2e-05
AGL301C Chr7 complement(137221..138306) [1086 bp, 361 aa] {ON} S...    50   2e-05
YKL021C Chr11 complement(397344..398750) [1407 bp, 468 aa] {ON} ...    50   2e-05
Kpol_1032.65 s1032 complement(150052..151095) [1044 bp, 347 aa] ...    50   2e-05
TBLA0A03210 Chr1 complement(762289..764535) [2247 bp, 748 aa] {O...    50   2e-05
SAKL0A06534g Chr1 complement(584399..586162) [1764 bp, 587 aa] {...    50   2e-05
NDAI0K01410 Chr11 (321553..324486) [2934 bp, 977 aa] {ON} Anc_2....    51   2e-05
CAGL0A00605g Chr1 complement(67281..69203) [1923 bp, 640 aa] {ON...    50   2e-05
KNAG0A01610 Chr1 complement(84663..85270,85389..86376) [1596 bp,...    50   2e-05
Skud_7.284 Chr7 complement(495549..497249) [1701 bp, 566 aa] {ON...    50   2e-05
Suva_7.279 Chr7 complement(484066..485766) [1701 bp, 566 aa] {ON...    50   2e-05
KNAG0M00450 Chr13 complement(65548..68523) [2976 bp, 991 aa] {ON...    50   2e-05
CAGL0D02090g Chr4 (214357..214893,215564..215860) [834 bp, 277 a...    49   2e-05
Suva_8.318 Chr8 (565468..566961) [1494 bp, 497 aa] {ON} YOR269W ...    50   2e-05
Smik_7.287 Chr7 complement(484376..486076) [1701 bp, 566 aa] {ON...    50   2e-05
TPHA0P00330 Chr16 (63488..65419) [1932 bp, 643 aa] {ON} Anc_8.67...    50   2e-05
ADR176W Chr4 (1012411..1013796) [1386 bp, 461 aa] {ON} Syntenic ...    50   2e-05
Kpol_1057.12 s1057 (22322..23515) [1194 bp, 397 aa] {ON} (22322....    50   2e-05
KAFR0K01900 Chr11 complement(388463..389554) [1092 bp, 363 aa] {...    49   3e-05
Smik_13.289 Chr13 complement(454351..456864) [2514 bp, 837 aa] {...    50   3e-05
TBLA0B04070 Chr2 complement(930877..932130) [1254 bp, 417 aa] {O...    50   3e-05
KAFR0B05030 Chr2 (1040952..1041998) [1047 bp, 348 aa] {ON} Anc_2...    49   3e-05
KLLA0C07513g Chr3 complement(656060..657379) [1320 bp, 439 aa] {...    50   3e-05
YGL003C Chr7 complement(492474..494174) [1701 bp, 566 aa] {ON}  ...    50   3e-05
Kwal_47.17465 s47 (415977..418379) [2403 bp, 800 aa] {ON} YBL008...    50   3e-05
TBLA0A03890 Chr1 complement(973249..974337) [1089 bp, 362 aa] {O...    49   3e-05
NDAI0H02240 Chr8 complement(545073..546617) [1545 bp, 514 aa] {O...    50   3e-05
Smik_13.344 Chr13 complement(540043..541086) [1044 bp, 347 aa] {...    49   3e-05
Skud_13.307 Chr13 complement(530776..531819) [1044 bp, 347 aa] {...    49   3e-05
TDEL0C05940 Chr3 complement(1070975..1072264) [1290 bp, 429 aa] ...    49   3e-05
Ecym_6167 Chr6 complement(309181..310437) [1257 bp, 418 aa] {ON}...    49   3e-05
TPHA0B00590 Chr2 complement(134906..136672) [1767 bp, 588 aa] {O...    50   3e-05
Smik_15.451 Chr15 (775983..777467) [1485 bp, 494 aa] {ON} YOR269...    49   3e-05
TBLA0B09730 Chr2 (2309400..2310938) [1539 bp, 512 aa] {ON} Anc_2...    49   4e-05
ACR166W Chr3 (647933..649102) [1170 bp, 389 aa] {ON} Syntenic ho...    49   4e-05
Kpol_526.37 s526 complement(88726..89769) [1044 bp, 347 aa] {ON}...    49   4e-05
KAFR0F03340 Chr6 (656751..657980) [1230 bp, 409 aa] {ON} Anc_4.1...    49   4e-05
TPHA0F03650 Chr6 (793481..795703) [2223 bp, 740 aa] {ON} Anc_1.5...    49   4e-05
KNAG0B05550 Chr2 (1080707..1082560) [1854 bp, 617 aa] {ON} Anc_4...    49   4e-05
KAFR0B05580 Chr2 (1142731..1146093) [3363 bp, 1120 aa] {ON} Anc_...    50   4e-05
Ecym_5635 Chr5 (1285780..1286937) [1158 bp, 385 aa] {ON} similar...    49   4e-05
Suva_13.280 Chr13 complement(451520..454051) [2532 bp, 843 aa] {...    49   4e-05
ZYRO0D00616g Chr4 complement(47163..48347) [1185 bp, 394 aa] {ON...    49   4e-05
Skud_11.207 Chr11 complement(378222..379469) [1248 bp, 415 aa] {...    49   4e-05
ADR108C Chr4 complement(899198..900097) [900 bp, 299 aa] {ON} NO...    48   5e-05
SAKL0F10384g Chr6 complement(799553..803338) [3786 bp, 1261 aa] ...    49   5e-05
KAFR0I00640 Chr9 (128872..129819) [948 bp, 315 aa] {ON} Anc_8.58...    49   5e-05
Kwal_26.8975 s26 (1026741..1028078) [1338 bp, 445 aa] {ON} YOR27...    49   5e-05
SAKL0H07656g Chr8 complement(659189..660469) [1281 bp, 426 aa] {...    49   5e-05
YMR146C Chr13 complement(557481..558524) [1044 bp, 347 aa] {ON} ...    49   5e-05
TPHA0I01690 Chr9 (377629..378651) [1023 bp, 340 aa] {ON} Anc_8.5...    49   5e-05
NDAI0J01840 Chr10 (459174..460466) [1293 bp, 430 aa] {ON} Anc_4....    49   5e-05
YMR102C Chr13 complement(469848..472352) [2505 bp, 834 aa] {ON} ...    49   5e-05
TPHA0A04810 Chr1 complement(1090373..1092751) [2379 bp, 792 aa] ...    49   5e-05
ADR264C Chr4 complement(1158216..1159256) [1041 bp, 346 aa] {ON}...    49   5e-05
Skud_15.434 Chr15 (765132..766616) [1485 bp, 494 aa] {ON} YOR269...    49   5e-05
Suva_4.53 Chr4 (95619..99434) [3816 bp, 1271 aa] {ON} YDL195W (R...    49   6e-05
Kwal_47.17567 s47 complement(459443..461215) [1773 bp, 590 aa] {...    49   6e-05
NCAS0B01660 Chr2 complement(270046..271320) [1275 bp, 424 aa] {O...    49   6e-05
TDEL0A01730 Chr1 complement(310640..312433) [1794 bp, 597 aa] {O...    49   6e-05
SAKL0D02068g Chr4 (167213..168823) [1611 bp, 536 aa] {ON} simila...    49   6e-05
KNAG0C03490 Chr3 (684848..685936) [1089 bp, 362 aa] {ON} Anc_7.4...    48   6e-05
Suva_11.205 Chr11 complement(381101..382348) [1248 bp, 415 aa] {...    48   7e-05
TBLA0G02090 Chr7 (545989..547911) [1923 bp, 640 aa] {ON} Anc_4.3...    49   7e-05
SAKL0G19668g Chr7 (1695030..1696214) [1185 bp, 394 aa] {ON} simi...    48   7e-05
Ecym_6228 Chr6 (425765..427102) [1338 bp, 445 aa] {ON} similar t...    48   7e-05
ZYRO0A08184g Chr1 (655686..656726) [1041 bp, 346 aa] {ON} highly...    48   8e-05
YOR269W Chr15 (826385..827869) [1485 bp, 494 aa] {ON}  PAC1Prote...    48   8e-05
NCAS0D01130 Chr4 (208915..209958) [1044 bp, 347 aa] {ON} Anc_2.3...    48   8e-05
YDL195W Chr4 (107208..111029) [3822 bp, 1273 aa] {ON}  SEC31Comp...    49   8e-05
Smik_4.45 Chr4 (85422..89234) [3813 bp, 1270 aa] {ON} YDL195W (R...    49   8e-05
CAGL0L06952g Chr12 complement(782790..783833) [1044 bp, 347 aa] ...    48   8e-05
KLTH0C04378g Chr3 (381355..382860) [1506 bp, 501 aa] {ON} simila...    48   8e-05
Ecym_7373 Chr7 complement(776909..779269) [2361 bp, 786 aa] {ON}...    49   9e-05
NCAS0B03690 Chr2 complement(657488..660925) [3438 bp, 1145 aa] {...    49   9e-05
NCAS0C05310 Chr3 complement(1079501..1080550) [1050 bp, 349 aa] ...    48   9e-05
AGR367C Chr7 complement(1408852..1411167) [2316 bp, 771 aa] {ON}...    48   9e-05
KLTH0H15752g Chr8 complement(1359449..1360501) [1053 bp, 350 aa]...    47   1e-04
TBLA0H02380 Chr8 (568334..570721) [2388 bp, 795 aa] {ON} Anc_5.1...    48   1e-04
Skud_4.634 Chr4 complement(1131614..1132978) [1365 bp, 454 aa] {...    48   1e-04
KNAG0E02020 Chr5 (416909..417949) [1041 bp, 346 aa] {ON} Anc_2.3...    47   1e-04
TDEL0B07580 Chr2 (1329080..1330252) [1173 bp, 390 aa] {ON} Anc_2...    47   1e-04
KLTH0E07700g Chr5 (705358..707778) [2421 bp, 806 aa] {ON} simila...    48   1e-04
Suva_4.449 Chr4 complement(780822..782096) [1275 bp, 424 aa] {ON...    47   1e-04
KNAG0F02420 Chr6 complement(453743..455668) [1926 bp, 641 aa] {O...    48   1e-04
KLTH0B01628g Chr2 (129632..132004) [2373 bp, 790 aa] {ON} simila...    48   1e-04
Smik_11.233 Chr11 complement(384291..385538) [1248 bp, 415 aa] {...    47   1e-04
TPHA0N01850 Chr14 (393690..394910) [1221 bp, 406 aa] {ON} Anc_2....    47   1e-04
TDEL0A05770 Chr1 (1018340..1019641) [1302 bp, 433 aa] {ON} Anc_8...    47   1e-04
ZYRO0F05808g Chr6 complement(479060..482908) [3849 bp, 1282 aa] ...    48   1e-04
TDEL0D01090 Chr4 complement(204076..206004) [1929 bp, 642 aa] {O...    48   1e-04
Kwal_27.12586 s27 (1290276..1291805) [1530 bp, 509 aa] {ON} YBR1...    47   1e-04
AFL009C Chr6 complement(420007..421248) [1242 bp, 413 aa] {ON} S...    47   2e-04
NCAS0A02800 Chr1 (533712..535517) [1806 bp, 601 aa] {ON} Anc_4.3...    47   2e-04
CAGL0K00957g Chr11 (95657..98038) [2382 bp, 793 aa] {ON} similar...    47   2e-04
Skud_13.261 Chr13 complement(445193..447697) [2505 bp, 834 aa] {...    47   2e-04
Smik_12.525 Chr12 (919777..921735) [1959 bp, 652 aa] {ON} YLR429...    47   2e-04
TBLA0D04020 Chr4 complement(997081..1000617) [3537 bp, 1178 aa] ...    47   2e-04
ZYRO0C14564g Chr3 (1135755..1137491) [1737 bp, 578 aa] {ON} simi...    47   2e-04
Kwal_14.884 s14 complement(95068..96255) [1188 bp, 395 aa] {ON} ...    47   2e-04
KLTH0C00616g Chr3 complement(62501..63724) [1224 bp, 407 aa] {ON...    47   2e-04
SAKL0H22418g Chr8 complement(1951429..1952724) [1296 bp, 431 aa]...    47   2e-04
Kwal_34.15818 s34 (74248..75297) [1050 bp, 349 aa] {ON} YMR146C ...    47   2e-04
Kpol_1018.164 s1018 (420666..423203) [2538 bp, 845 aa] {ON} (420...    47   2e-04
TPHA0L01720 Chr12 (362572..363831) [1260 bp, 419 aa] {ON} Anc_8....    47   2e-04
Smik_4.631 Chr4 complement(1128746..1130113) [1368 bp, 455 aa] {...    47   2e-04
SAKL0F01804g Chr6 complement(151476..152714,152788..152790) [124...    47   2e-04
Kpol_1019.30 s1019 (56367..60125) [3759 bp, 1252 aa] {ON} (56367...    47   2e-04
KLLA0F07403g Chr6 (697593..698636) [1044 bp, 347 aa] {ON} simila...    46   3e-04
SAKL0F12782g Chr6 complement(999031..1000134) [1104 bp, 367 aa] ...    46   3e-04
Suva_1.74 Chr1 (131924..133210) [1287 bp, 428 aa] {ON} YAR003W (...    46   3e-04
Kpol_1024.39 s1024 complement(104336..105589) [1254 bp, 417 aa] ...    46   3e-04
NDAI0E00910 Chr5 complement(182574..183968) [1395 bp, 464 aa] {O...    46   3e-04
YLR429W Chr12 (990777..992732) [1956 bp, 651 aa] {ON}  CRN1Coron...    47   3e-04
KAFR0A06490 Chr1 complement(1314794..1316098) [1305 bp, 434 aa] ...    46   3e-04
Skud_7.283 Chr7 complement(493716..494972) [1257 bp, 418 aa] {ON...    46   3e-04
SAKL0E03080g Chr5 (253338..254885) [1548 bp, 515 aa] {ON} highly...    46   3e-04
SAKL0H21846g Chr8 (1905888..1908134) [2247 bp, 748 aa] {ON} simi...    46   4e-04
CAGL0G03399g Chr7 complement(325879..326988) [1110 bp, 369 aa] {...    46   4e-04
AAL157C Chr1 complement(70077..71516) [1440 bp, 479 aa] {ON} Syn...    46   4e-04
Suva_10.545 Chr10 (945641..947569) [1929 bp, 642 aa] {ON} YLR429...    46   4e-04
YER066W Chr5 (290242..290799) [558 bp, 185 aa] {ON}  RRT13Putati...    44   4e-04
NDAI0E01500 Chr5 complement(295871..297157) [1287 bp, 428 aa] {O...    46   4e-04
Kwal_56.24478 s56 complement(1010876..1014766) [3891 bp, 1296 aa...    46   4e-04
KLTH0H02134g Chr8 (191540..195439) [3900 bp, 1299 aa] {ON} simil...    46   4e-04
Kwal_56.23685 s56 complement(656691..659999) [3309 bp, 1102 aa] ...    46   4e-04
Kwal_55.21450 s55 (842483..843994) [1512 bp, 503 aa] {ON} YDR364...    46   5e-04
YGL213C Chr7 complement(90054..91247) [1194 bp, 397 aa] {ON}  SK...    45   5e-04
NCAS0B02170 Chr2 complement(354274..355518) [1245 bp, 414 aa] {O...    45   5e-04
KAFR0L01120 Chr12 complement(211027..212679) [1653 bp, 550 aa] {...    46   5e-04
CAGL0G00704g Chr7 (65805..67127) [1323 bp, 440 aa] {ON} similar ...    45   5e-04
CAGL0B03575g Chr2 complement(357525..358784) [1260 bp, 419 aa] {...    45   5e-04
TDEL0F02260 Chr6 (414020..415309) [1290 bp, 429 aa] {ON} Anc_4.1...    45   5e-04
Skud_2.321 Chr2 complement(577912..579180) [1269 bp, 422 aa] {ON...    45   5e-04
TDEL0B02980 Chr2 complement(529584..530822) [1239 bp, 412 aa] {O...    45   5e-04
Skud_12.521 Chr12 (924571..926508) [1938 bp, 645 aa] {ON} YLR429...    46   5e-04
Kpol_1045.33 s1045 (77282..78367) [1086 bp, 361 aa] {ON} (77284....    45   5e-04
NDAI0H03030 Chr8 complement(733181..734233) [1053 bp, 350 aa] {O...    45   5e-04
TPHA0E00770 Chr5 (154048..155115) [1068 bp, 355 aa] {ON} Anc_7.4...    45   6e-04
Kpol_1002.101 s1002 complement(252330..254240) [1911 bp, 636 aa]...    45   6e-04
KAFR0A04110 Chr1 (826618..828000) [1383 bp, 460 aa] {ON} Anc_8.7...    45   6e-04
Suva_8.265 Chr8 (481783..483054) [1272 bp, 423 aa] {ON} YOR212W ...    45   6e-04
KLLA0F10791g Chr6 complement(991642..993279) [1638 bp, 545 aa] {...    45   6e-04
Suva_2.291 Chr2 (504722..508177) [3456 bp, 1151 aa] {ON} YDR128W...    45   6e-04
Smik_4.374 Chr4 (670748..674206) [3459 bp, 1152 aa] {ON} YDR128W...    45   7e-04
KLTH0E08184g Chr5 complement(751459..752772) [1314 bp, 437 aa] {...    45   7e-04
SAKL0E03058g Chr5 complement(251271..253112) [1842 bp, 613 aa] {...    45   7e-04
TBLA0B03570 Chr2 complement(828308..829684) [1377 bp, 458 aa] {O...    45   7e-04
Skud_2.302 Chr2 (549799..550803) [1005 bp, 334 aa] {ON} YBR175W ...    45   7e-04
NDAI0E00950 Chr5 complement(192199..193734) [1536 bp, 511 aa] {O...    45   7e-04
NDAI0D04730 Chr4 (1109256..1111241) [1986 bp, 661 aa] {ON} Anc_4...    45   7e-04
CAGL0K00275g Chr11 complement(26129..28276) [2148 bp, 715 aa] {O...    45   8e-04
TBLA0A01540 Chr1 complement(355418..357592) [2175 bp, 724 aa] {O...    45   8e-04
Ecym_3481 Chr3 complement(897444..898958) [1515 bp, 504 aa] {ON}...    45   8e-04
Kpol_2001.68 s2001 complement(187786..188673) [888 bp, 295 aa] {...    44   8e-04
TDEL0E04280 Chr5 complement(799966..801411) [1446 bp, 481 aa] {O...    45   8e-04
ZYRO0G11660g Chr7 (924314..926665) [2352 bp, 783 aa] {ON} simila...    45   8e-04
NCAS0A14470 Chr1 complement(2848835..2849923) [1089 bp, 362 aa] ...    45   8e-04
YDR128W Chr4 (709549..712995) [3447 bp, 1148 aa] {ON}  MTC5Subun...    45   8e-04
AFL006C Chr6 complement(425925..427226) [1302 bp, 433 aa] {ON} S...    45   8e-04
KNAG0A03220 Chr1 complement(399879..401150) [1272 bp, 423 aa] {O...    45   8e-04
KLTH0H06160g Chr8 complement(538741..540465) [1725 bp, 574 aa] {...    45   9e-04
Suva_5.12 Chr5 (23273..24478) [1206 bp, 401 aa] {ON} YEL056W (REAL)    45   9e-04
KAFR0A07550 Chr1 (1523221..1524804) [1584 bp, 527 aa] {ON} Anc_2...    45   9e-04
Ecym_1202 Chr1 complement(408312..409565,409631..409633) [1257 b...    45   9e-04
NCAS0A07860 Chr1 (1563830..1565362) [1533 bp, 510 aa] {ON} Anc_2...    45   9e-04
KLLA0C07425g Chr3 complement(647673..649007) [1335 bp, 444 aa] {...    45   9e-04
Skud_4.389 Chr4 (681326..684781) [3456 bp, 1151 aa] {ON} YDR128W...    45   9e-04
TPHA0F00760 Chr6 (173015..174415) [1401 bp, 466 aa] {ON} Anc_4.1...    45   9e-04
SAKL0G16962g Chr7 (1463359..1463363,1463442..1465290) [1854 bp, ...    45   0.001
SAKL0E05368g Chr5 complement(444630..445679) [1050 bp, 349 aa] {...    44   0.001
Kwal_27.10785 s27 (495263..496366) [1104 bp, 367 aa] {ON} YER107...    45   0.001
KAFR0A05270 Chr1 complement(1043260..1044975) [1716 bp, 571 aa] ...    45   0.001
CAGL0J03344g Chr10 complement(324829..326460) [1632 bp, 543 aa] ...    45   0.001
KLTH0D10186g Chr4 (845352..846617) [1266 bp, 421 aa] {ON} simila...    45   0.001
Ecym_2139 Chr2 complement(262217..263524) [1308 bp, 435 aa] {ON}...    45   0.001
KLLA0D06787g Chr4 (586289..587599) [1311 bp, 436 aa] {ON} simila...    45   0.001
SAKL0C03344g Chr3 (315639..317087) [1449 bp, 482 aa] {ON} weakly...    45   0.001
Suva_8.321 Chr8 (572329..573711) [1383 bp, 460 aa] {ON} YOR272W ...    45   0.001
NDAI0J02490 Chr10 complement(613859..615748) [1890 bp, 629 aa] {...    45   0.001
KLTH0C06358g Chr3 (556638..557741) [1104 bp, 367 aa] {ON} highly...    44   0.001
KAFR0D03060 Chr4 (604145..606625) [2481 bp, 826 aa] {ON} Anc_2.4...    45   0.001
TPHA0I00460 Chr9 (89882..91564) [1683 bp, 560 aa] {ON} Anc_8.817...    45   0.001
Kpol_1001.23 s1001 complement(63130..64962) [1833 bp, 610 aa] {O...    45   0.001
ACL116W Chr3 (140589..143003) [2415 bp, 804 aa] {ON} Syntenic ho...    45   0.001
KNAG0C04950 Chr3 (955701..957023) [1323 bp, 440 aa] {ON} Anc_5.4...    44   0.001
ZYRO0B03652g Chr2 complement(301728..302804) [1077 bp, 358 aa] {...    44   0.001
YGL004C Chr7 complement(490703..491956) [1254 bp, 417 aa] {ON}  ...    44   0.001
NCAS0A07850 Chr1 complement(1561758..1563596) [1839 bp, 612 aa] ...    44   0.001
Smik_7.50 Chr7 complement(84865..86058) [1194 bp, 397 aa] {ON} Y...    44   0.001
Ecym_5599 Chr5 complement(1220881..1221930) [1050 bp, 349 aa] {O...    44   0.001
Kpol_1002.36 s1002 (110010..112229) [2220 bp, 739 aa] {ON} (1100...    44   0.001
KLLA0A08800g Chr1 (770989..772308) [1320 bp, 439 aa] {ON} simila...    44   0.001
Kpol_387.7 s387 (15235..16893) [1659 bp, 552 aa] {ON} (15235..16...    44   0.001
KLLA0F13772g Chr6 (1276532..1278094) [1563 bp, 520 aa] {ON} high...    44   0.001
TDEL0E04900 Chr5 complement(913381..915738) [2358 bp, 785 aa] {O...    44   0.001
Skud_1.64 Chr1 (130376..131662) [1287 bp, 428 aa] {ON} YAR003W (...    44   0.001
SAKL0H16390g Chr8 complement(1437966..1441388) [3423 bp, 1140 aa...    44   0.002
KAFR0A04550 Chr1 complement(901244..903100) [1857 bp, 618 aa] {O...    44   0.002
Ecym_6170 Chr6 complement(316353..317675) [1323 bp, 440 aa] {ON}...    44   0.002
AER337W Chr5 (1256750..1258087) [1338 bp, 445 aa] {ON} Syntenic ...    44   0.002
KNAG0B06450 Chr2 complement(1274888..1276792) [1905 bp, 634 aa] ...    44   0.002
Smik_2.335 Chr2 complement(596903..598171) [1269 bp, 422 aa] {ON...    44   0.002
KAFR0D04430 Chr4 (874649..876928) [2280 bp, 759 aa] {ON} Anc_5.3...    44   0.002
TBLA0D03580 Chr4 complement(885182..887353) [2172 bp, 723 aa] {O...    44   0.002
TBLA0C03990 Chr3 (960225..961538) [1314 bp, 437 aa] {ON} Anc_4.1...    44   0.002
KLTH0E03872g Chr5 (353271..355511) [2241 bp, 746 aa] {ON} simila...    44   0.002
Smik_4.585 Chr4 complement(1040861..1043125) [2265 bp, 754 aa] {...    44   0.002
AER439W Chr5 (1476148..1476150,1476201..1477442) [1245 bp, 414 a...    44   0.002
NCAS0F02050 Chr6 complement(409352..413923) [4572 bp, 1523 aa] {...    44   0.002
Ecym_4280 Chr4 complement(600066..603464) [3399 bp, 1132 aa] {ON...    44   0.002
Ecym_7402 Chr7 complement(827224..829044) [1821 bp, 606 aa] {ON}...    44   0.002
YMR093W Chr13 (454015..455556) [1542 bp, 513 aa] {ON}  UTP15Nucl...    44   0.002
NCAS0F02940 Chr6 complement(582657..584924) [2268 bp, 755 aa] {O...    44   0.002
Smik_13.277 Chr13 (437902..439443) [1542 bp, 513 aa] {ON} YMR093...    44   0.002
Skud_5.33 Chr5 (46184..47389) [1206 bp, 401 aa] {ON} YEL056W (REAL)    43   0.002
AER114W Chr5 (850726..850730,850789..852685) [1902 bp, 633 aa] {...    44   0.002
NCAS0B00430 Chr2 (57814..59280) [1467 bp, 488 aa] {ON} Anc_8.717...    44   0.002
TDEL0G03100 Chr7 (582165..583205) [1041 bp, 346 aa] {ON} Anc_2.3...    43   0.002
TPHA0D02150 Chr4 complement(441410..443737) [2328 bp, 775 aa] {O...    44   0.002
ZYRO0B02486g Chr2 complement(199474..201201) [1728 bp, 575 aa] {...    44   0.002
NDAI0D02250 Chr4 complement(526907..529294) [2388 bp, 795 aa] {O...    44   0.002
Kwal_55.20233 s55 (311887..314130) [2244 bp, 747 aa] {ON} YDR324...    44   0.002
TBLA0B04670 Chr2 (1088358..1089392) [1035 bp, 344 aa] {ON} Anc_6...    43   0.003
KLLA0C09262g Chr3 (805512..807188) [1677 bp, 558 aa] {ON} highly...    44   0.003
Smik_1.70 Chr1 (138173..139459) [1287 bp, 428 aa] {ON} YAR003W (...    43   0.003
KNAG0D02720 Chr4 complement(489642..494267) [4626 bp, 1541 aa] {...    44   0.003
AFL007C Chr6 complement(424004..425659) [1656 bp, 551 aa] {ON} S...    43   0.003
Kwal_56.24399 s56 (981153..982262) [1110 bp, 369 aa] {ON} [conti...    43   0.003
AFL157C Chr6 complement(140404..141720) [1317 bp, 438 aa] {ON} S...    43   0.003
YAR003W Chr1 (155005..156285) [1281 bp, 426 aa] {ON}  SWD1Subuni...    43   0.003
CAGL0D05588g Chr4 (533235..534668) [1434 bp, 477 aa] {ON} highly...    43   0.003
YBR195C Chr2 complement(610614..611882) [1269 bp, 422 aa] {ON}  ...    43   0.003
SAKL0H22330g Chr8 complement(1943859..1945094) [1236 bp, 411 aa]...    43   0.003
Smik_15.454 Chr15 (782403..783788) [1386 bp, 461 aa] {ON} YOR272...    43   0.003
Suva_5.228 Chr5 complement(347755..348852) [1098 bp, 365 aa] {ON...    43   0.003
TBLA0B09190 Chr2 (2171629..2172669) [1041 bp, 346 aa] {ON} Anc_2...    43   0.003
TPHA0J01890 Chr10 (430218..432287) [2070 bp, 689 aa] {ON} Anc_6....    43   0.004
TPHA0C01050 Chr3 complement(235500..238874) [3375 bp, 1124 aa] {...    43   0.004
Kpol_1033.58 s1033 (147020..149881) [2862 bp, 953 aa] {ON} (1470...    43   0.004
SAKL0H05566g Chr8 complement(500251..501663) [1413 bp, 470 aa] {...    43   0.004
TDEL0A02460 Chr1 (439489..441321) [1833 bp, 610 aa] {ON} Anc_2.4...    43   0.004
Skud_15.437 Chr15 (771566..772951) [1386 bp, 461 aa] {ON} YOR272...    43   0.004
Kwal_27.10385 s27 (317980..319590) [1611 bp, 536 aa] {ON} YML102...    43   0.004
AFL014C Chr6 complement(409496..411169) [1674 bp, 557 aa] {ON} S...    43   0.004
TPHA0D04530 Chr4 complement(988612..989496) [885 bp, 294 aa] {ON...    42   0.004
KNAG0B02670 Chr2 (517131..518042) [912 bp, 303 aa] {ON} Anc_7.33...    42   0.004
KLTH0G13068g Chr7 complement(1118964..1122269) [3306 bp, 1101 aa...    43   0.004
KLLA0F05159g Chr6 (506007..509702) [3696 bp, 1231 aa] {ON} simil...    43   0.004
CAGL0F07337g Chr6 complement(714870..716735) [1866 bp, 621 aa] {...    43   0.004
Kpol_1033.19 s1033 (40266..43685) [3420 bp, 1139 aa] {ON} (40266...    43   0.004
KLTH0F14344g Chr6 (1177844..1179556) [1713 bp, 570 aa] {ON} high...    43   0.004
Kpol_1025.38 s1025 (90229..90465,90467..91492) [1263 bp, 420 aa]...    42   0.004
Ecym_2282 Chr2 complement(552170..553879) [1710 bp, 569 aa] {ON}...    43   0.004
Ecym_8317 Chr8 (648256..649527) [1272 bp, 423 aa] {ON} similar t...    42   0.004
KNAG0C05420 Chr3 (1059879..1062236) [2358 bp, 785 aa] {ON} Anc_5...    43   0.005
YOR212W Chr15 (742910..744181) [1272 bp, 423 aa] {ON}  STE4G pro...    42   0.005
KAFR0L00320 Chr12 (56449..57624) [1176 bp, 391 aa] {ON} Anc_6.9 ...    42   0.005
AER035W Chr5 (699524..702544) [3021 bp, 1006 aa] {ON} Syntenic h...    43   0.005
Ecym_7028 Chr7 (52132..52136,52211..54083) [1878 bp, 625 aa] {ON...    42   0.005
SAKL0G08492g Chr7 (725684..727894) [2211 bp, 736 aa] {ON} simila...    42   0.005
Kpol_361.3 s361 complement(3792..5675) [1884 bp, 627 aa] {ON} co...    42   0.005
KLLA0A08866g Chr1 (776960..778231) [1272 bp, 423 aa] {ON} simila...    42   0.005
Kpol_1044.27 s1044 complement(63632..65197) [1566 bp, 521 aa] {O...    42   0.005
ZYRO0G03168g Chr7 (241103..242923) [1821 bp, 606 aa] {ON} simila...    42   0.005
KNAG0G00800 Chr7 (147792..150164) [2373 bp, 790 aa] {ON} Anc_5.1...    42   0.006
Skud_5.232 Chr5 complement(369506..370603) [1098 bp, 365 aa] {ON...    42   0.006
KLLA0E20703g Chr5 complement(1841092..1842207) [1116 bp, 371 aa]...    42   0.006
KAFR0E01230 Chr5 complement(247314..248423) [1110 bp, 369 aa] {O...    42   0.006
KLLA0F15598g Chr6 (1439610..1441046) [1437 bp, 478 aa] {ON} high...    42   0.006
TDEL0A02260 Chr1 (409508..412027) [2520 bp, 839 aa] {ON} Anc_2.4...    42   0.006
Ecym_5334 Chr5 (679515..682574) [3060 bp, 1019 aa] {ON} similar ...    42   0.006
Smik_7.286 Chr7 complement(482658..483911) [1254 bp, 417 aa] {ON...    42   0.006
NCAS0D04050 Chr4 (760598..762865) [2268 bp, 755 aa] {ON}               42   0.006
ABL044C Chr2 complement(312376..313932) [1557 bp, 518 aa] {ON} S...    42   0.006
SAKL0F10010g Chr6 (767640..768644) [1005 bp, 334 aa] {ON} simila...    42   0.006
Skud_12.56 Chr12 (118914..120383) [1470 bp, 489 aa] {ON} YLL011W...    42   0.006
SAKL0A02970g Chr1 complement(275095..276342) [1248 bp, 415 aa] {...    42   0.006
KLTH0B03410g Chr2 complement(276115..277548) [1434 bp, 477 aa] {...    42   0.006
KLLA0F17237g Chr6 (1577197..1578768) [1572 bp, 523 aa] {ON} high...    42   0.007
TPHA0J01070 Chr10 complement(249880..251535) [1656 bp, 551 aa] {...    42   0.007
ZYRO0B10450g Chr2 complement(825240..826688) [1449 bp, 482 aa] {...    42   0.007
KLTH0F02948g Chr6 (254134..255333) [1200 bp, 399 aa] {ON} weakly...    42   0.008
NCAS0A06510 Chr1 (1283824..1285056) [1233 bp, 410 aa] {ON} Anc_4...    42   0.008
Kpol_2002.99 s2002 (237070..238533) [1464 bp, 487 aa] {ON} (2370...    42   0.008
YER107C Chr5 complement(373448..374545) [1098 bp, 365 aa] {ON}  ...    42   0.008
Kwal_47.17310 s47 (345235..346896) [1662 bp, 553 aa] {ON} YER124...    42   0.008
KNAG0E02460 Chr5 complement(488247..490064) [1818 bp, 605 aa] {O...    42   0.008
Kwal_33.15136 s33 (974095..975516) [1422 bp, 473 aa] {ON} YLL011...    42   0.008
Kwal_26.7736 s26 complement(491687..493210) [1524 bp, 507 aa] {O...    42   0.008
Kpol_1061.35 s1061 (98864..100180) [1317 bp, 438 aa] {ON} (98864...    42   0.009
Kwal_55.21144 s55 (703153..704865) [1713 bp, 570 aa] {ON} YPR137...    42   0.009
NDAI0J01180 Chr10 complement(273472..276876) [3405 bp, 1134 aa] ...    42   0.009
TDEL0F02220 Chr6 (406232..407542) [1311 bp, 436 aa] {ON} Anc_4.1...    42   0.010
Smik_15.398 Chr15 (692606..693883) [1278 bp, 425 aa] {ON} YOR212...    41   0.010
TPHA0B04250 Chr2 complement(995664..997187) [1524 bp, 507 aa] {O...    42   0.010
ZYRO0G13596g Chr7 complement(1084499..1085908) [1410 bp, 469 aa]...    41   0.010
TPHA0G03110 Chr7 (661602..663428) [1827 bp, 608 aa] {ON} Anc_2.4...    42   0.011
AFR715C Chr6 complement(1753288..1755438) [2151 bp, 716 aa] {ON}...    42   0.011
KNAG0G02790 Chr7 (617832..619247) [1416 bp, 471 aa] {ON} Anc_8.7...    41   0.011
TBLA0B08980 Chr2 complement(2125687..2129208) [3522 bp, 1173 aa]...    42   0.011
TBLA0E04570 Chr5 (1163562..1165349) [1788 bp, 595 aa] {ON} Anc_4...    42   0.011
TPHA0K01570 Chr11 (329273..330553) [1281 bp, 426 aa] {ON} Anc_4....    41   0.011
KLLA0F22000g Chr6 complement(2044973..2047354) [2382 bp, 793 aa]...    42   0.011
ZYRO0B13838g Chr2 (1121025..1123079) [2055 bp, 684 aa] {ON} some...    42   0.011
TBLA0F01150 Chr6 (287045..290413) [3369 bp, 1122 aa] {ON} Anc_3....    42   0.011
TPHA0M00190 Chr13 complement(38571..39746) [1176 bp, 391 aa] {ON...    41   0.011
Skud_4.592 Chr4 complement(1050634..1052892) [2259 bp, 752 aa] {...    42   0.012
Kpol_1050.22 s1050 (54876..56171) [1296 bp, 431 aa] {ON} (54876....    41   0.012
SAKL0F03432g Chr6 complement(274302..276029) [1728 bp, 575 aa] {...    41   0.012
Kwal_26.8628 s26 (871377..872645) [1269 bp, 422 aa] {ON} YOR212W...    41   0.013
KLTH0E15158g Chr5 (1346780..1348309) [1530 bp, 509 aa] {ON} simi...    41   0.013
YLL011W Chr12 (127523..128992) [1470 bp, 489 aa] {ON}  SOF1Essen...    41   0.013
YDR324C Chr4 complement(1114433..1116763) [2331 bp, 776 aa] {ON}...    41   0.013
KNAG0J02560 Chr10 (482741..484294) [1554 bp, 517 aa] {ON} Anc_3....    41   0.013
Skud_15.379 Chr15 (681934..683211) [1278 bp, 425 aa] {ON} YOR212...    41   0.013
KLLA0D00814g Chr4 complement(76687..77913) [1227 bp, 408 aa] {ON...    41   0.013
Ecym_4433 Chr4 complement(893223..894923) [1701 bp, 566 aa] {ON}...    41   0.013
KAFR0G01170 Chr7 (265249..267603) [2355 bp, 784 aa] {ON} Anc_5.1...    41   0.013
KNAG0D00740 Chr4 complement(115399..116913) [1515 bp, 504 aa] {O...    41   0.013
KLLA0C06633g Chr3 (580349..582244) [1896 bp, 631 aa] {ON} simila...    41   0.013
ZYRO0F16104g Chr6 complement(1322975..1324183) [1209 bp, 402 aa]...    41   0.013
NCAS0D02730 Chr4 (523453..524880) [1428 bp, 475 aa] {ON} Anc_5.201     41   0.014
AEL250C Chr5 complement(168010..169263) [1254 bp, 417 aa] {ON} S...    41   0.014
AAR102C Chr1 complement(526057..527832) [1776 bp, 591 aa] {ON} S...    41   0.014
ZYRO0D06556g Chr4 complement(564778..568221) [3444 bp, 1147 aa] ...    41   0.015
Suva_10.64 Chr10 (132461..133933) [1473 bp, 490 aa] {ON} YLL011W...    41   0.015
Kwal_14.1710 s14 (433526..435250) [1725 bp, 574 aa] {ON} YGL116W...    41   0.015
NDAI0C04390 Chr3 complement(993861..996212) [2352 bp, 783 aa] {O...    41   0.015
NDAI0K02900 Chr11 (657436..658752) [1317 bp, 438 aa] {ON} Anc_6.9      41   0.015
Skud_7.55 Chr7 complement(95372..96565) [1194 bp, 397 aa] {ON} Y...    41   0.016
KNAG0H01290 Chr8 (227947..229341) [1395 bp, 464 aa] {ON} Anc_3.2...    41   0.016
TBLA0I01220 Chr9 (261925..263460) [1536 bp, 511 aa] {ON} Anc_2.4...    41   0.016
CAGL0J01287g Chr10 (120215..122047) [1833 bp, 610 aa] {ON} simil...    41   0.017
Kpol_467.21 s467 (46346..48160) [1815 bp, 604 aa] {ON} (46346..4...    41   0.017
Suva_2.495 Chr2 complement(871929..874187) [2259 bp, 752 aa] {ON...    41   0.017
SAKL0H05456g Chr8 complement(490546..491886) [1341 bp, 446 aa] {...    40   0.017
ZYRO0A03234g Chr1 (258942..260183) [1242 bp, 413 aa] {ON} simila...    40   0.017
YOR272W Chr15 (832813..834195) [1383 bp, 460 aa] {ON}  YTM1Const...    40   0.018
NCAS0J01860 Chr10 (350125..352011) [1887 bp, 628 aa] {ON} Anc_4....    41   0.018
KNAG0D03460 Chr4 (622817..624055) [1239 bp, 412 aa] {ON} Anc_4.1...    40   0.018
KLLA0E19515g Chr5 complement(1733708..1735426) [1719 bp, 572 aa]...    41   0.018
Suva_13.270 Chr13 (435573..437114) [1542 bp, 513 aa] {ON} YMR093...    40   0.018
Smik_5.31 Chr5 (49406..50689) [1284 bp, 427 aa] {ON} YEL056W (REAL)    40   0.018
ZYRO0A01804g Chr1 complement(150103..151233) [1131 bp, 376 aa] {...    40   0.019
YEL056W Chr5 (47168..48373) [1206 bp, 401 aa] {ON}  HAT2Subunit ...    40   0.019
Smik_12.52 Chr12 (114649..116118) [1470 bp, 489 aa] {ON} YLL011W...    40   0.020
Skud_13.249 Chr13 (427918..429459) [1542 bp, 513 aa] {ON} YMR093...    40   0.020
Smik_16.106 Chr16 (194195..196564) [2370 bp, 789 aa] {ON} YGR200...    41   0.020
KLTH0G10296g Chr7 complement(869990..871270) [1281 bp, 426 aa] {...    40   0.020
TPHA0N01070 Chr14 complement(224464..225525) [1062 bp, 353 aa] {...    40   0.020
TDEL0C02650 Chr3 complement(460884..461978) [1095 bp, 364 aa] {O...    40   0.021
Kwal_33.15475 s33 complement(1123396..1125747) [2352 bp, 783 aa]...    40   0.021
Ecym_7105 Chr7 complement(205465..206919) [1455 bp, 484 aa] {ON}...    40   0.022
TBLA0A09070 Chr1 complement(2236928..2238094) [1167 bp, 388 aa] ...    40   0.022
ACR097W Chr3 (529784..531187) [1404 bp, 467 aa] {ON} Syntenic ho...    40   0.023
TBLA0D01190 Chr4 complement(301525..302820) [1296 bp, 431 aa] {O...    40   0.023
TPHA0G02940 Chr7 (631081..633837) [2757 bp, 918 aa] {ON} Anc_2.4...    40   0.024
Suva_7.494 Chr7 complement(856266..858641) [2376 bp, 791 aa] {ON...    40   0.025
KAFR0J00980 Chr10 (176984..178426) [1443 bp, 480 aa] {ON} Anc_5....    40   0.025
KLTH0E09394g Chr5 complement(853592..855160) [1569 bp, 522 aa] {...    40   0.026
Ecym_6067 Chr6 (124870..126438) [1569 bp, 522 aa] {ON} similar t...    40   0.027
Kpol_1038.20 s1038 complement(43719..47660) [3942 bp, 1313 aa] {...    40   0.028
KLTH0E12694g Chr5 (1126940..1128196) [1257 bp, 418 aa] {ON} simi...    40   0.028
SAKL0G12892g Chr7 complement(1102157..1103587) [1431 bp, 476 aa]...    40   0.028
TPHA0K00780 Chr11 (163003..164088) [1086 bp, 361 aa] {ON} Anc_7....    40   0.029
TPHA0G00680 Chr7 complement(127929..129302) [1374 bp, 457 aa] {O...    40   0.030
KAFR0A04420 Chr1 complement(881701..882768) [1068 bp, 355 aa] {O...    40   0.032
Smik_13.329 Chr13 complement(515612..517141) [1530 bp, 509 aa] {...    40   0.032
KNAG0G03310 Chr7 complement(709092..710552) [1461 bp, 486 aa] {O...    40   0.032
KLLA0F06754g Chr6 complement(650475..651509) [1035 bp, 344 aa] {...    40   0.032
CAGL0J06512g Chr10 complement(622640..624277) [1638 bp, 545 aa] ...    40   0.032
NDAI0H02750 Chr8 (677299..678837) [1539 bp, 512 aa] {ON} Anc_2.4...    40   0.032
Skud_7.536 Chr7 complement(874704..877070) [2367 bp, 788 aa] {ON...    40   0.033
TDEL0D03660 Chr4 (671946..673298) [1353 bp, 450 aa] {ON} Anc_3.2...    40   0.033
NDAI0D03490 Chr4 (820778..822079) [1302 bp, 433 aa] {ON} Anc_4.1...    40   0.033
CAGL0L10890g Chr12 (1165380..1166753) [1374 bp, 457 aa] {ON} hig...    40   0.034
TBLA0B08930 Chr2 complement(2117704..2119536) [1833 bp, 610 aa] ...    40   0.035
NDAI0I02180 Chr9 complement(499955..501394) [1440 bp, 479 aa] {O...    40   0.039
SAKL0D03740g Chr4 (303240..304676) [1437 bp, 478 aa] {ON} simila...    39   0.040
TPHA0G00720 Chr7 complement(136125..137672) [1548 bp, 515 aa] {O...    40   0.040
NCAS0C04430 Chr3 complement(905927..909862) [3936 bp, 1311 aa] {...    40   0.041
ACR199C Chr3 complement(698881..699768) [888 bp, 295 aa] {ON} Sy...    39   0.041
NCAS0F00640 Chr6 complement(123774..124396,124484..125543) [1683...    40   0.041
KLTH0G12430g Chr7 (1057236..1058339) [1104 bp, 367 aa] {ON} simi...    39   0.042
AGR067W Chr7 (842176..845553) [3378 bp, 1125 aa] {ON} Syntenic h...    40   0.042
Ecym_8393 Chr8 complement(805739..807394) [1656 bp, 551 aa] {ON}...    39   0.042
TBLA0A05690 Chr1 (1412275..1413546) [1272 bp, 423 aa] {ON} Anc_1...    39   0.042
CAGL0J08998g Chr10 (884779..888624) [3846 bp, 1281 aa] {ON} high...    40   0.042
KAFR0I00840 Chr9 complement(162878..164119) [1242 bp, 413 aa] {O...    39   0.042
YGR200C Chr7 complement(899904..902270) [2367 bp, 788 aa] {ON}  ...    40   0.043
Kpol_513.12 s513 complement(32164..36762) [4599 bp, 1532 aa] {ON...    40   0.044
ZYRO0F06314g Chr6 (526555..527850) [1296 bp, 431 aa] {ON} simila...    39   0.044
Kpol_1018.103 s1018 complement(268887..269966) [1080 bp, 359 aa]...    39   0.045
ZYRO0F09372g Chr6 (761606..762952) [1347 bp, 448 aa] {ON} highly...    39   0.047
KLLA0D12760g Chr4 complement(1090428..1091909) [1482 bp, 493 aa]...    39   0.047
Smik_4.265 Chr4 complement(483300..484820) [1521 bp, 506 aa] {ON...    39   0.048
Sklu_YGOB_Anc_2.401 Chr5 complement(385202..386764) [1563 bp, 52...    39   0.048
NCAS0A11750 Chr1 (2335605..2337320) [1716 bp, 571 aa] {ON} Anc_3...    39   0.049
KLLA0D13222g Chr4 complement(1132067..1134277) [2211 bp, 736 aa]...    39   0.050
TPHA0G02500 Chr7 (515975..518812) [2838 bp, 945 aa] {ON} Anc_2.4...    39   0.050
TPHA0A03100 Chr1 (679875..683672) [3798 bp, 1265 aa] {ON} Anc_7....    39   0.050
CAGL0J01265g Chr10 complement(118375..119928) [1554 bp, 517 aa] ...    39   0.051
AFR634W Chr6 (1594214..1595686) [1473 bp, 490 aa] {ON} Syntenic ...    39   0.051
TPHA0E03080 Chr5 complement(646691..648157) [1467 bp, 488 aa] {O...    39   0.052
ADR242C Chr4 complement(1126441..1128006) [1566 bp, 521 aa] {ON}...    39   0.054
TBLA0H02000 Chr8 complement(474850..476271) [1422 bp, 473 aa] {O...    39   0.054
SAKL0A05962g Chr1 complement(543144..544184) [1041 bp, 346 aa] {...    39   0.054
KNAG0M01750 Chr13 complement(323446..324903) [1458 bp, 485 aa] {...    39   0.057
KAFR0E02470 Chr5 complement(503462..505351) [1890 bp, 629 aa] {O...    39   0.059
TDEL0E02620 Chr5 (508356..510593) [2238 bp, 745 aa] {ON} Anc_5.3...    39   0.059
CAGL0M13409g Chr13 complement(1317818..1322401) [4584 bp, 1527 a...    39   0.059
Kpol_530.39 s530 (90456..91340) [885 bp, 294 aa] {ON} (90456..91...    39   0.059
TPHA0D04170 Chr4 (894124..895845) [1722 bp, 573 aa] {ON} Anc_3.4...    39   0.060
NCAS0F01970 Chr6 complement(396326..397861) [1536 bp, 511 aa] {O...    39   0.060
CAGL0H00781g Chr8 complement(77292..78833) [1542 bp, 513 aa] {ON...    39   0.062
YMR131C Chr13 complement(533163..534698) [1536 bp, 511 aa] {ON} ...    39   0.062
Kpol_2000.39 s2000 complement(76168..77499) [1332 bp, 443 aa] {O...    39   0.063
Suva_13.311 Chr13 complement(511812..513344) [1533 bp, 510 aa] {...    39   0.065
TPHA0I01180 Chr9 (274330..276999) [2670 bp, 889 aa] {ON} Anc_1.3...    39   0.065
Suva_11.103 Chr11 (200612..203182) [2571 bp, 856 aa] {ON} YKL121...    39   0.065
TPHA0D03590 Chr4 (752790..754586) [1797 bp, 598 aa] {ON} Anc_6.2...    39   0.066
Smik_6.451 Chr6 (740074..741645) [1572 bp, 523 aa] {ON} YPL247C ...    39   0.067
KNAG0E02400 Chr5 (477698..480430) [2733 bp, 910 aa] {ON} Anc_2.4...    39   0.068
YPL247C Chr16 complement(82625..84196) [1572 bp, 523 aa] {ON} Pu...    39   0.068
Smik_5.253 Chr5 complement(382390..383487) [1098 bp, 365 aa] {ON...    39   0.069
Ecym_2695 Chr2 complement(1343162..1344724) [1563 bp, 520 aa] {O...    39   0.072
TDEL0G03340 Chr7 (618276..619820) [1545 bp, 514 aa] {ON} Anc_2.4...    39   0.072
Kwal_27.12070 s27 (1071472..1072728) [1257 bp, 418 aa] {ON} YBR1...    39   0.072
YHR186C Chr8 complement(475999..480672) [4674 bp, 1557 aa] {ON} ...    39   0.074
Suva_7.48 Chr7 complement(86451..87644) [1194 bp, 397 aa] {ON} Y...    39   0.074
Kwal_56.24332 s56 (959476..960732) [1257 bp, 418 aa] {ON} YPL247...    39   0.075
KLTH0E06930g Chr5 (637945..639609) [1665 bp, 554 aa] {ON} simila...    39   0.076
CAGL0A00561g Chr1 complement(63710..64948) [1239 bp, 412 aa] {ON...    39   0.076
Skud_13.291 Chr13 complement(506764..508293) [1530 bp, 509 aa] {...    39   0.077
KAFR0F01060 Chr6 complement(201465..203126) [1662 bp, 553 aa] {O...    39   0.080
KLTH0H02772g Chr8 complement(248747..250009) [1263 bp, 420 aa] {...    39   0.083
NDAI0F01240 Chr6 complement(302631..304205) [1575 bp, 524 aa] {O...    39   0.084
KLTH0D05346g Chr4 complement(475917..477440) [1524 bp, 507 aa] {...    39   0.085
YMR092C Chr13 complement(451632..453479) [1848 bp, 615 aa] {ON} ...    39   0.087
KLLA0F13750g Chr6 complement(1274110..1275972) [1863 bp, 620 aa]...    39   0.089
Suva_7.166 Chr7 (307962..309014) [1053 bp, 350 aa] {ON} YGL100W ...    38   0.090
KLLA0B11077g Chr2 complement(970761..972464) [1704 bp, 567 aa] {...    39   0.090
Suva_16.60 Chr16 complement(91552..93132) [1581 bp, 526 aa] {ON}...    39   0.091
KNAG0F00620 Chr6 (105380..106768) [1389 bp, 462 aa] {ON} Anc_1.1...    38   0.097
NCAS0D03490 Chr4 (650325..651362) [1038 bp, 345 aa] {ON} Anc_6.159     38   0.10 
YKL121W Chr11 (214142..216700) [2559 bp, 852 aa] {ON}  DGR2Prote...    39   0.10 
TBLA0F02400 Chr6 complement(590293..591189) [897 bp, 298 aa] {ON...    38   0.10 
ABL043W Chr2 (314670..316490) [1821 bp, 606 aa] {ON} Syntenic ho...    38   0.10 
TPHA0F02890 Chr6 complement(640553..641440) [888 bp, 295 aa] {ON...    38   0.10 
TBLA0H03650 Chr8 (888840..890099) [1260 bp, 419 aa] {ON} Anc_8.5...    38   0.10 
TDEL0F04150 Chr6 (765748..769152) [3405 bp, 1134 aa] {ON} Anc_8....    39   0.11 
Smik_2.423 Chr2 complement(750642..753278) [2637 bp, 878 aa] {ON...    38   0.11 
KAFR0G01970 Chr7 complement(414143..415420) [1278 bp, 425 aa] {O...    38   0.11 
SAKL0C01188g Chr3 (104624..106948) [2325 bp, 774 aa] {ON} simila...    38   0.11 
ZYRO0B04444g Chr2 complement(363742..365469) [1728 bp, 575 aa] {...    38   0.11 
ZYRO0D10516g Chr4 (883922..886171) [2250 bp, 749 aa] {ON} simila...    38   0.12 
Kwal_47.17827 s47 complement(570622..572193) [1572 bp, 523 aa] {...    38   0.12 
ZYRO0F00462g Chr6 complement(46021..47202) [1182 bp, 393 aa] {ON...    38   0.12 
KLTH0H02508g Chr8 complement(225069..225998) [930 bp, 309 aa] {O...    38   0.12 
Skud_16.32 Chr16 complement(56168..57736) [1569 bp, 522 aa] {ON}...    38   0.12 
Ecym_7403 Chr7 (829923..831476) [1554 bp, 517 aa] {ON} similar t...    38   0.13 
KAFR0D01700 Chr4 complement(339178..340785) [1608 bp, 535 aa] {O...    38   0.13 
CAGL0I07073g Chr9 complement(681102..682283) [1182 bp, 393 aa] {...    38   0.13 
TPHA0G02650 Chr7 (558370..559920) [1551 bp, 516 aa] {ON} Anc_2.4...    38   0.13 
NDAI0A07790 Chr1 (1790683..1795206) [4524 bp, 1507 aa] {ON} Anc_...    38   0.13 
Kwal_56.24596 s56 complement(1068314..1069198) [885 bp, 294 aa] ...    37   0.14 
TBLA0B09250 Chr2 (2194005..2195585) [1581 bp, 526 aa] {ON} Anc_2...    38   0.14 
KAFR0A04080 Chr1 (820402..821889) [1488 bp, 495 aa] {ON} Anc_8.7...    38   0.14 
TPHA0A00380 Chr1 complement(55881..59813) [3933 bp, 1310 aa] {ON...    38   0.14 
TDEL0G04620 Chr7 (842202..843380) [1179 bp, 392 aa] {ON} Anc_6.9...    37   0.15 
Kpol_1061.6 s1061 complement(19407..20762) [1356 bp, 451 aa] {ON...    38   0.15 
NCAS0A07270 Chr1 complement(1442956..1445355) [2400 bp, 799 aa] ...    38   0.15 
KLLA0D08371g Chr4 (710885..712411) [1527 bp, 508 aa] {ON} simila...    38   0.16 
NCAS0G01120 Chr7 complement(199561..201045) [1485 bp, 494 aa] {O...    37   0.17 
Kpol_2001.63 s2001 complement(171777..175607) [3831 bp, 1276 aa]...    38   0.17 
KNAG0A07760 Chr1 complement(1232666..1234366) [1701 bp, 566 aa] ...    37   0.17 
YBR281C Chr2 complement(764970..767606) [2637 bp, 878 aa] {ON}  ...    38   0.18 
ZYRO0C09724g Chr3 (738113..739588) [1476 bp, 491 aa] {ON} simila...    37   0.18 
NDAI0A05790 Chr1 (1315884..1317374) [1491 bp, 496 aa] {ON}             37   0.18 
CAGL0L09647g Chr12 (1034737..1036026) [1290 bp, 429 aa] {ON} hig...    37   0.18 
NDAI0H02330 Chr8 complement(564240..567221) [2982 bp, 993 aa] {O...    38   0.18 
KLTH0G15620g Chr7 complement(1363249..1366056) [2808 bp, 935 aa]...    38   0.18 
SAKL0C10098g Chr3 complement(909553..912489) [2937 bp, 978 aa] {...    37   0.19 
TDEL0A06890 Chr1 (1202790..1204133) [1344 bp, 447 aa] {ON} Anc_6...    37   0.19 
KLTH0H01518g Chr8 (138469..139353) [885 bp, 294 aa] {ON} highly ...    37   0.19 
KLLA0F19734g Chr6 (1826828..1830229) [3402 bp, 1133 aa] {ON} sim...    37   0.19 
Skud_2.412 Chr2 complement(733900..736536) [2637 bp, 878 aa] {ON...    37   0.20 
KNAG0A06340 Chr1 (967160..970114) [2955 bp, 984 aa] {ON} Anc_2.4...    37   0.20 
TDEL0F03590 Chr6 (659038..660756) [1719 bp, 572 aa] {ON} Anc_3.4...    37   0.20 
TBLA0A07120 Chr1 complement(1765718..1766941) [1224 bp, 407 aa] ...    37   0.20 
Smik_5.221 Chr5 complement(332843..334507) [1665 bp, 554 aa] {ON...    37   0.20 
Suva_13.269 Chr13 complement(433166..435016) [1851 bp, 616 aa] {...    37   0.20 
KLTH0B07040g Chr2 (567756..569276) [1521 bp, 506 aa] {ON} simila...    37   0.21 
NDAI0A04540 Chr1 complement(1023305..1025011) [1707 bp, 568 aa] ...    37   0.21 
CAGL0J08778g Chr10 (868299..869195) [897 bp, 298 aa] {ON} highly...    37   0.21 
TBLA0A02310 Chr1 (557822..559417) [1596 bp, 531 aa] {ON} Anc_6.2...    37   0.21 
KNAG0K00850 Chr11 complement(159329..162832) [3504 bp, 1167 aa] ...    37   0.21 
ZYRO0D00748g Chr4 (56274..57251) [978 bp, 325 aa] {ON} highly si...    37   0.21 
Suva_10.302 Chr10 (532343..533236) [894 bp, 297 aa] {ON} YLR208W...    37   0.22 
YLR208W Chr12 (559551..560444) [894 bp, 297 aa] {ON}  SEC13Struc...    37   0.22 
KNAG0E02180 Chr5 (440039..441592) [1554 bp, 517 aa] {ON} Anc_2.4...    37   0.22 
CAGL0J10340g Chr10 complement(1010761..1011777) [1017 bp, 338 aa...    37   0.22 
Kpol_401.8 s401 (21214..22521) [1308 bp, 435 aa] {ON} (21214..22...    37   0.23 
Skud_4.283 Chr4 complement(493677..495191) [1515 bp, 504 aa] {ON...    37   0.23 
KNAG0E00980 Chr5 complement(186207..187451) [1245 bp, 414 aa] {O...    37   0.23 
Smik_15.16 Chr15 complement(29410..33390) [3981 bp, 1326 aa] {ON...    37   0.23 
Smik_13.276 Chr13 complement(435512..437359) [1848 bp, 615 aa] {...    37   0.25 
Skud_16.427 Chr16 (761681..763402) [1722 bp, 573 aa] {ON} YPR137...    37   0.25 
KNAG0B00900 Chr2 (164610..165698) [1089 bp, 362 aa] {ON} Anc_3.4...    37   0.26 
Kpol_1057.7 s1057 complement(16034..17017) [984 bp, 327 aa] {ON}...    37   0.26 
Skud_12.272 Chr12 (506157..507050) [894 bp, 297 aa] {ON} YLR208W...    37   0.26 
Smik_8.275 Chr8 complement(450898..455568) [4671 bp, 1556 aa] {O...    37   0.28 
SAKL0F11022g Chr6 (863614..864504) [891 bp, 296 aa] {ON} highly ...    36   0.28 
SAKL0G14432g Chr7 complement(1245508..1247877) [2370 bp, 789 aa]...    37   0.29 
NCAS0E00530 Chr5 (89654..90853) [1200 bp, 399 aa] {ON} Anc_3.526...    37   0.29 
CAGL0I07821g Chr9 complement(751754..755143) [3390 bp, 1129 aa] ...    37   0.29 
Ecym_4644 Chr4 (1256560..1257447) [888 bp, 295 aa] {ON} similar ...    36   0.29 
Kpol_1041.20 s1041 complement(56019..57566) [1548 bp, 515 aa] {O...    37   0.30 
Kpol_1055.2 s1055 complement(663..2915) [2253 bp, 750 aa] {ON} c...    37   0.30 
NDAI0C05510 Chr3 (1281190..1282449) [1260 bp, 419 aa] {ON} Anc_8...    37   0.30 
Smik_16.383 Chr16 (679641..681362) [1722 bp, 573 aa] {ON} YPR137...    37   0.31 
NCAS0A10500 Chr1 complement(2087347..2088783) [1437 bp, 478 aa] ...    37   0.31 
TDEL0C02360 Chr3 (412482..416276) [3795 bp, 1264 aa] {ON} Anc_7....    37   0.31 
CAGL0M01430g Chr13 (164428..166683) [2256 bp, 751 aa] {ON} highl...    37   0.32 
Ecym_7042 Chr7 (86859..88103) [1245 bp, 414 aa] {ON} similar to ...    37   0.33 
Smik_7.173 Chr7 (308539..309588) [1050 bp, 349 aa] {ON} YGL100W ...    36   0.34 
Smik_12.266 Chr12 (506562..507455) [894 bp, 297 aa] {ON} YLR208W...    36   0.34 
Kpol_1060.24 s1060 complement(61507..62967) [1461 bp, 486 aa] {O...    37   0.34 
TBLA0C05340 Chr3 complement(1293851..1295560) [1710 bp, 569 aa] ...    37   0.35 
NCAS0A07160 Chr1 complement(1419393..1420385) [993 bp, 330 aa] {...    36   0.35 
NCAS0A00740 Chr1 (143564..144946) [1383 bp, 460 aa] {ON} Anc_1.1...    36   0.36 
KNAG0F02280 Chr6 complement(432897..433967) [1071 bp, 356 aa] {O...    36   0.36 
Suva_15.389 Chr15 complement(680068..684735) [4668 bp, 1555 aa] ...    37   0.36 
CAGL0K03861g Chr11 complement(360277..361818) [1542 bp, 513 aa] ...    37   0.36 
Skud_8.252 Chr8 complement(444916..449586) [4671 bp, 1556 aa] {O...    37   0.37 
TDEL0G01280 Chr7 complement(258957..259555,259626..260934) [1908...    37   0.37 
TDEL0F03030 Chr6 (545760..552173) [6414 bp, 2137 aa] {ON} Anc_1....    37   0.37 
KNAG0A03670 Chr1 complement(472849..474129) [1281 bp, 426 aa] {O...    36   0.38 
Kpol_1050.100 s1050 (228171..229895) [1725 bp, 574 aa] {ON} (228...    36   0.39 
KLLA0B12804g Chr2 (1117475..1120033) [2559 bp, 852 aa] {ON} simi...    37   0.39 
Kwal_27.11550 s27 (845458..846681) [1224 bp, 407 aa] {ON} YNL035...    36   0.40 
TDEL0C02080 Chr3 (360056..360940) [885 bp, 294 aa] {ON} Anc_7.33...    36   0.41 
KLLA0A01650g Chr1 complement(146030..147235) [1206 bp, 401 aa] {...    36   0.41 
TBLA0I00360 Chr9 (56206..57300) [1095 bp, 364 aa] {ON} Anc_7.405...    36   0.42 
TBLA0J01290 Chr10 (294789..296456) [1668 bp, 555 aa] {ON} Anc_7....    36   0.42 
Ecym_4717 Chr4 (1407391..1409202) [1812 bp, 603 aa] {ON} similar...    36   0.43 
AER280C Chr5 complement(1148956..1150488) [1533 bp, 510 aa] {ON}...    36   0.43 
TDEL0D05940 Chr4 (1076418..1077710) [1293 bp, 430 aa] {ON} Anc_3...    36   0.43 
Ecym_1039 Chr1 (72890..75073) [2184 bp, 727 aa] {ON} similar to ...    36   0.43 
Ecym_2258 Chr2 complement(510259..511278) [1020 bp, 339 aa] {ON}...    36   0.43 
TDEL0F03510 Chr6 complement(647165..648505) [1341 bp, 446 aa] {O...    36   0.47 
YPR137W Chr16 (802359..804080) [1722 bp, 573 aa] {ON}  RRP9Prote...    36   0.49 
TDEL0B03950 Chr2 complement(709272..710306) [1035 bp, 344 aa] {O...    36   0.49 
ABL141C Chr2 complement(131670..133226) [1557 bp, 518 aa] {ON} S...    36   0.50 
CAGL0A04037g Chr1 complement(404063..405814) [1752 bp, 583 aa] {...    36   0.51 
Kpol_534.25 s534 complement(58326..59444) [1119 bp, 372 aa] {ON}...    36   0.54 
Suva_16.464 Chr16 (804728..806449) [1722 bp, 573 aa] {ON} YPR137...    36   0.57 
ZYRO0E08602g Chr5 (687971..689242) [1272 bp, 423 aa] {ON} simila...    36   0.57 
KLLA0A07106g Chr1 complement(640536..641468) [933 bp, 310 aa] {O...    35   0.57 
NDAI0I01360 Chr9 complement(331085..332122) [1038 bp, 345 aa] {O...    35   0.58 
YER082C Chr5 complement(324272..325936) [1665 bp, 554 aa] {ON}  ...    36   0.58 
NDAI0D00630 Chr4 (139065..139967) [903 bp, 300 aa] {ON} Anc_7.33...    35   0.58 
Suva_5.195 Chr5 complement(298871..300550) [1680 bp, 559 aa] {ON...    36   0.60 
YGL100W Chr7 (313234..314283) [1050 bp, 349 aa] {ON}  SEH1Compon...    35   0.60 
Skud_5.201 Chr5 complement(318460..320142) [1683 bp, 560 aa] {ON...    36   0.62 
ZYRO0F11484g Chr6 complement(943018..943902) [885 bp, 294 aa] {O...    35   0.63 
CAGL0J07854g Chr10 complement(767587..768885) [1299 bp, 432 aa] ...    35   0.65 
Skud_7.174 Chr7 (317467..318516) [1050 bp, 349 aa] {ON} YGL100W ...    35   0.65 
Kwal_47.18825 s47 complement(989263..991137) [1875 bp, 624 aa] {...    36   0.66 
KAFR0B04210 Chr2 (874621..875803,875906..876507) [1785 bp, 594 a...    35   0.67 
ZYRO0F06776g Chr6 (555965..557263) [1299 bp, 432 aa] {ON} simila...    35   0.67 
Suva_13.43 Chr13 (68221..68556,68574..69404) [1167 bp, 388 aa] {...    35   0.68 
Skud_15.16 Chr15 complement(26552..30550) [3999 bp, 1332 aa] {ON...    36   0.68 
Kwal_26.8604 s26 complement(859891..862494) [2604 bp, 867 aa] {O...    36   0.68 
KAFR0D03800 Chr4 complement(735667..736953) [1287 bp, 428 aa] {O...    35   0.69 
TDEL0A06650 Chr1 (1160677..1162032) [1356 bp, 451 aa] {ON} Anc_8...    35   0.71 
AGL001W Chr7 (719728..720903) [1176 bp, 391 aa] {ON} Syntenic ho...    35   0.71 
Kwal_14.1235 s14 complement(247700..249523) [1824 bp, 607 aa] {O...    35   0.74 
KLLA0B11924g Chr2 complement(1043344..1047582) [4239 bp, 1412 aa...    36   0.75 
ZYRO0A13068g Chr1 (1032695..1033888) [1194 bp, 397 aa] {ON} simi...    35   0.77 
Suva_15.22 Chr15 complement(39171..43181) [4011 bp, 1336 aa] {ON...    35   0.78 
SAKL0H15708g Chr8 (1370148..1371254) [1107 bp, 368 aa] {ON} high...    35   0.80 
KLTH0G02772g Chr7 (214898..216805) [1908 bp, 635 aa] {ON} simila...    35   0.80 
NDAI0H03610 Chr8 (887848..889410) [1563 bp, 520 aa] {ON} Anc_1.359     35   0.81 
Skud_13.248 Chr13 complement(425542..427389) [1848 bp, 615 aa] {...    35   0.82 
ZYRO0E08184g Chr5 (639823..641343) [1521 bp, 506 aa] {ON} simila...    35   0.83 
NCAS0H00700 Chr8 (125259..126152) [894 bp, 297 aa] {ON} Anc_7.33...    35   0.83 
NCAS0B08910 Chr2 complement(1709752..1712469) [2718 bp, 905 aa] ...    35   0.83 
KNAG0B03930 Chr2 complement(756034..757881) [1848 bp, 615 aa] {O...    35   0.85 
NDAI0H02250 Chr8 (546983..548821) [1839 bp, 612 aa] {ON} Anc_2.4...    35   0.85 
CAGL0J09966g Chr10 complement(978692..979915) [1224 bp, 407 aa] ...    35   0.87 
TDEL0A01140 Chr1 complement(192604..194151) [1548 bp, 515 aa] {O...    35   0.94 
KAFR0H03340 Chr8 (637913..639016) [1104 bp, 367 aa] {ON} Anc_2.2...    35   1.0  
ZYRO0A08690g Chr1 (691253..692803) [1551 bp, 516 aa] {ON} highly...    35   1.0  
KNAG0B00550 Chr2 complement(90327..91658) [1332 bp, 443 aa] {ON}...    35   1.1  
KLLA0E11177g Chr5 (983669..985150) [1482 bp, 493 aa] {ON} simila...    35   1.1  
TPHA0G03100 Chr7 complement(659503..661032) [1530 bp, 509 aa] {O...    35   1.1  
KLLA0E08449g Chr5 (759718..760986) [1269 bp, 422 aa] {ON} simila...    35   1.1  
ZYRO0G21736g Chr7 (1788792..1789856) [1065 bp, 354 aa] {ON} high...    35   1.1  
Kpol_2002.54 s2002 complement(118705..125166) [6462 bp, 2153 aa]...    35   1.1  
Kwal_14.1611 s14 complement(390491..391495) [1005 bp, 334 aa] {O...    35   1.1  
NCAS0H03270 Chr8 (628484..630904) [2421 bp, 806 aa] {ON} Anc_2.6...    35   1.2  
KLTH0H05610g Chr8 complement(498715..499734) [1020 bp, 339 aa] {...    35   1.2  
KAFR0B01580 Chr2 (298942..303528) [4587 bp, 1528 aa] {ON} Anc_5....    35   1.2  
Kwal_26.7738 s26 (493416..495251) [1836 bp, 611 aa] {ON} YMR092C...    35   1.2  
KAFR0C04130 Chr3 (825105..827501) [2397 bp, 798 aa] {ON} Anc_2.6...    35   1.2  
KAFR0A00380 Chr1 (70400..71950) [1551 bp, 516 aa] {ON} Anc_2.401...    35   1.2  
ZYRO0G20988g Chr7 complement(1723533..1726193) [2661 bp, 886 aa]...    35   1.2  
TBLA0D04560 Chr4 (1130244..1131584) [1341 bp, 446 aa] {ON} Anc_7...    35   1.2  
Smik_15.69 Chr15 complement(118407..121760) [3354 bp, 1117 aa] {...    35   1.3  
KNAG0F02350 Chr6 (441601..442767) [1167 bp, 388 aa] {ON} Anc_6.1...    34   1.3  
Suva_4.541 Chr4 complement(937148..939775) [2628 bp, 875 aa] {ON...    35   1.4  
KLTH0F19338g Chr6 (1564555..1568427) [3873 bp, 1290 aa] {ON} sim...    35   1.4  
TDEL0D05080 Chr4 (924017..927007) [2991 bp, 996 aa] {ON} Anc_3.1...    35   1.5  
KNAG0B02580 Chr2 (501215..502957) [1743 bp, 580 aa] {ON} Anc_7.3...    34   1.5  
AFL038C Chr6 complement(367581..368573) [993 bp, 330 aa] {ON} Sy...    34   1.6  
Kwal_33.13148 s33 (94593..96614) [2022 bp, 673 aa] {ON} YCL039W ...    34   1.6  
Ecym_4649 Chr4 (1264219..1265784) [1566 bp, 521 aa] {ON} similar...    34   1.6  
ZYRO0G02618g Chr7 (201987..204629) [2643 bp, 880 aa] {ON} simila...    35   1.6  
KAFR0C01310 Chr3 (268850..271888) [3039 bp, 1012 aa] {ON} Anc_3....    35   1.6  
TDEL0C04810 Chr3 (867670..871932) [4263 bp, 1420 aa] {ON} Anc_3....    35   1.6  
KNAG0C00410 Chr3 (69301..71367) [2067 bp, 688 aa] {ON} Anc_1.34 ...    34   1.7  
Kwal_56.23895 s56 complement(763257..764360) [1104 bp, 367 aa] {...    34   1.7  
TBLA0C02620 Chr3 (622295..624985) [2691 bp, 896 aa] {ON} Anc_1.3...    34   1.8  
NDAI0C03540 Chr3 complement(810904..815580) [4677 bp, 1558 aa] {...    34   1.8  
Kpol_1045.78 s1045 (183044..184222) [1179 bp, 392 aa] {ON} (1830...    34   1.8  
KLTH0C07634g Chr3 (654087..655364) [1278 bp, 425 aa] {ON} weakly...    34   1.9  
SAKL0D07238g Chr4 complement(594187..596784) [2598 bp, 865 aa] {...    34   1.9  
KLTH0F01166g Chr6 (90708..92939) [2232 bp, 743 aa] {ON} similar ...    34   1.9  
ZYRO0C08976g Chr3 complement(684862..686514) [1653 bp, 550 aa] {...    34   2.0  
KNAG0A07390 Chr1 complement(1156310..1157542) [1233 bp, 410 aa] ...    34   2.0  
SAKL0H24530g Chr8 complement(2127253..2128998) [1746 bp, 581 aa]...    34   2.0  
KNAG0B02800 Chr2 (537056..540979) [3924 bp, 1307 aa] {ON} Anc_7....    34   2.0  
KAFR0L01440 Chr12 complement(266463..267377) [915 bp, 304 aa] {O...    33   2.1  
YDR030C Chr4 complement(501753..503273) [1521 bp, 506 aa] {ON}  ...    34   2.2  
CAGL0L04950g Chr12 complement(564488..566905) [2418 bp, 805 aa] ...    34   2.3  
ZYRO0F11374g Chr6 complement(934451..935983) [1533 bp, 510 aa] {...    34   2.3  
NDAI0A03090 Chr1 (692473..694143) [1671 bp, 556 aa] {ON} Anc_7.2...    34   2.3  
TPHA0M00700 Chr13 complement(132140..135313) [3174 bp, 1057 aa] ...    34   2.4  
Ecym_3487 Chr3 complement(910575..914810) [4236 bp, 1411 aa] {ON...    34   2.4  
KAFR0C02420 Chr3 (471045..472484) [1440 bp, 479 aa] {ON} Anc_1.3...    33   2.5  
TBLA0D03080 Chr4 (741949..748887) [6939 bp, 2312 aa] {ON} Anc_1....    34   2.6  
TDEL0C06690 Chr3 complement(1221419..1223716) [2298 bp, 765 aa] ...    34   2.6  
TDEL0A02450 Chr1 complement(437732..439264) [1533 bp, 510 aa] {O...    33   2.6  
KLLA0A09471g Chr1 complement(827264..831784) [4521 bp, 1506 aa] ...    34   2.7  
NCAS0D03400 Chr4 complement(635698..636840) [1143 bp, 380 aa] {O...    33   2.7  
KLTH0D10054g Chr4 complement(835206..837818) [2613 bp, 870 aa] {...    34   2.7  
Kpol_467.20 s467 complement(43262..43506,43751..45251) [1746 bp,...    33   2.7  
KAFR0F04190 Chr6 (822926..824110) [1185 bp, 394 aa] {ON} Anc_3.5...    33   2.7  
KLLA0E04093g Chr5 (371642..372760) [1119 bp, 372 aa] {ON} simila...    33   2.7  
Kwal_56.23035 s56 complement(373146..374420) [1275 bp, 424 aa] {...    33   2.8  
Ecym_6179 Chr6 complement(330143..333823) [3681 bp, 1226 aa] {ON...    34   2.8  
TBLA0E03460 Chr5 (859536..863192) [3657 bp, 1218 aa] {ON} Anc_3....    34   2.9  
NDAI0J01040 Chr10 (238940..240136) [1197 bp, 398 aa] {ON} Anc_8....    33   2.9  
ZYRO0C14762g Chr3 complement(1148438..1149568) [1131 bp, 376 aa]...    33   3.0  
TDEL0C02130 Chr3 (366855..368435) [1581 bp, 526 aa] {ON} Anc_7.3...    33   3.0  
Suva_2.181 Chr2 complement(312873..314396) [1524 bp, 507 aa] {ON...    33   3.0  
TBLA0A10190 Chr1 complement(2515833..2518256) [2424 bp, 807 aa] ...    33   3.1  
YOL087C Chr15 complement(155287..158637) [3351 bp, 1116 aa] {ON}...    33   3.2  
Ecym_2240 Chr2 (470406..473900) [3495 bp, 1164 aa] {ON} similar ...    33   3.2  
Skud_15.191 Chr15 (339578..340603) [1026 bp, 341 aa] {ON} YOR026...    33   3.3  
TDEL0G02140 Chr7 complement(420388..421566) [1179 bp, 392 aa] {O...    33   3.3  
KAFR0C04445 Chr3 (882595..884274) [1680 bp, 559 aa] {ON}               33   3.3  
TPHA0J01960 Chr10 complement(442993..444126) [1134 bp, 377 aa] {...    33   3.3  
ABR101C Chr2 complement(567358..569841) [2484 bp, 827 aa] {ON} S...    33   3.3  
KAFR0A02700 Chr1 complement(557333..558619) [1287 bp, 428 aa] {O...    33   3.3  
TDEL0G00730 Chr7 (147888..152492) [4605 bp, 1534 aa] {ON} Anc_5....    33   3.4  
Kpol_543.34 s543 (75894..77843) [1950 bp, 649 aa] {ON} (75894..7...    33   3.4  
SAKL0B11836g Chr2 complement(1020766..1023195) [2430 bp, 809 aa]...    33   3.5  
NCAS0B01020 Chr2 complement(161030..162634) [1605 bp, 534 aa] {O...    33   3.6  
KNAG0I02870 Chr9 (558973..562131) [3159 bp, 1052 aa] {ON} Anc_6....    33   3.6  
NDAI0C00390 Chr3 complement(63036..65537) [2502 bp, 833 aa] {ON}...    33   3.8  
SAKL0E08734g Chr5 (713258..714493) [1236 bp, 411 aa] {ON} simila...    33   3.9  
Suva_14.89 Chr14 (164766..166034) [1269 bp, 422 aa] {ON} YNL253W...    33   4.1  
KLTH0D05368g Chr4 (479606..481438) [1833 bp, 610 aa] {ON} simila...    33   4.1  
KLLA0F08811g Chr6 complement(819834..821744) [1911 bp, 636 aa] {...    33   4.2  
Kpol_1002.94 s1002 (240130..241269) [1140 bp, 379 aa] {ON} (2401...    33   4.3  
TPHA0A05850 Chr1 (1327076..1328374) [1299 bp, 432 aa] {ON} Anc_3...    33   4.7  
KLTH0B04136g Chr2 complement(335902..338352) [2451 bp, 816 aa] {...    33   4.7  
CAGL0B00748g Chr2 (65727..68165) [2439 bp, 812 aa] {ON} similar ...    33   4.9  
TBLA0C05010 Chr3 complement(1217846..1219564) [1719 bp, 572 aa] ...    33   4.9  
KAFR0C03870 Chr3 (783131..784120) [990 bp, 329 aa] {ON} Anc_2.65...    32   5.0  
Suva_13.218 Chr13 complement(352704..355115) [2412 bp, 803 aa] {...    33   5.1  
Kwal_33.14971 s33 (896070..898526) [2457 bp, 818 aa] {ON} YMR049...    33   5.2  
KLLA0C16643g Chr3 complement(1457590..1458498) [909 bp, 302 aa] ...    32   5.2  
YOL138C Chr15 complement(61325..65350) [4026 bp, 1341 aa] {ON}  ...    33   5.3  
Kpol_262.1 s262 (224..2131) [1908 bp, 635 aa] {ON} (224..2131) [...    33   5.5  
ZYRO0D11616g Chr4 (977141..978928) [1788 bp, 595 aa] {ON} simila...    33   5.6  
Kpol_530.25 s530 (67445..69169) [1725 bp, 574 aa] {ON} (67445..6...    33   5.6  
NDAI0A00340 Chr1 (50320..53166) [2847 bp, 948 aa] {ON} Anc_1.34 ...    33   5.9  
NCAS0I01210 Chr9 complement(218242..222582) [4341 bp, 1446 aa] {...    33   6.0  
TDEL0E03590 Chr5 complement(670913..676561) [5649 bp, 1882 aa] {...    33   6.0  
Skud_16.142 Chr16 complement(261333..262718) [1386 bp, 461 aa] {...    32   6.2  
KLLA0F21076g Chr6 (1966373..1969036) [2664 bp, 887 aa] {ON} weak...    33   6.3  
Suva_4.491 Chr4 complement(855726..856880) [1155 bp, 384 aa] {ON...    32   6.3  
CAGL0M05291g Chr13 complement(566250..567509) [1260 bp, 419 aa] ...    32   6.5  
KLLA0F26653g Chr6 (2461876..2464251) [2376 bp, 791 aa] {ON} simi...    32   6.6  
TPHA0D01130 Chr4 (236199..237554) [1356 bp, 451 aa] {ON} Anc_8.6...    32   6.6  
Kpol_1072.46 s1072 (103226..105850) [2625 bp, 874 aa] {ON} (1032...    32   6.7  
YCL039W Chr3 (52645..54882) [2238 bp, 745 aa] {ON}  GID7Protein ...    32   6.7  
Ecym_8020 Chr8 (52179..53834) [1656 bp, 551 aa] {ON} similar to ...    32   6.8  
TBLA0B01860 Chr2 complement(424732..427818) [3087 bp, 1028 aa] {...    32   6.8  
KLLA0B07667g Chr2 (667863..673862) [6000 bp, 1999 aa] {ON} some ...    32   7.0  
Ecym_5584 Chr5 complement(1199282..1200238) [957 bp, 318 aa] {ON...    32   7.1  
Smik_6.325 Chr6 complement(511278..513968) [2691 bp, 896 aa] {ON...    32   7.3  
ZYRO0B15268g Chr2 complement(1243795..1244396,1244475..1245684) ...    32   7.4  
TDEL0H01690 Chr8 (289748..291382) [1635 bp, 544 aa] {ON} Anc_7.2...    32   7.6  
Skud_15.66 Chr15 complement(114566..117898) [3333 bp, 1110 aa] {...    32   7.7  
CAGL0K03377g Chr11 complement(307358..310294) [2937 bp, 978 aa] ...    32   7.8  
NDAI0G01680 Chr7 (367237..369705) [2469 bp, 822 aa] {ON} Anc_3.2...    32   7.8  
TPHA0J02880 Chr10 (639057..640961) [1905 bp, 634 aa] {ON} Anc_5....    32   8.0  
CAGL0F01837g Chr6 (181178..182980) [1803 bp, 600 aa] {ON} simila...    32   8.3  
ADL054W Chr4 (586898..588772) [1875 bp, 624 aa] {ON} Syntenic ho...    32   8.5  
Kpol_1036.22 s1036 (54759..57860) [3102 bp, 1033 aa] {ON} (54759...    32   8.5  
Suva_11.210 Chr11 (387997..388986) [990 bp, 329 aa] {ON} YKL018W...    32   8.8  
ADR331C Chr4 complement(1285562..1290250) [4689 bp, 1562 aa] {ON...    32   8.8  
TPHA0O01610 Chr15 (319614..321224) [1611 bp, 536 aa] {ON} Anc_2....    32   8.9  
Skud_11.211 Chr11 (384964..385953) [990 bp, 329 aa] {ON} YKL018W...    32   9.1  
TPHA0L02130 Chr12 complement(441224..445750) [4527 bp, 1508 aa] ...    32   9.1  
Suva_3.105 Chr3 complement(150015..153692) [3678 bp, 1225 aa] {O...    32   9.2  
Kpol_1012.5 s1012 (8531..8920,8923..9909) [1377 bp, 458 aa] {ON}...    32   9.5  
Skud_13.205 Chr13 complement(349265..351682) [2418 bp, 805 aa] {...    32   9.5  
YKL018W Chr11 (404102..405091) [990 bp, 329 aa] {ON}  SWD2Subuni...    32   9.6  
NCAS0F01450 Chr6 complement(287070..289796) [2727 bp, 908 aa] {O...    32   9.7  
Kwal_23.4327 s23 (670568..675208) [4641 bp, 1546 aa] {ON} YHR186...    32   9.9  

>CAGL0M04279g Chr13 (469040..471862) [2823 bp, 940 aa] {ON} highly
           similar to uniprot|Q12220 Saccharomyces cerevisiae
           YLR129w DIP2 DOM34P-interacting protein
          Length = 940

 Score = 1932 bits (5006), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 940/940 (100%), Positives = 940/940 (100%)

Query: 1   MVKSYQRFEQANVFGVISSNSNSVWIEPEASKRKTGNLGQVIVGGLENILVWDIKTGEQI 60
           MVKSYQRFEQANVFGVISSNSNSVWIEPEASKRKTGNLGQVIVGGLENILVWDIKTGEQI
Sbjct: 1   MVKSYQRFEQANVFGVISSNSNSVWIEPEASKRKTGNLGQVIVGGLENILVWDIKTGEQI 60

Query: 61  AQLTDGLPPGASDAKLSKPAETTFLKYHPETNLLAAGYADGVIKIWDLISKTVLISFNGH 120
           AQLTDGLPPGASDAKLSKPAETTFLKYHPETNLLAAGYADGVIKIWDLISKTVLISFNGH
Sbjct: 61  AQLTDGLPPGASDAKLSKPAETTFLKYHPETNLLAAGYADGVIKIWDLISKTVLISFNGH 120

Query: 121 KSAITVLAFDTTGTRLISASKDSDIIVWDLVGESGLYKLRSHKDAITGLWCEDENWLIST 180
           KSAITVLAFDTTGTRLISASKDSDIIVWDLVGESGLYKLRSHKDAITGLWCEDENWLIST
Sbjct: 121 KSAITVLAFDTTGTRLISASKDSDIIVWDLVGESGLYKLRSHKDAITGLWCEDENWLIST 180

Query: 181 SKDGLVKIWDLKSQQCVETHLAHTGECWSLGIIEDMAVTCSADSQVKLWKLDLQAENGSK 240
           SKDGLVKIWDLKSQQCVETHLAHTGECWSLGIIEDMAVTCSADSQVKLWKLDLQAENGSK
Sbjct: 181 SKDGLVKIWDLKSQQCVETHLAHTGECWSLGIIEDMAVTCSADSQVKLWKLDLQAENGSK 240

Query: 241 LTEKGIIEKQSKQRGVEIDFAVAPDGVKFFYIQNADKTIEIYRLRKEEEISRALKKREKR 300
           LTEKGIIEKQSKQRGVEIDFAVAPDGVKFFYIQNADKTIEIYRLRKEEEISRALKKREKR
Sbjct: 241 LTEKGIIEKQSKQRGVEIDFAVAPDGVKFFYIQNADKTIEIYRLRKEEEISRALKKREKR 300

Query: 301 LQDKGMSEEEIKEAMGSPVSLMYHLFQVVRSPYKIKSAQWTVCSNSKLELVVTTSNNSIE 360
           LQDKGMSEEEIKEAMGSPVSLMYHLFQVVRSPYKIKSAQWTVCSNSKLELVVTTSNNSIE
Sbjct: 301 LQDKGMSEEEIKEAMGSPVSLMYHLFQVVRSPYKIKSAQWTVCSNSKLELVVTTSNNSIE 360

Query: 361 YYSIPYSKREPTQPAPLKLHTIDLHGQRTDIRSTSISDDNKLLATASNGSLKIWNIKTKR 420
           YYSIPYSKREPTQPAPLKLHTIDLHGQRTDIRSTSISDDNKLLATASNGSLKIWNIKTKR
Sbjct: 361 YYSIPYSKREPTQPAPLKLHTIDLHGQRTDIRSTSISDDNKLLATASNGSLKIWNIKTKR 420

Query: 421 CIRSFECGYALTCKFLPGGALVVVGTRNGELQLFDIASSTMLDNKEGAHDAAIWSLDLTS 480
           CIRSFECGYALTCKFLPGGALVVVGTRNGELQLFDIASSTMLDNKEGAHDAAIWSLDLTS
Sbjct: 421 CIRSFECGYALTCKFLPGGALVVVGTRNGELQLFDIASSTMLDNKEGAHDAAIWSLDLTS 480

Query: 481 DGRKLVTGSADKTVRFWTFEVSEVPVSDESNKTMPMLQLFHDTTLELDDDILSVVISPDD 540
           DGRKLVTGSADKTVRFWTFEVSEVPVSDESNKTMPMLQLFHDTTLELDDDILSVVISPDD
Sbjct: 481 DGRKLVTGSADKTVRFWTFEVSEVPVSDESNKTMPMLQLFHDTTLELDDDILSVVISPDD 540

Query: 541 KFIAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSMDISYDSKLIVTCSADKNIKIWGLD 600
           KFIAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSMDISYDSKLIVTCSADKNIKIWGLD
Sbjct: 541 KFIAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSMDISYDSKLIVTCSADKNIKIWGLD 600

Query: 601 FGDCHKSLFAHQDSIMNVKFLPESYNFFSCSKDATVKYWDGQKFECIQKLAAHQSEVWSI 660
           FGDCHKSLFAHQDSIMNVKFLPESYNFFSCSKDATVKYWDGQKFECIQKLAAHQSEVWSI
Sbjct: 601 FGDCHKSLFAHQDSIMNVKFLPESYNFFSCSKDATVKYWDGQKFECIQKLAAHQSEVWSI 660

Query: 661 SVSNDGTFVISTGHDHSIRVWEETEDQVFLEEEREKEMDEQYEDTLLTSLEGGAGDEMLS 720
           SVSNDGTFVISTGHDHSIRVWEETEDQVFLEEEREKEMDEQYEDTLLTSLEGGAGDEMLS
Sbjct: 661 SVSNDGTFVISTGHDHSIRVWEETEDQVFLEEEREKEMDEQYEDTLLTSLEGGAGDEMLS 720

Query: 721 VKKGDNEESEEVEGVHKQTVESLKAGERLMEALEIGVNDIIAMEEFNEQLNAWKKSKKGI 780
           VKKGDNEESEEVEGVHKQTVESLKAGERLMEALEIGVNDIIAMEEFNEQLNAWKKSKKGI
Sbjct: 721 VKKGDNEESEEVEGVHKQTVESLKAGERLMEALEIGVNDIIAMEEFNEQLNAWKKSKKGI 780

Query: 781 QPIRPQENTLLVALKKTPEEYIIETLVKIKPSQIEDALMVMPFSYILKFLKFIDVVTTKA 840
           QPIRPQENTLLVALKKTPEEYIIETLVKIKPSQIEDALMVMPFSYILKFLKFIDVVTTKA
Sbjct: 781 QPIRPQENTLLVALKKTPEEYIIETLVKIKPSQIEDALMVMPFSYILKFLKFIDVVTTKA 840

Query: 841 ALLQKHISLVCKTLFFVIRFNYKELVAQKNANLKLQITRVKDNLRKSLKSNVDELGFNIE 900
           ALLQKHISLVCKTLFFVIRFNYKELVAQKNANLKLQITRVKDNLRKSLKSNVDELGFNIE
Sbjct: 841 ALLQKHISLVCKTLFFVIRFNYKELVAQKNANLKLQITRVKDNLRKSLKSNVDELGFNIE 900

Query: 901 GMKFIKQQWELNHHLEFNDEYEEKNFEEKHSKKRVFGTLA 940
           GMKFIKQQWELNHHLEFNDEYEEKNFEEKHSKKRVFGTLA
Sbjct: 901 GMKFIKQQWELNHHLEFNDEYEEKNFEEKHSKKRVFGTLA 940

>SAKL0H15532g Chr8 complement(1351712..1354537) [2826 bp, 941 aa]
           {ON} highly similar to uniprot|Q12220 Saccharomyces
           cerevisiae YLR129W DIP2 Nucleolar protein specifically
           associated with the U3 snoRNA part of the large
           ribonucleoprotein complex known as the small subunit
           (SSU) processome required for 18S rRNA biogenesis part
           of the active pre-rRNA processing complex
          Length = 941

 Score = 1375 bits (3558), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 659/945 (69%), Positives = 794/945 (84%), Gaps = 9/945 (0%)

Query: 1   MVKSYQRFEQANVFGVISSNSNSVWIEPEASKRKTGNLGQVIVGGLENILVWDIKTGEQI 60
           MVKSYQRFEQ + FGVISSN+N VWI    + R  G+ GQ++ G LEN+  WDIKTGE  
Sbjct: 1   MVKSYQRFEQGSAFGVISSNTNCVWI----ASRNRGSAGQILTGALENVNCWDIKTGELS 56

Query: 61  AQLTDGLPPGASDAKLSKPAETTFLKYHPETNLLAAGYADGVIKIWDLISKTVLISFNGH 120
             LTDGLPPGA DAK +K AE+T+L+YHPETNLLA GYADGVIKIWDLISKTVLI+FNGH
Sbjct: 57  KILTDGLPPGAVDAKSTKLAESTYLQYHPETNLLAVGYADGVIKIWDLISKTVLINFNGH 116

Query: 121 KSAITVLAFDTTGTRLISASKDSDIIVWDLVGESGLYKLRSHKDAITGLWCEDENWLIST 180
           KSAITVL FD TGTRLIS SKDSDII+WDLVGE GLYKLRSHKD+ITG+WCE+E+WLIST
Sbjct: 117 KSAITVLRFDPTGTRLISGSKDSDIIIWDLVGEVGLYKLRSHKDSITGIWCENEDWLIST 176

Query: 181 SKDGLVKIWDLKSQQCVETHLAHTGECWSLGIIEDMAVTCSADSQVKLWKLDLQAENGSK 240
           SKDGL+KIWDLK+QQCVETH+AHT ECW L I  D+ +T S +SQ+K+W LDL  + GSK
Sbjct: 177 SKDGLIKIWDLKTQQCVETHMAHTSECWGLAIHNDLVITTSTESQIKIWNLDLDKDMGSK 236

Query: 241 LTEKGIIEKQSKQRGVEIDFAVAPDGVKFFYIQNADKTIEIYRLRKEEEISRALKKREKR 300
           L EKGI EKQSKQRGV ++F    DGV FFYIQNADKT+EI+R+R +EEIS+AL+KREKR
Sbjct: 237 LIEKGIYEKQSKQRGVSVEFITTSDGVNFFYIQNADKTVEIFRVRTQEEISKALRKREKR 296

Query: 301 LQDKGMSEEEIKEAM-GSPVSLMYHLFQVVRSPYKIKSAQWTVCSNSKLELVVTTSNNSI 359
           L+DKGM++E+I++ +  S VS++ H FQ +RSP+KIK+A W V + SKLE+V+TTSNN++
Sbjct: 297 LRDKGMADEKIQQNIKDSYVSVIMHPFQTIRSPFKIKAATWAVTTTSKLEMVLTTSNNTV 356

Query: 360 EYYSIPYSKREPTQPAPLKLHTIDLHGQRTDIRSTSISDDNKLLATASNGSLKIWNIKTK 419
           EYYSIPY KREPT+PAP KL+TI+L G RTD+RS  ISDDNKLLATASNG+LKIWNIKT 
Sbjct: 357 EYYSIPYQKREPTRPAPNKLYTIELQGHRTDVRSIDISDDNKLLATASNGTLKIWNIKTH 416

Query: 420 RCIRSFECGYALTCKFLPGGALVVVGTRNGELQLFDIASSTMLDNKEGAHDAAIWSLDLT 479
            CIR+FECGYALTCKFLPGGALVVVG R G+LQLFD+ASST+L+NKE AH AAIWSLDLT
Sbjct: 417 ACIRTFECGYALTCKFLPGGALVVVGNRGGDLQLFDLASSTLLENKEDAHGAAIWSLDLT 476

Query: 480 SDGRKLVTGSADKTVRFWTFEVSEVPVSDESNKTMPMLQLFHDTTLELDDDILSVVISPD 539
           SDG++LVTGSADKTV+FW F+V +  +    +K +P L++FHDTTLEL+DDIL+V IS D
Sbjct: 477 SDGKRLVTGSADKTVKFWDFKVDQELIPGTVDKFVPKLKIFHDTTLELNDDILAVKISSD 536

Query: 540 DKFIAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSMDISYDSKLIVTCSADKNIKIWGL 599
           +KF+AVSLLDNTVKVFFL+SMKFFLSLYGHKLPVLS+DIS+DSKL++T SADKNIKIWGL
Sbjct: 537 NKFLAVSLLDNTVKVFFLNSMKFFLSLYGHKLPVLSIDISFDSKLLITSSADKNIKIWGL 596

Query: 600 DFGDCHKSLFAHQDSIMNVKFLPESYNFFSCSKDATVKYWDGQKFECIQKLAAHQSEVWS 659
           DFGDCHKSLFAHQDSIM+VKF+PES+NFFSCSKD  VKYWDG KFEC+QKLAAHQSEVW+
Sbjct: 597 DFGDCHKSLFAHQDSIMSVKFVPESHNFFSCSKDGLVKYWDGDKFECVQKLAAHQSEVWA 656

Query: 660 ISVSNDGTFVISTGHDHSIRVWEETEDQVFLEEEREKEMDEQYEDTLLTSLEGGAGDEM- 718
           +++SND  FV+ST HDHSIRVWEETED+VFLEEEREKEMDEQYE+TLL SLE G+GD+  
Sbjct: 657 LAISNDARFVVSTSHDHSIRVWEETEDEVFLEEEREKEMDEQYENTLLHSLEAGSGDDNF 716

Query: 719 ---LSVKKGDNEESEEVEGVHKQTVESLKAGERLMEALEIGVNDIIAMEEFNEQLNAWKK 775
              +  +  D E +++   VHKQT+ESLKAGER++EAL++G+  I   E + + L  W+K
Sbjct: 717 QRDIEGRGEDGEITDQATDVHKQTIESLKAGERVIEALDLGIAVIEENETYEKNLKDWQK 776

Query: 776 SKKGIQPIRPQENTLLVALKKTPEEYIIETLVKIKPSQIEDALMVMPFSYILKFLKFIDV 835
            K G  P +PQEN +LVALKK PE+YI+ETLVKI+PSQ+EDAL+V+PFSY+L FLKFIDV
Sbjct: 777 KKSGEPPSKPQENAILVALKKAPEQYIMETLVKIRPSQLEDALLVLPFSYVLSFLKFIDV 836

Query: 836 VTTKAALLQKHISLVCKTLFFVIRFNYKELVAQKNANLKLQITRVKDNLRKSLKSNVDEL 895
           V     +   H++L+CK LFF+I+ NY+ELVAQKN  LKLQI RVK  LR +LK N D+L
Sbjct: 837 VIKDKKMQNNHLTLICKLLFFIIKSNYRELVAQKNEELKLQINRVKQELRTALKGNADDL 896

Query: 896 GFNIEGMKFIKQQWELNHHLEFNDEYEEKNFEEKHSKKRVFGTLA 940
           GFN++G+KFI+QQW L H+LEF D+Y+++  EEK  KKR+F TL 
Sbjct: 897 GFNVQGLKFIRQQWNLRHNLEFVDDYDQRKQEEKTVKKRIFETLV 941

>Suva_10.222 Chr10 (408217..411048) [2832 bp, 943 aa] {ON} YLR129W
           (REAL)
          Length = 943

 Score = 1372 bits (3551), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 652/940 (69%), Positives = 797/940 (84%), Gaps = 5/940 (0%)

Query: 1   MVKSYQRFEQANVFGVISSNSNSVWIEPEASKRKTGN-LGQVIVGGLENILVWDIKTGEQ 59
           MVKSYQRFEQA  FGVI+SN+N VWI P +S+   G+  GQ+I   LEN+ +WDIKTG+ 
Sbjct: 1   MVKSYQRFEQAAAFGVIASNANCVWI-PASSRTNNGSGPGQLITSALENVNIWDIKTGDL 59

Query: 60  IAQLTDGLPPGASDAKLSKPAETTFLKYHPETNLLAAGYADGVIKIWDLISKTVLISFNG 119
           +  L+DGLPPGASDAK SKPAE T+L+ H +TNLLA GYADGVIK+WDL+SKTVL++FNG
Sbjct: 60  VTTLSDGLPPGASDAKGSKPAECTYLEVHQDTNLLAVGYADGVIKVWDLVSKTVLLNFNG 119

Query: 120 HKSAITVLAFDTTGTRLISASKDSDIIVWDLVGESGLYKLRSHKDAITGLWCEDENWLIS 179
           HK+AIT++ FD+TGTRLIS SKDS+IIVWDLVGE GLYKLRSHKDAITG WC+ E+WL+S
Sbjct: 120 HKAAITLMQFDSTGTRLISGSKDSNIIVWDLVGEVGLYKLRSHKDAITGFWCQGEDWLVS 179

Query: 180 TSKDGLVKIWDLKSQQCVETHLAHTGECWSLGIIEDMAVTCSADSQVKLWKLDLQAEN-G 238
           TSKDGL+KIWDLK+QQC+ETH+AHTGECW L + +D+ +T S DSQVK+WKL+++ E  G
Sbjct: 180 TSKDGLIKIWDLKTQQCIETHIAHTGECWGLAVKDDLLITTSTDSQVKIWKLNMENEKMG 239

Query: 239 SKLTEKGIIEKQSKQRGVEIDFAV-APDGVKFFYIQNADKTIEIYRLRKEEEISRALKKR 297
            KLTE GI EKQSKQRG++I+F   A DGV FFYIQNADKTIE YR+RKEEEI+R LKKR
Sbjct: 240 EKLTEMGIFEKQSKQRGLKIEFITNASDGVSFFYIQNADKTIETYRIRKEEEIARGLKKR 299

Query: 298 EKRLQDKGMSEEEIKEAM-GSPVSLMYHLFQVVRSPYKIKSAQWTVCSNSKLELVVTTSN 356
           EKRL++KG+++EEI +++  S  SL+ H FQ VRS YKIKSA WT  ++SKLELVVTTSN
Sbjct: 300 EKRLREKGLTDEEISKSIKDSYSSLILHPFQTVRSLYKIKSASWTTVTSSKLELVVTTSN 359

Query: 357 NSIEYYSIPYSKREPTQPAPLKLHTIDLHGQRTDIRSTSISDDNKLLATASNGSLKIWNI 416
           N+IEYYSIPY KR+PT PAPLK HTI+L GQRTD+RS  +SDDNKLLATASNGSLKIWN+
Sbjct: 360 NTIEYYSIPYEKRDPTSPAPLKTHTIELQGQRTDVRSIDVSDDNKLLATASNGSLKIWNV 419

Query: 417 KTKRCIRSFECGYALTCKFLPGGALVVVGTRNGELQLFDIASSTMLDNKEGAHDAAIWSL 476
           KT +CIR+FECGYALTCKFLPGG LV++GTR+GELQLFD+ASS++LD  E AHDAAIWSL
Sbjct: 420 KTHKCIRTFECGYALTCKFLPGGLLVILGTRSGELQLFDLASSSLLDTIEDAHDAAIWSL 479

Query: 477 DLTSDGRKLVTGSADKTVRFWTFEVSEVPVSDESNKTMPMLQLFHDTTLELDDDILSVVI 536
           DLTSDG++LVTGSADKTV+FW F+V +  V    +K +PML+L HDTTLEL+DDILSV I
Sbjct: 480 DLTSDGKRLVTGSADKTVKFWDFQVEKTLVPGTKDKFVPMLKLNHDTTLELNDDILSVRI 539

Query: 537 SPDDKFIAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSMDISYDSKLIVTCSADKNIKI 596
           SPDD+++A+SLLDNTVKVFFLDSMKF+LSLYGHKLPVLS+DIS+DSK+I+T SADKNIKI
Sbjct: 540 SPDDRYLAISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDSKMIITSSADKNIKI 599

Query: 597 WGLDFGDCHKSLFAHQDSIMNVKFLPESYNFFSCSKDATVKYWDGQKFECIQKLAAHQSE 656
           WGLDFGDCHKSLFAHQDSIM+VKFLPES+NFFSCSKDA VKYWDG+KFECIQKL AHQSE
Sbjct: 600 WGLDFGDCHKSLFAHQDSIMSVKFLPESHNFFSCSKDAVVKYWDGEKFECIQKLYAHQSE 659

Query: 657 VWSISVSNDGTFVISTGHDHSIRVWEETEDQVFLEEEREKEMDEQYEDTLLTSLEGGAGD 716
           VW++++S DG+FV+S+ HDHSIR+WEETEDQVFLEEE+EKE++EQYEDTLLTSLE G GD
Sbjct: 660 VWALAISTDGSFVVSSSHDHSIRIWEETEDQVFLEEEKEKELEEQYEDTLLTSLEEGNGD 719

Query: 717 EMLSVKKGDNEESEEVEGVHKQTVESLKAGERLMEALEIGVNDIIAMEEFNEQLNAWKKS 776
           +            +E  GVHKQT+ESLKAGE+LMEAL++G+ +I  ME +N+ +  W++ 
Sbjct: 720 DAFKGDATGENVEDEASGVHKQTLESLKAGEKLMEALDLGIAEIEGMEMYNKDMKLWQRK 779

Query: 777 KKGIQPIRPQENTLLVALKKTPEEYIIETLVKIKPSQIEDALMVMPFSYILKFLKFIDVV 836
           K G  P++PQ N++L+A+KKTPE+YI++TL +I+ SQ+EDALMVMPFSY+LKFLKF D V
Sbjct: 780 KLGEAPMKPQGNSVLIAVKKTPEQYIMDTLSRIRASQLEDALMVMPFSYVLKFLKFTDAV 839

Query: 837 TTKAALLQKHISLVCKTLFFVIRFNYKELVAQKNANLKLQITRVKDNLRKSLKSNVDELG 896
                LL  H+ L+CK LFF+I+FN+KEL++QKN  LKLQI RVK  LR +LKS  D+LG
Sbjct: 840 MQNKTLLHNHLPLICKNLFFIIKFNHKELISQKNEELKLQINRVKTELRNALKSTEDDLG 899

Query: 897 FNIEGMKFIKQQWELNHHLEFNDEYEEKNFEEKHSKKRVF 936
           FN++G+KFI+QQW L H+ EF DEY+++  E   ++KRVF
Sbjct: 900 FNVQGLKFIRQQWNLKHNYEFVDEYDQQEKENTSARKRVF 939

>Skud_12.198 Chr12 (382439..385270) [2832 bp, 943 aa] {ON} YLR129W
           (REAL)
          Length = 943

 Score = 1367 bits (3538), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 642/942 (68%), Positives = 795/942 (84%), Gaps = 3/942 (0%)

Query: 1   MVKSYQRFEQANVFGVISSNSNSVWIEPEASKRKTGNLGQVIVGGLENILVWDIKTGEQI 60
           MVKSYQRFEQ+ +FGVI+SN+N VW+ P +   K    GQ+I   LEN+ +WDIKTG+ +
Sbjct: 1   MVKSYQRFEQSAIFGVIASNANCVWLPPSSRTNKGSGPGQLITSALENVNIWDIKTGDLL 60

Query: 61  AQLTDGLPPGASDAKLSKPAETTFLKYHPETNLLAAGYADGVIKIWDLISKTVLISFNGH 120
           A L+DGLPPGASDA+ SKPAE T+L+ H +T+LLA GYADGVIK+WDL+SKTVL++FNGH
Sbjct: 61  ATLSDGLPPGASDARGSKPAECTYLEVHEDTDLLAVGYADGVIKVWDLMSKTVLLNFNGH 120

Query: 121 KSAITVLAFDTTGTRLISASKDSDIIVWDLVGESGLYKLRSHKDAITGLWCEDENWLIST 180
           K+AIT+L FD+TGTRLIS S+DS+IIVWDLVGE GLYKLRSHKD ITG+WC+ E+WLIST
Sbjct: 121 KAAITLLQFDSTGTRLISGSRDSNIIVWDLVGEVGLYKLRSHKDCITGIWCQGEDWLIST 180

Query: 181 SKDGLVKIWDLKSQQCVETHLAHTGECWSLGIIEDMAVTCSADSQVKLWKLDLQAEN-GS 239
           SKDG++K+WDLK+QQC+ETH+AHTGECWSL + +D+ +T   DSQVK+WKL+++ +  G 
Sbjct: 181 SKDGMIKLWDLKTQQCIETHIAHTGECWSLSVKDDLLITTGTDSQVKIWKLNMENDKMGE 240

Query: 240 KLTEKGIIEKQSKQRGVEIDFAV-APDGVKFFYIQNADKTIEIYRLRKEEEISRALKKRE 298
           KLTE G+ EKQSKQRG++++F   A DGV FFYIQNADKTIE +R+RKEEEI+R LKKRE
Sbjct: 241 KLTEVGVFEKQSKQRGLKVEFITNASDGVSFFYIQNADKTIETFRIRKEEEIARGLKKRE 300

Query: 299 KRLQDKGMSEEEIKEAM-GSPVSLMYHLFQVVRSPYKIKSAQWTVCSNSKLELVVTTSNN 357
           KRL++KG+++EEI  ++ GS  SL+ H FQ +RS YK+KSA WT  ++SKLELV+TTSNN
Sbjct: 301 KRLREKGLTDEEIARSIKGSYSSLVLHPFQTIRSFYKVKSASWTTVTSSKLELVLTTSNN 360

Query: 358 SIEYYSIPYSKREPTQPAPLKLHTIDLHGQRTDIRSTSISDDNKLLATASNGSLKIWNIK 417
           +IEYYSIPY KRE T PAPLK HTI+L GQRTD+RS  ISDDNKLLATASNGSLKIWN+K
Sbjct: 361 TIEYYSIPYEKREATSPAPLKTHTIELQGQRTDVRSIDISDDNKLLATASNGSLKIWNVK 420

Query: 418 TKRCIRSFECGYALTCKFLPGGALVVVGTRNGELQLFDIASSTMLDNKEGAHDAAIWSLD 477
           T +CIR+FECGYAL+CKFLPGG LV++GTR GELQLFD+ASS++LD  E AHDAAIWSLD
Sbjct: 421 THKCIRTFECGYALSCKFLPGGLLVILGTRTGELQLFDLASSSLLDTVEDAHDAAIWSLD 480

Query: 478 LTSDGRKLVTGSADKTVRFWTFEVSEVPVSDESNKTMPMLQLFHDTTLELDDDILSVVIS 537
           LTSDG++LVTGSADKTV+FW F+V    V    +K +PML+L HDTTLEL+DDILSV IS
Sbjct: 481 LTSDGKRLVTGSADKTVKFWDFQVENTLVPGTKDKLLPMLKLNHDTTLELNDDILSVRIS 540

Query: 538 PDDKFIAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSMDISYDSKLIVTCSADKNIKIW 597
           PDD+++A+SLLDNTVKVFFLDSMKF+LSLYGHKLPVLS+DIS+DSK+I+T SADKNIKIW
Sbjct: 541 PDDRYLAISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDSKMIITSSADKNIKIW 600

Query: 598 GLDFGDCHKSLFAHQDSIMNVKFLPESYNFFSCSKDATVKYWDGQKFECIQKLAAHQSEV 657
           GLDFGDCHKSLFAHQDSIM+VKFLPES+NFFSCSKDA VKYWDG+KFECIQKL AHQSEV
Sbjct: 601 GLDFGDCHKSLFAHQDSIMSVKFLPESHNFFSCSKDAVVKYWDGEKFECIQKLYAHQSEV 660

Query: 658 WSISVSNDGTFVISTGHDHSIRVWEETEDQVFLEEEREKEMDEQYEDTLLTSLEGGAGDE 717
           W+++++++G+FV+S+ HDHSIR+WEETEDQVFLEEE+EKE++EQYEDTLL SLE G  D+
Sbjct: 661 WALAIASNGSFVVSSSHDHSIRIWEETEDQVFLEEEKEKELEEQYEDTLLASLEEGNADD 720

Query: 718 MLSVKKGDNEESEEVEGVHKQTVESLKAGERLMEALEIGVNDIIAMEEFNEQLNAWKKSK 777
                    +  +E  GVHKQT+ESLKAGERLMEAL+IG+ DI  ME +N+ +  W++ K
Sbjct: 721 AFKGDAAGEDVEDEASGVHKQTLESLKAGERLMEALDIGIADIEGMETYNKDMELWQRKK 780

Query: 778 KGIQPIRPQENTLLVALKKTPEEYIIETLVKIKPSQIEDALMVMPFSYILKFLKFIDVVT 837
            G  P++PQ N++L+A+ KTPE+YI++TL +I+ SQ+EDALMVMPFSY+LKFLKFID V 
Sbjct: 781 LGEAPMKPQGNSVLIAVNKTPEQYILDTLSRIRTSQLEDALMVMPFSYVLKFLKFIDTVM 840

Query: 838 TKAALLQKHISLVCKTLFFVIRFNYKELVAQKNANLKLQITRVKDNLRKSLKSNVDELGF 897
               LL  H+ LVC+ LFF+I+FN+KELV+QKN  LKLQI RVK  LR +LKS  D+LGF
Sbjct: 841 QNKTLLHSHLPLVCRNLFFIIKFNHKELVSQKNEELKLQINRVKTELRNALKSTEDDLGF 900

Query: 898 NIEGMKFIKQQWELNHHLEFNDEYEEKNFEEKHSKKRVFGTL 939
           N++G+KFIKQQW L H+ EF DEY+++  E   ++KRVF T+
Sbjct: 901 NVQGLKFIKQQWNLRHNYEFVDEYDQQEKENSSARKRVFETV 942

>NCAS0C03260 Chr3 complement(640108..643059) [2952 bp, 983 aa] {ON}
           Anc_8.324
          Length = 983

 Score = 1360 bits (3519), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 657/958 (68%), Positives = 801/958 (83%), Gaps = 20/958 (2%)

Query: 1   MVKSYQRFEQANVFGVISSNSNSVWIEPEASKRKTGNLGQVIVGGLENILVWDIKTGEQI 60
           MVKSYQRFEQA+VFGVISSNSN VW+   +SK+   + GQ+I G LEN+ +WD+KTGE  
Sbjct: 28  MVKSYQRFEQASVFGVISSNSNCVWLPSTSSKK--SHPGQIITGALENVNIWDLKTGELA 85

Query: 61  AQLTDGL--PPGASDAKLSKPAETTFLKYHPETNLLAAGYADGVIKIWDLISKTVLISFN 118
           + L DGL  PPG+ DAK SKPAETTFL++H ETNLLA GY DGV+K+WDL SKTVL + N
Sbjct: 86  SFLNDGLVPPPGSVDAKSSKPAETTFLQHHKETNLLAVGYNDGVVKVWDLYSKTVLCNLN 145

Query: 119 GHKSAITVLAFDTTGTRLISASKDSDIIVWDLVGESGLYKLRSHKDAITGLWC------- 171
           GH SAIT L FDT+GTRLIS S+DS+IIVWDLV E GLYKLRSHKDAITG+WC       
Sbjct: 146 GHSSAITALKFDTSGTRLISGSRDSNIIVWDLVSEVGLYKLRSHKDAITGIWCNEVTNNN 205

Query: 172 EDEN---WLISTSKDGLVKIWDLKSQQCVETHLAHTGECWSLGIIEDMAVTCSADSQVKL 228
           ++EN   WLISTSKDGL+KIWDLK QQCVETH+AHTGECWSL +  D+ +T S+DSQVK 
Sbjct: 206 QEENELDWLISTSKDGLIKIWDLKIQQCVETHIAHTGECWSLAVRNDLVITTSSDSQVKF 265

Query: 229 WKLDLQAE---NGSKLTEKGIIEKQSKQRGVEIDFAVAPDGVKFFYIQNADKTIEIYRLR 285
           W+L LQ +   NGSKL EKGI EKQSKQRG+ ++F  + DGV FF IQNAD+T+EI+RLR
Sbjct: 266 WQLSLQDDTVPNGSKLIEKGIYEKQSKQRGLNVEFIDSIDGVGFFLIQNADRTVEIFRLR 325

Query: 286 KEEEISRALKKREKRLQDKGMSEEEIKEAM-GSPVSLMYHLFQVVRSPYKIKSAQWTVCS 344
           KEEEIS+ALKKREKRL +KGM+ +EIK+++  S VS+M H FQ++RS YK+K+A WT+ +
Sbjct: 326 KEEEISKALKKREKRLTEKGMTPDEIKKSLEDSFVSMMMHPFQIIRSIYKVKAATWTIAT 385

Query: 345 NSKLELVVTTSNNSIEYYSIPYSKREPTQPAPLKLHTIDLHGQRTDIRSTSISDDNKLLA 404
           ++KLEL VTT+NN+IEYYSIPY KREPTQP   KL+ ++L GQRTDIRS  ISDDNKLLA
Sbjct: 386 STKLELTVTTANNTIEYYSIPYEKREPTQPIANKLYNVELQGQRTDIRSIDISDDNKLLA 445

Query: 405 TASNGSLKIWNIKTKRCIRSFECGYALTCKFLPGGALVVVGTRNGELQLFDIASSTMLDN 464
           TASNGSLKIWN+KTK CIR+FECGYALTCKFLPGG LV++GTR GELQLFD+ASST + N
Sbjct: 446 TASNGSLKIWNLKTKLCIRTFECGYALTCKFLPGGMLVIIGTRAGELQLFDLASSTQIAN 505

Query: 465 KEGAHDAAIWSLDLTSDGRKLVTGSADKTVRFWTFEVSEVPVSDESNKTMPMLQLFHDTT 524
            E AHDAAIWSLDLTSDG++L+TGSADK+V+FW F++ +  V   S+K +P L L HDTT
Sbjct: 506 IEEAHDAAIWSLDLTSDGKRLITGSADKSVKFWNFQLEQELVPGTSDKFVPKLGLHHDTT 565

Query: 525 LELDDDILSVVISPDDKFIAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSMDISYDSKL 584
           LEL DDILSV +SP+DKF+AVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLS+DIS+DSK+
Sbjct: 566 LELSDDILSVRVSPEDKFLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSIDISFDSKM 625

Query: 585 IVTCSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLPESYNFFSCSKDATVKYWDGQKF 644
           I+T SADKNIKIWGLDFGDCHKSLFAHQDSIMNVKF+PES+NFFSCSKD  +KYWDG KF
Sbjct: 626 IITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFVPESHNFFSCSKDGIIKYWDGDKF 685

Query: 645 ECIQKLAAHQSEVWSISVSNDGTFVISTGHDHSIRVWEETEDQVFLEEEREKEMDEQYED 704
           ECIQKLAAHQSEVW+++++ND +FV+S+ HDHSIR+WEETED+VFLEEER+KEM+EQYED
Sbjct: 686 ECIQKLAAHQSEVWALAIANDASFVVSSSHDHSIRIWEETEDEVFLEEERDKEMEEQYED 745

Query: 705 TLLTSLEGGAGDEML--SVKKGDNEESEEVEGVHKQTVESLKAGERLMEALEIGVNDIIA 762
           TLL SLE G GD+      K   N E +E   VHKQT+ESLKAGERLMEA ++G+ +I +
Sbjct: 746 TLLASLEEGNGDDAFKGDTKGATNVEFDEATDVHKQTMESLKAGERLMEAFDLGMAEIES 805

Query: 763 MEEFNEQLNAWKKSKKGIQPIRPQENTLLVALKKTPEEYIIETLVKIKPSQIEDALMVMP 822
            EE+++ L  W++ K G  PI+PQ N +L+A+KKTPEEYI++TL++IKPSQ+EDAL+V+P
Sbjct: 806 FEEYDKNLKLWQRKKTGEPPIKPQGNAILIAIKKTPEEYIMDTLIRIKPSQLEDALLVLP 865

Query: 823 FSYILKFLKFIDVVTTKAALLQKHISLVCKTLFFVIRFNYKELVAQKNANLKLQITRVKD 882
           FSY+LKFLKFI++V     +L  H++L+CK LFF+++ N+KELV+QKN  LKLQIT+VK+
Sbjct: 866 FSYVLKFLKFINIVIGNKKMLNNHLALICKNLFFIVKSNHKELVSQKNEVLKLQITKVKN 925

Query: 883 NLRKSLKSNVDELGFNIEGMKFIKQQWELNHHLEFNDEYEEKNFEEKHSKKRVFGTLA 940
            LR +LK+N D+LGFNI+GMKFIKQQW L H+LEF DEY++K+ E+K +KKR FGTL 
Sbjct: 926 ELRNALKANEDDLGFNIQGMKFIKQQWNLRHNLEFVDEYDQKSHEDKMAKKRTFGTLV 983

>Smik_12.192 Chr12 (380993..383824) [2832 bp, 943 aa] {ON} YLR129W
           (REAL)
          Length = 943

 Score = 1353 bits (3503), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 643/944 (68%), Positives = 798/944 (84%), Gaps = 5/944 (0%)

Query: 1   MVKSYQRFEQANVFGVISSNSNSVWIEPEASKRKTGN-LGQVIVGGLENILVWDIKTGEQ 59
           MVKSYQRFEQ+  FGVI+SN+N VW+ P +S+ K+G+  GQ+I   LEN+ VWDIKTG+ 
Sbjct: 1   MVKSYQRFEQSASFGVIASNANCVWL-PASSRTKSGSGPGQLITSALENVNVWDIKTGDL 59

Query: 60  IAQLTDGLPPGASDAKLSKPAETTFLKYHPETNLLAAGYADGVIKIWDLISKTVLISFNG 119
           ++ L+DGLPPGASDA+ +KPAE T+L+ H +T+LLA GYADGVIK+WDL+SKTVL++FNG
Sbjct: 60  MSTLSDGLPPGASDARGAKPAECTYLEVHQDTDLLAVGYADGVIKVWDLMSKTVLLNFNG 119

Query: 120 HKSAITVLAFDTTGTRLISASKDSDIIVWDLVGESGLYKLRSHKDAITGLWCEDENWLIS 179
           HK+AIT+L FD TGTRLIS SKDS+IIVWDLVGE GLYKLRSHKD+ITG WC+ E+WLIS
Sbjct: 120 HKAAITLLQFDGTGTRLISGSKDSNIIVWDLVGEVGLYKLRSHKDSITGFWCQGEDWLIS 179

Query: 180 TSKDGLVKIWDLKSQQCVETHLAHTGECWSLGIIEDMAVTCSADSQVKLWKLDLQAEN-G 238
           TSKDG++K+WDLK+QQC+ETH+AHTGECW L + +D+ +T   DSQVKLWKL+++ +  G
Sbjct: 180 TSKDGMIKLWDLKTQQCIETHIAHTGECWGLSVKDDLLITTGTDSQVKLWKLNIENDKLG 239

Query: 239 SKLTEKGIIEKQSKQRGVEIDFAV-APDGVKFFYIQNADKTIEIYRLRKEEEISRALKKR 297
            KLTE G  EKQSKQRG++I+F     DG  FFYIQNADKTIEI+R+RKEEEI+R LKKR
Sbjct: 240 GKLTEMGTFEKQSKQRGLKIEFITNTSDGNSFFYIQNADKTIEIFRIRKEEEIARGLKKR 299

Query: 298 EKRLQDKGMSEEEIKEAM-GSPVSLMYHLFQVVRSPYKIKSAQWTVCSNSKLELVVTTSN 356
           EKRL++KG+++EEI +++  S  SL+ H FQ VRS YKIKSA WT  ++SKLELV+TTSN
Sbjct: 300 EKRLREKGLTDEEITKSIKDSYSSLILHPFQTVRSLYKIKSASWTTITSSKLELVLTTSN 359

Query: 357 NSIEYYSIPYSKREPTQPAPLKLHTIDLHGQRTDIRSTSISDDNKLLATASNGSLKIWNI 416
           N+IEYYSIPY KREPT PAPLK HTI+L GQRTD+RS  ISDDN+LLATASNGSLKIWN+
Sbjct: 360 NTIEYYSIPYEKREPTSPAPLKTHTIELQGQRTDMRSIDISDDNRLLATASNGSLKIWNV 419

Query: 417 KTKRCIRSFECGYALTCKFLPGGALVVVGTRNGELQLFDIASSTMLDNKEGAHDAAIWSL 476
           KT +CIR+FECGYALTCKFLPGG LV++GTRNGELQLFD+ASS++LD  E AHDAAIWSL
Sbjct: 420 KTHKCIRTFECGYALTCKFLPGGLLVILGTRNGELQLFDLASSSLLDTIEDAHDAAIWSL 479

Query: 477 DLTSDGRKLVTGSADKTVRFWTFEVSEVPVSDESNKTMPMLQLFHDTTLELDDDILSVVI 536
           DLTSDG++LVTGSADKTV+FW F+V    V    +K +P+L+L HDTTLEL+DDILS+ I
Sbjct: 480 DLTSDGKRLVTGSADKTVKFWDFQVENTLVPGTKDKFLPILKLNHDTTLELNDDILSLRI 539

Query: 537 SPDDKFIAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSMDISYDSKLIVTCSADKNIKI 596
           SPDD+++A+SLLDNTVKVFFLDSMKF+LSLYGHKLPVLS+DIS+DSK+I+T SADKNIKI
Sbjct: 540 SPDDRYLAISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDSKMIITSSADKNIKI 599

Query: 597 WGLDFGDCHKSLFAHQDSIMNVKFLPESYNFFSCSKDATVKYWDGQKFECIQKLAAHQSE 656
           WGLDFGDCHKSLFAHQDSIM+VKFLPES+NFFSCSKDA VKYWDG+KFECIQKL AHQSE
Sbjct: 600 WGLDFGDCHKSLFAHQDSIMSVKFLPESHNFFSCSKDAVVKYWDGEKFECIQKLYAHQSE 659

Query: 657 VWSISVSNDGTFVISTGHDHSIRVWEETEDQVFLEEEREKEMDEQYEDTLLTSLEGGAGD 716
           VW++++S DG+FV+S+ HDHSIR+WEETEDQVFLEEE+EKE++EQYEDTLLTSLE G GD
Sbjct: 660 VWALAISTDGSFVVSSSHDHSIRIWEETEDQVFLEEEKEKELEEQYEDTLLTSLEEGNGD 719

Query: 717 EMLSVKKGDNEESEEVEGVHKQTVESLKAGERLMEALEIGVNDIIAMEEFNEQLNAWKKS 776
           +            +EV GVHKQT+ESLKAGERLMEAL++G+ +I  +E ++  +  W++ 
Sbjct: 720 DAFKGDATGESVDDEVSGVHKQTLESLKAGERLMEALDLGIAEIEGIEAYSRDMKLWQRK 779

Query: 777 KKGIQPIRPQENTLLVALKKTPEEYIIETLVKIKPSQIEDALMVMPFSYILKFLKFIDVV 836
           K G  PI+PQ N++L+A+ KTPE+YI++TL++I+ SQ+EDALMVMPFSY+LKFLKFID +
Sbjct: 780 KLGEAPIKPQGNSVLIAVNKTPEQYIMDTLLRIRSSQLEDALMVMPFSYVLKFLKFIDSI 839

Query: 837 TTKAALLQKHISLVCKTLFFVIRFNYKELVAQKNANLKLQITRVKDNLRKSLKSNVDELG 896
               +LL  H+ L+CK LFF+I+FN+KELV+QKN  LK Q++RVK  LR +LKS  D+LG
Sbjct: 840 MQNKSLLHSHLPLICKNLFFIIKFNHKELVSQKNEELKCQVSRVKTELRNALKSTEDDLG 899

Query: 897 FNIEGMKFIKQQWELNHHLEFNDEYEEKNFEEKHSKKRVFGTLA 940
           FN++G+KFIKQQW L H+ EF DEY+++  E   ++KR F T+ 
Sbjct: 900 FNVQGLKFIKQQWNLRHNYEFVDEYDQQEKESNGARKRFFETVV 943

>YLR129W Chr12 (399657..402488) [2832 bp, 943 aa] {ON}
           DIP2Nucleolar protein, specifically associated with the
           U3 snoRNA, part of the large ribonucleoprotein complex
           known as the small subunit (SSU) processome, required
           for 18S rRNA biogenesis, part of the active pre-rRNA
           processing complex
          Length = 943

 Score = 1335 bits (3455), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 641/942 (68%), Positives = 786/942 (83%), Gaps = 3/942 (0%)

Query: 1   MVKSYQRFEQANVFGVISSNSNSVWIEPEASKRKTGNLGQVIVGGLENILVWDIKTGEQI 60
           MVKSYQRFEQA  FGVI+SN+N VWI   +        GQ+I   LE++ +WDIKTG+ +
Sbjct: 1   MVKSYQRFEQAAAFGVIASNANCVWIPASSGNSNGSGPGQLITSALEDVNIWDIKTGDLV 60

Query: 61  AQLTDGLPPGASDAKLSKPAETTFLKYHPETNLLAAGYADGVIKIWDLISKTVLISFNGH 120
           ++L+DGLPPGASDA+ +KPAE T+L+ H +T+LLA GYADGVIK+WDL+SKTVL++FNGH
Sbjct: 61  SKLSDGLPPGASDARGAKPAECTYLEAHKDTDLLAVGYADGVIKVWDLMSKTVLLNFNGH 120

Query: 121 KSAITVLAFDTTGTRLISASKDSDIIVWDLVGESGLYKLRSHKDAITGLWCEDENWLIST 180
           K+AIT+L FD TGTRLIS SKDS+IIVWDLVGE GLYKLRSHKD+ITG WC+ E+WLIST
Sbjct: 121 KAAITLLQFDGTGTRLISGSKDSNIIVWDLVGEVGLYKLRSHKDSITGFWCQGEDWLIST 180

Query: 181 SKDGLVKIWDLKSQQCVETHLAHTGECWSLGIIEDMAVTCSADSQVKLWKLDLQAEN-GS 239
           SKDG++K+WDLK+ QC+ETH+AHTGECW L + +D+ +T   DSQVK+WKLD++ +  G 
Sbjct: 181 SKDGMIKLWDLKTHQCIETHIAHTGECWGLAVKDDLLITTGTDSQVKIWKLDIENDKMGG 240

Query: 240 KLTEKGIIEKQSKQRGVEIDFAV-APDGVKFFYIQNADKTIEIYRLRKEEEISRALKKRE 298
           KLTE GI EKQSKQRG++I+F   + D   FFYIQNADKTIE +R+RKEEEI+R LKKRE
Sbjct: 241 KLTEMGIFEKQSKQRGLKIEFITNSSDKTSFFYIQNADKTIETFRIRKEEEIARGLKKRE 300

Query: 299 KRLQDKGMSEEEIKEAMG-SPVSLMYHLFQVVRSPYKIKSAQWTVCSNSKLELVVTTSNN 357
           KRL++KG++EEEI +++  S  S + H FQ +RS YKIKSA WT  S+SKLELV+TTS+N
Sbjct: 301 KRLKEKGLTEEEIAKSIKESYSSFILHPFQTIRSLYKIKSASWTTVSSSKLELVLTTSSN 360

Query: 358 SIEYYSIPYSKREPTQPAPLKLHTIDLHGQRTDIRSTSISDDNKLLATASNGSLKIWNIK 417
           +IEYYSIPY KR+PT PAPLK HTI+L GQRTD+RS  ISDDNKLLATASNGSLKIWNIK
Sbjct: 361 TIEYYSIPYEKRDPTSPAPLKTHTIELQGQRTDVRSIDISDDNKLLATASNGSLKIWNIK 420

Query: 418 TKRCIRSFECGYALTCKFLPGGALVVVGTRNGELQLFDIASSTMLDNKEGAHDAAIWSLD 477
           T +CIR+FECGYALTCKFLPGG LV++GTRNGELQLFD+ASS++LD  E AHDAAIWSLD
Sbjct: 421 THKCIRTFECGYALTCKFLPGGLLVILGTRNGELQLFDLASSSLLDTIEDAHDAAIWSLD 480

Query: 478 LTSDGRKLVTGSADKTVRFWTFEVSEVPVSDESNKTMPMLQLFHDTTLELDDDILSVVIS 537
           LTSDG++LVTGSADKTV+FW F+V    V    NK +P+L+L HDTTLEL DDIL V +S
Sbjct: 481 LTSDGKRLVTGSADKTVKFWDFKVENSLVPGTKNKFLPVLKLHHDTTLELTDDILCVRVS 540

Query: 538 PDDKFIAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSMDISYDSKLIVTCSADKNIKIW 597
           PDD+++A+SLLDNTVKVFFLDSMKF+LSLYGHKLPVLS+DIS+DSK+I+T SADKNIKIW
Sbjct: 541 PDDRYLAISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDSKMIITSSADKNIKIW 600

Query: 598 GLDFGDCHKSLFAHQDSIMNVKFLPESYNFFSCSKDATVKYWDGQKFECIQKLAAHQSEV 657
           GLDFGDCHKSLFAHQDSIMNVKFLP+S+NFFSCSKDA VKYWDG+KFECIQKL AHQSEV
Sbjct: 601 GLDFGDCHKSLFAHQDSIMNVKFLPQSHNFFSCSKDAVVKYWDGEKFECIQKLYAHQSEV 660

Query: 658 WSISVSNDGTFVISTGHDHSIRVWEETEDQVFLEEEREKEMDEQYEDTLLTSLEGGAGDE 717
           W+++V+ DG FV+S+ HDHSIR+WEETEDQVFLEEE+EKE++EQYEDTLLTSLE G GD+
Sbjct: 661 WALAVATDGGFVVSSSHDHSIRIWEETEDQVFLEEEKEKELEEQYEDTLLTSLEEGNGDD 720

Query: 718 MLSVKKGDNEESEEVEGVHKQTVESLKAGERLMEALEIGVNDIIAMEEFNEQLNAWKKSK 777
                       +E  GVHKQT+ESLKAGERLMEAL++G+ +I  +E +N  +  W++ K
Sbjct: 721 AFKADASGEGVEDEASGVHKQTLESLKAGERLMEALDLGIAEIEGLEAYNRDMKLWQRKK 780

Query: 778 KGIQPIRPQENTLLVALKKTPEEYIIETLVKIKPSQIEDALMVMPFSYILKFLKFIDVVT 837
            G  PI+PQ N +L+A+ KTPE+YI++TL++I+ SQ+EDALMVMPFSY+LKFLKFID V 
Sbjct: 781 LGEAPIKPQGNAVLIAVNKTPEQYIMDTLLRIRMSQLEDALMVMPFSYVLKFLKFIDTVM 840

Query: 838 TKAALLQKHISLVCKTLFFVIRFNYKELVAQKNANLKLQITRVKDNLRKSLKSNVDELGF 897
               LL  H+ L+CK LFF+I+FN+KELV+QKN  LKLQI RVK  LR +LKS  D+LGF
Sbjct: 841 QNKTLLHSHLPLICKNLFFIIKFNHKELVSQKNEELKLQINRVKTELRSALKSTEDDLGF 900

Query: 898 NIEGMKFIKQQWELNHHLEFNDEYEEKNFEEKHSKKRVFGTL 939
           N++G+KF+KQQW L H+ EF DEY+++  E   ++KRVFGT+
Sbjct: 901 NVQGLKFVKQQWNLRHNYEFVDEYDQQEKESNSARKRVFGTV 942

>Kpol_1036.69 s1036 (189457..192267) [2811 bp, 936 aa] {ON}
           (189457..192267) [2811 nt, 937 aa]
          Length = 936

 Score = 1323 bits (3423), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 644/943 (68%), Positives = 796/943 (84%), Gaps = 10/943 (1%)

Query: 1   MVKSYQRFEQANVFGVISSNSNSVWIEPEASKRKTGNLGQVIVGGLENILVWDIKTGEQI 60
           MVKSYQRFEQA+VFGVIS+N+N VW+ PE+  +K+ + G VI   LENI +WDIKTGE I
Sbjct: 1   MVKSYQRFEQASVFGVISTNANCVWMSPES--KKSNSPGSVITSALENINIWDIKTGELI 58

Query: 61  AQLTDGLPPGASDAKLSKPAETTFLKYHPETNLLAAGYADGVIKIWDLISKTVLISFNGH 120
           + L+DGLP G+ D K SKPAE ++L YH ETNLLAAGY DG IK+WDL+SK+VL++FNGH
Sbjct: 59  SVLSDGLPAGSIDVKSSKPAEVSYLHYHDETNLLAAGYMDGTIKVWDLLSKSVLLTFNGH 118

Query: 121 KSAITVLAFDTTGTRLISASKDSDIIVWDLVGESGLYKLRSHKDAITGLWCEDENWLIST 180
           KSAITV+ FD TGTRLIS S+DS+IIVWDLV E GLYKLRSHKDAI+G+WCE E+WL+ST
Sbjct: 119 KSAITVMKFDVTGTRLISGSRDSNIIVWDLVSEVGLYKLRSHKDAISGIWCEGEDWLVST 178

Query: 181 SKDGLVKIWDLKSQQCVETHLAHTGECWSLGIIEDMAVTCSADSQVKLWKLDLQAENGSK 240
           SKDGL+KIWDLK QQC+ETH+AHTGECW++G+ ED+ +T  AD+Q+KLW LD   E GSK
Sbjct: 179 SKDGLIKIWDLKVQQCIETHIAHTGECWAMGVHEDLLITSGADTQLKLWNLDFSKEAGSK 238

Query: 241 LTEKGIIEKQSKQRGVEIDFAVAPDGVKFFYIQNADKTIEIYRLRKEEEISRALKKREKR 300
           L EKG+ +KQSKQRG++I F+VAP+G  FFYIQNADKT E++R+R+EEEIS+ALKKREKR
Sbjct: 239 LIEKGVYDKQSKQRGLDIKFSVAPNGTAFFYIQNADKTTEVFRIRREEEISKALKKREKR 298

Query: 301 LQDKGMSEEEIKEAMG-SPVSLMYHLFQVVRSPYKIKSAQWTVCSNSKLELVVTTSNNSI 359
           L++KGM++EEI++ +  S  S++ H FQV++S YKIKS  +T  SN+KLE VVTTS+NSI
Sbjct: 299 LKEKGMTDEEIQQNIKESYSSIIMHPFQVIKSQYKIKSVSFTTVSNTKLEFVVTTSSNSI 358

Query: 360 EYYSIPYSKREPTQPAPLKLHTIDLHGQRTDIRSTSISDDNKLLATASNGSLKIWNIKTK 419
           EYYSIPY KR+PT PAP +L+TI+L G RTDIRS  ISDD+KLLATASNG LK+WN+KTK
Sbjct: 359 EYYSIPYEKRDPTSPAPTRLYTIELPGHRTDIRSVDISDDDKLLATASNGLLKVWNLKTK 418

Query: 420 RCIRSFECGYALTCKFLPGGALVVVGTRNGELQLFDIASSTMLDNKEGAHDAAIWSLDLT 479
            CIR F+CGYALTCKFLPGG LV+VGTR G LQLFD+ASST+L+NKE AH+ AIWSLD+T
Sbjct: 419 ACIRVFDCGYALTCKFLPGGTLVIVGTREGSLQLFDLASSTLLENKEDAHETAIWSLDIT 478

Query: 480 SDGRKLVTGSADKTVRFWTFEVSEVPVSDESNKTMPMLQLFHDTTLELDDDILSVVISPD 539
           SDGR+LVTGSADKT++FW F+V E  V   ++K +P+++L HDTT+E+++D+LSV ISP+
Sbjct: 479 SDGRRLVTGSADKTIKFWNFQVEEDLVPGTADKYLPVMKLIHDTTMEVNEDVLSVRISPE 538

Query: 540 DKFIAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSMDISYDSKLIVTCSADKNIKIWGL 599
           DKF+A+SLLDNTVKVF+LDSMKFFLSLYGHKLPVLS+DIS+DSKLI+T SADKNIKIWGL
Sbjct: 539 DKFLAISLLDNTVKVFYLDSMKFFLSLYGHKLPVLSIDISFDSKLIITSSADKNIKIWGL 598

Query: 600 DFGDCHKSLFAHQDSIMNVKFLPESYNFFSCSKDATVKYWDGQKFECIQKLAAHQSEVWS 659
           DFGDCHKSLFAHQDSIMNVKFLPES+NFFS SKD  VKYWDG KFECIQKLAAHQSEVWS
Sbjct: 599 DFGDCHKSLFAHQDSIMNVKFLPESHNFFSSSKDGLVKYWDGDKFECIQKLAAHQSEVWS 658

Query: 660 ISVSNDGTFVISTGHDHSIRVWEETEDQVFLEEEREKEMDEQYEDTLLTSLEGGAGDEML 719
           I++++DGT VIS  HDHS+RVWEET+DQVFLEEEREKE++EQYEDTLL SLE G+GD+  
Sbjct: 659 IAITSDGTSVISASHDHSLRVWEETDDQVFLEEEREKELEEQYEDTLLASLEEGSGDDAF 718

Query: 720 SVKKGDNEESE-EVEGVHKQTVESLKAGERLMEALEIGVNDIIAMEEFNEQLNAWKKSK- 777
              KGD E+ E E   V  QT+ESLKAGERLMEAL++G+++I A E++   + AW+K K 
Sbjct: 719 ---KGDAEKVEDESTSVRNQTMESLKAGERLMEALDLGMSEIEANEKYQIDMKAWEKKKS 775

Query: 778 KGIQPIRPQENTLLVALKKTPEEYIIETLVKIKPSQIEDALMVMPFSYILKFLKFIDVVT 837
            G  PI+PQ N +L+A+KK P EYI+ETLVKIKPSQ+EDAL+V+PFSY+LK LKFID+V 
Sbjct: 776 SGEPPIKPQGNAILIAMKKQPHEYIMETLVKIKPSQLEDALLVLPFSYVLKLLKFIDIVM 835

Query: 838 TKAALLQKHISLVCKTLFFVIRFNYKELVAQKNANLKLQITRVKDNLRKSLKSNVDELGF 897
               + + ++ L+CK LFFVIR N+KEL++Q+N  LK QI  VK++LR SL+ NVD+LGF
Sbjct: 836 KDKKMTKNYLMLICKNLFFVIRSNHKELISQRNEALKNQILNVKNSLRDSLQENVDDLGF 895

Query: 898 NIEGMKFIKQQWELNHHLEFNDEYEEKNFEEKHSKKRVFGTLA 940
           NI+G+KFIKQQW L H+ +F D++++K  EE   KKR+FGTL+
Sbjct: 896 NIQGLKFIKQQWNLKHNFDFTDDFDKK--EESSGKKRIFGTLS 936

>NDAI0G02580 Chr7 complement(590030..592906) [2877 bp, 958 aa] {ON}
           Anc_8.324 YLR129W
          Length = 958

 Score = 1311 bits (3393), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 645/961 (67%), Positives = 790/961 (82%), Gaps = 26/961 (2%)

Query: 1   MVKSYQRFEQANVFGVISSNSNSVWIEPEASKRKTGNLGQVIVGGLENILVWDIKTGEQI 60
           MVKSYQRFEQ +VFGVI+SNSN +W+ P  S   T   GQ+I   LENI +WDIKTGE  
Sbjct: 1   MVKSYQRFEQESVFGVINSNSNCIWL-PSDSNPSTSP-GQIITSALENINIWDIKTGELS 58

Query: 61  AQLTDGL--PPGASDAKLSKPAETTFLKYHPETNLLAAGYADGVIKIWDLISKTVLISFN 118
           + L D L  PPG+ DAK +KPAETT+L++H +TNLLA GY DGVIK+WDL SKTVL + N
Sbjct: 59  SHLIDSLIPPPGSIDAKSTKPAETTYLQHHKDTNLLAVGYNDGVIKVWDLYSKTVLCNLN 118

Query: 119 GHKSAITVLAFDTTGTRLISASKDSDIIVWDLVGESGLYKLRSHKDAITGLWC------- 171
           GH SAITVL FD+TGTRLIS S+DS+IIVWDLV E GLYKLRSHKDAITG+WC       
Sbjct: 119 GHSSAITVLKFDSTGTRLISGSRDSNIIVWDLVSEVGLYKLRSHKDAITGIWCNEMQNNG 178

Query: 172 -EDEN---WLISTSKDGLVKIWDLKSQQCVETHLAHTGECWSLGIIEDMAVTCSADSQVK 227
            +DEN   WLISTSKDGL+KIWDLK QQC+ETH+AHTGECWS+ +  D+ +T S+DSQ+K
Sbjct: 179 EDDENELDWLISTSKDGLIKIWDLKIQQCIETHIAHTGECWSVAVRNDLLITTSSDSQIK 238

Query: 228 LWKLDLQAEN---GSKLTEKGIIEKQSKQRGVEIDFAVAPDGVKFFYIQNADKTIEIYRL 284
           +W+L+L  ++     KL EKGI EKQSKQRG+ I+F    D   FFYIQNADKT+EI+RL
Sbjct: 239 IWELNLDNDDDGKNKKLIEKGIYEKQSKQRGLSIEFIDTADETGFFYIQNADKTVEIFRL 298

Query: 285 RKEEEISRALKKREKRLQDKGMSEEEIKEAM-GSPVSLMYHLFQVVRSPYKIKSAQWTVC 343
           RK++EI++A+KKR KRL +KGM+ E+I++ +  S +SL+ H FQ+VRS YKIK+  WT+ 
Sbjct: 299 RKQDEINKAIKKRTKRLTEKGMTPEDIEQNIKDSYISLIMHPFQIVRSIYKIKAVTWTIA 358

Query: 344 SNSKLELVVTTSNNSIEYYSIPYSKREPTQPAPLKLHTIDLHGQRTDIRSTSISDDNKLL 403
           + SKLEL +TTSNN+IEYYS PY KREPTQP P KLHTI+L GQRTDIRS  ISDDNKLL
Sbjct: 359 TPSKLELCLTTSNNTIEYYSTPYEKREPTQPTPNKLHTIELQGQRTDIRSIDISDDNKLL 418

Query: 404 ATASNGSLKIWNIKTKRCIRSFECGYALTCKFLPGGALVVVGTRNGELQLFDIASSTMLD 463
           ATASNG LKIWNIKTK CIR+FECGY+LTCKFLPGG LV+VGTR GELQLFD+ASST+L+
Sbjct: 419 ATASNGLLKIWNIKTKSCIRTFECGYSLTCKFLPGGTLVIVGTRGGELQLFDLASSTLLE 478

Query: 464 NKEGAHDAAIWSLDLTSDGRKLVTGSADKTVRFWTFEVSEVPVSDESNKTMPMLQLFHDT 523
             E AHDAAIWSLDLTSDG++LVTGSADK+V+FW F++ +  V+   +K +P L+LFHDT
Sbjct: 479 TIEDAHDAAIWSLDLTSDGKRLVTGSADKSVKFWDFQLEQELVAGTVDKYLPKLKLFHDT 538

Query: 524 TLELDDDILSVVISPDDKFIAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSMDISYDSK 583
           TLEL+DDILSV ISP+DKF+AVSLLDNTVKVFF+D+MKFFLSLYGHKLPVLS+DIS+DSK
Sbjct: 539 TLELNDDILSVKISPEDKFLAVSLLDNTVKVFFMDTMKFFLSLYGHKLPVLSIDISFDSK 598

Query: 584 LIVTCSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLPESYNFFSCSKDATVKYWDGQK 643
           LI+T SADKNIKIWGLDFGDCHKSLFAHQDSIMNVKF+PES+NFFSCSKD  +KYWDG K
Sbjct: 599 LIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFVPESHNFFSCSKDGLIKYWDGDK 658

Query: 644 FECIQKLAAHQSEVWSISVSNDGTFVISTGHDHSIRVWEETEDQVFLEEEREKEMDEQYE 703
           FECIQKLA HQSEVWSI+++ND +F++S+ HDHSIR+WEETED+VFLEEEREKE++E YE
Sbjct: 659 FECIQKLAGHQSEVWSIAIANDASFIVSSSHDHSIRIWEETEDEVFLEEEREKELEELYE 718

Query: 704 DTLLTSLEGGAGDEMLSVKKGDNEESEEVEGVHKQTVESLKAGERLMEALEIGVNDIIAM 763
           DTLLTSLE   GD+  + KK   E+ +E   VHKQT+ESLKA ERLMEA ++G+ +I AM
Sbjct: 719 DTLLTSLEEDNGDD--AFKKDGGEDKDEATDVHKQTMESLKASERLMEAFDLGMKEIEAM 776

Query: 764 EEFNEQLNAWKK---SKKGIQ--PIRPQENTLLVALKKTPEEYIIETLVKIKPSQIEDAL 818
           EE+  +L  W++   + K  Q  PI+PQ N +L+A+KKTPEEYI++TLV+IKPSQ+EDAL
Sbjct: 777 EEYERELKNWQRKDSNNKATQTVPIKPQGNAILLAIKKTPEEYIMDTLVRIKPSQLEDAL 836

Query: 819 MVMPFSYILKFLKFIDVVTTKAALLQKHISLVCKTLFFVIRFNYKELVAQKNANLKLQIT 878
           +V+PFSYI+KFLKFID+V     +L  H+ L+C+ LFF+++ N+KELV+QKN  LK QIT
Sbjct: 837 LVLPFSYIIKFLKFIDIVINSKKILNNHLPLICRILFFIVKSNHKELVSQKNEELKSQIT 896

Query: 879 RVKDNLRKSLKSNVDELGFNIEGMKFIKQQWELNHHLEFNDEYEEKNFEEKHSKKRVFGT 938
           RVKDNLR +LK+N D+LGFNI+G+KFIKQQW+L H+ E+ D+ ++K  E K +KKR FGT
Sbjct: 897 RVKDNLRNALKNNEDDLGFNIQGLKFIKQQWKLKHNYEYVDDQDQKAQEAKFAKKRTFGT 956

Query: 939 L 939
           +
Sbjct: 957 I 957

>TDEL0F04500 Chr6 (843307..846123) [2817 bp, 938 aa] {ON} Anc_8.324
           YLR129W
          Length = 938

 Score = 1310 bits (3390), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 616/941 (65%), Positives = 783/941 (83%), Gaps = 6/941 (0%)

Query: 1   MVKSYQRFEQANVFGVISSNSNSVWIEPEASKRKTGNLGQVIVGGLENILVWDIKTGEQI 60
           MVKSYQRFEQ+  FGVISSNSN V+I P   K     LGQV+ GGLE + +WD+KTG+ +
Sbjct: 1   MVKSYQRFEQSASFGVISSNSNCVYIPPANRK----GLGQVLTGGLEKVNLWDLKTGDLV 56

Query: 61  AQLTDGLPPGASDAKLSKPAETTFLKYHPETNLLAAGYADGVIKIWDLISKTVLISFNGH 120
           + L+DGLPPG+ DAK +KPAETT+L+YH ETNLLA GYA+GVIK+WDL+SKTVL++ NGH
Sbjct: 57  SCLSDGLPPGSIDAKSTKPAETTYLEYHAETNLLAVGYAEGVIKVWDLMSKTVLLTLNGH 116

Query: 121 KSAITVLAFDTTGTRLISASKDSDIIVWDLVGESGLYKLRSHKDAITGLWCEDENWLIST 180
           KSA+T+L FD TGTRLIS S+DS+II+WDL+GE GLYKLRSHK AI+GLW E + WLIST
Sbjct: 117 KSAVTILKFDITGTRLISGSQDSNIIMWDLIGEVGLYKLRSHKGAISGLWLEKDEWLIST 176

Query: 181 SKDGLVKIWDLKSQQCVETHLAHTGECWSLGIIEDMAVTCSADSQVKLWKLDLQAENGSK 240
           S+DGL+K+WDLK+QQCVETH+AHTGECWSLG+ ED+A+T SADSQVK+W L+ ++E GSK
Sbjct: 177 SRDGLIKVWDLKTQQCVETHIAHTGECWSLGVHEDLAITASADSQVKIWHLNFESEAGSK 236

Query: 241 LTEKGIIEKQSKQRGVEIDFAVAPDGVKFFYIQNADKTIEIYRLRKEEEISRALKKREKR 300
           L EKGI EKQS QRG  I+F    D   FFYIQNADK+IEI+R+RKEEEI +A +KREKR
Sbjct: 237 LIEKGIYEKQSNQRGSSIEFVTTTDETTFFYIQNADKSIEIFRIRKEEEILKATRKREKR 296

Query: 301 LQDKGMSEEEIKEAM-GSPVSLMYHLFQVVRSPYKIKSAQWTVCSNSKLELVVTTSNNSI 359
           L++KG+S+EEIK+ +    +S++ H FQ++RS +K+K+A W   + SKL+LVVTT++N++
Sbjct: 297 LKEKGLSDEEIKQNIQDGYISMIMHPFQILRSNFKVKAAAWGQATASKLDLVVTTASNTV 356

Query: 360 EYYSIPYSKREPTQPAPLKLHTIDLHGQRTDIRSTSISDDNKLLATASNGSLKIWNIKTK 419
           EYY+IPY KREP  PAP +LH+++L G RTD+R+  IS+D+ LLATASNG+LK+WN+KT+
Sbjct: 357 EYYTIPYEKREPKLPAPNRLHSVELQGHRTDVRAMDISNDSSLLATASNGTLKVWNLKTR 416

Query: 420 RCIRSFECGYALTCKFLPGGALVVVGTRNGELQLFDIASSTMLDNKEGAHDAAIWSLDLT 479
            C+R+F+CGYAL C+FLPGG L+VVGTRNG+LQLFD+ASSTMLDNKEGAHDAAIWSLD+T
Sbjct: 417 MCLRTFDCGYALCCRFLPGGFLIVVGTRNGDLQLFDLASSTMLDNKEGAHDAAIWSLDIT 476

Query: 480 SDGRKLVTGSADKTVRFWTFEVSEVPVSDESNKTMPMLQLFHDTTLELDDDILSVVISPD 539
           SDG+KLVTGSADK+V+FW F+V +  ++   +K  P+++L HDTTLEL+DD+LSV ISP+
Sbjct: 477 SDGKKLVTGSADKSVKFWKFQVEKDLIAGTVDKFAPVMKLSHDTTLELNDDVLSVRISPE 536

Query: 540 DKFIAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSMDISYDSKLIVTCSADKNIKIWGL 599
           DK+ A+SLLDNTVKVFFLDSMKF+LSLYGHKLPVLS+DIS+DSK+I+T SADKNIKIWGL
Sbjct: 537 DKYFAISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDSKVIITSSADKNIKIWGL 596

Query: 600 DFGDCHKSLFAHQDSIMNVKFLPESYNFFSCSKDATVKYWDGQKFECIQKLAAHQSEVWS 659
           DFGDCHKSLFAHQDSIM+VKFLPES+NFFSCSKD  VKYWDG KFECIQKLA HQSEVW+
Sbjct: 597 DFGDCHKSLFAHQDSIMSVKFLPESHNFFSCSKDGLVKYWDGDKFECIQKLAGHQSEVWA 656

Query: 660 ISVSNDGTFVISTGHDHSIRVWEETEDQVFLEEEREKEMDEQYEDTLLTSLEGGAGDEML 719
           +++SN+G +V+S  HD SIR+WEETEDQVFLEEEREKE++EQ E  LL+SLE G+GD   
Sbjct: 657 LAISNNGKYVVSASHDRSIRIWEETEDQVFLEEEREKELEEQNETALLSSLEEGSGDAAF 716

Query: 720 SVK-KGDNEESEEVEGVHKQTVESLKAGERLMEALEIGVNDIIAMEEFNEQLNAWKKSKK 778
                GD  + +E   V KQT+ESLKAGERLMEAL++G+ +I   E + ++L AW K K 
Sbjct: 717 RKDVGGDEADQDEAADVRKQTIESLKAGERLMEALDLGIPEIENREHYEKELKAWNKHKG 776

Query: 779 GIQPIRPQENTLLVALKKTPEEYIIETLVKIKPSQIEDALMVMPFSYILKFLKFIDVVTT 838
             +P++P  N +L A+ KTPEEYI+ETL +IKPSQ+EDAL+V+PFSY+LKF +FID    
Sbjct: 777 DAKPVKPPGNAILTAISKTPEEYILETLARIKPSQLEDALLVLPFSYVLKFFRFIDAALL 836

Query: 839 KAALLQKHISLVCKTLFFVIRFNYKELVAQKNANLKLQITRVKDNLRKSLKSNVDELGFN 898
              +LQ ++ L+CK LFF+++ N++ELV+QKN  LKL+I +VKD LR +LKSN D+LGFN
Sbjct: 837 DNRILQHNLPLICKNLFFIVKSNHRELVSQKNEELKLRIAKVKDLLRGALKSNEDDLGFN 896

Query: 899 IEGMKFIKQQWELNHHLEFNDEYEEKNFEEKHSKKRVFGTL 939
           IEG+KFI++QW+L H LEF D+Y ++  E+K +KKRVF T+
Sbjct: 897 IEGLKFIRRQWDLRHKLEFVDDYSQREQEDKTAKKRVFETI 937

>KLTH0G12276g Chr7 complement(1042617..1045430) [2814 bp, 937 aa]
           {ON} highly similar to uniprot|Q12220 Saccharomyces
           cerevisiae YLR129W DIP2 Nucleolar protein specifically
           associated with the U3 snoRNA part of the large
           ribonucleoprotein complex known as the small subunit
           (SSU) processome required for 18S rRNA biogenesis part
           of the active pre-rRNA processing complex
          Length = 937

 Score = 1308 bits (3384), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 623/941 (66%), Positives = 770/941 (81%), Gaps = 7/941 (0%)

Query: 1   MVKSYQRFEQANVFGVISSNSNSVWIEPEASKRKTGNLGQVIVGGLENILVWDIKTGEQI 60
           MVKSYQRFEQA+V GVISSNSN +WI  E         GQV+ G LEN+  W +K+G+ +
Sbjct: 1   MVKSYQRFEQASVLGVISSNSNCIWIPAETRNAS----GQVLTGALENVNCWSMKSGDLL 56

Query: 61  AQLTDGLPPGASDAKLSKPAETTFLKYHPETNLLAAGYADGVIKIWDLISKTVLISFNGH 120
           + L+DGLPPGA DAK SKPAETTFL+YHPET LLAAGY DGV+KIWDL+SK+VLI+FNGH
Sbjct: 57  STLSDGLPPGAVDAKSSKPAETTFLQYHPETKLLAAGYNDGVVKIWDLLSKSVLINFNGH 116

Query: 121 KSAITVLAFDTTGTRLISASKDSDIIVWDLVGESGLYKLRSHKDAITGLWCEDENWLIST 180
           KSAITVL FD+TGTRLIS SKDSDIIVWDLVGE GL+KLRSHKD+ITGLWCE E+WL+ST
Sbjct: 117 KSAITVLKFDSTGTRLISGSKDSDIIVWDLVGEVGLFKLRSHKDSITGLWCEGEDWLVST 176

Query: 181 SKDGLVKIWDLKSQQCVETHLAHTGECWSLGIIEDMAVTCSADSQVKLWKLDLQAENGSK 240
           SKDGL+K+WDLK+QQCVETH+AH GECWS+G+ ED+ VTC  D+Q+KLW +D +   GS 
Sbjct: 177 SKDGLIKVWDLKTQQCVETHVAHVGECWSMGVHEDLVVTCGGDNQIKLWSVDYEKPVGSM 236

Query: 241 LTEKGIIEKQSKQRGVEIDFAVAPDGVKFFYIQNADKTIEIYRLRKEEEISRALKKREKR 300
           LTE+G  EKQSKQRGV ++F    DGV FF++QNAD+T+E +RLR E+EIS+ALKKREKR
Sbjct: 237 LTERGTHEKQSKQRGVSVEFTTISDGVTFFFVQNADRTVETFRLRTEDEISKALKKREKR 296

Query: 301 LQDKGMSEEEIKEAMG-SPVSLMYHLFQVVRSPYKIKSAQWTVCSNSKLELVVTTSNNSI 359
           L DKG++ EEI+  +  S  S + H FQ++RSPYKIKSA W V + SKLE+VV+TSNN++
Sbjct: 297 LSDKGLTGEEIQANLKESYTSFIMHPFQILRSPYKIKSACWAVTTTSKLEIVVSTSNNTV 356

Query: 360 EYYSIPYSKREPTQPAPLKLHTIDLHGQRTDIRSTSISDDNKLLATASNGSLKIWNIKTK 419
           +YYSIPY+K+EP  P+P K+++ID+ G RTD+R+  ISDDNKLLATASNGSLKIWNIKTK
Sbjct: 357 DYYSIPYNKKEPKLPSPPKIYSIDIKGHRTDVRAIDISDDNKLLATASNGSLKIWNIKTK 416

Query: 420 RCIRSFECGYALTCKFLPGGALVVVGTRNGELQLFDIASSTMLDNKEGAHDAAIWSLDLT 479
            CIR+FECGYAL CKFLPGGALVV+GT+ G+L LFD+ASST+L + E AH  AIWSLDLT
Sbjct: 417 SCIRTFECGYALACKFLPGGALVVIGTKTGDLNLFDLASSTLLSSIEAAHSGAIWSLDLT 476

Query: 480 SDGRKLVTGSADKTVRFWTFEVSEVPVSDESNKTMPMLQLFHDTTLELDDDILSVVISPD 539
           +DG++LVTGSADK+VRFW F+V +  V   ++K +P L++FHDTTLEL+DD+L+V ISPD
Sbjct: 477 ADGKRLVTGSADKSVRFWDFQVEQELVPGTTDKFVPKLKMFHDTTLELNDDVLAVKISPD 536

Query: 540 DKFIAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSMDISYDSKLIVTCSADKNIKIWGL 599
           ++ +A+SLLDNTVKVFFLDSMKFFLSLYGHKLPVLS+DIS+DSKL++T SADKNIK+WGL
Sbjct: 537 NRLLAISLLDNTVKVFFLDSMKFFLSLYGHKLPVLSIDISFDSKLLITSSADKNIKVWGL 596

Query: 600 DFGDCHKSLFAHQDSIMNVKFLPESYNFFSCSKDATVKYWDGQKFECIQKLAAHQSEVWS 659
           DFGDCHKSLFAH DSIM V FLPES+NFFSC KD  VKYWDG KFECIQKLAAHQ EVW+
Sbjct: 597 DFGDCHKSLFAHSDSIMKVAFLPESHNFFSCGKDGLVKYWDGDKFECIQKLAAHQKEVWT 656

Query: 660 ISVSNDGTFVISTGHDHSIRVWEETEDQVFLEEEREKEMDEQYEDTLLTSLEGGAGDEML 719
           I++S+DGTFV+S  HD SIRVW ET+DQVFLEEEREKEMDEQYE TLL SLE GAGD M 
Sbjct: 657 IAISHDGTFVVSASHDQSIRVWVETDDQVFLEEEREKEMDEQYEKTLLNSLEDGAGDAMF 716

Query: 720 SVK-KGDNEESEEVEGVHKQTVESLKAGERLMEALEIGVNDIIAMEEFNEQLNAWKKSKK 778
                G  E  +E   VHKQT ESLKA ERLMEA+++G+ +I    E+ + L  W+K K 
Sbjct: 717 HGDGNGGAEIGDEATDVHKQTTESLKASERLMEAMDMGMAEISNHLEYEQALKEWQKKKS 776

Query: 779 GIQPIRPQENTLLVALKKTPEEYIIETLVKIKPSQIEDALMVMPFSYILKFLKFIDVVTT 838
           G  P RPQ N++L+A+ KTP EYI++ L +IKPSQ+EDAL+V+PFSY+L+FL FI++V  
Sbjct: 777 GPHPGRPQPNSILIAINKTPLEYIMDVLARIKPSQLEDALLVLPFSYVLEFLHFIELVIE 836

Query: 839 KAALLQKHISLVCKTLFFVIRFNYKELVAQKNANLKLQITRVKDNLRKSLKSNVDELGFN 898
             +L+++H+ L+CK LFF+I+ N++EL +QKN  LK+QI R+K  LR S+K+  D+LGFN
Sbjct: 837 DKSLVRRHLPLLCKNLFFIIKANHRELFSQKNEKLKIQIDRIKYGLRNSIKAKADDLGFN 896

Query: 899 IEGMKFIKQQWELNHHLEFNDEYEEKNFEEKHSKKRVFGTL 939
           I+G+KFIKQQW L H+ EF+D+      ++K  KKRVF T+
Sbjct: 897 IQGLKFIKQQWNLKHNFEFSDDVIISK-QDKKVKKRVFETV 936

>ZYRO0F10406g Chr6 (843429..846245) [2817 bp, 938 aa] {ON} similar
           to uniprot|Q12220 Saccharomyces cerevisiae YLR129W DIP2
           Nucleolar protein specifically associated with the U3
           snoRNA part of the large ribonucleoprotein complex known
           as the small subunit (SSU) processome required for 18S
           rRNA biogenesis part of the active pre- rRNA processing
           complex
          Length = 938

 Score = 1302 bits (3369), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 636/941 (67%), Positives = 789/941 (83%), Gaps = 4/941 (0%)

Query: 1   MVKSYQRFEQANVFGVISSNSNSVWIEPEASKRKTGNLGQVIVGGLENILVWDIKTGEQI 60
           MVKSYQRFEQ++VFGV+SS  NS+WI P  +KR  G  GQ+I G LEN+ +WDIKTGE +
Sbjct: 1   MVKSYQRFEQSSVFGVVSSGDNSIWI-PAENKRTNGP-GQIITGALENVNIWDIKTGELV 58

Query: 61  AQLTDGLPPGASDAKLSKPAETTFLKYHPETNLLAAGYADGVIKIWDLISKTVLISFNGH 120
           + L+DGLPPGA DA+ +KPAE T+++Y+ +T+LLA GYADGVIKIWD+ SKTVL+SFNGH
Sbjct: 59  SHLSDGLPPGAIDARTTKPAEVTYMQYYSDTSLLAVGYADGVIKIWDMFSKTVLLSFNGH 118

Query: 121 KSAITVLAFDTTGTRLISASKDSDIIVWDLVGESGLYKLRSHKDAITGLWCEDENWLIST 180
           +SA+T L FD+TGTRLIS S+DS+IIVWDLV E GLYKLRSHKD+ITGL   DENWL+S 
Sbjct: 119 RSAVTQLLFDSTGTRLISGSRDSNIIVWDLVSEVGLYKLRSHKDSITGLSLPDENWLMSV 178

Query: 181 SKDGLVKIWDLKSQQCVETHLAHTGECWSLGIIEDMAVTCSADSQVKLWKLDLQAENGSK 240
           SKDGL+K+WDLK QQCVETH+AH GECW+LG+ ED+ VT S+DSQ+K+W LDL A+ G K
Sbjct: 179 SKDGLIKLWDLKIQQCVETHIAHPGECWALGVDEDVVVTTSSDSQIKIWHLDLDADAGVK 238

Query: 241 LTEKGIIEKQSKQRGVEIDFAVAPDGVKFFYIQNADKTIEIYRLRKEEEISRALKKREKR 300
           +TEKGI EKQSKQRGV + F    DG KFFY+QNADKT+EI RLRKEEEISRALKKREKR
Sbjct: 239 VTEKGIFEKQSKQRGVAVSFITVSDGTKFFYVQNADKTLEIIRLRKEEEISRALKKREKR 298

Query: 301 LQDKGMSEEEIKEAMG-SPVSLMYHLFQVVRSPYKIKSAQWTVCSNSKLELVVTTSNNSI 359
            ++KGM++EEI++    S +S++ H FQV+RS +KI++A W V ++SKLEL VTTS N+I
Sbjct: 299 FKEKGMTDEEIQQNFKESYISIIMHSFQVLRSAFKIRAASWAVTTSSKLELTVTTSGNTI 358

Query: 360 EYYSIPYSKREPTQPAPLKLHTIDLHGQRTDIRSTSISDDNKLLATASNGSLKIWNIKTK 419
           EYYSIPY KREP  P P+++H+I+L G RTD+R+  ISDD KLLATASNG LKIWNI+TK
Sbjct: 359 EYYSIPYEKREPKHPTPIRVHSIELQGHRTDVRAIDISDDGKLLATASNGLLKIWNIRTK 418

Query: 420 RCIRSFECGYALTCKFLPGGALVVVGTRNGELQLFDIASSTMLDNKEGAHDAAIWSLDLT 479
            C+R+FECGYALTCKFLPGG LV+VGTR+G+LQLFD+ASST+L+N E AHDAAIWSLD+T
Sbjct: 419 TCLRTFECGYALTCKFLPGGVLVIVGTRSGQLQLFDLASSTILENNEEAHDAAIWSLDIT 478

Query: 480 SDGRKLVTGSADKTVRFWTFEVSEVPVSDESNKTMPMLQLFHDTTLELDDDILSVVISPD 539
           SDGR+LVTGSADKTV+FW F V E  V   ++K +P + L HDTTLE+ DDILSV ISP+
Sbjct: 479 SDGRRLVTGSADKTVKFWNFIVEEKKVPGTTDKLIPTMSLHHDTTLEMSDDILSVKISPE 538

Query: 540 DKFIAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSMDISYDSKLIVTCSADKNIKIWGL 599
           +K +AVSLLDNTVKVF+L++MKFFLSLYGHKLPVLS+DIS+DSKLI+T SADKNIKIWGL
Sbjct: 539 NKLLAVSLLDNTVKVFYLETMKFFLSLYGHKLPVLSIDISFDSKLIITSSADKNIKIWGL 598

Query: 600 DFGDCHKSLFAHQDSIMNVKFLPESYNFFSCSKDATVKYWDGQKFECIQKLAAHQSEVWS 659
           DFGDCHKSLFAHQDSIMNVKFLPES+NFFSCSKDATVKYWDG KFE IQKLA HQSEVW+
Sbjct: 599 DFGDCHKSLFAHQDSIMNVKFLPESHNFFSCSKDATVKYWDGDKFETIQKLAGHQSEVWA 658

Query: 660 ISVSNDGTFVISTGHDHSIRVWEETEDQVFLEEEREKEMDEQYEDTLLTSLEGGAGDEML 719
           ++V+  GT VIS  HD SIRVWEET+DQVFLEEERE+E++EQ E+ LLTSLE G+GD   
Sbjct: 659 LAVARSGTCVISVSHDSSIRVWEETDDQVFLEEERERELEEQNEEGLLTSLEEGSGDSAF 718

Query: 720 SVKKGDNEESEEVEGVHKQTVESLKAGERLMEALEIGVNDIIAMEEFNEQLNAWKKSKKG 779
             +   +++ ++   VHKQTVESLKAGERLMEA+++G+ +I A E + ++L  WKK K+G
Sbjct: 719 K-QDEKDDDHDDAVDVHKQTVESLKAGERLMEAIDLGIPEIEAWEIYEKELQLWKKKKQG 777

Query: 780 IQPIRPQENTLLVALKKTPEEYIIETLVKIKPSQIEDALMVMPFSYILKFLKFIDVVTTK 839
           ++P RPQ+N +L+A+ K PEEYI++TLV+IKPSQ+EDAL+ +PFSY+LKFLKF+D V   
Sbjct: 778 VEPERPQDNAILLAINKRPEEYIMDTLVRIKPSQLEDALLTLPFSYVLKFLKFLDTVLQD 837

Query: 840 AALLQKHISLVCKTLFFVIRFNYKELVAQKNANLKLQITRVKDNLRKSLKSNVDELGFNI 899
             LL  H+SL+CK LFF+++ N++ELV+QKN  LK +ITRVK+ LR++LK+N D+LGFNI
Sbjct: 838 KKLLHNHLSLICKNLFFIVQSNHRELVSQKNEELKQRITRVKNELREALKNNEDDLGFNI 897

Query: 900 EGMKFIKQQWELNHHLEFNDEYEEKNFEEKHSKKRVFGTLA 940
           EG+KFIKQQW L H+ EF DE++++   EK +KKRVF TL+
Sbjct: 898 EGLKFIKQQWNLKHNYEFVDEFDQRKQAEKTAKKRVFETLS 938

>Kwal_56.23920 s56 (776647..779460) [2814 bp, 937 aa] {ON} YLR129W
           (DIP2) - interacts with Dom3p [contig 171] FULL
          Length = 937

 Score = 1293 bits (3346), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 610/942 (64%), Positives = 763/942 (80%), Gaps = 7/942 (0%)

Query: 1   MVKSYQRFEQANVFGVISSNSNSVWIEPEASKRKTGNLGQVIVGGLENILVWDIKTGEQI 60
           MVKSYQRFEQ +VFGVISSNSN +W+ P  ++  TG   QV+ G LEN+  W +K+GE I
Sbjct: 1   MVKSYQRFEQESVFGVISSNSNCLWL-PAENRNSTG---QVLTGALENVNCWSMKSGELI 56

Query: 61  AQLTDGLPPGASDAKLSKPAETTFLKYHPETNLLAAGYADGVIKIWDLISKTVLISFNGH 120
             LTDGLPPGA DAK +KPAET++L+YHPET LLA GY DG IKIWDL+SK+VLISFNGH
Sbjct: 57  GTLTDGLPPGAVDAKSTKPAETSYLQYHPETRLLAVGYNDGAIKIWDLLSKSVLISFNGH 116

Query: 121 KSAITVLAFDTTGTRLISASKDSDIIVWDLVGESGLYKLRSHKDAITGLWCEDENWLIST 180
           KSAIT+L FD TGTRLIS S+DSDIIVWDLVGE GLYKLRSHKD+ITGLWCE E WLIST
Sbjct: 117 KSAITILTFDQTGTRLISGSRDSDIIVWDLVGEVGLYKLRSHKDSITGLWCEGEEWLIST 176

Query: 181 SKDGLVKIWDLKSQQCVETHLAHTGECWSLGIIEDMAVTCSADSQVKLWKLDLQAENGSK 240
           SKDGL+K+WDLK QQCVETH+AH GECWS+G+ ED+ +T  AD+Q+KLW L+ +   GS 
Sbjct: 177 SKDGLIKVWDLKVQQCVETHVAHVGECWSMGVHEDLVITAGADNQIKLWNLNFEESAGSM 236

Query: 241 LTEKGIIEKQSKQRGVEIDFAVAPDGVKFFYIQNADKTIEIYRLRKEEEISRALKKREKR 300
           L EKG  EKQS+QRGV I F    D   FF+IQNAD+++E +RLRK++EI++ALKKREKR
Sbjct: 237 LIEKGTHEKQSRQRGVAIQFTTVSDETTFFFIQNADRSVETFRLRKQDEIAKALKKREKR 296

Query: 301 LQDKGMSEEEIKEAM-GSPVSLMYHLFQVVRSPYKIKSAQWTVCSNSKLELVVTTSNNSI 359
           L +KG+SE+EI++ +  S  S + H FQ+VRS YK++S  W   + SKL+LVVTT+NN++
Sbjct: 297 LTEKGLSEDEIQQNLKDSFTSFIMHPFQIVRSIYKVRSVCWATTTTSKLDLVVTTANNTV 356

Query: 360 EYYSIPYSKREPTQPAPLKLHTIDLHGQRTDIRSTSISDDNKLLATASNGSLKIWNIKTK 419
           +YYSI Y KREPT P+P KLH+ID+ G R+D+R+  IS DNKLLATASNG+LKIWNIKT 
Sbjct: 357 DYYSIKYQKREPTMPSPPKLHSIDIRGHRSDVRAIDISGDNKLLATASNGTLKIWNIKTN 416

Query: 420 RCIRSFECGYALTCKFLPGGALVVVGTRNGELQLFDIASSTMLDNKEGAHDAAIWSLDLT 479
            CIR+FECGYAL CKFLPGGALVV+GT+ G+L L+D+ASST+L+  EGAH  AIWSLD+T
Sbjct: 417 SCIRTFECGYALACKFLPGGALVVLGTKTGDLHLYDLASSTLLNTIEGAHSGAIWSLDMT 476

Query: 480 SDGRKLVTGSADKTVRFWTFEVSEVPVSDESNKTMPMLQLFHDTTLELDDDILSVVISPD 539
           +DG++LVTGSADKTV FW F+V + PV   ++K  P L++FHDTTLEL+DD+L+V ISPD
Sbjct: 477 TDGKRLVTGSADKTVCFWDFQVEQEPVPGTTDKFNPKLKMFHDTTLELNDDVLAVKISPD 536

Query: 540 DKFIAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSMDISYDSKLIVTCSADKNIKIWGL 599
           ++ +AVSLLDNTVKVFF+DSMKFFLSLYGHKLPVLS+DIS+DSKL++T SADKNIKIWGL
Sbjct: 537 NRLLAVSLLDNTVKVFFMDSMKFFLSLYGHKLPVLSIDISFDSKLLITSSADKNIKIWGL 596

Query: 600 DFGDCHKSLFAHQDSIMNVKFLPESYNFFSCSKDATVKYWDGQKFECIQKLAAHQSEVWS 659
           DFGDCH+SLFAH DSIM V F+PES+NFFSCSKDA VKYWDG KFECIQKLAAHQ EVW+
Sbjct: 597 DFGDCHRSLFAHNDSIMKVVFVPESHNFFSCSKDALVKYWDGDKFECIQKLAAHQKEVWT 656

Query: 660 ISVSNDGTFVISTGHDHSIRVWEETEDQVFLEEEREKEMDEQYEDTLLTSLEGGAGDEML 719
           +++S+DG FV+S  HD SIRVW ET+DQVFLEEERE+E DEQYE TLL SLE GAGD+M 
Sbjct: 657 LAISSDGRFVVSASHDQSIRVWSETDDQVFLEEERERESDEQYEKTLLNSLENGAGDDMF 716

Query: 720 SVK-KGDNEESEEVEGVHKQTVESLKAGERLMEALEIGVNDIIAMEEFNEQLNAWKKSKK 778
                GD E +++   VHKQT ESLKA E+LMEAL++G+++I  + E+ + L  W+K + 
Sbjct: 717 EKDGNGDGEITDQATDVHKQTTESLKASEKLMEALDLGMSEINNLLEYEKALKQWEKKRS 776

Query: 779 GIQPIRPQENTLLVALKKTPEEYIIETLVKIKPSQIEDALMVMPFSYILKFLKFIDVVTT 838
           G  P +P  N++LVA+ KTP EYI++ LVKIKPSQ+EDAL+V+PF+Y+L FL FID+V  
Sbjct: 777 GPHPGKPLPNSILVAINKTPLEYIMDVLVKIKPSQLEDALLVLPFTYVLTFLHFIDLVLK 836

Query: 839 KAALLQKHISLVCKTLFFVIRFNYKELVAQKNANLKLQITRVKDNLRKSLKSNVDELGFN 898
           +  L ++ + L+C+ LFF+I+ N++EL +QKN  LK+Q+ R+KD LRKS+K+  D+LGFN
Sbjct: 837 EKELARRRLPLICRNLFFIIKSNHRELFSQKNEELKIQMNRIKDGLRKSIKAKSDDLGFN 896

Query: 899 IEGMKFIKQQWELNHHLEFNDEYEEKNFEEKHSKKRVFGTLA 940
           I+G+ FIKQQW + H+ EF+D+       EK +KKRVF TL 
Sbjct: 897 IQGLTFIKQQWNMKHNFEFSDDITVNKTNEK-AKKRVFETLV 937

>KAFR0H02260 Chr8 complement(430272..433088) [2817 bp, 938 aa] {ON}
           Anc_8.324 YLR129W
          Length = 938

 Score = 1292 bits (3344), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 650/946 (68%), Positives = 784/946 (82%), Gaps = 14/946 (1%)

Query: 1   MVKSYQRFEQANVFGVISSNSNSVWIEPEASKRKTGNLGQVIVGGLENILVWDIKTGEQI 60
           MVKSYQRFEQ +VFGVISSNSNSVWI P  +       G +I   LENI +WDIKTGE +
Sbjct: 1   MVKSYQRFEQTSVFGVISSNSNSVWI-PNGNGP-----GNIITSALENINIWDIKTGELV 54

Query: 61  AQLTDGLPP-GASDAKLSKPAETTFLKYHPETNLLAAGYADGVIKIWDLISKTVLISFNG 119
            QLTDGLPP G+ D+KLSKPA  T+ KYH +TNLLAAGY+DGVIK+WDLISKT+L++FNG
Sbjct: 55  NQLTDGLPPPGSIDSKLSKPASVTYFKYHEDTNLLAAGYSDGVIKVWDLISKTILLTFNG 114

Query: 120 HKSAITVLAFDTTGTRLISASKDSDIIVWDLVGESGLYKLRSHKDAITGLWC-EDENWLI 178
           HKSAIT+L FD+TGTRLIS S DSDIIVWDLV E GLYKLRSHKD ITG+WC +DENWLI
Sbjct: 115 HKSAITILTFDSTGTRLISGSNDSDIIVWDLVSEVGLYKLRSHKDNITGIWCSDDENWLI 174

Query: 179 STSKDGLVKIWDLKSQQCVETHLAHTGECWSLGIIEDMAVTCSADSQVKLWKLDLQAE-N 237
           STSKDGL+K+WDLK QQCVETH+AHTGECWSLGI  D+ VT SA+SQVK WKLDL+ + N
Sbjct: 175 STSKDGLIKVWDLKIQQCVETHIAHTGECWSLGIHNDLVVTTSAESQVKFWKLDLENQPN 234

Query: 238 GSKLTEKGIIEKQSKQRGVEIDFAVAP-DGVKFFYIQNADKTIEIYRLRKEEEISRALKK 296
           GSKL EKGI EKQSKQRG+ ++F  +  D V FF+IQNADKT+EI+R+RK++EI +ALKK
Sbjct: 235 GSKLVEKGIFEKQSKQRGLSVEFITSKGDDVSFFHIQNADKTVEIFRIRKKDEIEKALKK 294

Query: 297 REKRLQDKGMSEEEIKEAMGSP-VSLMYHLFQVVRSPYKIKSAQWTVCSNSKLELVVTTS 355
           REKRL++KGM+++EI + +    VS + H FQ VRS YKIKS  WT  ++SKLELVVTTS
Sbjct: 295 REKRLKEKGMTDDEIAQNVDEAFVSFLMHPFQTVRSTYKIKSVCWTHATSSKLELVVTTS 354

Query: 356 NNSIEYYSIPYSKREPTQPAPLKLHTIDLHGQRTDIRSTSISDDNKLLATASNGSLKIWN 415
           +N+IEYYS+ Y+KR P QP P K+HTI+LHGQRTDIRS +ISDDNKLLATASNG LKIWN
Sbjct: 355 SNTIEYYSVTYAKRIP-QP-PSKIHTIELHGQRTDIRSIAISDDNKLLATASNGLLKIWN 412

Query: 416 IKTKRCIRSFECGYALTCKFLPGGALVVVGTRNGELQLFDIASSTMLDNKEGAHDAAIWS 475
           +KT +CIR+FECGYAL CKFLPGG LV+VGTRNGELQLFD+ASST L+N E AHDAAIWS
Sbjct: 413 LKTHKCIRTFECGYALCCKFLPGGLLVIVGTRNGELQLFDLASSTQLENIEDAHDAAIWS 472

Query: 476 LDLTSDGRKLVTGSADKTVRFWTFEVSEVPVSDESNKTMPMLQLFHDTTLELDDDILSVV 535
           LD+TSDG++L+TGSADKTV+FW F++ +  V    +  +P+L+LFHDTTLE+ +DIL V 
Sbjct: 473 LDITSDGKRLITGSADKTVKFWDFKLDQQKVEGTRDSYIPVLKLFHDTTLEIGEDILCVR 532

Query: 536 ISPDDKFIAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSMDISYDSKLIVTCSADKNIK 595
           +SPDDKF+AVSLLD TVK+FFLDSMKFFLSLYGHKLPVLS+DIS+DSKLI+T SADKNIK
Sbjct: 533 LSPDDKFLAVSLLDYTVKIFFLDSMKFFLSLYGHKLPVLSIDISFDSKLIITSSADKNIK 592

Query: 596 IWGLDFGDCHKSLFAHQDSIMNVKFLPESYNFFSCSKDATVKYWDGQKFECIQKLAAHQS 655
           IWGLDFGDCHKSLFAH DSIMNVKFL  S+NFFSCSKD T+KYWDG KFECIQKL AHQ+
Sbjct: 593 IWGLDFGDCHKSLFAHADSIMNVKFLNNSHNFFSCSKDGTIKYWDGDKFECIQKLVAHQN 652

Query: 656 EVWSISVSNDGTFVISTGHDHSIRVWEETEDQVFLEEEREKEMDEQYEDTLLTSLEGGAG 715
           EVWSI++++D +FV+S+ HDHS+R+WEETEDQVFLEEERE+EM+EQYE+TLL SLE G G
Sbjct: 653 EVWSIAIADDSSFVVSSSHDHSLRIWEETEDQVFLEEEREREMEEQYENTLLNSLEEGTG 712

Query: 716 DEMLSVKKGDNEESEEVEGVHKQTVESLKAGERLMEALEIGVNDIIAMEEFNEQLNAWKK 775
           D         +E+ +E   VHKQT ESLKAGERLMEAL++G+ +I   E + + L  WKK
Sbjct: 713 DSAFKSDTKGSEDEDEATDVHKQTAESLKAGERLMEALDLGIEEIEKNETYLKDLELWKK 772

Query: 776 SK-KGIQPIRPQENTLLVALKKTPEEYIIETLVKIKPSQIEDALMVMPFSYILKFLKFID 834
            K  G  PI+PQ N +L A+ KTPE+YI+ETL+KIKPSQ+EDA++V PFSY+LKFLKFID
Sbjct: 773 KKIGGDAPIKPQGNAILTAINKTPEQYILETLIKIKPSQLEDAILVFPFSYVLKFLKFID 832

Query: 835 VVTTKAALLQKHISLVCKTLFFVIRFNYKELVAQKNANLKLQITRVKDNLRKSLKSNVDE 894
           +V     +L  H++L+CK LFFVI+ N+KEL++QKN +LKLQ+ RVKD LR +L+ N D+
Sbjct: 833 IVLNDPKVLNNHLTLICKNLFFVIKSNHKELISQKNEDLKLQVDRVKDRLRGALRKNEDD 892

Query: 895 LGFNIEGMKFIKQQWELNHHLEFNDEYEEKNFEEKHSKKRVFGTLA 940
           LG+NI+G+KFIKQQW L H+ EFNDE ++   E K  KKRVFGT+ 
Sbjct: 893 LGYNIQGLKFIKQQWNLTHNFEFNDELDQNVQESKSGKKRVFGTIV 938

>TPHA0C00810 Chr3 complement(158582..161395) [2814 bp, 937 aa] {ON}
           Anc_8.324 YLR129W
          Length = 937

 Score = 1290 bits (3338), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 617/942 (65%), Positives = 793/942 (84%), Gaps = 7/942 (0%)

Query: 1   MVKSYQRFEQANVFGVISSNSNSVWIEPEASKRKTGNLGQVIVGGLENILVWDIKTGEQI 60
           MVKSYQRFEQ +VFGVI++N+N VW+ P +  RK+ N+GQV+ G LENI +WDIKTGE +
Sbjct: 1   MVKSYQRFEQDSVFGVITTNANCVWL-PSSDSRKS-NVGQVLTGALENINLWDIKTGELL 58

Query: 61  AQLTDGLPPGASDAKLSKPAETTFLKYHPETNLLAAGYADGVIKIWDLISKTVLISFNGH 120
           + L+DGLPPG+ D K SKPAE T+L+YH ETNLLAAGYADGVIKIWDL+SKTVL+SF+GH
Sbjct: 59  SVLSDGLPPGSIDVKSSKPAEVTYLEYHDETNLLAAGYADGVIKIWDLMSKTVLLSFSGH 118

Query: 121 KSAITVLAFDTTGTRLISASKDSDIIVWDLVGESGLYKLRSHKDAITGLWCEDENWLIST 180
           KS +T+L FD+TGTRL+S S+DSDII+WDLV E G++KLRSHKDAITG+WCE E+WL+ST
Sbjct: 119 KSGVTILKFDSTGTRLMSGSRDSDIIIWDLVSEVGVFKLRSHKDAITGIWCEGEDWLVST 178

Query: 181 SKDGLVKIWDLKSQQCVETHLAHTGECWSLGIIEDMAVTCSADSQVKLWKLDLQAENGSK 240
           +KDGL+K+WDLK+QQCVETH+A TGECW+LG+  D+ VT   DSQ+K+W LD   ENGSK
Sbjct: 179 AKDGLIKLWDLKTQQCVETHIAQTGECWALGVHGDLVVTTGTDSQIKIWNLDTSKENGSK 238

Query: 241 LTEKGIIEKQSKQRGVEIDFAVAPDGVKFFYIQNADKTIEIYRLRKEEEISRALKKREKR 300
           + EKG  EKQSKQRG+ ++F    D   F YIQN+DKT+EI+R+RK++EISRALKKREKR
Sbjct: 239 IVEKGTYEKQSKQRGLSVNFKTTADETTFLYIQNSDKTVEIFRIRKQDEISRALKKREKR 298

Query: 301 LQDKGMSEEEIKEA-MGSPVSLMYHLFQVVRSPYKIKSAQWTVCSNSKLELVVTTSNNSI 359
           +++KG ++E+I++  + + VSLM   FQ+++S YKIK+  WTV +NSK+ELVVTTS+N+I
Sbjct: 299 MKEKGSTDEQIQQYFIDTYVSLMLQPFQIIKSTYKIKAVSWTVAANSKIELVVTTSSNTI 358

Query: 360 EYYSIPYSKREPTQPAPLKLHTIDLHGQRTDIRSTSISDDNKLLATASNGSLKIWNIKTK 419
           EYYSIPY KR P  P+P KL+TI+  G RTDIRS  ISDDNKLLA+ASNG LKIWN+KTK
Sbjct: 359 EYYSIPYEKRLPKNPSPSKLYTIEQKGHRTDIRSIDISDDNKLLASASNGLLKIWNLKTK 418

Query: 420 RCIRSFECGYALTCKFLPGGALVVVGTRNGELQLFDIASSTMLDNKEGAHDAAIWSLDLT 479
            CIR+F+CGYALTCKFLP G L V+GTR G++QLFD+ +ST++++ + AH+AAIWSLD+T
Sbjct: 419 SCIRTFDCGYALTCKFLPSGTLCVIGTREGQIQLFDLVTSTLIESIDVAHNAAIWSLDIT 478

Query: 480 SDGRKLVTGSADKTVRFWTFEVSEVPVSDESNKTMPMLQLFHDTTLELDDDILSVVISPD 539
            DG++LVTGSADK+++FW F + +  V   ++K +P+++L HDTTLEL+DDILSV ISP+
Sbjct: 479 QDGKRLVTGSADKSIKFWNFSIEQDLVPGTTDKFVPVMKLIHDTTLELNDDILSVKISPE 538

Query: 540 DKFIAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSMDISYDSKLIVTCSADKNIKIWGL 599
           DK++AVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLS+DIS+DSKLI+T SADKNIKIWGL
Sbjct: 539 DKYLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSIDISFDSKLIITSSADKNIKIWGL 598

Query: 600 DFGDCHKSLFAHQDSIMNVKFLPESYNFFSCSKDATVKYWDGQKFECIQKLAAHQSEVWS 659
           DFGDCHKSLFAHQDSIMNV FLPES+NFFS SKD  VKYWDG KFEC+QKLAAHQSEVW+
Sbjct: 599 DFGDCHKSLFAHQDSIMNVCFLPESHNFFSSSKDGLVKYWDGDKFECVQKLAAHQSEVWA 658

Query: 660 ISVSNDGTFVISTGHDHSIRVWEETEDQVFLEEEREKEMDEQYEDTLLTSLEGGAGDEML 719
           +++++DG+ V+S+ HDHS+RVW+ET+DQVFLEEEREKE++EQYEDTLLTSLE G+GD   
Sbjct: 659 LAITSDGSTVVSSSHDHSMRVWKETDDQVFLEEEREKELEEQYEDTLLTSLEEGSGD--- 715

Query: 720 SVKKGDNEES-EEVEGVHKQTVESLKAGERLMEALEIGVNDIIAMEEFNEQLNAWKKSKK 778
           S  K D E+  +E   V  QT+ESLK+GERLMEALE+G ++I A+E++N+    W+K K 
Sbjct: 716 SAFKADIEDGMDESTSVRNQTMESLKSGERLMEALELGFSEIEALEKYNKDYKQWEKKKA 775

Query: 779 GIQPIRPQENTLLVALKKTPEEYIIETLVKIKPSQIEDALMVMPFSYILKFLKFIDVVTT 838
           G  P++PQ N +L+A+ + P++YI++TL+KIKPSQ+EDAL+V+PFSY+L+FLKFID+V  
Sbjct: 776 GEPPVKPQGNAILLAINRRPDQYIMDTLIKIKPSQLEDALLVLPFSYVLQFLKFIDIVMD 835

Query: 839 KAALLQKHISLVCKTLFFVIRFNYKELVAQKNANLKLQITRVKDNLRKSLKSNVDELGFN 898
              +L+  ++L+CK LF +++ N+KEL++Q+N  LK QIT VK+ LR SL++NVD+LGFN
Sbjct: 836 DPEILKNRLALICKNLFIIVKANHKELISQRNDVLKKQITSVKNKLRTSLQANVDDLGFN 895

Query: 899 IEGMKFIKQQWELNHHLEFNDEYEEKNFEEKHSKKRVFGTLA 940
           I+G+KFIKQQW L H+ EF DE ++K  EEK+SKKR+FGTLA
Sbjct: 896 IQGLKFIKQQWNLKHNYEFIDEEDQKKQEEKNSKKRIFGTLA 937

>Ecym_4255 Chr4 (529455..532268) [2814 bp, 937 aa] {ON} similar to
           Ashbya gossypii AGL196C
          Length = 937

 Score = 1288 bits (3334), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 625/940 (66%), Positives = 772/940 (82%), Gaps = 4/940 (0%)

Query: 1   MVKSYQRFEQANVFGVISSNSNSVWIEPEASKRKTGNLGQVIVGGLENILVWDIKTGEQI 60
           MV SYQRFEQ + FGVI+SNSN VWI  E S+   G   Q+I   LENI  WDIKTG  +
Sbjct: 1   MVNSYQRFEQRSFFGVIASNSNCVWIPTEGSRTSPG---QIITSSLENINCWDIKTGNLL 57

Query: 61  AQLTDGLPPGASDAKLSKPAETTFLKYHPETNLLAAGYADGVIKIWDLISKTVLISFNGH 120
             L+D +PPG+ DAK  KPAE  +L+YH ETNLLAAGYADGVIKIWD+ ++TVLI FN H
Sbjct: 58  KTLSDSIPPGSIDAKYEKPAEVAYLEYHHETNLLAAGYADGVIKIWDMQTQTVLIIFNSH 117

Query: 121 KSAITVLAFDTTGTRLISASKDSDIIVWDLVGESGLYKLRSHKDAITGLWCEDENWLIST 180
            +AIT L FD +GTRLIS S+DS+II+WDLVGE GL KLRSHKD+ITG+W E+++WLIST
Sbjct: 118 TAAITFLKFDPSGTRLISGSRDSNIIIWDLVGEVGLCKLRSHKDSITGIWFENDDWLIST 177

Query: 181 SKDGLVKIWDLKSQQCVETHLAHTGECWSLGIIEDMAVTCSADSQVKLWKLDLQAENGSK 240
           SKDGL+K+WD+KSQQCVETH+AHT ECWSL I +D+ VT +ADS++K+W+LDL+ ENGSK
Sbjct: 178 SKDGLIKVWDIKSQQCVETHMAHTTECWSLAISDDLVVTANADSELKIWELDLERENGSK 237

Query: 241 LTEKGIIEKQSKQRGVEIDFAVAPDGVKFFYIQNADKTIEIYRLRKEEEISRALKKREKR 300
           L EKGI EKQS+QR V++     PD VKFFY+QNADKT E++R+R   E+S+ALKKREKR
Sbjct: 238 LKEKGIYEKQSRQRSVDVKIVTNPDEVKFFYVQNADKTTEVFRIRTSSELSKALKKREKR 297

Query: 301 LQDKGMSEEEIKEAMGSP-VSLMYHLFQVVRSPYKIKSAQWTVCSNSKLELVVTTSNNSI 359
           L++KG+SE+EI+E + S  V+ +   FQVVRS +K KSA WT CS SKLELV TTSNN+I
Sbjct: 298 LKEKGISEDEIQEKIKSSFVNDIIQPFQVVRSSFKFKSAAWTRCSLSKLELVFTTSNNTI 357

Query: 360 EYYSIPYSKREPTQPAPLKLHTIDLHGQRTDIRSTSISDDNKLLATASNGSLKIWNIKTK 419
           EYYSIPY  ++PTQ A  KL+TI+L G RTD+RS  IS+DNKLLA ASNG LKIWNI T+
Sbjct: 358 EYYSIPYKNQKPTQVAASKLYTIELQGHRTDVRSIDISEDNKLLAAASNGMLKIWNITTQ 417

Query: 420 RCIRSFECGYALTCKFLPGGALVVVGTRNGELQLFDIASSTMLDNKEGAHDAAIWSLDLT 479
            CIR+F+CGYAL CKFLPGG LVVVGTR GELQLFD+ASS +L+NKE AHDAAIWSLDLT
Sbjct: 418 SCIRTFDCGYALCCKFLPGGTLVVVGTRGGELQLFDLASSIVLENKEAAHDAAIWSLDLT 477

Query: 480 SDGRKLVTGSADKTVRFWTFEVSEVPVSDESNKTMPMLQLFHDTTLELDDDILSVVISPD 539
           SDGR+L+TGSADKTV+FW F+V +  +S  ++K    LQ+ HDTTLEL +DILSV ISP+
Sbjct: 478 SDGRRLITGSADKTVKFWNFQVEKELISSSTDKYNSRLQMVHDTTLELGEDILSVKISPE 537

Query: 540 DKFIAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSMDISYDSKLIVTCSADKNIKIWGL 599
           D+F+AVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLS+DISYDSKLI+T SADKNIKIWGL
Sbjct: 538 DRFLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSIDISYDSKLIITSSADKNIKIWGL 597

Query: 600 DFGDCHKSLFAHQDSIMNVKFLPESYNFFSCSKDATVKYWDGQKFECIQKLAAHQSEVWS 659
           DFGDCH+SLFAHQD+IMNVKF+P+S+NFFSC KD  +KYWDG KF+CIQKL AH+SEVW+
Sbjct: 598 DFGDCHRSLFAHQDAIMNVKFVPQSHNFFSCGKDGVIKYWDGVKFDCIQKLIAHKSEVWA 657

Query: 660 ISVSNDGTFVISTGHDHSIRVWEETEDQVFLEEEREKEMDEQYEDTLLTSLEGGAGDEML 719
           +++S+DG F +S  HD SIRVWEETEDQVFLEEEREKEMDEQYE+ LL++LE  A DE  
Sbjct: 658 LALSSDGQFFVSVSHDRSIRVWEETEDQVFLEEEREKEMDEQYEEKLLSTLENDASDEKF 717

Query: 720 SVKKGDNEESEEVEGVHKQTVESLKAGERLMEALEIGVNDIIAMEEFNEQLNAWKKSKKG 779
           +    ++ +  EV  VHKQT+ESLKAGERLMEAL++G++++ A EE++  L  W K+K G
Sbjct: 718 ARNSEEDTDVTEVTDVHKQTIESLKAGERLMEALDLGISELEAQEEYHRNLLLWNKNKSG 777

Query: 780 IQPIRPQENTLLVALKKTPEEYIIETLVKIKPSQIEDALMVMPFSYILKFLKFIDVVTTK 839
            QP++PQ N++L+A+ K PEEYI++TLV+IKP+Q+EDAL+V+PFSY+LKFLKFID    K
Sbjct: 778 DQPMKPQSNSILIAVNKLPEEYIMDTLVRIKPAQLEDALLVLPFSYVLKFLKFIDASIEK 837

Query: 840 AALLQKHISLVCKTLFFVIRFNYKELVAQKNANLKLQITRVKDNLRKSLKSNVDELGFNI 899
             L+  H+ L+C+ L +V++ N+KEL+AQKN  LKLQI +VKD LR +LK N+D+LGFNI
Sbjct: 838 KQLVNNHLPLICRNLLYVVKINHKELIAQKNEELKLQINKVKDKLRAALKGNIDDLGFNI 897

Query: 900 EGMKFIKQQWELNHHLEFNDEYEEKNFEEKHSKKRVFGTL 939
           EG+KFIKQQW + H+ EF DEY++++ E K SKKRVF T+
Sbjct: 898 EGLKFIKQQWNVKHNFEFVDEYDQRDAETKSSKKRVFTTV 937

>TBLA0A03950 Chr1 (986923..989733) [2811 bp, 936 aa] {ON} Anc_8.324
           YLR129W
          Length = 936

 Score = 1285 bits (3325), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 618/936 (66%), Positives = 770/936 (82%), Gaps = 8/936 (0%)

Query: 1   MVKSYQRFEQANVFGVISSNSNSVWIEPEASKRKTGNLGQVIVGGLENILVWDIKTGEQI 60
           MVKSYQRFEQ++VFGVISSNSN VW+ P + K K+  LG+VI G LENI VWD+KT E  
Sbjct: 1   MVKSYQRFEQSSVFGVISSNSNCVWVPPSSKKSKS--LGKVITGALENISVWDLKTSELE 58

Query: 61  AQLTDGLPPGASDAKLSKPAETTFLKYHPETNLLAAGYADGVIKIWDLISKTVLISFNGH 120
             L+DGLPPG+ D K SKPAE ++L++H ET L+AAGYADGVIK+WDL+SKTVL+SFNGH
Sbjct: 59  YVLSDGLPPGSVDLKSSKPAEVSYLQFHSETGLIAAGYADGVIKLWDLVSKTVLLSFNGH 118

Query: 121 KSAITVLAFDTTGTRLISASKDSDIIVWDLVGESGLYKLRSHKDAITGLWCEDENWLIST 180
           KS IT+L FD TGT+LIS S+DS+IIVWDLV E GLYKLRSHK  ITGLWC+ +NWLIST
Sbjct: 119 KSRITMLKFDKTGTQLISGSEDSNIIVWDLVSEVGLYKLRSHKGTITGLWCDSDNWLIST 178

Query: 181 SKDGLVKIWDLKSQQCVETHLAHTGECWSLGIIEDMAVTCSADSQVKLWKLDLQAENGSK 240
           SKDGL+K+WDLK+QQC+ETH+AHTGECW+LGI+ D  VT SADSQ+K+W++DL+ E GSK
Sbjct: 179 SKDGLIKVWDLKTQQCIETHIAHTGECWALGIMTDFVVTSSADSQLKIWQMDLEGEPGSK 238

Query: 241 LTEKGIIEKQSKQRGVEIDFAVAPDGVKFFYIQNADKTIEIYRLRKEEEISRALKKREKR 300
           L EKG  EKQSKQRG+ I+F    DGV FFY+QNADKT+EI+RLRK+ EI++A+K+REKR
Sbjct: 239 LIEKGAFEKQSKQRGLSIEFTTTSDGVHFFYVQNADKTVEIFRLRKDIEIAKAIKRREKR 298

Query: 301 LQDKGMSEEEIKEAMG-SPVSLMYHLFQVVRSPYKIKSAQWTVCSNSKLELVVTTSNNSI 359
           L +KGM+EE+IK  +  S VS + H FQVVRS YKIKS  WT+  ++KLE+VVTT++N+I
Sbjct: 299 LTEKGMTEEDIKTNISESYVSFVMHPFQVVRSMYKIKSVAWTLSLSTKLEVVVTTNSNTI 358

Query: 360 EYYSIPYSKREPTQPAPLKLHTIDLHGQRTDIRSTSISDDNKLLATASNGSLKIWNIKTK 419
           EYYS+PY KR+PT P P+K HTI+L G RTD+RS  ISDDN LLATASNG LKIWN+ TK
Sbjct: 359 EYYSVPYEKRDPTSPTPIKAHTIELQGSRTDVRSIDISDDNALLATASNGELKIWNLNTK 418

Query: 420 RCIRSFECGYALTCKFLPGGALVVVGTRNGELQLFDIASSTMLDNKEGAHDAAIWSLDLT 479
            CIR+FECGYALTCKFLPGG LVVVGTR G LQLFD+ASS +L   E AH+ AIWSLD+T
Sbjct: 419 SCIRTFECGYALTCKFLPGGLLVVVGTREGNLQLFDLASSVLLTTIEAAHEGAIWSLDVT 478

Query: 480 SDGRKLVTGSADKTVRFWTFEVSEVPVSDESNKTMPMLQLFHDTTLELDDDILSVVISPD 539
           +DG++LVTGSADK+++FW F+V +  ++  S+K +P + + HD+TLEL DDILS+ IS D
Sbjct: 479 NDGKRLVTGSADKSIKFWDFQVKQELIAGTSDKYVPQMNIVHDSTLELGDDILSIKISGD 538

Query: 540 DKFIAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSMDISYDSKLIVTCSADKNIKIWGL 599
           DKF+A+SLLDNTVKVFFLDSMKFFLSLYGHKLPVLS+DIS D+K+I+T SADKNIKIWGL
Sbjct: 539 DKFLAISLLDNTVKVFFLDSMKFFLSLYGHKLPVLSLDISDDTKVIITSSADKNIKIWGL 598

Query: 600 DFGDCHKSLFAHQDSIMNVKFLPESYNFFSCSKDATVKYWDGQKFECIQKLAAHQSEVWS 659
           DFGDCHKSLFAHQDSIM VKFLP S+NFFS SKD  VKYWDG KFECIQKLAAHQSEVW+
Sbjct: 599 DFGDCHKSLFAHQDSIMCVKFLPGSHNFFSASKDGFVKYWDGDKFECIQKLAAHQSEVWA 658

Query: 660 ISVSNDGTFVISTGHDHSIRVWEETEDQVFLEEEREKEMDEQYEDTLLTSLEGGAGDEML 719
           ++VS++G  V+S  HDHSIR+WEET+DQVFLEEEREKE++EQYEDTLL SLE G  D+  
Sbjct: 659 LAVSDNGERVVSVSHDHSIRIWEETDDQVFLEEEREKELEEQYEDTLLASLEEGNADDTF 718

Query: 720 SVKKGD--NEESEEVEGVHKQTVESLKAGERLMEALEIGVNDIIAMEEFNEQLNAWKKSK 777
              KGD  N+E +E   V KQT+ESLKAGERLM+AL++G+ +I  ME +  ++  +KK +
Sbjct: 719 ---KGDVKNDEDDEATRVSKQTIESLKAGERLMDALDLGIKEIEEMENYEAEMVKYKKKQ 775

Query: 778 KGIQPIRPQENTLLVALKKTPEEYIIETLVKIKPSQIEDALMVMPFSYILKFLKFIDVVT 837
           +   P++P  N +L+A++KTP EYI++TL+ IKPSQ+ED+L+V+PFSY+LKFLKF D V 
Sbjct: 776 RIDAPVKPTGNAILLAVRKTPVEYIMDTLIGIKPSQLEDSLLVLPFSYVLKFLKFFDYVM 835

Query: 838 TKAALLQKHISLVCKTLFFVIRFNYKELVAQKNANLKLQITRVKDNLRKSLKSNVDELGF 897
               +L   ++L+CK LFF+++ N KELV+QKN  LKLQI+RVK  LR +L++N D+LGF
Sbjct: 836 KVPNILNNRLALICKNLFFILKSNSKELVSQKNEELKLQISRVKHQLRSALQTNEDDLGF 895

Query: 898 NIEGMKFIKQQWELNHHLEFNDEYEEKNFEEKHSKK 933
           NI+G+KFIKQQW + H+ EF D+Y+++   EK +KK
Sbjct: 896 NIQGLKFIKQQWNMKHNFEFVDDYDQQAQAEKSAKK 931

>KNAG0G02450 Chr7 (557570..560398) [2829 bp, 942 aa] {ON} Anc_8.324
           YLR129W
          Length = 942

 Score = 1274 bits (3296), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 625/944 (66%), Positives = 779/944 (82%), Gaps = 6/944 (0%)

Query: 1   MVKSYQRFEQANVFGVISSNSNSVWIEPEASKRKTGNLGQVIVGGLENILVWDIKTGEQI 60
           MVKSYQRFEQ+ VFGVISS +N+VW+ P    R +G+ GQ+I   LEN+ +WDIKTGE I
Sbjct: 1   MVKSYQRFEQSAVFGVISSEANNVWLPP-LKGRSSGSPGQIITSALENVNIWDIKTGELI 59

Query: 61  AQLTDGLPPGASDAKL-SKPAETTFLKYHPETNLLAAGYADGVIKIWDLISKTVLISFNG 119
           AQL DG+ PG++D+K+ +KPAE TFL+YHP+++LLA GY DG IK+WDL+SKTVLI+ NG
Sbjct: 60  AQLQDGITPGSADSKVNTKPAEVTFLQYHPDSSLLAVGYRDGNIKVWDLVSKTVLINLNG 119

Query: 120 HKSAITVLAFDTTGTRLISASKDSDIIVWDLVGESGLYKLRSHKDAITGLWCEDE-NWLI 178
           HKS+ITVL FD   TRL+S S DS+II+WDLV E G+ KLRSHKD I+ L+ +D+ NWL+
Sbjct: 120 HKSSITVLKFDVNCTRLVSGSSDSNIIIWDLVSEVGICKLRSHKDRISDLYVDDDFNWLL 179

Query: 179 STSKDGLVKIWDLKSQQCVETHLAHTGECWSLGIIEDMAVTCSADSQVKLWKLDLQAENG 238
           S SKDGL+K+WDLK+ QCVETH+AHTGECWSLGI +D+ +T S  SQ+KLW LDL  E G
Sbjct: 180 SVSKDGLIKVWDLKTNQCVETHIAHTGECWSLGIKDDVVITTSNTSQIKLWSLDLDGEVG 239

Query: 239 SKLTEKGIIEKQSKQRGVEIDFAVAPDGVKFFYIQNADKTIEIYRLRKEEEISRALKKRE 298
           SKL EKG+ EKQSKQRG  + F     GV FF I NADKTIEI+R+R +EEI+RALKKRE
Sbjct: 240 SKLIEKGVYEKQSKQRGTSVKFIENSSGVAFFAIGNADKTIEIFRIRPQEEITRALKKRE 299

Query: 299 KRLQDKGMSEEEIKEAMG-SPVSLMYHLFQVVRSPYKIKSAQWTVCSNSKLELVVTTSNN 357
           KRL++KGM +E+I++ +  S VS M H FQ VRS +K+KS  WT  +NSKLELV TTS+N
Sbjct: 300 KRLKEKGMEDEDIQQNIKESFVSTMMHSFQTVRSAFKLKSFSWTFATNSKLELVATTSSN 359

Query: 358 SIEYYSIPYSKREPTQPAPLKLHTIDLHGQRTDIRSTSISDDNKLLATASNGSLKIWNIK 417
           +IEYY+I Y KREPTQPAP +L+TI+L G RTDIR+T ISDDN LLATASNG LKIWN++
Sbjct: 360 TIEYYTIAYEKREPTQPAPNRLYTIELQGLRTDIRATDISDDNMLLATASNGLLKIWNLR 419

Query: 418 TKRCIRSFECGYALTCKFLPGGALVVVGTRNGELQLFDIASSTMLDNKEGAHDAAIWSLD 477
           TK+CIR+F+CGYALTCKFLPGG LV++GTRNGELQLFD+ASST ++N EGAHDAAIWSLD
Sbjct: 420 TKQCIRTFDCGYALTCKFLPGGLLVILGTRNGELQLFDLASSTQIENIEGAHDAAIWSLD 479

Query: 478 LTSDGRKLVTGSADKTVRFWTFEVSEVPVSDESNKTMPMLQLFHDTTLELDDDILSVVIS 537
           LTS+G++LVTGSADKTV+FW F++ ++P+   S K+   L L HDTTLEL+DD+L V IS
Sbjct: 480 LTSNGKRLVTGSADKTVKFWDFQLEQLPIEGTSGKSESKLTLNHDTTLELNDDVLCVKIS 539

Query: 538 PDDKFIAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSMDISYDSKLIVTCSADKNIKIW 597
           P+DK +AVSLLDNTVK+FFLD+MKFFLSLYGHKLPVLS+DIS+DSK+++T SADKNIKIW
Sbjct: 540 PEDKHLAVSLLDNTVKIFFLDTMKFFLSLYGHKLPVLSIDISFDSKMVITSSADKNIKIW 599

Query: 598 GLDFGDCHKSLFAHQDSIMNVKFLPESYNFFSCSKDATVKYWDGQKFECIQKLAAHQSEV 657
           GLDFGDCHKSLFAHQDSIMNVKFLPES+NFFSCSKD  VKYWDG KFEC+QKL +HQSEV
Sbjct: 600 GLDFGDCHKSLFAHQDSIMNVKFLPESHNFFSCSKDGQVKYWDGDKFECVQKLVSHQSEV 659

Query: 658 WSISVSNDGTFVISTGHDHSIRVWEETEDQVFLEEEREKEMDEQYEDTLLTSLEGGAGDE 717
           W +++  DG+FV+ST HDHSIR+W+ETEDQVFLEEEREKEM+EQYE+TLL SLE G GD+
Sbjct: 660 WCLAMGLDGSFVVSTSHDHSIRIWQETEDQVFLEEEREKEMEEQYEETLLNSLEEGTGDD 719

Query: 718 MLSVKKGDNEESEEVEGVHKQTVESLKAGERLMEALEIGVNDIIAMEEFNEQLNAWKKSK 777
               K   + E +E   VHKQT+ESLKA E+LM+AL++G+ +I AME +N  +  WKK K
Sbjct: 720 AFK-KDSVDGEGDEATDVHKQTIESLKANEKLMDALDLGLTEIEAMERYNSDMALWKKKK 778

Query: 778 KGIQ-PIRPQENTLLVALKKTPEEYIIETLVKIKPSQIEDALMVMPFSYILKFLKFIDVV 836
            G + P++P  N +L+A+KK+PE+YI+ETL +IKPSQ+EDAL+++PFSY+LKFLKFID+V
Sbjct: 779 IGSEMPVKPSGNAVLLAVKKSPEQYIMETLARIKPSQLEDALLILPFSYVLKFLKFIDIV 838

Query: 837 TTKAALLQKHISLVCKTLFFVIRFNYKELVAQKNANLKLQITRVKDNLRKSLKSNVDELG 896
                +L  +++L+CK LFF++R N+KEL++QKN  LKLQITRVK  LR +LK N D LG
Sbjct: 839 LKNKKMLHNYLALICKNLFFIVRTNHKELISQKNEELKLQITRVKQELRNTLKQNEDALG 898

Query: 897 FNIEGMKFIKQQWELNHHLEFNDEYEEKNFEEKHSKKRVFGTLA 940
           FNI+G+KFIKQQW+L H+ EF DEY+++  EEK +KKR+F TL 
Sbjct: 899 FNIQGLKFIKQQWDLKHNFEFVDEYDQRIQEEKKAKKRIFETLV 942

>AGL196C Chr7 complement(328838..331645) [2808 bp, 935 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR129W
           (DIP2)
          Length = 935

 Score = 1268 bits (3282), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 613/940 (65%), Positives = 761/940 (80%), Gaps = 6/940 (0%)

Query: 1   MVKSYQRFEQANVFGVISSNSNSVWIEPEASKRKTGNLGQVIVGGLENILVWDIKTGEQI 60
           MVKSYQRFEQA+VFGV+++NSN VW+  +A        GQVI G LE +  W+IKTGE +
Sbjct: 1   MVKSYQRFEQADVFGVVTANSNCVWLPSQAKNSP----GQVITGALEEVKCWEIKTGELL 56

Query: 61  AQLTDGLPPGASDAKLSKPAETTFLKYHPETNLLAAGYADGVIKIWDLISKTVLISFNGH 120
             + DGLPPGA D K  KPAE T+L+YH ET +LA GYADG IKIWD+ ++TVLI F+ H
Sbjct: 57  KTMRDGLPPGAIDTKAEKPAEATYLQYHEETFILAVGYADGTIKIWDMQTQTVLIVFHSH 116

Query: 121 KSAITVLAFDTTGTRLISASKDSDIIVWDLVGESGLYKLRSHKDAITGLWCEDENWLIST 180
            SAIT+L FD TGTRLIS S+D+ II+WDLV E+GL KLRSHKDAITG+WCE+++WLIS 
Sbjct: 117 SSAITILRFDQTGTRLISGSRDATIILWDLVAETGLCKLRSHKDAITGIWCENDDWLISV 176

Query: 181 SKDGLVKIWDLKSQQCVETHLAHTGECWSLGIIEDMAVTCSADSQVKLWKLDLQAENGSK 240
           SKDGL+K+WD+K  QCVETH+AHTGECWSL + ++M +T +A+S++KLW+LDL+  NGS 
Sbjct: 177 SKDGLIKLWDMKVHQCVETHMAHTGECWSLAVKDNMVITANAESEIKLWELDLERPNGSM 236

Query: 241 LTEKGIIEKQSKQRGVEIDFAVAPDGVKFFYIQNADKTIEIYRLRKEEEISRALKKREKR 300
           L EKG  EKQSKQR  E+ F    DG  FFY  N+DKT+EI+R+R E EI++ALKKREKR
Sbjct: 237 LLEKGSYEKQSKQRCTELSFTTVADGTTFFYSLNSDKTMEIFRIRSETEIAKALKKREKR 296

Query: 301 LQDKGMSEEEIKEAM-GSPVSLMYHLFQVVRSPYKIKSAQWTVCSNSKLELVVTTSNNSI 359
            ++KGMS+EEI+E+   S  +L+ H FQ+VRS +K+K++ WTVC+ SKLELV+TT+NN+I
Sbjct: 297 FKEKGMSDEEIQESFRNSYANLLLHPFQLVRSLFKLKASSWTVCTPSKLELVITTANNTI 356

Query: 360 EYYSIPYSKREPTQPAPLKLHTIDLHGQRTDIRSTSISDDNKLLATASNGSLKIWNIKTK 419
           EYYSIPY K+EP QP  +KLH+I+  G RTD+R+  IS D+KLLATASNG+LK+WNIKTK
Sbjct: 357 EYYSIPYKKKEPLQPTAIKLHSIESPGHRTDLRAADISSDDKLLATASNGNLKVWNIKTK 416

Query: 420 RCIRSFECGYALTCKFLPGGALVVVGTRNGELQLFDIASSTMLDNKEGAHDAAIWSLDLT 479
            CIR+ +CGYAL CKFLPGGALV++GTR G+LQLFD+ASSTML+N E AH AAIWSLDLT
Sbjct: 417 TCIRNLDCGYALCCKFLPGGALVILGTRAGQLQLFDLASSTMLENIEEAHTAAIWSLDLT 476

Query: 480 SDGRKLVTGSADKTVRFWTFEVSEVPVSDESNKTMPMLQLFHDTTLELDDDILSVVISPD 539
           SDG++LVT SADKTV+FW F+V +  V+   +K +P ++L HDTTL+L +D+  V ISP+
Sbjct: 477 SDGKRLVTASADKTVKFWDFKVEQELVAGTLDKFVPKMKLIHDTTLDLGEDLWCVKISPE 536

Query: 540 DKFIAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSMDISYDSKLIVTCSADKNIKIWGL 599
           D+F+AVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSMDIS+DSKLI+T SADKNIKIWGL
Sbjct: 537 DRFLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSMDISHDSKLIITSSADKNIKIWGL 596

Query: 600 DFGDCHKSLFAHQDSIMNVKFLPESYNFFSCSKDATVKYWDGQKFECIQKLAAHQSEVWS 659
           DFGDCHKSLFAHQDSIMNVKFLPES+NFFSCSKD TVKYWDG  F+CIQKL  HQ EVW+
Sbjct: 597 DFGDCHKSLFAHQDSIMNVKFLPESHNFFSCSKDGTVKYWDGNSFDCIQKLYGHQGEVWA 656

Query: 660 ISVSNDGTFVISTGHDHSIRVWEETEDQVFLEEEREKEMDEQYEDTLLTSLEGGAGDEML 719
           ++VS+DG  V+S  HD SIRVWEETEDQVFLEEEREKE++EQYE TLLTSLEGG+GD+  
Sbjct: 657 LAVSSDGQAVVSVSHDRSIRVWEETEDQVFLEEEREKELEEQYEKTLLTSLEGGSGDDAF 716

Query: 720 SVKKGDNEESEEVEGVHKQTVESLKAGERLMEALEIGVNDIIAMEEFNEQLNAWKKSKKG 779
               GD     E   VHKQT+ESLKAGERLMEAL++G+ +I A E++ +Q+  W K K G
Sbjct: 717 ISNNGDETAGVESTEVHKQTIESLKAGERLMEALDLGITEIDAWEKYEQQMKLWNK-KLG 775

Query: 780 IQPIRPQENTLLVALKKTPEEYIIETLVKIKPSQIEDALMVMPFSYILKFLKFIDVVTTK 839
            QP +PQ N +L AL KTPE Y++ETL KIKPSQ+EDAL+V+PFSY+LKFLKFID+    
Sbjct: 776 DQPTKPQTNAILAALDKTPEAYVMETLSKIKPSQLEDALLVLPFSYVLKFLKFIDIAIKN 835

Query: 840 AALLQKHISLVCKTLFFVIRFNYKELVAQKNANLKLQITRVKDNLRKSLKSNVDELGFNI 899
             +L K + L+CK L FV+R N+KELV+QKN  LK+QI RVKD LR +L+S+VD+LGFNI
Sbjct: 836 DVILHKQLPLLCKILIFVVRSNHKELVSQKNEELKMQINRVKDQLRAALRSHVDDLGFNI 895

Query: 900 EGMKFIKQQWELNHHLEFNDEYEEKNFEEKHSKKRVFGTL 939
           +G+KF++  W +NH+ +FNDEY++   E+ HSKKR+F T 
Sbjct: 896 QGLKFVRNHWNVNHNYDFNDEYDQLAKEKVHSKKRLFPTF 935

>KLLA0D16390g Chr4 (1378884..1381694) [2811 bp, 936 aa] {ON} similar
           to uniprot|Q12220 Saccharomyces cerevisiae YLR129W DIP2
           Nucleolar protein specifically associated with the U3
           snoRNA part of the large ribonucleoprotein complex known
           as the small subunit (SSU) processome required for 18S
           rRNA biogenesis part of the active pre- rRNA processing
           complex
          Length = 936

 Score = 1171 bits (3030), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 581/944 (61%), Positives = 746/944 (79%), Gaps = 14/944 (1%)

Query: 1   MVKSYQRFEQANVFGVISSNSNSVWIEPEASKRKTGNLGQVIVGGLENILVWDIKTGEQI 60
           MVKSYQRFEQ+ +FG+IS+++ S+++    S       G++I G LENI +W +KT E +
Sbjct: 1   MVKSYQRFEQSGLFGLISTSNQSIYLPATNSTS-----GKLITGALENIQIWTLKTNE-V 54

Query: 61  AQLTDGLPPGASDAKLSKPAETTFLKYHPETNLLAAGYADGVIKIWDLISKTVLISFNGH 120
             LTDGLP GA +  +SKP+  T + +H ET LL  GY DGVIK+WDL+SK+VL+ FNGH
Sbjct: 55  EVLTDGLPIGAVETNISKPSVVTAMCFHKETELLCVGYEDGVIKVWDLLSKSVLMQFNGH 114

Query: 121 KSAITVLAFDTTGTRLISASKDSDIIVWDLVGESGLYKLRSHKDAITGLWCE-DENWLIS 179
           KS +TVL  D+ GTRL+S SKDSD+I+WDLVGE GL KLRSHKDAITG+W + + +WLIS
Sbjct: 115 KSGVTVLRLDSEGTRLVSGSKDSDLIIWDLVGEVGLMKLRSHKDAITGIWIDHNMDWLIS 174

Query: 180 TSKDGLVKIWDLKSQ-QCVETHLAHTGECWSLGIIEDMAVTCSADSQVKLWKLDLQAENG 238
            +KDGL+K+WDLK+  QCVETH+AHTG+CWS+ I E++ +T S DSQ K+W+LDL+  NG
Sbjct: 175 VAKDGLIKVWDLKAGGQCVETHMAHTGQCWSMAIDEEVIITTSMDSQAKIWELDLEKSNG 234

Query: 239 SKLTEKGIIEKQSKQRGVEIDFAVAPDGVKFFYIQNADKTIEIYRLRKEEEISRALKKRE 298
            K++E+G  E +SKQRGV  +F  AP+G +FFYIQN DKTIEI+R+R EEEI +AL +RE
Sbjct: 235 EKISERGTFETESKQRGVSTEFITAPNGTRFFYIQNNDKTIEIFRIRPEEEIRKALNRRE 294

Query: 299 KRLQDKGMSEEEIKEAMG-SPVSLMYHLFQVVRSPYKIKSAQWTVCSNSKLELVVTTSNN 357
           KRL+DKG SEEEI+EA+  + +S+++H F  VRS YKIKS+ W   SNSKLE+V+TTSNN
Sbjct: 295 KRLRDKGASEEEIQEAVNPNDISVLFHSFSTVRSSYKIKSSNWIQASNSKLEVVLTTSNN 354

Query: 358 SIEYYSIPYSKREPTQPAPLKLHTIDLHGQRTDIRSTSISDDNKLLATASNGSLKIWNIK 417
           +IE Y IPYSKR+  +P P++ + ++L G RTDIRS  ISDD KLL+TASNG LK+WN+ 
Sbjct: 355 TIESYQIPYSKRD-AEP-PVRRYNVELQGHRTDIRSMDISDDGKLLSTASNGELKVWNLT 412

Query: 418 TKRCIRSFECGYALTCKFLPGGALVVVGTRNGELQLFDIASSTMLDNKEGAHDAAIWSLD 477
           TK+CIR+F CGYAL  + LPGG LVVVGTR GELQLFD+ASST+L   E AH AAIWSLD
Sbjct: 413 TKKCIRTFSCGYALCSQMLPGGLLVVVGTRQGELQLFDLASSTLLSTTE-AHTAAIWSLD 471

Query: 478 LTSDGRKLVTGSADKTVRFWTFEVSEVPVSDESNKTMPMLQLFHDTTLELDDDILSVVIS 537
           LTS+G++LVTGSADK+ +FW FEV E  V    +K +P L+L HDTTLEL DDIL+V IS
Sbjct: 472 LTSNGKRLVTGSADKSCKFWDFEVVEQLVPGTKDKYIPQLKLVHDTTLELTDDILAVKIS 531

Query: 538 PDDKFIAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSMDISYDSKLIVTCSADKNIKIW 597
            +D+++AVSLLDNTVKVFF DS+KF+LSLYGHKLPVLS+D S DSK+++T SADKNIKIW
Sbjct: 532 SEDRYLAVSLLDNTVKVFFFDSLKFYLSLYGHKLPVLSIDFSVDSKMLITSSADKNIKIW 591

Query: 598 GLDFGDCHKSLFAHQDSIMNVKFLPESYNFFSCSKDATVKYWDGQKFECIQKLAAHQSEV 657
           G+DFGDCHKS+FAHQDSIM+V+F  +++NFFSC KD  VK WDG KF+CIQKL  HQSEV
Sbjct: 592 GVDFGDCHKSIFAHQDSIMSVRFEADTHNFFSCGKDGAVKRWDGDKFDCIQKLNGHQSEV 651

Query: 658 WSISVSNDGTFVISTGHDHSIRVWEETEDQVFLEEEREKEMDEQYEDTLLTSLEGGAGDE 717
           W I+VS DG  V+ST HDHSIRVW+ET+DQVFLEEE+E+EM+E+YE+TLL SLEGG+GD+
Sbjct: 652 WCIAVSPDGRTVVSTSHDHSIRVWQETDDQVFLEEEKEREMEEEYEETLLKSLEGGSGDD 711

Query: 718 MLSVKK--GDNEESEEVEGVHKQTVESLKAGERLMEALEIGVNDIIAMEEFNEQLNAWKK 775
                K  GD+   +EV GV+KQT+ESLKAGE+LMEAL++GV +I + E + + L +WKK
Sbjct: 712 QFLRDKNSGDDGVIDEVSGVNKQTLESLKAGEKLMEALDLGVAEIESWENYEKSLKSWKK 771

Query: 776 SKKGIQPIRPQENTLLVALKKTPEEYIIETLVKIKPSQIEDALMVMPFSYILKFLKFIDV 835
            K G  P++PQ N +L+A+K  PE+YI++TL KIKPSQ+ED+L+V+PFSY++KF KF DV
Sbjct: 772 KKSGEPPMKPQSNAILIAMKIKPEKYIMDTLGKIKPSQLEDSLLVLPFSYVIKFFKFFDV 831

Query: 836 VTTKAALLQKHISLVCKTLFFVIRFNYKELVAQKNANLKLQITRVKDNLRKSLKSNVDEL 895
           +  +  L+  H+SL+CK LFF++R N KELVAQKN  LK +I RVK N+R  L+ N D+L
Sbjct: 832 IMKQKDLVLLHLSLICKILFFIVRTNNKELVAQKNEELKQRIERVKTNIRTMLQKNADDL 891

Query: 896 GFNIEGMKFIKQQWELNHHLEFNDEYEEKNFEEKHSKKRVFGTL 939
           GFNI G+ FIKQQW L H+LEF D+Y +   E+K +KKRVF T+
Sbjct: 892 GFNIAGLNFIKQQWNLRHNLEFTDDYSQLEHEKKVAKKRVFETV 935

>Skud_12.285 Chr12 complement(525831..528284) [2454 bp, 817 aa] {ON}
           YLR222C (REAL)
          Length = 817

 Score =  137 bits (345), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 143/644 (22%), Positives = 270/644 (41%), Gaps = 101/644 (15%)

Query: 81  ETTFLKYHPETNLLAAGYADGVIKIWDLISKTVLISFNGHKSAITVLAFDTTGTRLISAS 140
           E T L+  P+   LA      ++KI+ L +  ++ S     S   +L  D T T L    
Sbjct: 63  EITALRLTPDGQYLAYVSQAQLLKIFQLKTGRIVRSLK-ISSPSYILDTDPTSTLLAVGG 121

Query: 141 KDSDIIVWDLVGESGLYKLRSHKDAITGL----WCEDENWLISTS-KDGLVKIWDLKSQQ 195
            D  I++ D+      + L+ H   I+ L      + E WL+++   +G+VK+WDL  ++
Sbjct: 122 TDGSIVIVDIENGYITHSLKGHGGTISSLKFYGQLDSETWLLASGDTNGMVKVWDLVKRK 181

Query: 196 CVETHLAHTGECWSLGIIEDMA--------VTCSADSQVKLWKLDLQAENGSKLTEKGII 247
           C+ T   H+     L IIE  +        ++   D  V +W  D++ +   KL +   +
Sbjct: 182 CLLTLQEHSSAVRGLDIIEGESGDGSSLKLLSGGRDDIVNVWDFDMKKK--CKLVKTLPV 239

Query: 248 EKQSKQRGVEIDFAVAPDGVKFFYIQNADKTIEIYRLRKEEEISRALKKREKRLQD---- 303
            +Q +  G    F    DG +  Y    D   ++  L    E    LK+  K +++    
Sbjct: 240 NQQVESCG----FLKNHDGKRIIYTAGGDAIFQLIDL----ESGTVLKRTNKPIEELFII 291

Query: 304 ---KGMSEEEIKEAMGSPVSLMYHLFQVVRSPYKIKSAQWTVCSNSKL------------ 348
                M++ E+   M      + ++ +V+ +     +A+ T+  N+ +            
Sbjct: 292 GVLPIMNDSEMFLVMSDQTLQLINIEEVLENENDTINARSTIAGNNGIIADMRFVGPELN 351

Query: 349 ELVVTTSNNSIEYYSIP-YSKREPTQPAPLKLHTIDLHGQRTDIRSTSISDDNKLLATAS 407
           +L + T++ S+    IP  S  + + P  ++++     G    + S   ++D   +ATAS
Sbjct: 352 KLALATNSPSLRIIPIPDLSGADASLPLDVEIY----EGHEDLLNSLDATEDGLWIATAS 407

Query: 408 NGSLKI---WNIKTKRCIRSFECGYALTCKFLPGGALVVVGTRNGELQLFDIASSTMLDN 464
             +  I   +N +T +                                 FDI +  +   
Sbjct: 408 KDNTAILWKYNERTSK---------------------------------FDIYAKYI--- 431

Query: 465 KEGAHDAAIWSLDLTSDGRK-----LVTGSADKTVRFWTFEVSEVPVSDESNKTMPMLQL 519
               H +A+ ++ L +   K     L+T S D T++ W     +VP    S   + ++++
Sbjct: 432 ---GHSSAVTAVGLPNVMPKGYPEFLLTASNDLTIKKW-----KVP-KPTSIMDVQIIKV 482

Query: 520 FHDTTLELDDDILSVVISPDDKFIAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSMDIS 579
              T    + DI ++ +SP+D   A +  D T K++ L++ +   +L  HK  +  +   
Sbjct: 483 SEYTRHAHEKDINALSVSPNDSIFATASYDKTCKIWSLENGELEATLANHKRGLWDVSFC 542

Query: 580 YDSKLIVTCSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLPESYNFFSCSKDATVKYW 639
              KL+ T S DK +KIW LD     K+L  H +++    F+ +     SC  D  +K W
Sbjct: 543 QYDKLLATSSGDKTVKIWSLDTFSVMKTLEGHSNAVQRCSFINKQKQLVSCGADGLIKIW 602

Query: 640 DGQKFECIQKLAAHQSEVWSISVSNDGTFVISTGHDHSIRVWEE 683
           D    EC+  L  H + +W+++  NDG  ++S   D   + W++
Sbjct: 603 DCSSGECLNTLDGHNNRLWALNTMNDGDMIVSADADGVFQFWKD 646

 Score = 57.4 bits (137), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 50/191 (26%), Positives = 88/191 (46%), Gaps = 14/191 (7%)

Query: 505 PVSDESN---KTMPMLQLFHDTTLELDDDILSVVISPDDKFIAVSLLDNTVKVFFLDSMK 561
           P+ DE N    T+   ++ H  + E + +I ++ ++PD +++A       +K+F L + +
Sbjct: 35  PILDEINIIDLTLGCRKILHKISNEDEQEITALRLTPDGQYLAYVSQAQLLKIFQLKTGR 94

Query: 562 FFLSLYGHKLPVLSMDISYDSKLIVTCSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFL 621
              SL     P   +D    S L+     D +I I  ++ G    SL  H  +I ++KF 
Sbjct: 95  IVRSLKISS-PSYILDTDPTSTLLAVGGTDGSIVIVDIENGYITHSLKGHGGTISSLKFY 153

Query: 622 ----PESYNFFSCSKDATVKYWDGQKFECIQKLAAHQSEVWSISV----SNDGTF--VIS 671
                E++   S   +  VK WD  K +C+  L  H S V  + +    S DG+   ++S
Sbjct: 154 GQLDSETWLLASGDTNGMVKVWDLVKRKCLLTLQEHSSAVRGLDIIEGESGDGSSLKLLS 213

Query: 672 TGHDHSIRVWE 682
            G D  + VW+
Sbjct: 214 GGRDDIVNVWD 224

>Suva_10.316 Chr10 complement(551612..554068) [2457 bp, 818 aa] {ON}
           YLR222C (REAL)
          Length = 818

 Score =  135 bits (339), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 144/640 (22%), Positives = 266/640 (41%), Gaps = 92/640 (14%)

Query: 81  ETTFLKYHPETNLLAAGYADGVIKIWDLISKTVLISFNGHKSAITVLAFDTTGTRLISAS 140
           E T L+  P+   L       ++KI+ L +  V+ S     S   +L  D+T T L    
Sbjct: 63  EITALQLTPDGQYLTYVSQAQLLKIFQLKTGKVVRSMK-ISSPSYILDTDSTSTLLAVGG 121

Query: 141 KDSDIIVWDLVGESGLYKLRSHKDAITGL----WCEDENWLISTS-KDGLVKIWDLKSQQ 195
            D  IIV D+      + L+ H   I+ L      + + WL+++   +G+VK+WDL  ++
Sbjct: 122 TDGSIIVVDIENGYITHSLKGHGGTISSLKFYGQLDSKVWLLASGDTNGMVKVWDLVKRK 181

Query: 196 CVETHLAHTGECWSLGIIED---------MAVTCSADSQVKLWKLDLQAENGSKLTEKGI 246
           C+ T   HT     L I E            ++   D  V  W  D++ +   KL +   
Sbjct: 182 CLHTLQEHTSAVRGLDITEVENNDGPSHLKLISGGRDDIVNFWDFDMKKK--CKLIKTLP 239

Query: 247 IEKQSKQRGVEIDFAVAPDGVKFFYIQNADKTIEIYRLRKEEEISRALKKREKRLQDKG- 305
           + +Q +  G    F    DG    Y    D   ++  L     + R  K  E+ L   G 
Sbjct: 240 VNQQVESCG----FLNTRDGKHIIYTAGGDAIFQLIDLESGSMLKRTNKPIEE-LYIIGV 294

Query: 306 ---MSEEEIKEAMGSPVSLMYHLFQVVRSPYKIKSAQWTVCSNSKL------------EL 350
              MS+ ++   M      + ++ + + S  +I  A+ ++  N  +            +L
Sbjct: 295 LPIMSDSKMFLVMSDQTLQLINIEEALESKEEIIQAESSIAGNHGIIADMRFVGPELNKL 354

Query: 351 VVTTSNNSIEYYSIP-YSKREPTQPAPLKLHTIDLHGQRTDIRSTSISDDNKLLATAS-N 408
            + T++ ++    IP  +  E + P  ++++     G    + S   ++D   +ATAS +
Sbjct: 355 ALATNSPALRIIPIPDLTSTESSLPLDVEIY----EGHEDLLNSLDATEDGLWIATASKD 410

Query: 409 GSLKIWNIKTKRCIRSFECGYALTCKFLPGGALVVVGTRNGELQLFDIASSTMLDNKEGA 468
            S  +W                                 N +   FDI +      K   
Sbjct: 411 NSAIVWK-------------------------------YNNDTSKFDIYA------KYIG 433

Query: 469 HDAAIWSLDLTSDGRK-----LVTGSADKTVRFWTFEVSEVPVSDESNKTMPMLQLFHDT 523
           H +A+ ++ L +   K     L+T S D T++ W     ++P    +N  + ++++   T
Sbjct: 434 HSSAVTAVGLPNVMPKGYPEFLLTASNDLTIKKW-----KIPKPTSTND-VQIIKVSEYT 487

Query: 524 TLELDDDILSVVISPDDKFIAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSMDISYDSK 583
               + DI ++ +SP+D   A +  D T K++ L++ +   +L  HK  +  +      K
Sbjct: 488 RHAHEKDINALSVSPNDSIFATASYDKTCKIWNLENGELEATLANHKRGLWDVSFCQYDK 547

Query: 584 LIVTCSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLPESYNFFSCSKDATVKYWDGQK 643
           L+ TCS DK +KIW L+     K+L  H +++    F+ +     SC  D  +K WD   
Sbjct: 548 LLATCSGDKTVKIWSLETFSVMKTLEGHTNAVQRCSFINKQKQLVSCGADGLIKIWDCYS 607

Query: 644 FECIQKLAAHQSEVWSISVSNDGTFVISTGHDHSIRVWEE 683
            EC++ L  H + +W+++  NDG  ++S   D   + W++
Sbjct: 608 GECLKTLDGHNNRLWALNTMNDGDTIVSADADGIFQFWKD 647

 Score = 67.0 bits (162), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 46/175 (26%), Positives = 76/175 (43%), Gaps = 12/175 (6%)

Query: 68  PPGASDAKLSKPAETT---------FLKYHPETNLLAAGYADGVIKIWDLISKTVLISFN 118
           P   +D ++ K +E T          L   P  ++ A    D   KIW+L +  +  +  
Sbjct: 472 PTSTNDVQIIKVSEYTRHAHEKDINALSVSPNDSIFATASYDKTCKIWNLENGELEATLA 531

Query: 119 GHKSAITVLAFDTTGTRLISASKDSDIIVWDLVGESGLYKLRSHKDAITGL-WCEDENWL 177
            HK  +  ++F      L + S D  + +W L   S +  L  H +A+    +   +  L
Sbjct: 532 NHKRGLWDVSFCQYDKLLATCSGDKTVKIWSLETFSVMKTLEGHTNAVQRCSFINKQKQL 591

Query: 178 ISTSKDGLVKIWDLKSQQCVETHLAHTGECWSLGIIE--DMAVTCSADSQVKLWK 230
           +S   DGL+KIWD  S +C++T   H    W+L  +   D  V+  AD   + WK
Sbjct: 592 VSCGADGLIKIWDCYSGECLKTLDGHNNRLWALNTMNDGDTIVSADADGIFQFWK 646

 Score = 50.1 bits (118), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 47/192 (24%), Positives = 84/192 (43%), Gaps = 15/192 (7%)

Query: 505 PVSDESN---KTMPMLQLFHDTTLELDDDILSVVISPDDKFIAVSLLDNTVKVFFLDSMK 561
           P+ DE N    T    ++ H  + E + +I ++ ++PD +++        +K+F L + K
Sbjct: 35  PILDEINIIDLTADSRKILHKISNEDEQEITALQLTPDGQYLTYVSQAQLLKIFQLKTGK 94

Query: 562 FFLSLYGHKLPVLSMDISYDSKLIVTCSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFL 621
              S+     P   +D    S L+     D +I +  ++ G    SL  H  +I ++KF 
Sbjct: 95  VVRSMKISS-PSYILDTDSTSTLLAVGGTDGSIIVVDIENGYITHSLKGHGGTISSLKFY 153

Query: 622 PE----SYNFFSCSKDATVKYWDGQKFECIQKLAAHQSEVWSISVS----NDGTF---VI 670
            +     +   S   +  VK WD  K +C+  L  H S V  + ++    NDG     +I
Sbjct: 154 GQLDSKVWLLASGDTNGMVKVWDLVKRKCLHTLQEHTSAVRGLDITEVENNDGPSHLKLI 213

Query: 671 STGHDHSIRVWE 682
           S G D  +  W+
Sbjct: 214 SGGRDDIVNFWD 225

>NDAI0E03440 Chr5 complement(735469..738042) [2574 bp, 857 aa] {ON}
           Anc_8.435
          Length = 857

 Score =  134 bits (337), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 156/657 (23%), Positives = 266/657 (40%), Gaps = 117/657 (17%)

Query: 75  KLSKPAETTFLKYHPETNLLAAGYADGVIKIWDLISKTVLISFNGHKSAITVLAF----D 130
           KLS P+    +     + L+A G  DG I + D+ +  +  SF GH   I+ + F    D
Sbjct: 116 KLSSPSY--IMDCDSTSTLVAVGGTDGSIIVVDIENGFITHSFKGHGGTISSVKFYGNND 173

Query: 131 TTGTRLISASKDSDIIVWDLVGESGLYKLRSHKDAITGLWC-----EDEN---WLISTSK 182
           T    L S   +  + +WDLV  S ++ L+ H  A+ GL       E++N    L+S S+
Sbjct: 174 TNCWLLCSGDTNGMVKIWDLVKRSCIHTLQEHNSAVRGLDVRSVSKENDNVVLQLLSGSR 233

Query: 183 DGLVKIWDLKSQQCVE--THLAHTGECWSLGIIEDMAVTCSADSQVKLWKLDLQAENGSK 240
           D +V +W+   ++  +    L    +  S G I D       D++++    D+    G  
Sbjct: 234 DNIVNLWEFNLRKLCKLLKTLPVNQQVESCGFIHDH------DNELQ----DIIYTAGG- 282

Query: 241 LTEKGIIEKQSKQRGVEIDFAVAPDGVKFF---------------YIQNADKTIEIYRLR 285
              + I +  S  +G  I   V P    F                YI  +D+T+++  L 
Sbjct: 283 ---EAIFQLISLSKGSVIKRTVKPTEELFIIGTLPFTATNNDLNSYIVMSDQTLQMINLT 339

Query: 286 KEEEISRALKKREKRLQDKGMSEEEIKEAMGSPVSLMYHLFQVVRSPYKIKSAQWTVCSN 345
           K      AL   E  L +  +  E         ++ M  + Q +                
Sbjct: 340 K------ALSPTE--LSNPIIEIESCIAGNHGTIADMKFVGQDLN--------------- 376

Query: 346 SKLELVVTTSNNSIEYYSIPYSKREPTQP--------APLKLHTIDLHGQRTD-IRSTSI 396
              +L + T++ ++    +P + +E   P         P+ + T + H   TD + S + 
Sbjct: 377 ---KLALATNSPTLRIIPVPSTMKEAADPNTQDNSADLPINMETYEGH---TDLLNSLAA 430

Query: 397 SDDNKLLATASNGSLKIWNIKTKRCIRSFECGYALTCKFLP-GGALVVVGTRNGELQLFD 455
           ++D + LATAS     I    +    R F   YA   KF+    ++  VG  N  L+ + 
Sbjct: 431 TEDGQWLATASKDHTSILWKYSSETSRFF--AYA---KFIGHSSSVTAVGLPNVLLRGYP 485

Query: 456 IASSTMLDNKEGAHDAAIWSLDLTSDGRKLVTGSADKTVRFWTFEV-SEVPVSDESNKTM 514
                                        L+T S D T++ W     S+    DES    
Sbjct: 486 ---------------------------EFLITASNDLTIKKWKIPTPSKERSDDESKDKT 518

Query: 515 PMLQLFHDTTLELDDDILSVVISPDDKFIAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVL 574
            ++++   T    D DI S+ ISP+D  IA    D + K++ LDS +   +L  HK  + 
Sbjct: 519 HIIKVSEYTRHAHDKDINSISISPNDSLIATGSYDKSCKLWNLDSGELVATLNNHKRGIW 578

Query: 575 SMDISYDSKLIVTCSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLPESYNFFSCSKDA 634
            +      KLI TCS DK IK+W LD     K+   H +++    F+ +     S   D 
Sbjct: 579 DVSFCQFDKLIATCSGDKTIKLWSLDTFAVLKTFAGHTNAVQRCTFINKQKQLVSSGADG 638

Query: 635 TVKYWDGQKFECIQKLAAHQSEVWSISVSNDGTFVISTGHDHSIRVWEETEDQVFLE 691
            +K WD    +C++ L  H + +W+++  NDG  ++S   D  ++ W +  +   L+
Sbjct: 639 LIKIWDCTTGDCLKTLDGHDNRIWALTTWNDGELIVSADADGVLQFWNDCTELEILQ 695

 Score = 54.3 bits (129), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 46/171 (26%), Positives = 76/171 (44%), Gaps = 22/171 (12%)

Query: 22  NSVWIEPEASKRKTGNLGQVIVGGLENILVWDIKTGEQIAQLTDGLPPGASDAKLSKPAE 81
           NS+ I P  S   TG+  +       +  +W++ +GE +A L +    G  D        
Sbjct: 536 NSISISPNDSLIATGSYDK-------SCKLWNLDSGELVATLNNH-KRGIWDV------- 580

Query: 82  TTFLKYHPETNLLAAGYADGVIKIWDLISKTVLISFNGHKSAITVLAFDTTGTRLISASK 141
            +F ++     L+A    D  IK+W L +  VL +F GH +A+    F     +L+S+  
Sbjct: 581 -SFCQFD---KLIATCSGDKTIKLWSLDTFAVLKTFAGHTNAVQRCTFINKQKQLVSSGA 636

Query: 142 DSDIIVWDLVGESGLYKLRSHKDAITGL--WCEDENWLISTSKDGLVKIWD 190
           D  I +WD      L  L  H + I  L  W  D   ++S   DG+++ W+
Sbjct: 637 DGLIKIWDCTTGDCLKTLDGHDNRIWALTTW-NDGELIVSADADGVLQFWN 686

 Score = 47.8 bits (112), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 52/204 (25%), Positives = 88/204 (43%), Gaps = 26/204 (12%)

Query: 505 PVSD--ESNKTMPMLQLFHDTTLELDDDILSVVISPDDKF-IAVSLLDNTVKVFFLDSMK 561
           PV D  E  K  P+ +     T   + +I  + ++PD KF I+++L    +K++ L +++
Sbjct: 38  PVLDDIEIIKLSPLQERLTTITNNDEQEITCLKLTPDGKFLISIALQSQALKIYNLTAIE 97

Query: 562 FFLSLYGHKL------------PVLSMDISYDSKLIVTCSADKNIKIWGLDFGDCHKSLF 609
              ++   +             P   MD    S L+     D +I +  ++ G    S  
Sbjct: 98  GETTMNTKQQSLQPIKTLKLSSPSYIMDCDSTSTLVAVGGTDGSIIVVDIENGFITHSFK 157

Query: 610 AHQDSIMNVKFLP--ESYNFFSCSKDAT--VKYWDGQKFECIQKLAAHQS-----EVWSI 660
            H  +I +VKF    ++  +  CS D    VK WD  K  CI  L  H S     +V S+
Sbjct: 158 GHGGTISSVKFYGNNDTNCWLLCSGDTNGMVKIWDLVKRSCIHTLQEHNSAVRGLDVRSV 217

Query: 661 SVSNDGTF--VISTGHDHSIRVWE 682
           S  ND     ++S   D+ + +WE
Sbjct: 218 SKENDNVVLQLLSGSRDNIVNLWE 241

>Smik_12.279 Chr12 complement(526367..528820) [2454 bp, 817 aa] {ON}
           YLR222C (REAL)
          Length = 817

 Score =  130 bits (328), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 144/641 (22%), Positives = 256/641 (39%), Gaps = 95/641 (14%)

Query: 81  ETTFLKYHPETNLLAAGYADGVIKIWDLISKTVLISFNGHKSAITVLAFDTTGTRLISAS 140
           E T LK  P+   L       ++KI+ L +  V+ S     S   +L  D+T T L    
Sbjct: 63  EITALKLTPDGQYLTYVSQAQLLKIFHLKTGKVVRSMK-ISSPSYILDADSTSTLLAVGG 121

Query: 141 KDSDIIVWDLVGESGLYKLRSHKDAITGL----WCEDENWLISTS-KDGLVKIWDLKSQQ 195
            D  IIV D+      +  + H   I+ L      + + WL+++   +G+VK+WDL  ++
Sbjct: 122 TDGSIIVVDIENGYITHSFKGHGGTISSLKFYGQLDSKIWLLASGDTNGMVKVWDLVKRK 181

Query: 196 CVETHLAHTGECWSLGIIEDM--------AVTCSADSQVKLWKLDLQAENGSKLTEKGII 247
           C+ T   H+     L I+E           ++   D  + +W  D   +   KL +   +
Sbjct: 182 CLHTLQEHSSAVRGLDIVEVQNSDEPFLKLLSGGRDDIINIW--DFNMKKTCKLIKTLPV 239

Query: 248 EKQSKQRGVEIDFAVAPDGVKFFYIQNADKTIEIYRLRKEEEISRALKKREKRLQD---- 303
            +Q +  G    F    D     Y    D   ++  L    E    +KK  K +++    
Sbjct: 240 NQQVESCG----FLRYHDDKHLIYTAGGDAIFQLIDL----ESGIMIKKTNKPIEELFII 291

Query: 304 ---KGMSEEEIKEAMGSPVSLMYHLFQVVRSPYKIKSAQWTVCSNSKL------------ 348
                +S  ++   M      + ++ +V++S  +I     T+  N  +            
Sbjct: 292 GVLPIVSSSKMFLVMSDQTLQLINVEEVIKSENEIIEVSSTIAGNHGIIADMRFVGPELN 351

Query: 349 ELVVTTSNNSIEYYSIPYSKREPTQPAPLKLHTIDLHGQRTDIRSTSISDDNKLLATAS- 407
           +L + T++ S+    IP      T   PL +   +  G    + S   ++D   +ATAS 
Sbjct: 352 KLALATNSPSLRIIPIP-DLAGTTASLPLDVEIYE--GHEDLLNSLDATEDGLWIATASK 408

Query: 408 NGSLKIWNIKTKRCIRSFECGYALTCKFLPGGALVVVGTRNGELQLFDIASSTMLDNKEG 467
           + S  +W  K     R FE    +  K++                               
Sbjct: 409 DNSAIVW--KYNENTRKFE----VYSKYI------------------------------- 431

Query: 468 AHDAAIWSLDLTSDGRK-----LVTGSADKTVRFWTFEVSEVPVSDESNKTMPMLQLFHD 522
            H +A+ ++ L     K     L+T S D T++ W       P   ++ K     +  H+
Sbjct: 432 GHSSAVTAVGLPKIMPKGYPEFLLTASNDLTIKKWKIPKPTFPFDVQTIKVSEYTRHAHE 491

Query: 523 TTLELDDDILSVVISPDDKFIAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSMDISYDS 582
                  DI ++ ISP+D   A +  D T K++ L++ +   +L  HK  +  +      
Sbjct: 492 K------DINALSISPNDSIFATASYDKTCKIWNLENGELEATLSNHKRGLWDVTFCQYD 545

Query: 583 KLIVTCSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLPESYNFFSCSKDATVKYWDGQ 642
           KL+ TCS DK +KIW LD     K+L  H +++    F+ +     SC  D  +K WD  
Sbjct: 546 KLLATCSGDKTVKIWSLDTFSVMKTLEGHTNAVQRCSFINKQKQLVSCGADGLIKIWDCS 605

Query: 643 KFECIQKLAAHQSEVWSISVSNDGTFVISTGHDHSIRVWEE 683
             EC++ L  H + +W+++  NDG  ++S   D   + W++
Sbjct: 606 SGECLKTLDGHNNRLWALNTMNDGDIIVSADADGVFQFWKD 646

 Score = 45.8 bits (107), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 45/191 (23%), Positives = 83/191 (43%), Gaps = 14/191 (7%)

Query: 505 PVSDESN---KTMPMLQLFHDTTLELDDDILSVVISPDDKFIAVSLLDNTVKVFFLDSMK 561
           P+ DE N    T     + H  + E + +I ++ ++PD +++        +K+F L + K
Sbjct: 35  PMLDEINIIDLTPGSRNIIHRISNEDEQEITALKLTPDGQYLTYVSQAQLLKIFHLKTGK 94

Query: 562 FFLSLYGHKLPVLSMDISYDSKLIVTCSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFL 621
              S+     P   +D    S L+     D +I +  ++ G    S   H  +I ++KF 
Sbjct: 95  VVRSMKISS-PSYILDADSTSTLLAVGGTDGSIIVVDIENGYITHSFKGHGGTISSLKFY 153

Query: 622 PE----SYNFFSCSKDATVKYWDGQKFECIQKLAAHQSEVWSISV----SNDGTF--VIS 671
            +     +   S   +  VK WD  K +C+  L  H S V  + +    ++D  F  ++S
Sbjct: 154 GQLDSKIWLLASGDTNGMVKVWDLVKRKCLHTLQEHSSAVRGLDIVEVQNSDEPFLKLLS 213

Query: 672 TGHDHSIRVWE 682
            G D  I +W+
Sbjct: 214 GGRDDIINIWD 224

>CAGL0C00737g Chr3 complement(75028..77478) [2451 bp, 816 aa] {ON}
           similar to uniprot|Q05946 Saccharomyces cerevisiae
           YLR222c
          Length = 816

 Score =  130 bits (326), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 159/651 (24%), Positives = 274/651 (42%), Gaps = 104/651 (15%)

Query: 75  KLSKPAETTFLKYHPETNLLAAGYADGVIKIWDLISKTVLISFNGHKSAITVLAF-DTTG 133
           K+S P+    +   P + L+A G  DG I + D+ +  +  SF GH   I+ L F    G
Sbjct: 101 KVSSPSYV--MTCDPTSTLVAIGGTDGSITVIDIENGYIAHSFKGHGGTISSLKFYGELG 158

Query: 134 TRL-ISASKDSDII--VWDLVGESGLYKLRSHKDAITGL-WCEDENW----LISTSKDGL 185
           T + +  S D++ +  VWDLV     + ++ H  AI G+ + ++++     LI+  +D +
Sbjct: 159 TNIWLLGSGDTNGMAKVWDLVTRKCKFTVQEHSSAIRGIDFTKNDDKDVLNLITGGRDNV 218

Query: 186 VKIWDL----KSQQCVETHLAHTGECWSLGII----EDMAVTCSADSQVKLWKLDLQAEN 237
           + +W      KS + V+T  AH  +  + G I    E  A T   D+  ++  +DL   +
Sbjct: 219 LNLWRFNIKGKSSKLVKTIPAHL-QIEACGFITHNDETFAYTAGGDAVFQI--IDLNESS 275

Query: 238 GSKLTEKGIIEKQSKQRGVEIDFAVAPDGVKFFYIQNADKTIEIYRLRKEEEISRALKKR 297
             K T+K I E       + I   +  +    FY   +D+TI++  L+   EI      +
Sbjct: 276 VVKCTKKPIEE-------LFITGVIPINQGNQFYAVLSDQTIQL--LQPNSEI---FSSK 323

Query: 298 EKRLQDKGMSEEEIKEAMGSPVSLMYHLFQVVRSPYKIKSAQWTVCSNSKLELVVTTSNN 357
            + +Q     +E I    G+   L                     C  +K +  +  + N
Sbjct: 324 SEFIQ----IQEYIAGNHGTVADL---------------------CLVTKNKDCIALATN 358

Query: 358 SIEYYSIPYSKREP-TQPAPLKLHTIDLHGQRTDIRSTSISDDNKLLATASNGSLKI--- 413
           S     IP  K +  TQ   L +      G    + S + ++D + LATAS     I   
Sbjct: 359 SPSLRIIPLPKIDADTQDTDLPIEVNLYEGHSDLLNSLACTEDGQWLATASKDKTAILWH 418

Query: 414 WNIKTKRCIRSFECGYALTCKFLPGGALVVVGTRNGELQLFDIASSTMLDNKEGAHDAAI 473
           WN  +KR        + +   F+   A V               S+  L N    +    
Sbjct: 419 WNNTSKR--------FYIYATFVGHAASV---------------SAVCLPNVMEKNYP-- 453

Query: 474 WSLDLTSDGRKLVTGSADKTVRFWTFEVSEVPVSDESNKTMPMLQLFHDTTLELDDDILS 533
                    + ++T S D TV+ W       P+ ++ N+   +++    T    + DI +
Sbjct: 454 ---------KYIITASNDLTVKKWEIP----PMKNDLNEVPFIVKSSIYTRHAHEKDINA 500

Query: 534 VVISPDDKFIAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSMDISYDSKLIVTCSADKN 593
           + ++P+D   A +  D T K++ +D+ +   +L  HK  +  +      K I TCS DK 
Sbjct: 501 ISMAPNDSIFATASYDKTCKLWNVDTGEPVATLANHKRGLWDVSFCESEKWIATCSGDKT 560

Query: 594 IKIWGLDFGDCHKSLFAHQDSIMNVKFLPESYNFFSCSKDATVKYWDGQKFECIQKLAAH 653
           +KIW L+     K+L  H +++    F+ +     S   D  +K WD    +CI+ L  H
Sbjct: 561 VKIWSLESFTVLKTLEGHTNAVQRCSFMNKQKQLVSAGADGLIKVWDIASGDCIKNLDGH 620

Query: 654 QSEVWSISVSNDGTFVISTGHDHSIRVWE---ETEDQVFLEEEREKEMDEQ 701
            + +W++SV  DG  +IS   D   + W+   E E Q  LEE + +   EQ
Sbjct: 621 SNRIWALSVLEDGDLIISADADSVFQFWKDCTEAEIQGALEENKVRVEQEQ 671

 Score = 55.1 bits (131), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 42/152 (27%), Positives = 66/152 (43%), Gaps = 17/152 (11%)

Query: 51  VWDIKTGEQIAQLTDGLPPGASDAKLSKPAETTFLKYHPETNLLAAGYADGVIKIWDLIS 110
           +W++ TGE +A L +    G  D    +  +            +A    D  +KIW L S
Sbjct: 521 LWNVDTGEPVATLANH-KRGLWDVSFCESEK-----------WIATCSGDKTVKIWSLES 568

Query: 111 KTVLISFNGHKSAITVLAFDTTGTRLISASKDSDIIVWDLVGESGLYKLRSHKDAITGLW 170
            TVL +  GH +A+   +F     +L+SA  D  I VWD+     +  L  H + I  L 
Sbjct: 569 FTVLKTLEGHTNAVQRCSFMNKQKQLVSAGADGLIKVWDIASGDCIKNLDGHSNRIWALS 628

Query: 171 C-EDENWLISTSKDGLVKIWDLKSQQCVETHL 201
             ED + +IS   D + + W    + C E  +
Sbjct: 629 VLEDGDLIISADADSVFQFW----KDCTEAEI 656

 Score = 38.5 bits (88), Expect = 0.095,   Method: Compositional matrix adjust.
 Identities = 43/188 (22%), Positives = 76/188 (40%), Gaps = 11/188 (5%)

Query: 505 PVSDESN--KTMPMLQLFHDTTLELDDDILSVVISPDDKFIAVSLLDNTVKVFFLDSMKF 562
           PV DE N  + +P  +L H      + +I  + ++PD K++        VK+  +++   
Sbjct: 37  PVLDEINIIQLIPNRKLLHSIDNADEQEITGISLTPDGKYLIYVSQSQLVKIVNVETGVI 96

Query: 563 FLSLYGHKLPVLSMDISYDSKLIVTCSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLP 622
             SL     P   M     S L+     D +I +  ++ G    S   H  +I ++KF  
Sbjct: 97  TRSLKVSS-PSYVMTCDPTSTLVAIGGTDGSITVIDIENGYIAHSFKGHGGTISSLKFYG 155

Query: 623 E-SYNFF---SCSKDATVKYWDGQKFECIQKLAAHQSEVWSISVS----NDGTFVISTGH 674
           E   N +   S   +   K WD    +C   +  H S +  I  +     D   +I+ G 
Sbjct: 156 ELGTNIWLLGSGDTNGMAKVWDLVTRKCKFTVQEHSSAIRGIDFTKNDDKDVLNLITGGR 215

Query: 675 DHSIRVWE 682
           D+ + +W 
Sbjct: 216 DNVLNLWR 223

>TDEL0B02010 Chr2 complement(355418..357835) [2418 bp, 805 aa] {ON}
           Anc_8.435 YLR222C
          Length = 805

 Score =  128 bits (322), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 151/645 (23%), Positives = 273/645 (42%), Gaps = 113/645 (17%)

Query: 75  KLSKPAETTFLKYHPETNLLAAGYADGVIKIWDLISKTVLISFNGHKSAITVLAF--DTT 132
           K+S P+    +     + L+A G  DG I + D+ +  +  SF GH   I+ L F  +  
Sbjct: 99  KISSPSYV--MDSDSTSTLIAIGGTDGSISVVDVENGYITHSFKGHGGTISSLKFHGELN 156

Query: 133 GTRLISASKDSDII--VWDLVGESGLYKLRSHKDAITGL-----WCEDENWLISTSKDGL 185
           G + + AS D++ +  VWDLV    L+ ++ H  AI GL       ED   L+S  +D +
Sbjct: 157 GDKWLLASGDTNGVAKVWDLVKRRCLHTMQEHTSAIRGLDFKEVEGEDCVKLLSGGRDDI 216

Query: 186 VKIWDL---KSQQCVETHLAHTGECWSLGIIEDMAVTCSADSQVKLWKLDLQAENGSKLT 242
           V +W+    K  + ++T   H  +  S G + +  +  +A  +  L  + L+++   K T
Sbjct: 217 VNLWEFNMKKHSKLLKTVPVHQ-QVESCGFVRESDLVYTAGGEAVLQLISLESQKVIKKT 275

Query: 243 EKGIIEKQSKQRGVEIDFAVAPDGVKFFYIQNADKTIEIYRLRKEEEISRALKKREKRLQ 302
           +K I E       + I   +     + FY+  +D+T+++  +  EE IS           
Sbjct: 276 QKPIEE-------LFIVGVLPILSGREFYLVLSDQTLQLINM--EEAISN---------- 316

Query: 303 DKGMSEEEIKEAMGSPVSLMYHLFQVVRSPYKIKSAQWTVCSNSKLELVVTTSNNSIEYY 362
                +E I  A  S ++  +     +R           V      ++ + T++ ++   
Sbjct: 317 ---FDDELINVA--SSIAGNHGTIADIR-----------VVGPGLNKIALATNSPALRII 360

Query: 363 SIPYSKREPTQPAPLKLHTIDLHGQRTDIRSTSISDDNKLLATASNGSLKI-WNIKTKRC 421
            IP +  E + P  ++++     G    + S   ++D   LAT S  S  I W    +  
Sbjct: 361 PIPQTS-ENSLPLDVEVY----EGHEDLLNSLDATEDGLWLATCSKDSSAILWRFNVE-- 413

Query: 422 IRSFECGYALTCKFLPGGALVVVGTRNGELQLFDIASSTMLDNKEGAHDAAIWSLDLTSD 481
                     T KF P                           K   H A++ ++ L + 
Sbjct: 414 ----------TAKFFPYA-------------------------KFTGHSASVTAVALPNV 438

Query: 482 GRK-----LVTGSADKTVRFWTFEVSEVPVSDESNKTMPMLQ---LFHDTTLELDDDILS 533
             +     L+T S D TV+ W       P +++ +  + + Q    FH        DI +
Sbjct: 439 MLRGWPEFLITASNDLTVKRWKVPK---PANEDISDLLTIKQSEYTFHVHA----KDINA 491

Query: 534 VVISPDDKFIAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSMDISYDSKLIVTCSADKN 593
           + ++P+D   A +  D T K++ +++ +   +L GHK  +  +      KL+ T S DK 
Sbjct: 492 LSLAPNDSLFATASYDKTCKIWDVETGESKATLAGHKRGLWDVSFCQYDKLLATSSGDKT 551

Query: 594 IKIWGLDFGDCHKSLFAHQDSIMNVKFLPESYNFFSCSKDATVKYWDGQKFECIQKLAAH 653
           IKIW LD   C K+L  H +++    F+ +     S   D  +K WD    +C++ L  H
Sbjct: 552 IKIWNLDTFSCVKTLEGHTNAVQRCAFMNKQKQLVSSGADGLIKIWDCITGDCLKTLDGH 611

Query: 654 QSEVWSISVSNDGTFVISTGHDHSIRVWEETEDQVFLEEEREKEM 698
            + +W+++V NDG  +IS   D   + W +       EE+RE+++
Sbjct: 612 GNRIWAMNVCNDGDLIISADADGVFQFWRDCT-----EEQREQDL 651

 Score = 68.6 bits (166), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 46/171 (26%), Positives = 77/171 (45%), Gaps = 12/171 (7%)

Query: 72  SDAKLSKPAETTF---------LKYHPETNLLAAGYADGVIKIWDLISKTVLISFNGHKS 122
           SD    K +E TF         L   P  +L A    D   KIWD+ +     +  GHK 
Sbjct: 470 SDLLTIKQSEYTFHVHAKDINALSLAPNDSLFATASYDKTCKIWDVETGESKATLAGHKR 529

Query: 123 AITVLAFDTTGTRLISASKDSDIIVWDLVGESGLYKLRSHKDAITGL-WCEDENWLISTS 181
            +  ++F      L ++S D  I +W+L   S +  L  H +A+    +   +  L+S+ 
Sbjct: 530 GLWDVSFCQYDKLLATSSGDKTIKIWNLDTFSCVKTLEGHTNAVQRCAFMNKQKQLVSSG 589

Query: 182 KDGLVKIWDLKSQQCVETHLAHTGECWSLGIIE--DMAVTCSADSQVKLWK 230
            DGL+KIWD  +  C++T   H    W++ +    D+ ++  AD   + W+
Sbjct: 590 ADGLIKIWDCITGDCLKTLDGHGNRIWAMNVCNDGDLIISADADGVFQFWR 640

 Score = 63.2 bits (152), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 45/149 (30%), Positives = 69/149 (46%), Gaps = 17/149 (11%)

Query: 51  VWDIKTGEQIAQLTDGLPPGASDAKLSKPAETTFLKYHPETNLLAAGYADGVIKIWDLIS 110
           +WD++TGE  A L  G   G  D         +F +Y     LLA    D  IKIW+L +
Sbjct: 512 IWDVETGESKATLA-GHKRGLWDV--------SFCQYD---KLLATSSGDKTIKIWNLDT 559

Query: 111 KTVLISFNGHKSAITVLAFDTTGTRLISASKDSDIIVWDLVGESGLYKLRSHKDAITGL- 169
            + + +  GH +A+   AF     +L+S+  D  I +WD +    L  L  H + I  + 
Sbjct: 560 FSCVKTLEGHTNAVQRCAFMNKQKQLVSSGADGLIKIWDCITGDCLKTLDGHGNRIWAMN 619

Query: 170 WCEDENWLISTSKDGLVKIWDLKSQQCVE 198
            C D + +IS   DG+ + W    + C E
Sbjct: 620 VCNDGDLIISADADGVFQFW----RDCTE 644

 Score = 58.5 bits (140), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 52/190 (27%), Positives = 83/190 (43%), Gaps = 15/190 (7%)

Query: 505 PVSDESN--KTMPMLQLFHDTTLELDDD--ILSVVISPDDKFIAVSLLDNTVKVFFLDSM 560
           PV DE N  +  P  +L H  T+E DD+  I ++ ++PD +++        +K+F LDSM
Sbjct: 35  PVLDEINVIQLKPTQKLLH--TIENDDEQEITALRLTPDGRYLCYVSQAQQLKIFSLDSM 92

Query: 561 KFFLSLYGHKLPVLSMDISYDSKLIVTCSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKF 620
           K   S+     P   MD    S LI     D +I +  ++ G    S   H  +I ++KF
Sbjct: 93  KITRSMKISS-PSYVMDSDSTSTLIAIGGTDGSISVVDVENGYITHSFKGHGGTISSLKF 151

Query: 621 LPE----SYNFFSCSKDATVKYWDGQKFECIQKLAAHQSEVWSISV----SNDGTFVIST 672
             E     +   S   +   K WD  K  C+  +  H S +  +        D   ++S 
Sbjct: 152 HGELNGDKWLLASGDTNGVAKVWDLVKRRCLHTMQEHTSAIRGLDFKEVEGEDCVKLLSG 211

Query: 673 GHDHSIRVWE 682
           G D  + +WE
Sbjct: 212 GRDDIVNLWE 221

>ZYRO0A09636g Chr1 (779501..781927) [2427 bp, 808 aa] {ON} highly
           similar to uniprot|Q05946 Saccharomyces cerevisiae
           YLR222C UTP13 Nucleolar protein component of the small
           subunit (SSU) processome containing the U3 snoRNA that
           is involved in processing of pre-18S rRNA
          Length = 808

 Score =  125 bits (313), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 148/669 (22%), Positives = 272/669 (40%), Gaps = 96/669 (14%)

Query: 81  ETTFLKYHPETNLLAAGYADGVIKIWDLISKTVLISFNGHKSAITVLAFDTTGTRLISAS 140
           + T LK   +   L       ++KI+DL    ++ S     S   V+  D+T T L    
Sbjct: 62  DITALKLTADGRYLCFASQAQLLKIFDLREGKIVRSMK-ISSPSYVVDSDSTSTLLAIGG 120

Query: 141 KDSDIIVWDLVGESGLYKLRSHKDAITGLWCEDEN----WLISTS-KDGLVKIWDLKSQQ 195
            D  I V D+      + L+ H   I+ +    E     WL+++   +G+VKIWDL  ++
Sbjct: 121 TDGSITVVDVENGYVTHSLKGHGGTISSVKFYGEQNGEVWLLASGDTNGMVKIWDLVKRK 180

Query: 196 CVETHLAHTGECWSLGIIED--------MAVTCSADSQVKLWKLDLQAENGSKLTEKGII 247
           C+ T   HT     +   E           ++   D  +  W+ +L+ +    L +   +
Sbjct: 181 CIHTVQEHTAAVRGIDFHESKNNDESELFLISGGRDDVINYWQFNLKKK--CTLLKTLPV 238

Query: 248 EKQSKQRGVEIDFAVAPDGVKFFYIQNADKTIEIYRLRKEEEISRALKKREKR------- 300
            +Q +  G    FA +    +  Y   +D  +++  L   + + R  K  E+        
Sbjct: 239 SQQVESCG----FANS----ELIYTAGSDAFLQLISLESGKAVKRTHKPVEELFTVGVLS 290

Query: 301 ----------LQDKGMSEEEIKEAMGSPVSLMYHLFQVVRSPYKIKSAQWTVCSNSKLEL 350
                     + D+ ++   ++EA+ S  +L+     +  +   I    +      KL L
Sbjct: 291 ILGGSKLYMVISDQTLALINLEEALESESALIEVESYIAGNHGTIADMNFVGPELDKLAL 350

Query: 351 VVTTSNNSIEYYSIPYSKREPTQPAPLKLHTIDLHGQRTDIRSTSISDDNKLLATASNGS 410
               + NS     IP S  E   P  ++L+     G +  + +   ++D   LATAS  S
Sbjct: 351 ----ATNSPTLRIIPVS-MEGGLPIDVELY----EGHKDLLNAVDATEDGLWLATASKDS 401

Query: 411 LKI-WNIKTKRCIRSFECGYALTCKFLPGGALVVVGTRNGELQLFDIASSTMLDNKEGAH 469
             I W  ++             + KF+P                            EG H
Sbjct: 402 TAILWWYQSN------------SNKFVPYAKF------------------------EG-H 424

Query: 470 DAAIWSLDLTSDGRK-----LVTGSADKTVRFWTFEVSEVPVSDESNKTMPMLQLFHDTT 524
            +A+ ++ L +   K     ++T S D TV+ W       PV+   +  + ++++   T 
Sbjct: 425 SSAVTAVGLPNIMHKGWPEFILTASNDLTVKKWAVPK---PVASNESFELQVVKVSEYTR 481

Query: 525 LELDDDILSVVISPDDKFIAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSMDISYDSKL 584
              + DI ++ ++P+D   A +  D T KV+ L+S +   +L  H+  +  +      +L
Sbjct: 482 RAHEKDINALSVAPNDSTFATASYDKTCKVWDLESGEVKATLANHRRGLWDVAFCQYERL 541

Query: 585 IVTCSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLPESYNFFSCSKDATVKYWDGQKF 644
           I TCS DK IKIW LD     K+   H +++    F+ +     S S D  VK WD    
Sbjct: 542 IATCSGDKTIKIWSLDTFAVVKTFEGHTNAVQRCSFINKQTQLVSSSADGLVKIWDCSTG 601

Query: 645 ECIQKLAAHQSEVWSISVSNDGTFVISTGHDHSIRVWEETEDQVFLEEEREKEMDEQYED 704
           EC++ L  H + +W++ V+ DG  ++S   D   + W+++ +Q   +   ++ +  + E 
Sbjct: 602 ECVKTLDGHTNRIWALCVAEDGDLIVSADADGVFQFWKDSTEQERQQHNEQQHLKVEQEQ 661

Query: 705 TLLTSLEGG 713
           +L   L  G
Sbjct: 662 SLQNYLSQG 670

 Score = 60.1 bits (144), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 44/154 (28%), Positives = 72/154 (46%), Gaps = 19/154 (12%)

Query: 51  VWDIKTGEQIAQLTD---GLPPGASDAKLSKPAETTFLKYHPETNLLAAGYADGVIKIWD 107
           VWD+++GE  A L +   GL             +  F +Y     L+A    D  IKIW 
Sbjct: 511 VWDLESGEVKATLANHRRGL------------WDVAFCQYE---RLIATCSGDKTIKIWS 555

Query: 108 LISKTVLISFNGHKSAITVLAFDTTGTRLISASKDSDIIVWDLVGESGLYKLRSHKDAIT 167
           L +  V+ +F GH +A+   +F    T+L+S+S D  + +WD      +  L  H + I 
Sbjct: 556 LDTFAVVKTFEGHTNAVQRCSFINKQTQLVSSSADGLVKIWDCSTGECVKTLDGHTNRIW 615

Query: 168 GLW-CEDENWLISTSKDGLVKIWDLKSQQCVETH 200
            L   ED + ++S   DG+ + W   ++Q  + H
Sbjct: 616 ALCVAEDGDLIVSADADGVFQFWKDSTEQERQQH 649

 Score = 52.4 bits (124), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 55/194 (28%), Positives = 87/194 (44%), Gaps = 21/194 (10%)

Query: 505 PVSDESNKTMPMLQLFHDT----TLELDD--DILSVVISPDDKFIAVSLLDNTVKVFFLD 558
           PV DE N    ++QL  +     T+E DD  DI ++ ++ D +++  +     +K+F L 
Sbjct: 35  PVLDEIN----IIQLVPERKTLFTIENDDEQDITALKLTADGRYLCFASQAQLLKIFDLR 90

Query: 559 SMKFFLSLYGHKLPVLSMDISYDSKLIVTCSADKNIKIWGLDFGDCHKSLFAHQDSIMNV 618
             K   S+     P   +D    S L+     D +I +  ++ G    SL  H  +I +V
Sbjct: 91  EGKIVRSMKISS-PSYVVDSDSTSTLLAIGGTDGSITVVDVENGYVTHSLKGHGGTISSV 149

Query: 619 KFLPES----YNFFSCSKDATVKYWDGQKFECIQKLAAHQSEVWSI----SVSNDGT--F 668
           KF  E     +   S   +  VK WD  K +CI  +  H + V  I    S +ND +  F
Sbjct: 150 KFYGEQNGEVWLLASGDTNGMVKIWDLVKRKCIHTVQEHTAAVRGIDFHESKNNDESELF 209

Query: 669 VISTGHDHSIRVWE 682
           +IS G D  I  W+
Sbjct: 210 LISGGRDDVINYWQ 223

>Kwal_27.11585 s27 (859952..862423) [2472 bp, 823 aa] {ON} YLR222C
           (UTP13) - Protein required for cell viability [contig
           27] FULL
          Length = 823

 Score =  124 bits (311), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 159/675 (23%), Positives = 272/675 (40%), Gaps = 118/675 (17%)

Query: 81  ETTFLKYHPETNLLAAGYADGVIKIWDLISKTVLISFNGHKSAITVLAFDTTGTRLISAS 140
           E T LK  P    L       +++I+ L SK ++ S     S + V+  D++ T +    
Sbjct: 62  EITALKLTPNGEYLCFVSQAQLLRIYKLSSKKIIRSMKV-SSPVYVMDCDSSSTLVALGG 120

Query: 141 KDSDIIVWDLVGESGLYKLRSHKDAITGLWCEDEN----W-LISTSKDGLVKIWDLKSQQ 195
            D  + V D+      +  + H   I+ +    E     W L S    G+VK+WDL  + 
Sbjct: 121 TDGSVTVVDIENGYVTHSFKGHGATISSVKFHGEQSGSIWRLASGDTSGMVKVWDLVRRN 180

Query: 196 CVETHLAHTGECWSL---------GIIEDMAVTCSADSQVKLWKLDLQAENGSKLTEKGI 246
           C+ T   H      L         G++E   +T   D  V L++L+  +   +KL     
Sbjct: 181 CIHTIQEHAAAVRGLDFRLSPADDGVLE--LLTGGRDDIVNLFQLN--STKKAKLMRTIP 236

Query: 247 IEKQSKQRGVEIDFAVAPDGVKFFYIQNADKTIEIYRLRKEEEISRALKKREKRLQDKGM 306
           + +Q +  G   D   +PDG   FY    D   +I         S ++ KR K+  ++  
Sbjct: 237 VHQQIEACGFIRD---SPDG-SLFYTAGGDAVFQILSF-----TSASVAKRTKKPIEELF 287

Query: 307 SEEEIKEAMGSPVSLMYH---LFQVVRSP------------YKIKSAQWTVC-------- 343
               +    GS V L+     LF V  S             +KI     TV         
Sbjct: 288 IIGVLPIMQGSKVYLVLSDQTLFLVNLSASLSKDGDEIVIEHKIAGNHGTVADMRFVGKE 347

Query: 344 -------SNSKLELVVT---TSNNSIEYYSIPYSKREPTQPAPLKLHTIDLHGQRTDI-R 392
                  +NS    V+T   T +N+ E    P SK +     PL+   ++L+   TD+  
Sbjct: 348 LDKLALATNSPALRVITAPVTKHNAAEKEDEPTSKVDIQNCLPLE---VELYEGHTDLLN 404

Query: 393 STSISDDNKLLATAS-NGSLKIWNIKTKRCIRSFECGYALTCKFLPGGALVVVGTRNGEL 451
           S   S++ + LAT S + ++ +W +             A + KF P              
Sbjct: 405 SLDSSENGEWLATCSKDHTVILWKLN------------ADSEKFKPYARFT--------- 443

Query: 452 QLFDIASSTMLDNKEGAHDAAIWSLDLTSDGRK-----LVTGSADKTVRFWTFEVSEVPV 506
                            H   + ++ L +  R      ++T S D T++ W+     VP 
Sbjct: 444 ----------------GHAGPVTAVGLPNVMRNTWPEFIITASNDLTIKKWS-----VPK 482

Query: 507 SDESNKTMPMLQLFHDTTLELDDDILSVVISPDDKFIAVSLLDNTVKVFFLDSMKFFLSL 566
              ++  M  +++   T    + DI ++ ISP+D   A +  D T K++ +DS +   +L
Sbjct: 483 PTSNDVDMHNIKVSDYTRRAHEKDINALSISPNDSVFATASYDKTCKIWNVDSGELEGTL 542

Query: 567 YGHKLPVLSMDISYDSKLIVTCSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLPESYN 626
             HK  +  +      KL+ TCS DK IK+W L+     K+L  H +++    F+  +  
Sbjct: 543 ANHKRGLWDVTFCQYDKLLATCSGDKTIKVWSLESMSVVKTLEGHTNAVQRCSFINRNKQ 602

Query: 627 FFSCSKDATVKYWDGQKFECIQKLAAHQSEVWSISVSNDGTFVISTGHDHSIRVWEETED 686
             S   D  +K WD    ECI+ L AH + +W++SV +DG   ++   D   + W++   
Sbjct: 603 IVSTGADGLIKVWDLSTGECIRTLDAHSNRIWALSVLSDGKEFVTADADGVFQFWKDCS- 661

Query: 687 QVFLEEEREKEMDEQ 701
               EEE+++ ++ Q
Sbjct: 662 ----EEEQKENLENQ 672

 Score = 74.7 bits (182), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 62/231 (26%), Positives = 100/231 (43%), Gaps = 22/231 (9%)

Query: 20  NSNSVWIEPEASKRKTGNLGQVIVGGLENIL--VWD---IKTGEQIAQLTDGLP-PGASD 73
           N++S   +P A  R TG+ G V   GL N++   W    I     +      +P P ++D
Sbjct: 430 NADSEKFKPYA--RFTGHAGPVTAVGLPNVMRNTWPEFIITASNDLTIKKWSVPKPTSND 487

Query: 74  AKL-----------SKPAETTFLKYHPETNLLAAGYADGVIKIWDLISKTVLISFNGHKS 122
             +           +   +   L   P  ++ A    D   KIW++ S  +  +   HK 
Sbjct: 488 VDMHNIKVSDYTRRAHEKDINALSISPNDSVFATASYDKTCKIWNVDSGELEGTLANHKR 547

Query: 123 AITVLAFDTTGTRLISASKDSDIIVWDLVGESGLYKLRSHKDAITGLWCEDEN-WLISTS 181
            +  + F      L + S D  I VW L   S +  L  H +A+      + N  ++ST 
Sbjct: 548 GLWDVTFCQYDKLLATCSGDKTIKVWSLESMSVVKTLEGHTNAVQRCSFINRNKQIVSTG 607

Query: 182 KDGLVKIWDLKSQQCVETHLAHTGECWSLGIIEDMA--VTCSADSQVKLWK 230
            DGL+K+WDL + +C+ T  AH+   W+L ++ D    VT  AD   + WK
Sbjct: 608 ADGLIKVWDLSTGECIRTLDAHSNRIWALSVLSDGKEFVTADADGVFQFWK 658

 Score = 49.7 bits (117), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 46/180 (25%), Positives = 80/180 (44%), Gaps = 15/180 (8%)

Query: 506 VSDESN--KTMPMLQLFHDTTLELDDD--ILSVVISPDDKFIAVSLLDNTVKVFFLDSMK 561
           V DE N  +  P  +L H  T+E DD+  I ++ ++P+ +++        ++++ L S K
Sbjct: 36  VVDEVNIMELSPTKRLIH--TIENDDEQEITALKLTPNGEYLCFVSQAQLLRIYKLSSKK 93

Query: 562 FFLSLYGHKLPVLSMDISYDSKLIVTCSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFL 621
              S+     PV  MD    S L+     D ++ +  ++ G    S   H  +I +VKF 
Sbjct: 94  IIRSMKVSS-PVYVMDCDSSSTLVALGGTDGSVTVVDIENGYVTHSFKGHGATISSVKFH 152

Query: 622 PES----YNFFSCSKDATVKYWDGQKFECIQKLAAHQSEV----WSISVSNDGTFVISTG 673
            E     +   S      VK WD  +  CI  +  H + V    + +S ++DG   + TG
Sbjct: 153 GEQSGSIWRLASGDTSGMVKVWDLVRRNCIHTIQEHAAAVRGLDFRLSPADDGVLELLTG 212

 Score = 34.3 bits (77), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 26/95 (27%), Positives = 46/95 (48%), Gaps = 18/95 (18%)

Query: 80  AETTFLKYHPETN----LLAAGYADGVIKIWDLISKTVLISFNGHKSAITVLAF-----D 130
           A  + +K+H E +     LA+G   G++K+WDL+ +  + +   H +A+  L F     D
Sbjct: 144 ATISSVKFHGEQSGSIWRLASGDTSGMVKVWDLVRRNCIHTIQEHAAAVRGLDFRLSPAD 203

Query: 131 TTGTRLISASKDSDIIVWDLVGESGLYKLRSHKDA 165
                L++  +D DI+         L++L S K A
Sbjct: 204 DGVLELLTGGRD-DIV--------NLFQLNSTKKA 229

>TBLA0I02570 Chr9 (597481..600027) [2547 bp, 848 aa] {ON} Anc_8.717
           YOR269W
          Length = 848

 Score =  122 bits (307), Expect = 9e-28,   Method: Compositional matrix adjust.
 Identities = 147/670 (21%), Positives = 268/670 (40%), Gaps = 97/670 (14%)

Query: 81  ETTFLKYHPETNLLAAGYADGVIKIWDLISKTVLISFNGHKSAITVLAFDTTGTRLISAS 140
           E T L+  P+   L     + ++KI++++ K  + S     S   V++ D T T L    
Sbjct: 63  EITALQLSPDGKYLCYASTNQLLKIYNIVEKKFVKSLK-ISSPSYVMSIDQTSTLLAVGG 121

Query: 141 KDSDIIVWDLVGESGLYKLRSHKDAITGLWC-------EDENWLI-STSKDGLVKIWDLK 192
            D  + V D+      +  + H   I+ +          +E WL+ S    G++K+ D+ 
Sbjct: 122 TDGSVTVIDIENSYITHSFKGHGATISAVKFYSDASTQNNEGWLLFSGDTAGMIKVCDMV 181

Query: 193 SQQCVETHLAHTGECWSLGI------IED-----MAVTCSADSQVKLWKLDLQAENGSKL 241
            ++C+ T   HT     L I      +E+       ++   D  V LW+ +L+ +  SKL
Sbjct: 182 KRRCLYTFQEHTSAIRGLDIRLSPSHVENDEPLLQLLSGGRDDIVNLWEFNLRRK--SKL 239

Query: 242 TEKGIIEKQSKQRGVEIDFAVAPDGVKFFYIQNADKTIEIYRLRKEEEISRALKKREKR- 300
            +   + +Q +  G      +  +     Y   +D   +I  +   + + + LK  E+  
Sbjct: 240 IKTIPVYQQVEACGF-----LNGNYEDLIYTGGSDAIFQILSISSNKILKKTLKPIEELF 294

Query: 301 ----------------LQDKGMSEEEIKEAMG---SPVSLMYHLFQVVRSPYKIKSAQWT 341
                           L D+ +   +++E M    +P   + H   +++    I     T
Sbjct: 295 IIGVLPILDNSKFYLVLSDQTLLLVDVEENMAEDENPSEYVDH--TIIKIENSIAGNHGT 352

Query: 342 VCSNSKLE-----LVVTTSNNSIEYYSIPYSKREPTQPAPLKLHTIDL---HGQRTDIRS 393
           +     ++     L + T++ ++    I  +  E      L    ID+    G    + S
Sbjct: 353 IADMRVVDPTLSKLALATNSPTLRIIPISEANEEADSKDALSRIPIDVDMYEGHTDLLNS 412

Query: 394 TSISDDNKLLATAS-NGSLKIWNIKTKRCIRSFECGYALTCKFLP-GGALVVVGTRNGEL 451
              ++D+  +ATAS + S  +W     R     E  Y +  KFL    ++  VG  N   
Sbjct: 413 LDSTEDSLWIATASKDNSCILW-----RYNAVLE-KYQIYAKFLGHASSVTAVGLPN--- 463

Query: 452 QLFDIASSTMLDNKEGAHDAAIWSLDLTSDGRKLVTGSADKTVRFWTFEVSEVPVSDESN 511
               + +    D                     ++T S D T++ W        + +  +
Sbjct: 464 ----VLTKNYPD--------------------YVITASNDSTIKKWKVPKPTKNLDNNDS 499

Query: 512 KTMPMLQLFHDTTLELDDDILSVVISPDDKFIAVSLLDNTVKVFFLDSMKFFLSLYGHKL 571
                ++L   T    D DI ++ ISP+D   A +  D T K++ L+S     +L  HK 
Sbjct: 500 FKPHEVKLSEYTRRAHDKDINALSISPNDSIFATASYDKTCKIWDLESGDLKATLVNHKR 559

Query: 572 PVLSMDISYDSKLIVTCSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLPESYNFFSCS 631
            +  +      K IVT S DK IK+W LD     K+   H +++   +F+ +     SC 
Sbjct: 560 GLWDVSFCQYDKFIVTASGDKTIKMWSLDTFTVVKTFEGHSNAVQRCQFINKQKQLVSCG 619

Query: 632 KDATVKYWDGQKFECIQKLAAHQSEVWSISVSNDGTFVISTGHDHSIRVWEETEDQVFLE 691
            D  +K WD    ECI+ L  H + +W++SV NDG  +IS   D   + W +        
Sbjct: 620 ADGLIKIWDCSSGECIKTLDGHSNRIWALSVINDGDVIISADADGVFQFWRDCTG----- 674

Query: 692 EEREKEMDEQ 701
           E REK+++++
Sbjct: 675 ENREKDLEKE 684

 Score = 76.6 bits (187), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 50/172 (29%), Positives = 82/172 (47%), Gaps = 4/172 (2%)

Query: 85  LKYHPETNLLAAGYADGVIKIWDLISKTVLISFNGHKSAITVLAFDTTGTRLISASKDSD 144
           L   P  ++ A    D   KIWDL S  +  +   HK  +  ++F      +++AS D  
Sbjct: 522 LSISPNDSIFATASYDKTCKIWDLESGDLKATLVNHKRGLWDVSFCQYDKFIVTASGDKT 581

Query: 145 IIVWDLVGESGLYKLRSHKDAITGL-WCEDENWLISTSKDGLVKIWDLKSQQCVETHLAH 203
           I +W L   + +     H +A+    +   +  L+S   DGL+KIWD  S +C++T   H
Sbjct: 582 IKMWSLDTFTVVKTFEGHSNAVQRCQFINKQKQLVSCGADGLIKIWDCSSGECIKTLDGH 641

Query: 204 TGECWSLGIIEDMAVTCSADSQ--VKLWKLDLQAENGSKLTEKGIIEKQSKQ 253
           +   W+L +I D  V  SAD+    + W+ D   EN  K  EK  ++ + +Q
Sbjct: 642 SNRIWALSVINDGDVIISADADGVFQFWR-DCTGENREKDLEKERLKVEQEQ 692

 Score = 43.9 bits (102), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 74/340 (21%), Positives = 135/340 (39%), Gaps = 61/340 (17%)

Query: 505 PVSDESNKTMPMLQLFHDTTLELDD-------DILSVVISPDDKFIAVSLLDNTVKVFFL 557
           P+ DE N    +++   + +  LD+       +I ++ +SPD K++  +  +  +K++ +
Sbjct: 35  PILDEIN----IVKFIDNNSYLLDNVSNDDEQEITALQLSPDGKYLCYASTNQLLKIYNI 90

Query: 558 DSMKFFLSLYGHKLPVLSMDISYDSKLIVTCSADKNIKIWGLDFGDCHKSLFAHQDSIMN 617
              KF  SL     P   M I   S L+     D ++ +  ++      S   H  +I  
Sbjct: 91  VEKKFVKSLKISS-PSYVMSIDQTSTLLAVGGTDGSVTVIDIENSYITHSFKGHGATISA 149

Query: 618 VKFLP-------ESYNFFSCSKDATVKYWDGQKFECIQKLAAHQSEVWSIS-------VS 663
           VKF         E +  FS      +K  D  K  C+     H S +  +        V 
Sbjct: 150 VKFYSDASTQNNEGWLLFSGDTAGMIKVCDMVKRRCLYTFQEHTSAIRGLDIRLSPSHVE 209

Query: 664 NDGTF--VISTGHDHSIRVWEETEDQ---------VFLEEEREKEMDEQYEDTLLTSLEG 712
           ND     ++S G D  + +WE    +         V+ + E    ++  YED + T    
Sbjct: 210 NDEPLLQLLSGGRDDIVNLWEFNLRRKSKLIKTIPVYQQVEACGFLNGNYEDLIYT---- 265

Query: 713 GAGDEMLSVKKGDNEESEEVEGVHKQTVESLKAGERLMEALEIGVNDIIAMEEFNEQLNA 772
           G  D +  +       S     + K+T++ ++      E   IGV  I+   +F   L  
Sbjct: 266 GGSDAIFQIL------SISSNKILKKTLKPIE------ELFIIGVLPILDNSKFYLVL-- 311

Query: 773 WKKSKKGIQPIRPQENTLLVALKKTPEEYIIETLVKIKPS 812
              S + +  +  +EN   +A  + P EY+  T++KI+ S
Sbjct: 312 ---SDQTLLLVDVEEN---MAEDENPSEYVDHTIIKIENS 345

 Score = 43.5 bits (101), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 37/134 (27%), Positives = 57/134 (42%), Gaps = 19/134 (14%)

Query: 75  KLSKPAETTFLKYHPETNLLAAGYADGVIKIWDLISKTVLISFNGHKSAITVLAF----- 129
           K+S P+    +     + LLA G  DG + + D+ +  +  SF GH + I+ + F     
Sbjct: 100 KISSPSYV--MSIDQTSTLLAVGGTDGSVTVIDIENSYITHSFKGHGATISAVKFYSDAS 157

Query: 130 --DTTGTRLISASKDSDIIVWDLVGESGLYKLRSHKDAITGLWCE--------DENW--L 177
             +  G  L S      I V D+V    LY  + H  AI GL           DE    L
Sbjct: 158 TQNNEGWLLFSGDTAGMIKVCDMVKRRCLYTFQEHTSAIRGLDIRLSPSHVENDEPLLQL 217

Query: 178 ISTSKDGLVKIWDL 191
           +S  +D +V +W+ 
Sbjct: 218 LSGGRDDIVNLWEF 231

>YLR222C Chr12 complement(579318..581771) [2454 bp, 817 aa] {ON}
           UTP13Nucleolar protein, component of the small subunit
           (SSU) processome containing the U3 snoRNA that is
           involved in processing of pre-18S rRNA
          Length = 817

 Score =  122 bits (305), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 150/679 (22%), Positives = 272/679 (40%), Gaps = 111/679 (16%)

Query: 81  ETTFLKYHPETNLLAAGYADGVIKIWDLISKTVLISFNGHKSAITVLAFDTTGTRLISAS 140
           E T LK  P+   L       ++KI+ L +  V+ S     S   +L  D+T T L    
Sbjct: 63  EITALKLTPDGQYLTYVSQAQLLKIFHLKTGKVVRSMK-ISSPSYILDADSTSTLLAVGG 121

Query: 141 KDSDIIVWDLVGESGLYKLRSHKDAITGL----WCEDENWLISTS-KDGLVKIWDLKSQQ 195
            D  IIV D+      +  + H   I+ L        + WL+++   +G+VK+WDL  ++
Sbjct: 122 TDGSIIVVDIENGYITHSFKGHGGTISSLKFYGQLNSKIWLLASGDTNGMVKVWDLVKRK 181

Query: 196 CVETHLAHTGECWSLGIIEDM--------AVTCSADSQVKLWKLDLQAENGSKLTEKGII 247
           C+ T   HT     L IIE           ++   D  + LW  +++ +     T    +
Sbjct: 182 CLHTLQEHTSAVRGLDIIEVPDNDEPSLNLLSGGRDDIINLWDFNMKKKCKLLKTLP--V 239

Query: 248 EKQSKQRGVEIDFAVAPDGVKFFYIQNADKTIEIYRLRKEEEISRALKKREKRLQDKGMS 307
            +Q +  G    F    DG +  Y    D   ++     + E    LK+  K +      
Sbjct: 240 NQQVESCG----FLKDGDGKRIIYTAGGDAIFQLI----DSESGSVLKRTNKPI------ 285

Query: 308 EEEIKEAMGSPVSLMYHLF--------QVVRSPYKIKSAQWTVCSNSKL----------- 348
            EE+      P+     +F        Q++     +K+ + T+   S +           
Sbjct: 286 -EELFIIGVLPILSNSQMFLVLSDQTLQLINVEEDLKNDEDTIQVTSSIAGNHGIIADMR 344

Query: 349 -------ELVVTTSNNSIEYYSIP-YSKREPTQPAPLKLHTIDLHGQRTDIRSTSISDDN 400
                  +L + T++ S+    +P  S  E + P  ++++     G    + S   ++D 
Sbjct: 345 YVGPELNKLALATNSPSLRIIPVPDLSGPEASLPLDVEIY----EGHEDLLNSLDATEDG 400

Query: 401 KLLATASNGSLKI-WNIKTKRCIRSFECGYALTCKFLPGGALVVVGTRNGELQLFDIASS 459
             +ATAS  +  I W      C                                FDI + 
Sbjct: 401 LWIATASKDNTAIVWRYNENSC-------------------------------KFDIYA- 428

Query: 460 TMLDNKEGAHDAAIWSLDLTSDGRK-----LVTGSADKTVRFWTFEVSEVPVSDESNKTM 514
                K   H AA+ ++ L +   K     L+T S D T++ W      +P    ++  +
Sbjct: 429 -----KYIGHSAAVTAVGLPNIVSKGYPEFLLTASNDLTIKKWI-----IP-KPTASMDV 477

Query: 515 PMLQLFHDTTLELDDDILSVVISPDDKFIAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVL 574
            ++++   T    + DI ++ +SP+D   A +  D T K++ L++ +   +L  HK  + 
Sbjct: 478 QIIKVSEYTRHAHEKDINALSVSPNDSIFATASYDKTCKIWNLENGELEATLANHKRGLW 537

Query: 575 SMDISYDSKLIVTCSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLPESYNFFSCSKDA 634
            +      KL+ T S DK +KIW LD     K+L  H +++    F+ +     SC  D 
Sbjct: 538 DVSFCQYDKLLATSSGDKTVKIWSLDTFSVMKTLEGHTNAVQRCSFINKQKQLISCGADG 597

Query: 635 TVKYWDGQKFECIQKLAAHQSEVWSISVSNDGTFVISTGHDHSIRVWEETEDQVFLEEER 694
            +K WD    EC++ L  H + +W++S  NDG  ++S   D   + W++  +Q   EE+ 
Sbjct: 598 LIKIWDCSSGECLKTLDGHNNRLWALSTMNDGDMIVSADADGVFQFWKDCTEQEIEEEQE 657

Query: 695 EKEMDEQYEDTLLTSLEGG 713
           + ++  + E +L   +  G
Sbjct: 658 KAKLQVEQEQSLQNYMSKG 676

 Score = 71.2 bits (173), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 48/175 (27%), Positives = 78/175 (44%), Gaps = 12/175 (6%)

Query: 68  PPGASDAKLSKPAETT---------FLKYHPETNLLAAGYADGVIKIWDLISKTVLISFN 118
           P  + D ++ K +E T          L   P  ++ A    D   KIW+L +  +  +  
Sbjct: 471 PTASMDVQIIKVSEYTRHAHEKDINALSVSPNDSIFATASYDKTCKIWNLENGELEATLA 530

Query: 119 GHKSAITVLAFDTTGTRLISASKDSDIIVWDLVGESGLYKLRSHKDAITGL-WCEDENWL 177
            HK  +  ++F      L ++S D  + +W L   S +  L  H +A+    +   +  L
Sbjct: 531 NHKRGLWDVSFCQYDKLLATSSGDKTVKIWSLDTFSVMKTLEGHTNAVQRCSFINKQKQL 590

Query: 178 ISTSKDGLVKIWDLKSQQCVETHLAHTGECWSLGIIE--DMAVTCSADSQVKLWK 230
           IS   DGL+KIWD  S +C++T   H    W+L  +   DM V+  AD   + WK
Sbjct: 591 ISCGADGLIKIWDCSSGECLKTLDGHNNRLWALSTMNDGDMIVSADADGVFQFWK 645

 Score = 45.8 bits (107), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 46/191 (24%), Positives = 82/191 (42%), Gaps = 14/191 (7%)

Query: 505 PVSDESN---KTMPMLQLFHDTTLELDDDILSVVISPDDKFIAVSLLDNTVKVFFLDSMK 561
           PV DE N    T    ++ H  + E + +I ++ ++PD +++        +K+F L + K
Sbjct: 35  PVLDEINIIDLTPGSRKILHKISNEDEQEITALKLTPDGQYLTYVSQAQLLKIFHLKTGK 94

Query: 562 FFLSLYGHKLPVLSMDISYDSKLIVTCSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFL 621
              S+     P   +D    S L+     D +I +  ++ G    S   H  +I ++KF 
Sbjct: 95  VVRSMKISS-PSYILDADSTSTLLAVGGTDGSIIVVDIENGYITHSFKGHGGTISSLKFY 153

Query: 622 PESYN----FFSCSKDATVKYWDGQKFECIQKLAAHQSEVWSISV----SND--GTFVIS 671
            +  +      S   +  VK WD  K +C+  L  H S V  + +     ND     ++S
Sbjct: 154 GQLNSKIWLLASGDTNGMVKVWDLVKRKCLHTLQEHTSAVRGLDIIEVPDNDEPSLNLLS 213

Query: 672 TGHDHSIRVWE 682
            G D  I +W+
Sbjct: 214 GGRDDIINLWD 224

>NCAS0C02710 Chr3 complement(505852..508299) [2448 bp, 815 aa] {ON}
           Anc_8.435
          Length = 815

 Score =  116 bits (291), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 142/646 (21%), Positives = 258/646 (39%), Gaps = 85/646 (13%)

Query: 81  ETTFLKYHPETNLLAAGYADGVIKIWDL----ISKTVLISFNGHKSAITVLAFDTTGTRL 136
           E T LK  P+   L+    + ++KI+ L      +  +I      S   ++  D+T T +
Sbjct: 62  EITALKLTPDAQYLSFISQNQLLKIFKLDQEKKDQGKIIRSMKMSSPCYIMDCDSTSTLV 121

Query: 137 ISASKDSDIIVWDLVGESGLYKLRSHKDAITGL----WCEDENWLI-STSKDGLVKIWDL 191
                D  I V D+      + L+ H   I+ L          WL+ S   +G+VK+WDL
Sbjct: 122 ALGGTDGSITVVDIENGFITHSLKGHGATISALKFFGQANSNVWLLCSGDTNGMVKVWDL 181

Query: 192 KSQQCVETHLAHTGECWSLGIIED----MAVTCSADSQVKLWKLDLQAENGSKLTEKGII 247
             ++C+ T   H+     L + E       ++   D+   LW  +L+ +    L +   +
Sbjct: 182 VKRKCLHTMQEHSNAVRGLDVREVGDEWQLISGGRDNVCTLWNFNLKKK--CTLLKTIPV 239

Query: 248 EKQSKQRGVEIDFAVAPDGVKFFYIQNADKTIEIYRLRKEEEISRALKKREKR------- 300
            +Q +  G      +  +     Y    D  ++   L K   I +  K  E+        
Sbjct: 240 HQQVESCGF-----INHEHDDLIYTAGGDALLQFISLEKATMIKKTKKHIEELFIIGVLP 294

Query: 301 ----------LQDKGMSEEEIKEAMGSPVSLMYHLFQVVRSPYKIKSAQWTVCSNSKLEL 350
                     + D+ +   +IK  + +  S +  +   +       +    V  N   +L
Sbjct: 295 ILENDKMYLVMSDQTLELVDIKSNLLNESSDIIEIESCIAGNNGTIADMKFVGPNHD-KL 353

Query: 351 VVTTSNNSIEYYSIPYSKREPTQPAPLKLHTIDLHGQRTDIRSTSISDDNKLLATASNGS 410
            + T++ ++    +P S++E   P  ++++     G    + S   +DD   +ATAS   
Sbjct: 354 ALATNSPTLRIIPVPSSEQEEL-PINVEMY----EGHEDLLNSLDTTDDGLWMATASKDH 408

Query: 411 LKI-WNIKTKRCIRSFECGYALTCKFLPGGALV-VVGTRNGELQLFDIASSTMLDNKEGA 468
             I W  K    I  F+  Y    KF+   A V  VG  N  L+ +              
Sbjct: 409 TAIVW--KYNSIINKFQ-PYV---KFIGHSATVTAVGLPNVMLRGYP------------- 449

Query: 469 HDAAIWSLDLTSDGRKLVTGSADKTVRFWTFEVSEVPVSDESNKTMPMLQLFHDTTLELD 528
                           L+T S D T++ W        V ++      ++++   T    +
Sbjct: 450 --------------EFLLTASNDLTIKKWKIPKPSTTVEEDCQ----IVKVSEYTRRAHE 491

Query: 529 DDILSVVISPDDKFIAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSMDISYDSKLIVTC 588
            DI ++ ISP+D   A +  D T K++ L++ +   +L  HK  +  +      KLI TC
Sbjct: 492 KDINALAISPNDSIFATASYDKTCKIWDLENGELTATLSNHKRGLWDVAFCQYDKLIATC 551

Query: 589 SADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLPESYNFFSCSKDATVKYWDGQKFECIQ 648
           S DK IKIW LD     K+L  H +++    F+ +     S   D  +K WD    +C++
Sbjct: 552 SGDKTIKIWSLDTFSVMKTLEGHTNAVQRCMFINKQLQLVSSGADGLIKIWDCSTGDCLK 611

Query: 649 KLAAHQSEVWSISVSNDGTFVISTGHDHSIRVWEETEDQVFLEEER 694
            L  H + +W+++  NDG  ++S   D   + W++  +   LE+E+
Sbjct: 612 TLDGHDNRIWALTEINDGDMIVSADADGVFQFWKDCTE---LEKEQ 654

 Score = 48.5 bits (114), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 117/560 (20%), Positives = 224/560 (40%), Gaps = 106/560 (18%)

Query: 80  AETTFLKYHPETN----LLAAGYADGVIKIWDLISKTVLISFNGHKSAITVLAFDTTGT- 134
           A  + LK+  + N    LL +G  +G++K+WDL+ +  L +   H +A+  L     G  
Sbjct: 149 ATISALKFFGQANSNVWLLCSGDTNGMVKVWDLVKRKCLHTMQEHSNAVRGLDVREVGDE 208

Query: 135 -RLISASKDSDIIVW--DLVGESGLYK---LRSHKDAITGLWCEDENWLISTSKDGLVKI 188
            +LIS  +D+   +W  +L  +  L K   +    ++   +  E ++ + +   D L++ 
Sbjct: 209 WQLISGGRDNVCTLWNFNLKKKCTLLKTIPVHQQVESCGFINHEHDDLIYTAGGDALLQF 268

Query: 189 WDLKSQQCVETHLAHTGECWSLGII----EDMAVTCSADSQVKLWKLDLQAENGSKLTEK 244
             L+    ++    H  E + +G++     D      +D  ++L  +     N S     
Sbjct: 269 ISLEKATMIKKTKKHIEELFIIGVLPILENDKMYLVMSDQTLELVDIKSNLLNES----S 324

Query: 245 GIIEKQSKQRGVEIDFA----VAPDGVKFFYIQNADKTIEIYRL--RKEEEIS---RALK 295
            IIE +S   G     A    V P+  K     N+  T+ I  +   ++EE+       +
Sbjct: 325 DIIEIESCIAGNNGTIADMKFVGPNHDKLALATNS-PTLRIIPVPSSEQEELPINVEMYE 383

Query: 296 KREKRLQDKGMSEEEIKEAMGSP--VSLMYHLFQVVR--SPY-KIKSAQWTVCS----NS 346
             E  L     +++ +  A  S    ++++    ++    PY K      TV +    N 
Sbjct: 384 GHEDLLNSLDTTDDGLWMATASKDHTAIVWKYNSIINKFQPYVKFIGHSATVTAVGLPNV 443

Query: 347 KL----ELVVTTSNN-SIEYYSIP---YSKREPTQPAPLKLHTIDLHGQRTDIRSTSISD 398
            L    E ++T SN+ +I+ + IP    +  E  Q   +  +T   H +  DI + +IS 
Sbjct: 444 MLRGYPEFLLTASNDLTIKKWKIPKPSTTVEEDCQIVKVSEYTRRAHEK--DINALAISP 501

Query: 399 DNKLLATAS-NGSLKIWNIKTKRCIRSFECGYALTCKFLPGGALVVVGTRNGELQLFDIA 457
           ++ + ATAS + + KIW+++                              NGEL      
Sbjct: 502 NDSIFATASYDKTCKIWDLE------------------------------NGEL------ 525

Query: 458 SSTMLDNKEGAHDAAIWSLDLTSDGRKLVTGSADKTVRFWTFEVSEVPVSDESNKTMPML 517
           ++T+ ++K G  D A    D     + + T S DKT++ W+ +   V  + E +      
Sbjct: 526 TATLSNHKRGLWDVAFCQYD-----KLIATCSGDKTIKIWSLDTFSVMKTLEGHTNAVQR 580

Query: 518 QLFHDTTLELDDDILSVVISPDDKFIAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSMD 577
            +F +  L+L                  S  D  +K++   +     +L GH   + ++ 
Sbjct: 581 CMFINKQLQL----------------VSSGADGLIKIWDCSTGDCLKTLDGHDNRIWALT 624

Query: 578 ISYDSKLIVTCSADKNIKIW 597
              D  +IV+  AD   + W
Sbjct: 625 EINDGDMIVSADADGVFQFW 644

 Score = 47.8 bits (112), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 52/210 (24%), Positives = 91/210 (43%), Gaps = 21/210 (10%)

Query: 485 LVTGSADKTVRFWTFEVSEVPVSDES---NKTMPMLQLFHDTTLELDDDILSVVISPDDK 541
           + T SAD TV          P+ D+    + T P  +L H    + + +I ++ ++PD +
Sbjct: 22  IATVSADGTVL-------ATPILDDIEIISLTTPQRRL-HSIANDDEQEITALKLTPDAQ 73

Query: 542 FIAVSLLDNTVKVFFLDSMKF----FLSLYGHKLPVLSMDISYDSKLIVTCSADKNIKIW 597
           +++    +  +K+F LD  K      +       P   MD    S L+     D +I + 
Sbjct: 74  YLSFISQNQLLKIFKLDQEKKDQGKIIRSMKMSSPCYIMDCDSTSTLVALGGTDGSITVV 133

Query: 598 GLDFGDCHKSLFAHQDSIMNVKFLPESYN--FFSCSKDAT--VKYWDGQKFECIQKLAAH 653
            ++ G    SL  H  +I  +KF  ++ +  +  CS D    VK WD  K +C+  +  H
Sbjct: 134 DIENGFITHSLKGHGATISALKFFGQANSNVWLLCSGDTNGMVKVWDLVKRKCLHTMQEH 193

Query: 654 QSEVWSISVSNDGT--FVISTGHDHSIRVW 681
            + V  + V   G    +IS G D+   +W
Sbjct: 194 SNAVRGLDVREVGDEWQLISGGRDNVCTLW 223

>Ecym_4134 Chr4 complement(280146..282578) [2433 bp, 810 aa] {ON}
           similar to Ashbya gossypii AGR180W
          Length = 810

 Score =  112 bits (279), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 64/230 (27%), Positives = 117/230 (50%), Gaps = 5/230 (2%)

Query: 485 LVTGSADKTVRFWTF-EVSEVPVSDESNKTMPMLQLFHDTTLELDDDILSVVISPDDKFI 543
           L++ S D TV+ W   + ++ P  DE    +P+++    T    + DI ++ ISP+D   
Sbjct: 447 LLSSSTDMTVKKWKVPKPTQNPTEDE----IPVVKTSEYTRRAHEKDINALSISPNDSIF 502

Query: 544 AVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSMDISYDSKLIVTCSADKNIKIWGLDFGD 603
           A +  D T K++ L + +   +L  HK  +  +      KLI TCS DK IKIW L+  +
Sbjct: 503 ATASYDKTCKIWDLVTGELVATLANHKRGLWDVSFCQHDKLIATCSGDKTIKIWSLENYN 562

Query: 604 CHKSLFAHQDSIMNVKFLPESYNFFSCSKDATVKYWDGQKFECIQKLAAHQSEVWSISVS 663
              +L  H +++  + F+ ++    SC  D  VK WD    EC++ L AH + +W++ V+
Sbjct: 563 IKATLEGHTNAVQRISFINKNKQLVSCGADGLVKIWDCSTGECLRTLDAHDNRIWALEVA 622

Query: 664 NDGTFVISTGHDHSIRVWEETEDQVFLEEEREKEMDEQYEDTLLTSLEGG 713
           +DG   ++   D   + W++  ++   ++  +K +  + E +L   L  G
Sbjct: 623 DDGDRFVTADADGLFQFWKDNSEEEHEQDLEKKRLKVEQEQSLQNYLSKG 672

 Score = 74.3 bits (181), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 48/171 (28%), Positives = 82/171 (47%), Gaps = 3/171 (1%)

Query: 85  LKYHPETNLLAAGYADGVIKIWDLISKTVLISFNGHKSAITVLAFDTTGTRLISASKDSD 144
           L   P  ++ A    D   KIWDL++  ++ +   HK  +  ++F      + + S D  
Sbjct: 493 LSISPNDSIFATASYDKTCKIWDLVTGELVATLANHKRGLWDVSFCQHDKLIATCSGDKT 552

Query: 145 IIVWDLVGESGLYKLRSHKDAITGLWCEDEN-WLISTSKDGLVKIWDLKSQQCVETHLAH 203
           I +W L   +    L  H +A+  +   ++N  L+S   DGLVKIWD  + +C+ T  AH
Sbjct: 553 IKIWSLENYNIKATLEGHTNAVQRISFINKNKQLVSCGADGLVKIWDCSTGECLRTLDAH 612

Query: 204 TGECWSLGIIE--DMAVTCSADSQVKLWKLDLQAENGSKLTEKGIIEKQSK 252
               W+L + +  D  VT  AD   + WK + + E+   L +K +  +Q +
Sbjct: 613 DNRIWALEVADDGDRFVTADADGLFQFWKDNSEEEHEQDLEKKRLKVEQEQ 663

 Score = 54.3 bits (129), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 56/230 (24%), Positives = 94/230 (40%), Gaps = 33/230 (14%)

Query: 92  NLLAAGYADGVIKIWDL-------------ISKTVLISFNGHKSAITVLAFDTTGTRLIS 138
           N L +   D  +K W +             + KT   +   H+  I  L+     +   +
Sbjct: 445 NFLLSSSTDMTVKKWKVPKPTQNPTEDEIPVVKTSEYTRRAHEKDINALSISPNDSIFAT 504

Query: 139 ASKDSDIIVWDLVGESGLYKLRSHKDAITGLW----CEDENWLISTSKDGLVKIWDLKSQ 194
           AS D    +WDLV    +  L +HK    GLW    C+ +  + + S D  +KIW L++ 
Sbjct: 505 ASYDKTCKIWDLVTGELVATLANHK---RGLWDVSFCQHDKLIATCSGDKTIKIWSLENY 561

Query: 195 QCVETHLAHTGECWSLGII--EDMAVTCSADSQVKLWKLDLQAENGSKLTEKGIIEKQSK 252
               T   HT     +  I      V+C AD  VK+W        G  L  + +    ++
Sbjct: 562 NIKATLEGHTNAVQRISFINKNKQLVSCGADGLVKIW----DCSTGECL--RTLDAHDNR 615

Query: 253 QRGVEIDFAVAPDGVKFFYIQNADKTIEIYRLRKEEEISRALKKREKRLQ 302
              +E    VA DG +F    +AD   + ++   EEE  + L+K+  +++
Sbjct: 616 IWALE----VADDGDRFV-TADADGLFQFWKDNSEEEHEQDLEKKRLKVE 660

 Score = 53.5 bits (127), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 37/146 (25%), Positives = 63/146 (43%), Gaps = 13/146 (8%)

Query: 51  VWDIKTGEQIAQLTDGLPPGASDAKLSKPAETTFLKYHPETNLLAAGYADGVIKIWDLIS 110
           +WD+ TGE +A L +    G  D    +              L+A    D  IKIW L +
Sbjct: 513 IWDLVTGELVATLANH-KRGLWDVSFCQ-----------HDKLIATCSGDKTIKIWSLEN 560

Query: 111 KTVLISFNGHKSAITVLAFDTTGTRLISASKDSDIIVWDLVGESGLYKLRSHKDAITGLW 170
             +  +  GH +A+  ++F     +L+S   D  + +WD      L  L +H + I  L 
Sbjct: 561 YNIKATLEGHTNAVQRISFINKNKQLVSCGADGLVKIWDCSTGECLRTLDAHDNRIWALE 620

Query: 171 CEDE-NWLISTSKDGLVKIWDLKSQQ 195
             D+ +  ++   DGL + W   S++
Sbjct: 621 VADDGDRFVTADADGLFQFWKDNSEE 646

 Score = 49.3 bits (116), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 84/403 (20%), Positives = 146/403 (36%), Gaps = 118/403 (29%)

Query: 115 ISFNGHKSAITVLAFDTTGTRLISASKDSDIIVWDLVGESGLYKLRS-----HKDAITGL 169
           + F G    +  LA ++   R+I A + S+        E G + + +     H D +  L
Sbjct: 336 MKFVGPNLDMLALATNSPTLRIIKAPQASE--------EDGQFPVETNMYGGHVDLLNAL 387

Query: 170 -WCEDENWLISTSKDGLVKIWDLKSQ----QCVETHLAHTGECWSLGI-------IEDMA 217
              ED  W+ + SKD  V +W    Q    +     + H G   ++ +         +  
Sbjct: 388 DASEDGLWIATASKDHTVLLWRYSEQLGDFKQYAKFIGHAGSVTAVALPNIMDQHFPNFL 447

Query: 218 VTCSADSQVKLWKLDLQAENGSKLTEKGIIEKQSKQRGVEID---FAVAPDGVKFFYIQN 274
           ++ S D  VK WK+    +N ++     +   +  +R  E D    +++P+    F   +
Sbjct: 448 LSSSTDMTVKKWKVPKPTQNPTEDEIPVVKTSEYTRRAHEKDINALSISPND-SIFATAS 506

Query: 275 ADKTIEIYRLRKEEEISRALKKREKRLQDKGMSEEEIKEAMGSPVSLMYHLFQVVRSPYK 334
            DKT +I+ L   E ++  L   ++ L D               VS   H          
Sbjct: 507 YDKTCKIWDLVTGELVA-TLANHKRGLWD---------------VSFCQH---------- 540

Query: 335 IKSAQWTVCSNSKLELVVTTSNNSIEYYSIPYSKREPTQPAPLKLHTIDLHGQRTDIRST 394
                   CS  K     T    S+E Y+I          A L+ HT  +       R +
Sbjct: 541 --DKLIATCSGDK-----TIKIWSLENYNIK---------ATLEGHTNAVQ------RIS 578

Query: 395 SISDDNKLLATASNGSLKIWNIKTKRCIRSFECGYALTCKFLPGGALVVVGTRNGELQLF 454
            I+ + +L++  ++G +KIW+  T  C+R+ +                            
Sbjct: 579 FINKNKQLVSCGADGLVKIWDCSTGECLRTLD---------------------------- 610

Query: 455 DIASSTMLDNKEGAHDAAIWSLDLTSDGRKLVTGSADKTVRFW 497
                        AHD  IW+L++  DG + VT  AD   +FW
Sbjct: 611 -------------AHDNRIWALEVADDGDRFVTADADGLFQFW 640

 Score = 48.5 bits (114), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 33/105 (31%), Positives = 56/105 (53%), Gaps = 7/105 (6%)

Query: 91  TNLLAAGYADGVIKIWDLISKTVLISFNGHKSAITVLAF--DTTGTRLISASKDSDIIV- 147
           + LL  G  DG + I+D+ +  V  SF GH   I+ + F  +  G   + AS D++ +V 
Sbjct: 113 STLLVIGGTDGSVSIFDIENGYVTHSFKGHGGIISSVKFYGELDGANWLLASGDTNGVVK 172

Query: 148 -WDLVGESGLYKLRSHKDAITGL-WC--EDENWLISTSKDGLVKI 188
            WDLV    ++ ++ H  A+ GL +C  + E  LIS  +D ++ +
Sbjct: 173 IWDLVKRRCMHTIQEHTAAVRGLDFCVKDSEMLLISGGRDEIINL 217

 Score = 37.0 bits (84), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 28/107 (26%), Positives = 51/107 (47%), Gaps = 10/107 (9%)

Query: 398 DDNKLLATASNGSLKIWNIKTKRCIRSFECG---YALTCKFLPGGALVVVGTRNGELQLF 454
           D + L   A N  L+I+++ +K+ +RS +     Y + C       L+V+G  +G + +F
Sbjct: 71  DGSYLCFVAQNQLLRIYSLASKKIVRSMKVSSPVYVMDCD--ETSTLLVIGGTDGSVSIF 128

Query: 455 DIASSTMLDNKEGAHDAAIWSLDLTS--DGRK--LVTGSADKTVRFW 497
           DI +  +  + +G H   I S+      DG    L +G  +  V+ W
Sbjct: 129 DIENGYVTHSFKG-HGGIISSVKFYGELDGANWLLASGDTNGVVKIW 174

>CAGL0C03608g Chr3 (360681..362612) [1932 bp, 643 aa] {ON} similar
           to uniprot|P16649 Saccharomyces cerevisiae YCR084c TUP1
           general transcription repressor
          Length = 643

 Score =  110 bits (274), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 97/370 (26%), Positives = 162/370 (43%), Gaps = 72/370 (19%)

Query: 360 EYYSIPYSKREPTQPAPL--KLHTIDLHGQRTDIRSTSISDDNKLLATASNGSLKIWNIK 417
           E Y + Y+   PTQP  +  +LH   LH   + +     S++ + LAT  N + KI+ + 
Sbjct: 293 EDYYVLYN---PTQPKDIDIELHRTLLHD--SVVCCVKFSNNGEYLATGCNKTTKIFEVA 347

Query: 418 TKRCIRSF----ECG------------YALTCKFLPGGALVVVGTRNGELQLFDIASSTM 461
           T   +       + G            Y  +  F P G  +  G  +  ++++DIA   +
Sbjct: 348 TGNLVTELVDDTKTGTEDANSASSADLYIRSVCFSPDGKFLATGAEDKLIRIWDIAQRKI 407

Query: 462 LDNKEGAHDAAIWSLDLTSDGRKLVTGSADKTVRFWTFEVSEVPVSDESNKTMPMLQLFH 521
           +    G H+  I+SLD    G KLV+GS D+T+R W     +  +               
Sbjct: 408 VMVLRG-HEQDIYSLDYFQSGNKLVSGSGDRTIRIWDLHTGQCSL--------------- 451

Query: 522 DTTLELDDDILSVVISPDD-KFIAVSLLDNTVKVFFLDSMKFFL---------SLYGHKL 571
             TL ++D + +V +SP +  ++A   LD TV+V+  DS   FL         +  GHK 
Sbjct: 452 --TLSIEDGVTTVAVSPGNGNYVAAGSLDRTVRVW--DSNSGFLVERLDSEGETGVGHKD 507

Query: 572 PVLSMDISYDSKLIVTCSADKNIKIWGLDF-------------GDCHKSLFAHQDSIMNV 618
            V S+  + D K IV+ S D+++K+W L               G+C  +   H+D +++V
Sbjct: 508 SVYSVVFTRDGKNIVSGSLDRSVKLWNLRNINGASTSPQPKTEGNCEMTYIGHKDFVLSV 567

Query: 619 KFLPESYNFFSCSKDATVKYWDGQKFECIQKLAAHQSEVWSISVSNDGTF-----VISTG 673
                     S SKD  V +WD      +  L  H++ V S++V+N         V +TG
Sbjct: 568 TTTENDQYILSGSKDRGVIFWDKVSGVPLLMLQGHRNSVISVAVANGKPLGANYNVFATG 627

Query: 674 H-DHSIRVWE 682
             D   ++W+
Sbjct: 628 SGDCKAKIWK 637

 Score = 81.3 bits (199), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 60/213 (28%), Positives = 100/213 (46%), Gaps = 17/213 (7%)

Query: 34  KTGNLGQVIVGGLENIL-VWDIKTGEQIAQLTDGLPPGASDAKLSKPAETTF--LKYHPE 90
           K  N G+ +  G      ++++ TG  + +L D    G  DA  +  A+     + + P+
Sbjct: 325 KFSNNGEYLATGCNKTTKIFEVATGNLVTELVDDTKTGTEDANSASSADLYIRSVCFSPD 384

Query: 91  TNLLAAGYADGVIKIWDLISKTVLISFNGHKSAITVLAFDTTGTRLISASKDSDIIVWDL 150
              LA G  D +I+IWD+  + +++   GH+  I  L +  +G +L+S S D  I +WDL
Sbjct: 385 GKFLATGAEDKLIRIWDIAQRKIVMVLRGHEQDIYSLDYFQSGNKLVSGSGDRTIRIWDL 444

Query: 151 -VGESGLYKLRSHKDAITGLWCE--DENWLISTSKDGLVKIWDLKSQQCV-------ETH 200
             G+  L    S +D +T +     + N++ + S D  V++WD  S   V       ET 
Sbjct: 445 HTGQCSL--TLSIEDGVTTVAVSPGNGNYVAAGSLDRTVRVWDSNSGFLVERLDSEGETG 502

Query: 201 LAHTGECWSLGIIEDMA--VTCSADSQVKLWKL 231
           + H    +S+    D    V+ S D  VKLW L
Sbjct: 503 VGHKDSVYSVVFTRDGKNIVSGSLDRSVKLWNL 535

 Score = 50.4 bits (119), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 35/128 (27%), Positives = 59/128 (46%), Gaps = 4/128 (3%)

Query: 571 LPVLSMDISYDSKLIVTCSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLPESYNFFSC 630
           L + S+  S D K + T + DK I+IW +        L  H+  I ++ +        S 
Sbjct: 374 LYIRSVCFSPDGKFLATGAEDKLIRIWDIAQRKIVMVLRGHEQDIYSLDYFQSGNKLVSG 433

Query: 631 SKDATVKYWDGQKFECIQKLAAHQSEVWSISVS-NDGTFVISTGHDHSIRVWEETEDQVF 689
           S D T++ WD    +C   L+     V +++VS  +G +V +   D ++RVW+      F
Sbjct: 434 SGDRTIRIWDLHTGQCSLTLSIEDG-VTTVAVSPGNGNYVAAGSLDRTVRVWDSNSG--F 490

Query: 690 LEEEREKE 697
           L E  + E
Sbjct: 491 LVERLDSE 498

 Score = 36.2 bits (82), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 39/181 (21%), Positives = 73/181 (40%), Gaps = 30/181 (16%)

Query: 36  GNLGQVIVGGLE-NILVWDIKTGEQIAQL-TDG-LPPGASDAKLSKPAETTFLKYHPETN 92
           GN   V  G L+  + VWD  +G  + +L ++G    G  D+  S       + +  +  
Sbjct: 467 GNGNYVAAGSLDRTVRVWDSNSGFLVERLDSEGETGVGHKDSVYS-------VVFTRDGK 519

Query: 93  LLAAGYADGVIKIWDL-------------ISKTVLISFNGHKSAITVLAFDTTGTRLISA 139
            + +G  D  +K+W+L                   +++ GHK  +  +        ++S 
Sbjct: 520 NIVSGSLDRSVKLWNLRNINGASTSPQPKTEGNCEMTYIGHKDFVLSVTTTENDQYILSG 579

Query: 140 SKDSDIIVWDLVGESGLYKLRSHKDAITGLWCEDE-------NWLISTSKDGLVKIWDLK 192
           SKD  +I WD V    L  L+ H++++  +   +        N   + S D   KIW  +
Sbjct: 580 SKDRGVIFWDKVSGVPLLMLQGHRNSVISVAVANGKPLGANYNVFATGSGDCKAKIWKFQ 639

Query: 193 S 193
           +
Sbjct: 640 T 640

>SAKL0H12760g Chr8 complement(1089272..1091797) [2526 bp, 841 aa]
           {ON} highly similar to uniprot|Q05946 Saccharomyces
           cerevisiae YLR222C UTP13 Nucleolar protein component of
           the small subunit (SSU) processome containing the U3
           snoRNA that is involved in processing of pre-18S rRNA
          Length = 841

 Score =  108 bits (271), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 57/199 (28%), Positives = 102/199 (51%), Gaps = 5/199 (2%)

Query: 485 LVTGSADKTVRFWTFEVSEVPVSDESNKTMPMLQLFHDTTLELDDDILSVVISPDDKFIA 544
           L++ S D T++ W      VP  ++   T+ +++    T    + DI ++ +SP+D   A
Sbjct: 486 LLSASNDLTIKKWA-----VPKPEDGKDTVHVVKASEYTRRAHEKDINALAVSPNDSVFA 540

Query: 545 VSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSMDISYDSKLIVTCSADKNIKIWGLDFGDC 604
            +  D T K++ LD+ +   +L  HK  +  ++     KL+ TCS DK +KIW LD    
Sbjct: 541 TASYDKTCKIWSLDTGELEATLANHKRGLWDVNFCQYDKLLATCSGDKTVKIWSLDTYSV 600

Query: 605 HKSLFAHQDSIMNVKFLPESYNFFSCSKDATVKYWDGQKFECIQKLAAHQSEVWSISVSN 664
            K+L  H +++    F+ ++    S   D  VK WD    EC++ L AH + +W++SV  
Sbjct: 601 MKTLEGHTNAVQRCSFISKNKQLVSSGADGLVKLWDCSTGECVKTLDAHNNRIWALSVLK 660

Query: 665 DGTFVISTGHDHSIRVWEE 683
           DG  +++   D   + W++
Sbjct: 661 DGDIIVTADADGVFQFWKD 679

 Score = 70.5 bits (171), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 43/149 (28%), Positives = 69/149 (46%), Gaps = 3/149 (2%)

Query: 85  LKYHPETNLLAAGYADGVIKIWDLISKTVLISFNGHKSAITVLAFDTTGTRLISASKDSD 144
           L   P  ++ A    D   KIW L +  +  +   HK  +  + F      L + S D  
Sbjct: 530 LAVSPNDSVFATASYDKTCKIWSLDTGELEATLANHKRGLWDVNFCQYDKLLATCSGDKT 589

Query: 145 IIVWDLVGESGLYKLRSHKDAITGL-WCEDENWLISTSKDGLVKIWDLKSQQCVETHLAH 203
           + +W L   S +  L  H +A+    +      L+S+  DGLVK+WD  + +CV+T  AH
Sbjct: 590 VKIWSLDTYSVMKTLEGHTNAVQRCSFISKNKQLVSSGADGLVKLWDCSTGECVKTLDAH 649

Query: 204 TGECWSLGIIE--DMAVTCSADSQVKLWK 230
               W+L +++  D+ VT  AD   + WK
Sbjct: 650 NNRIWALSVLKDGDIIVTADADGVFQFWK 678

 Score = 49.7 bits (117), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 30/101 (29%), Positives = 54/101 (53%), Gaps = 4/101 (3%)

Query: 400 NKLLATAS-NGSLKIWNIKTKRCIRSFE--CGYALTCKFLPGGALVVVGTRNGELQLFDI 456
           +KLLAT S + ++KIW++ T   +++ E        C F+     +V    +G ++L+D 
Sbjct: 578 DKLLATCSGDKTVKIWSLDTYSVMKTLEGHTNAVQRCSFISKNKQLVSSGADGLVKLWDC 637

Query: 457 ASSTMLDNKEGAHDAAIWSLDLTSDGRKLVTGSADKTVRFW 497
           ++   +   + AH+  IW+L +  DG  +VT  AD   +FW
Sbjct: 638 STGECVKTLD-AHNNRIWALSVLKDGDIIVTADADGVFQFW 677

 Score = 49.3 bits (116), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 34/115 (29%), Positives = 56/115 (48%), Gaps = 10/115 (8%)

Query: 91  TNLLAAGYADGVIKIWDLISKTVLISFNGHKSAITVLAF----DTTGTRLISASKDSDII 146
           + LLA G  DG + I D+ +  V  SF GH   I+ + F    ++   RL S      + 
Sbjct: 133 STLLAIGGTDGSVSIIDIENGYVTHSFKGHGGTISSVKFHGELNSNVWRLASGDTTGVVK 192

Query: 147 VWDLVGESGLYKLRSHKDAITGLWC------EDENWLISTSKDGLVKIWDLKSQQ 195
           +WDLV    L+ ++ H  A+ GL        ED+  LIS  +D ++ ++   S++
Sbjct: 193 IWDLVKRKCLHTVQEHTMAVRGLDFRVLDEDEDQMQLISGGRDNIINLYQFDSRK 247

 Score = 42.0 bits (97), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 34/129 (26%), Positives = 56/129 (43%), Gaps = 6/129 (4%)

Query: 81  ETTFLKYHPETNLLAAGYADGVIKIWDLISKTVLISFNGHKSAITVLAFDTTGTRLISAS 140
           E T L+  P+   L       +++++ L SK ++ S     S + V+  D T T L    
Sbjct: 82  EITALRITPDGQFLCFVSQAQLLRVYHLPSKKIVRSMKV-SSPVYVMECDVTSTLLAIGG 140

Query: 141 KDSDIIVWDLVGESGLYKLRSHKDAITGLWCEDE----NW-LISTSKDGLVKIWDLKSQQ 195
            D  + + D+      +  + H   I+ +    E     W L S    G+VKIWDL  ++
Sbjct: 141 TDGSVSIIDIENGYVTHSFKGHGGTISSVKFHGELNSNVWRLASGDTTGVVKIWDLVKRK 200

Query: 196 CVETHLAHT 204
           C+ T   HT
Sbjct: 201 CLHTVQEHT 209

 Score = 38.5 bits (88), Expect = 0.085,   Method: Compositional matrix adjust.
 Identities = 25/70 (35%), Positives = 36/70 (51%), Gaps = 9/70 (12%)

Query: 85  LKYHPETN----LLAAGYADGVIKIWDLISKTVLISFNGHKSAITVLAF-----DTTGTR 135
           +K+H E N     LA+G   GV+KIWDL+ +  L +   H  A+  L F     D    +
Sbjct: 169 VKFHGELNSNVWRLASGDTTGVVKIWDLVKRKCLHTVQEHTMAVRGLDFRVLDEDEDQMQ 228

Query: 136 LISASKDSDI 145
           LIS  +D+ I
Sbjct: 229 LISGGRDNII 238

 Score = 37.0 bits (84), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 50/251 (19%), Positives = 100/251 (39%), Gaps = 59/251 (23%)

Query: 349 ELVVTTSNN-SIEYYSIPYSKREPTQPAPLKLHTIDLHGQRTDIRSTSISDDNKLLATAS 407
           E +++ SN+ +I+ +++P  +        +K           DI + ++S ++ + ATAS
Sbjct: 484 EFLLSASNDLTIKKWAVPKPEDGKDTVHVVKASEYTRRAHEKDINALAVSPNDSVFATAS 543

Query: 408 -NGSLKIWNIKTKRCIRSFECGYALTCKFLPGGALVVVGTRNGELQLFDIASSTMLDNKE 466
            + + KIW++ T                              GEL+      +T+ ++K 
Sbjct: 544 YDKTCKIWSLDT------------------------------GELE------ATLANHKR 567

Query: 467 GAHDAAIWSLDLTSDGRKLVTGSADKTVRFWTFEVSEVPVSDESNKTMPMLQLFHDTTLE 526
           G     +W ++     + L T S DKTV+ W+ +   V  + E +        F      
Sbjct: 568 G-----LWDVNFCQYDKLLATCSGDKTVKIWSLDTYSVMKTLEGHTNAVQRCSF------ 616

Query: 527 LDDDILSVVISPDDKFIAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSMDISYDSKLIV 586
                    IS + + ++ S  D  VK++   + +   +L  H   + ++ +  D  +IV
Sbjct: 617 ---------ISKNKQLVS-SGADGLVKLWDCSTGECVKTLDAHNNRIWALSVLKDGDIIV 666

Query: 587 TCSADKNIKIW 597
           T  AD   + W
Sbjct: 667 TADADGVFQFW 677

 Score = 32.7 bits (73), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 30/135 (22%), Positives = 56/135 (41%), Gaps = 22/135 (16%)

Query: 568 GHKLPVLSMDISYDSKLIVTCSADKNIKIWGLD----FGDCHKSLFAHQDSIMNVKFLPE 623
           GH+  + S+D + D   + T S D  + +W  D        +     H   +  V  LP 
Sbjct: 418 GHEDLLNSLDATEDGMWLATASKDNFVILWRYDEQTELFKQYAKFVGHAGPVTAVG-LPN 476

Query: 624 SYN------FFSCSKDATVKYW------DGQKFECIQKLA-----AHQSEVWSISVSNDG 666
             N        S S D T+K W      DG+    + K +     AH+ ++ +++VS + 
Sbjct: 477 VMNRPWPEFLLSASNDLTIKKWAVPKPEDGKDTVHVVKASEYTRRAHEKDINALAVSPND 536

Query: 667 TFVISTGHDHSIRVW 681
           +   +  +D + ++W
Sbjct: 537 SVFATASYDKTCKIW 551

>TDEL0A07780 Chr1 complement(1352017..1353990) [1974 bp, 657 aa]
           {ON} Anc_6.363 YCR084C
          Length = 657

 Score =  108 bits (269), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 82/286 (28%), Positives = 129/286 (45%), Gaps = 50/286 (17%)

Query: 429 YALTCKFLPGGALVVVGTRNGELQLFDIASSTMLDNKEGAHDAAIWSLDLTSDGRKLVTG 488
           Y  +  F P G  +  G  +  ++++DIA   ++   +G H+  I+SLD    G KLV+G
Sbjct: 377 YIRSVCFSPDGKFLATGAEDRLIRIWDIAKKQIVMVLQG-HEQDIYSLDYFPSGDKLVSG 435

Query: 489 SADKTVRFWTFEVSEVPVSDESNKTMPMLQLFHDTTLELDDDILSVVISPDD-KFIAVSL 547
           S D+TVR W     +  +                 TL ++D + +V +SP D KFIA   
Sbjct: 436 SGDRTVRIWDLRTGQCSL-----------------TLSIEDGVTTVAVSPGDGKFIAAGS 478

Query: 548 LDNTVKVFFLDSMKFFLSLY---------GHKLPVLSMDISYDSKLIVTCSADKNIKIWG 598
           LD  V+V+  DS   FL            GHK  V S+  + D   +V+ S D+++K+W 
Sbjct: 479 LDRAVRVW--DSETGFLVERLDSENELGTGHKDSVYSVVFTRDGNGVVSGSLDRSVKLWN 536

Query: 599 L------------DFGDCHKSLFAHQDSIMNVKFLPESYNFFSCSKDATVKYWDGQKFEC 646
           L              G C  +   H+D +++V          S SKD  V +WD Q    
Sbjct: 537 LRGDKNNSSSGKPTPGTCEVTYTGHKDFVLSVATTQNDQYILSGSKDRGVLFWDTQSGNP 596

Query: 647 IQKLAAHQSEVWSISVSND-------GTFVISTGHDHSIRVWEETE 685
           +  L  H++ V S++V+N        G F   +G D   R+W+ T+
Sbjct: 597 LLMLQGHRNSVISVAVANGFPLGPQYGVFATGSG-DCKARIWKYTK 641

 Score = 78.6 bits (192), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 59/240 (24%), Positives = 104/240 (43%), Gaps = 31/240 (12%)

Query: 469 HDAAIWSLDLTSDGRKLVTGSADKTVRFWTFEVSE----------------VPVSDESNK 512
           H + +  +  ++DG  L TG  +KT +   F VS+                 P    +N 
Sbjct: 300 HTSVVCCVRFSNDGEYLATG-CNKTTQV--FRVSDGALIARLSDDAASQVAAPAGSPANA 356

Query: 513 TMP---MLQLFHDTTLELDDDILSVVISPDDKFIAVSLLDNTVKVFFLDSMKFFLSLYGH 569
             P   +       +   D  I SV  SPD KF+A    D  ++++ +   +  + L GH
Sbjct: 357 DEPNNDVNSFVTAKSASSDLYIRSVCFSPDGKFLATGAEDRLIRIWDIAKKQIVMVLQGH 416

Query: 570 KLPVLSMDISYDSKLIVTCSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLPESYNFFS 629
           +  + S+D       +V+ S D+ ++IW L  G C  +L + +D +  V   P    F +
Sbjct: 417 EQDIYSLDYFPSGDKLVSGSGDRTVRIWDLRTGQCSLTL-SIEDGVTTVAVSPGDGKFIA 475

Query: 630 C-SKDATVKYWDGQKFECIQKL-------AAHQSEVWSISVSNDGTFVISTGHDHSIRVW 681
             S D  V+ WD +    +++L         H+  V+S+  + DG  V+S   D S+++W
Sbjct: 476 AGSLDRAVRVWDSETGFLVERLDSENELGTGHKDSVYSVVFTRDGNGVVSGSLDRSVKLW 535

 Score = 67.0 bits (162), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 48/165 (29%), Positives = 77/165 (46%), Gaps = 14/165 (8%)

Query: 87  YHPETNLLAAGYADGVIKIWDLISKTVLISFNGHKSAITVLAFDTTGTRLISASKDSDII 146
           + P+   LA G  D +I+IWD+  K +++   GH+  I  L +  +G +L+S S D  + 
Sbjct: 383 FSPDGKFLATGAEDRLIRIWDIAKKQIVMVLQGHEQDIYSLDYFPSGDKLVSGSGDRTVR 442

Query: 147 VWDL-VGESGLYKLRSHKDAITGLWCE--DENWLISTSKDGLVKIWDLKSQQCVET---- 199
           +WDL  G+  L    S +D +T +     D  ++ + S D  V++WD ++   VE     
Sbjct: 443 IWDLRTGQCSL--TLSIEDGVTTVAVSPGDGKFIAAGSLDRAVRVWDSETGFLVERLDSE 500

Query: 200 ---HLAHTGECWSLGIIED--MAVTCSADSQVKLWKLDLQAENGS 239
                 H    +S+    D    V+ S D  VKLW L     N S
Sbjct: 501 NELGTGHKDSVYSVVFTRDGNGVVSGSLDRSVKLWNLRGDKNNSS 545

 Score = 56.6 bits (135), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 57/232 (24%), Positives = 100/232 (43%), Gaps = 47/232 (20%)

Query: 45  GLENILVWDIKTGEQIAQLTDGLPPGASDAKLSKPAETTFLKYHPETNLLAAGYADGVIK 104
           G   + +WD++TG+    LT  +  G +   +S P +  F+         AAG  D  ++
Sbjct: 437 GDRTVRIWDLRTGQ--CSLTLSIEDGVTTVAVS-PGDGKFI---------AAGSLDRAVR 484

Query: 105 IWD-----LISKTVLISFN----GHKSAITVLAFDTTGTRLISASKDSDIIVWDLVGE-- 153
           +WD     L+ +  L S N    GHK ++  + F   G  ++S S D  + +W+L G+  
Sbjct: 485 VWDSETGFLVER--LDSENELGTGHKDSVYSVVFTRDGNGVVSGSLDRSVKLWNLRGDKN 542

Query: 154 ---SGL-------YKLRSHKDAITGLWC-EDENWLISTSKDGLVKIWDLKSQQCVETHLA 202
              SG             HKD +  +   +++ +++S SKD  V  WD +S   +     
Sbjct: 543 NSSSGKPTPGTCEVTYTGHKDFVLSVATTQNDQYILSGSKDRGVLFWDTQSGNPLLMLQG 602

Query: 203 HTGECWSLGIIEDMAV--------TCSADSQVKLWKL---DLQAENGSKLTE 243
           H     S+ +     +        T S D + ++WK    D   ++GSK+ E
Sbjct: 603 HRNSVISVAVANGFPLGPQYGVFATGSGDCKARIWKYTKTDAGIDSGSKIKE 654

 Score = 50.1 bits (118), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 54/225 (24%), Positives = 90/225 (40%), Gaps = 42/225 (18%)

Query: 39  GQVIVGGLEN--ILVWDIKTGEQIAQLTDGLPPGASDAKLSKPAETTFLKYHPETNLLAA 96
           G+ +  G E+  I +WDI   +QI  +  G              +   L Y P  + L +
Sbjct: 387 GKFLATGAEDRLIRIWDIAK-KQIVMVLQG-----------HEQDIYSLDYFPSGDKLVS 434

Query: 97  GYADGVIKIWDLISKTVLISFNGHKSAITVLAFDTTGTRLISASKDSDIIVWDLVGESGL 156
           G  D  ++IWDL +    ++ +      TV      G  + + S D  + VWD   E+G 
Sbjct: 435 GSGDRTVRIWDLRTGQCSLTLSIEDGVTTVAVSPGDGKFIAAGSLDRAVRVWD--SETGF 492

Query: 157 YKLR---------SHKDAITG-LWCEDENWLISTSKDGLVKIWDLKSQQ----------- 195
              R          HKD++   ++  D N ++S S D  VK+W+L+  +           
Sbjct: 493 LVERLDSENELGTGHKDSVYSVVFTRDGNGVVSGSLDRSVKLWNLRGDKNNSSSGKPTPG 552

Query: 196 -CVETHLAHTGECWSLGIIED--MAVTCSADSQVKLWKLDLQAEN 237
            C  T+  H     S+   ++    ++ S D  V  W  D Q+ N
Sbjct: 553 TCEVTYTGHKDFVLSVATTQNDQYILSGSKDRGVLFW--DTQSGN 595

 Score = 40.0 bits (92), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 33/141 (23%), Positives = 63/141 (44%), Gaps = 22/141 (15%)

Query: 41  VIVGGLEN-ILVWDIKTGEQIAQLT--DGLPPGASDAKLSKPAETTFLKYHPETNLLAAG 97
           +  G L+  + VWD +TG  + +L   + L  G  D+  S      F +   + N + +G
Sbjct: 474 IAAGSLDRAVRVWDSETGFLVERLDSENELGTGHKDSVYS----VVFTR---DGNGVVSG 526

Query: 98  YADGVIKIWDL------------ISKTVLISFNGHKSAITVLAFDTTGTRLISASKDSDI 145
             D  +K+W+L               T  +++ GHK  +  +A       ++S SKD  +
Sbjct: 527 SLDRSVKLWNLRGDKNNSSSGKPTPGTCEVTYTGHKDFVLSVATTQNDQYILSGSKDRGV 586

Query: 146 IVWDLVGESGLYKLRSHKDAI 166
           + WD    + L  L+ H++++
Sbjct: 587 LFWDTQSGNPLLMLQGHRNSV 607

>KAFR0H01750 Chr8 complement(322707..325058) [2352 bp, 783 aa] {ON}
           Anc_8.435 YLR222C
          Length = 783

 Score =  108 bits (269), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 67/225 (29%), Positives = 108/225 (48%), Gaps = 20/225 (8%)

Query: 485 LVTGSADKTVRFWTFEVSEVPVSDESNKTMPMLQLFHD------TTLELDDDILSVVISP 538
           L+T S D T++ W  ++ +    DE  +       FHD      T    + DI ++ ISP
Sbjct: 423 LLTASNDLTIKKW--KIPKPSAGDEEVE-------FHDVKISEYTRRAHEKDINALSISP 473

Query: 539 DDKFIAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSMDISYDSKLIVTCSADKNIKIWG 598
           +D   A +  D T K++ L++ +   +L  HK  +  +      K+I TCS DK IKIW 
Sbjct: 474 NDSIFATASYDKTCKIWDLETGESVATLSNHKRGLWDVSFCQFDKIIATCSGDKTIKIWS 533

Query: 599 LDFGDCHKSLFAHQDSIMNVKFLPESYNFFSCSKDATVKYWDGQKFECIQKLAAHQSEVW 658
           LD     K+L  H +++    F+ +     S   D  +K WD    ECI  L  H + +W
Sbjct: 534 LDTFSVIKTLEGHTNAVQKCSFINKQNQLVSTGADGLIKIWDISNGECISTLDGHNNRIW 593

Query: 659 SISVSNDGTFVISTGHDHSIRVWEETEDQVFLEEEREKEMDEQYE 703
           ++ V NDG  ++S   D   + W +  D     E+RE++M ++ E
Sbjct: 594 ALCVQNDGDLIVSADADGVFQFWRDCTD-----EQREEDMAKEKE 633

 Score = 73.9 bits (180), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 49/174 (28%), Positives = 82/174 (47%), Gaps = 5/174 (2%)

Query: 85  LKYHPETNLLAAGYADGVIKIWDLISKTVLISFNGHKSAITVLAFDTTGTRLISASKDSD 144
           L   P  ++ A    D   KIWDL +   + + + HK  +  ++F      + + S D  
Sbjct: 469 LSISPNDSIFATASYDKTCKIWDLETGESVATLSNHKRGLWDVSFCQFDKIIATCSGDKT 528

Query: 145 IIVWDLVGESGLYKLRSHKDAITGL-WCEDENWLISTSKDGLVKIWDLKSQQCVETHLAH 203
           I +W L   S +  L  H +A+    +   +N L+ST  DGL+KIWD+ + +C+ T   H
Sbjct: 529 IKIWSLDTFSVIKTLEGHTNAVQKCSFINKQNQLVSTGADGLIKIWDISNGECISTLDGH 588

Query: 204 TGECWSLGIIE--DMAVTCSADSQVKLWK--LDLQAENGSKLTEKGIIEKQSKQ 253
               W+L +    D+ V+  AD   + W+   D Q E      ++ I ++QS Q
Sbjct: 589 NNRIWALCVQNDGDLIVSADADGVFQFWRDCTDEQREEDMAKEKERIEQEQSLQ 642

 Score = 56.2 bits (134), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 37/143 (25%), Positives = 68/143 (47%), Gaps = 19/143 (13%)

Query: 51  VWDIKTGEQIAQLTD---GLPPGASDAKLSKPAETTFLKYHPETNLLAAGYADGVIKIWD 107
           +WD++TGE +A L++   GL             + +F ++     ++A    D  IKIW 
Sbjct: 489 IWDLETGESVATLSNHKRGL------------WDVSFCQFD---KIIATCSGDKTIKIWS 533

Query: 108 LISKTVLISFNGHKSAITVLAFDTTGTRLISASKDSDIIVWDLVGESGLYKLRSHKDAIT 167
           L + +V+ +  GH +A+   +F     +L+S   D  I +WD+     +  L  H + I 
Sbjct: 534 LDTFSVIKTLEGHTNAVQKCSFINKQNQLVSTGADGLIKIWDISNGECISTLDGHNNRIW 593

Query: 168 GLWCE-DENWLISTSKDGLVKIW 189
            L  + D + ++S   DG+ + W
Sbjct: 594 ALCVQNDGDLIVSADADGVFQFW 616

 Score = 53.9 bits (128), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 98/509 (19%), Positives = 197/509 (38%), Gaps = 106/509 (20%)

Query: 85  LKYHPETN----LLAAGYADGVIKIWDLISKTVLISFNGHKSAITVLAF-----DTTGTR 135
           LK+  E N    LL +G  +G++KIWDL+ +  + +   H S +  +       DT   +
Sbjct: 118 LKFFGELNSNIWLLCSGDTNGMVKIWDLVKRKCIHTVQEHTSPVRGVDIVESENDTDVLQ 177

Query: 136 LISASKDSDIIVW--DLVGESGLYKLRSHKDAITGLWCEDENWLISTSKDGLVKIWDLKS 193
           L++  +D+ +  W  +L  +  L K       I      + +++ +   D + ++  LK+
Sbjct: 178 LVTGGRDNIVNFWEFNLKKKCTLVKTIPAHQQIESSGFINHDFIYTAGSDAVFQVISLKN 237

Query: 194 QQCVETHLAHTGECWSLGIIEDMAVT----CSADSQVKLWKLD--LQAENGSKLTEKGII 247
            Q ++       E + +G++  +  T      +D  + L  +   L+ E    ++ K  I
Sbjct: 238 GQVIKRTRKPIEELFIIGVLPILNGTEYYLVMSDQSLNLIDVQGALEEEEDELISSKSCI 297

Query: 248 EKQSKQRGVEIDFA-VAPD-----------GVKFFYIQNADKT----------IEIYRLR 285
              +   G+  D   V PD            ++   + N +K+          I++    
Sbjct: 298 ---AGNHGIIADMTFVGPDLKHLALATNSPTLRLIPVPNTNKSDGNEDESFLPIDVDMYE 354

Query: 286 KEEEISRALKKREKRLQDKGMSEEEIKEAMGSPVSLMYHLFQVVRSPYKIKSAQWT---- 341
             E++  A+   E  L     S++       S +   Y+  +   + Y   S   +    
Sbjct: 355 GHEDLLNAIDSTEDGLWIATASKDH------SAIVWKYNTIKQKFTQYARFSGHSSSVTA 408

Query: 342 -----VCSNSKLELVVTTSNN-SIEYYSIP--YSKREPTQPAPLKLHTIDLHGQRTDIRS 393
                V   S  E ++T SN+ +I+ + IP   +  E  +   +K+          DI +
Sbjct: 409 VGLPNVMPKSYPEYLLTASNDLTIKKWKIPKPSAGDEEVEFHDVKISEYTRRAHEKDINA 468

Query: 394 TSISDDNKLLATAS-------------------------------------------NGS 410
            SIS ++ + ATAS                                           + +
Sbjct: 469 LSISPNDSIFATASYDKTCKIWDLETGESVATLSNHKRGLWDVSFCQFDKIIATCSGDKT 528

Query: 411 LKIWNIKTKRCIRSFE--CGYALTCKFLPGGALVVVGTRNGELQLFDIASSTMLDNKEGA 468
           +KIW++ T   I++ E        C F+     +V    +G ++++DI++   +   +G 
Sbjct: 529 IKIWSLDTFSVIKTLEGHTNAVQKCSFINKQNQLVSTGADGLIKIWDISNGECISTLDG- 587

Query: 469 HDAAIWSLDLTSDGRKLVTGSADKTVRFW 497
           H+  IW+L + +DG  +V+  AD   +FW
Sbjct: 588 HNNRIWALCVQNDGDLIVSADADGVFQFW 616

 Score = 48.9 bits (115), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 41/177 (23%), Positives = 78/177 (44%), Gaps = 10/177 (5%)

Query: 515 PMLQLFHDTTLELDDDILSVVISPDDKFIAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVL 574
           P+ ++ H  +   + +I ++ ++PD K++        +K+  + + K   S+     P  
Sbjct: 16  PVKKILHTISNNDEQEITALKVTPDGKYLIFVSQAQLLKIVNVSTGKIIKSMKVSS-PSY 74

Query: 575 SMDISYDSKLIVTCSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLPE--SYNFFSCSK 632
            +D    S L+     D ++ +  ++ G    SL  H  +I ++KF  E  S  +  CS 
Sbjct: 75  IIDCDKTSTLVTIGGTDGSVVVIDIENGYITHSLKGHGGTISSLKFFGELNSNIWLLCSG 134

Query: 633 DAT--VKYWDGQKFECIQKLAAHQSEVWSISV-----SNDGTFVISTGHDHSIRVWE 682
           D    VK WD  K +CI  +  H S V  + +       D   +++ G D+ +  WE
Sbjct: 135 DTNGMVKIWDLVKRKCIHTVQEHTSPVRGVDIVESENDTDVLQLVTGGRDNIVNFWE 191

 Score = 37.4 bits (85), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 38/135 (28%), Positives = 62/135 (45%), Gaps = 14/135 (10%)

Query: 373 QPAPLK--LHTIDLHGQRTDIRSTSISDDNKLLATASNGS-LKIWNIKTKRCIRSFEC-- 427
           Q  P+K  LHTI  +    +I +  ++ D K L   S    LKI N+ T + I+S +   
Sbjct: 13  QLKPVKKILHTIS-NNDEQEITALKVTPDGKYLIFVSQAQLLKIVNVSTGKIIKSMKVSS 71

Query: 428 -GYALTCKFLPGGALVVVGTRNGELQLFDIASSTMLDNKEGAHDAAIWSL----DLTSDG 482
             Y + C       LV +G  +G + + DI +  +  + +G H   I SL    +L S+ 
Sbjct: 72  PSYIIDCD--KTSTLVTIGGTDGSVVVIDIENGYITHSLKG-HGGTISSLKFFGELNSNI 128

Query: 483 RKLVTGSADKTVRFW 497
             L +G  +  V+ W
Sbjct: 129 WLLCSGDTNGMVKIW 143

>Ecym_2523 Chr2 complement(1021566..1023506) [1941 bp, 646 aa] {ON}
           similar to Ashbya gossypii AGL234W
          Length = 646

 Score =  107 bits (267), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 80/281 (28%), Positives = 130/281 (46%), Gaps = 45/281 (16%)

Query: 429 YALTCKFLPGGALVVVGTRNGELQLFDIASSTMLDNKEGAHDAAIWSLDLTSDGRKLVTG 488
           Y  +  F P G  +  G  +  ++++D++S  +L   +G H+  I+SLD    G KLV+G
Sbjct: 371 YIRSVCFSPDGKYLATGAEDKLIRIWDLSSKKILMTLQG-HEQDIYSLDYFPAGDKLVSG 429

Query: 489 SADKTVRFWTFEVSEVPVSDESNKTMPMLQLFHDTTLELDDDILSVVISPDD-KFIAVSL 547
           S D+TVR W     +  +                 TL ++D + +V +SP D K+IA   
Sbjct: 430 SGDRTVRIWDLRTGQCSL-----------------TLSIEDGVTTVAVSPGDGKYIAAGS 472

Query: 548 LDNTVKVFFLDSMKFFLS---------LYGHKLPVLSMDISYDSKLIVTCSADKNIKIWG 598
           LD TV+V+  DS   FL            GHK  V S+  + D + +V+ S D+++K+W 
Sbjct: 473 LDRTVRVW--DSETGFLVERLDSENELSTGHKDSVYSVVFTRDGRSVVSGSLDRSVKLWD 530

Query: 599 L-------DFGDCHKSLFAHQDSIMNVKFLPESYNFFSCSKDATVKYWDGQKFECIQKLA 651
           L           C  +   H+D +++V    +     S SKD  V +WD      +  L 
Sbjct: 531 LRGLNGQKSHATCEVTYTGHKDFVLSVATTQDDEYILSGSKDRGVLFWDTASGNPLLMLQ 590

Query: 652 AHQSEVWSISVSND-------GTFVISTGHDHSIRVWEETE 685
            H++ V S++V N        G F   +G D   R+W+ T+
Sbjct: 591 GHRNSVISVAVVNGFPLGPDIGVFATGSG-DCKARIWKYTK 630

 Score = 83.2 bits (204), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 61/241 (25%), Positives = 112/241 (46%), Gaps = 29/241 (12%)

Query: 469 HDAAIWSLDLTSDGRKLVTGSADKTVRFWTFEVSEV--PVSDES----NKTMPMLQLFHD 522
           H + +  +  ++DG  L TG  +KT + +     E+   +SD+S    N     +   + 
Sbjct: 292 HSSVVCCVRFSNDGEYLATG-CNKTTQVYKVSTGELVARLSDDSVSGINNESSSVVAGNG 350

Query: 523 TTLELDDD-------------ILSVVISPDDKFIAVSLLDNTVKVFFLDSMKFFLSLYGH 569
            T + D+              I SV  SPD K++A    D  ++++ L S K  ++L GH
Sbjct: 351 ATEKGDESSATIQPGSSSDLYIRSVCFSPDGKYLATGAEDKLIRIWDLSSKKILMTLQGH 410

Query: 570 KLPVLSMDISYDSKLIVTCSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLPESYNFFS 629
           +  + S+D       +V+ S D+ ++IW L  G C  +L + +D +  V   P    + +
Sbjct: 411 EQDIYSLDYFPAGDKLVSGSGDRTVRIWDLRTGQCSLTL-SIEDGVTTVAVSPGDGKYIA 469

Query: 630 C-SKDATVKYWDGQKFECIQKL-------AAHQSEVWSISVSNDGTFVISTGHDHSIRVW 681
             S D TV+ WD +    +++L         H+  V+S+  + DG  V+S   D S+++W
Sbjct: 470 AGSLDRTVRVWDSETGFLVERLDSENELSTGHKDSVYSVVFTRDGRSVVSGSLDRSVKLW 529

Query: 682 E 682
           +
Sbjct: 530 D 530

 Score = 74.3 bits (181), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 67/240 (27%), Positives = 108/240 (45%), Gaps = 40/240 (16%)

Query: 37  NLGQVIVGGL-ENILVWDIKTGEQIAQLTDGLPPGASDAKLS------------------ 77
           N G+ +  G  +   V+ + TGE +A+L+D    G ++   S                  
Sbjct: 303 NDGEYLATGCNKTTQVYKVSTGELVARLSDDSVSGINNESSSVVAGNGATEKGDESSATI 362

Query: 78  KPAETTFLK-----YHPETNLLAAGYADGVIKIWDLISKTVLISFNGHKSAITVLAFDTT 132
           +P  ++ L      + P+   LA G  D +I+IWDL SK +L++  GH+  I  L +   
Sbjct: 363 QPGSSSDLYIRSVCFSPDGKYLATGAEDKLIRIWDLSSKKILMTLQGHEQDIYSLDYFPA 422

Query: 133 GTRLISASKDSDIIVWDL-VGESGLYKLRSHKDAITGLWCE--DENWLISTSKDGLVKIW 189
           G +L+S S D  + +WDL  G+  L    S +D +T +     D  ++ + S D  V++W
Sbjct: 423 GDKLVSGSGDRTVRIWDLRTGQCSL--TLSIEDGVTTVAVSPGDGKYIAAGSLDRTVRVW 480

Query: 190 DLKSQQCVET-------HLAHTGECWSLGIIED--MAVTCSADSQVKLWKLDLQAENGSK 240
           D ++   VE           H    +S+    D    V+ S D  VKLW  DL+  NG K
Sbjct: 481 DSETGFLVERLDSENELSTGHKDSVYSVVFTRDGRSVVSGSLDRSVKLW--DLRGLNGQK 538

 Score = 59.7 bits (143), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 54/211 (25%), Positives = 93/211 (44%), Gaps = 39/211 (18%)

Query: 45  GLENILVWDIKTGEQIAQLTDGLPPGASDAKLSKPAETTFLKYHPETNLLAAGYADGVIK 104
           G   + +WD++TG+    LT  +  G +   +S P +  ++         AAG  D  ++
Sbjct: 431 GDRTVRIWDLRTGQ--CSLTLSIEDGVTTVAVS-PGDGKYI---------AAGSLDRTVR 478

Query: 105 IWD-----LISKTVLISFN----GHKSAITVLAFDTTGTRLISASKDSDIIVWDLVGESG 155
           +WD     L+ +  L S N    GHK ++  + F   G  ++S S D  + +WDL G +G
Sbjct: 479 VWDSETGFLVER--LDSENELSTGHKDSVYSVVFTRDGRSVVSGSLDRSVKLWDLRGLNG 536

Query: 156 L-------YKLRSHKDAITGLWC-EDENWLISTSKDGLVKIWDLKSQQCVETHLAHTGEC 207
                        HKD +  +   +D+ +++S SKD  V  WD  S   +     H    
Sbjct: 537 QKSHATCEVTYTGHKDFVLSVATTQDDEYILSGSKDRGVLFWDTASGNPLLMLQGHRNSV 596

Query: 208 WSLGIIE------DMAV--TCSADSQVKLWK 230
            S+ ++       D+ V  T S D + ++WK
Sbjct: 597 ISVAVVNGFPLGPDIGVFATGSGDCKARIWK 627

 Score = 58.9 bits (141), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 37/139 (26%), Positives = 69/139 (49%), Gaps = 2/139 (1%)

Query: 571 LPVLSMDISYDSKLIVTCSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLPESYNFFSC 630
           L + S+  S D K + T + DK I+IW L       +L  H+  I ++ + P      S 
Sbjct: 370 LYIRSVCFSPDGKYLATGAEDKLIRIWDLSSKKILMTLQGHEQDIYSLDYFPAGDKLVSG 429

Query: 631 SKDATVKYWDGQKFECIQKLAAHQSEVWSISVS-NDGTFVISTGHDHSIRVWEETEDQVF 689
           S D TV+ WD +  +C   L+  +  V +++VS  DG ++ +   D ++RVW+     + 
Sbjct: 430 SGDRTVRIWDLRTGQCSLTLSI-EDGVTTVAVSPGDGKYIAAGSLDRTVRVWDSETGFLV 488

Query: 690 LEEEREKEMDEQYEDTLLT 708
              + E E+   ++D++ +
Sbjct: 489 ERLDSENELSTGHKDSVYS 507

 Score = 41.2 bits (95), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 34/139 (24%), Positives = 62/139 (44%), Gaps = 18/139 (12%)

Query: 39  GQVIVGGL--ENILVWDIKTGEQIAQLT--DGLPPGASDAKLSKPAETTFLKYHPETNLL 94
           G+ I  G     + VWD +TG  + +L   + L  G  D+  S      F +   +   +
Sbjct: 465 GKYIAAGSLDRTVRVWDSETGFLVERLDSENELSTGHKDSVYS----VVFTR---DGRSV 517

Query: 95  AAGYADGVIKIWDLIS-------KTVLISFNGHKSAITVLAFDTTGTRLISASKDSDIIV 147
            +G  D  +K+WDL          T  +++ GHK  +  +A       ++S SKD  ++ 
Sbjct: 518 VSGSLDRSVKLWDLRGLNGQKSHATCEVTYTGHKDFVLSVATTQDDEYILSGSKDRGVLF 577

Query: 148 WDLVGESGLYKLRSHKDAI 166
           WD    + L  L+ H++++
Sbjct: 578 WDTASGNPLLMLQGHRNSV 596

>TPHA0M02000 Chr13 complement(414262..416361) [2100 bp, 699 aa] {ON}
           Anc_6.363 YCR084C
          Length = 699

 Score =  107 bits (267), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 90/351 (25%), Positives = 148/351 (42%), Gaps = 85/351 (24%)

Query: 396 ISDDNKLLATASNGSLKIWNIKTKRCI-----------------RSFECG---------- 428
            S+D K LAT  N + +++N+ +   I                 +  E G          
Sbjct: 360 FSNDGKFLATGCNKTTQVYNVASGELIARLSDDSASHITPGQNSKDSEGGEENNDTTTYS 419

Query: 429 ---------YALTCKFLPGGALVVVGTRNGELQLFDIASSTMLDNKEGAHDAAIWSLDLT 479
                    Y  +  F P G  +  G  +  ++++DIA   ++   +G H+  I+SLD  
Sbjct: 420 TSATTSSDLYIRSVCFSPDGKFLATGAEDRLIRIWDIAQKKIIMVLQG-HEQDIYSLDYF 478

Query: 480 SDGRKLVTGSADKTVRFWTFEVSEVPVSDESNKTMPMLQLFHDTTLELDDDILSVVISPD 539
             G KLV+GS D+TVR W     +  +                 TL ++D + +V +SP+
Sbjct: 479 PSGEKLVSGSGDRTVRIWDLRTGQCSL-----------------TLSIEDGVTTVAVSPE 521

Query: 540 D-KFIAVSLLDNTVKVFFLDSMKFFLSLY---------GHKLPVLSMDISYDSKLIVTCS 589
           D K+IA   LD  V+V+  DS   FL            GHK  V S+  + D   +V+ S
Sbjct: 522 DGKYIAAGSLDRAVRVW--DSETGFLVERLDSENELGTGHKDSVYSVVFTRDGNNVVSGS 579

Query: 590 ADKNIKIWGLD-----------FGDCHKSLFAHQDSIMNVKFLPESYNFFSCSKDATVKY 638
            D+++K+W L+            G C  +   H+D +++V          S SKD  V +
Sbjct: 580 LDRSVKLWNLNDANNKDLKPNVPGTCEVTYTGHKDFVLSVATTQGDEYILSGSKDRGVLF 639

Query: 639 WDGQKFECIQKLAAHQSEVWSISVSND-------GTFVISTGHDHSIRVWE 682
           WD +    +  L  H++ V S++V+N        G F   +G D   R+W+
Sbjct: 640 WDTKSGNPLLMLQGHRNSVISVAVANGHPLGTEYGVFATGSG-DCKARIWK 689

 Score = 82.8 bits (203), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 61/239 (25%), Positives = 112/239 (46%), Gaps = 28/239 (11%)

Query: 469 HDAAIWSLDLTSDGRKLVTGSADKTVRFWTFEVSEV--PVSDESNKTMPMLQLFHDT-TL 525
           H + +  +  ++DG+ L TG  +KT + +     E+   +SD+S   +   Q   D+   
Sbjct: 351 HTSVVCCVRFSNDGKFLATG-CNKTTQVYNVASGELIARLSDDSASHITPGQNSKDSEGG 409

Query: 526 ELDDD---------------ILSVVISPDDKFIAVSLLDNTVKVFFLDSMKFFLSLYGHK 570
           E ++D               I SV  SPD KF+A    D  ++++ +   K  + L GH+
Sbjct: 410 EENNDTTTYSTSATTSSDLYIRSVCFSPDGKFLATGAEDRLIRIWDIAQKKIIMVLQGHE 469

Query: 571 LPVLSMDISYDSKLIVTCSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLPESYNFFSC 630
             + S+D     + +V+ S D+ ++IW L  G C  +L + +D +  V   PE   + + 
Sbjct: 470 QDIYSLDYFPSGEKLVSGSGDRTVRIWDLRTGQCSLTL-SIEDGVTTVAVSPEDGKYIAA 528

Query: 631 -SKDATVKYWDGQKFECIQKL-------AAHQSEVWSISVSNDGTFVISTGHDHSIRVW 681
            S D  V+ WD +    +++L         H+  V+S+  + DG  V+S   D S+++W
Sbjct: 529 GSLDRAVRVWDSETGFLVERLDSENELGTGHKDSVYSVVFTRDGNNVVSGSLDRSVKLW 587

 Score = 70.5 bits (171), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 62/232 (26%), Positives = 108/232 (46%), Gaps = 39/232 (16%)

Query: 37  NLGQVIVGGL-ENILVWDIKTGEQIAQLTDG----LPPGASDAKLSKPAETT-------- 83
           N G+ +  G  +   V+++ +GE IA+L+D     + PG  ++K S+  E          
Sbjct: 362 NDGKFLATGCNKTTQVYNVASGELIARLSDDSASHITPG-QNSKDSEGGEENNDTTTYST 420

Query: 84  --------FLK---YHPETNLLAAGYADGVIKIWDLISKTVLISFNGHKSAITVLAFDTT 132
                   +++   + P+   LA G  D +I+IWD+  K +++   GH+  I  L +  +
Sbjct: 421 SATTSSDLYIRSVCFSPDGKFLATGAEDRLIRIWDIAQKKIIMVLQGHEQDIYSLDYFPS 480

Query: 133 GTRLISASKDSDIIVWDL-VGESGLYKLRSHKDAIT--GLWCEDENWLISTSKDGLVKIW 189
           G +L+S S D  + +WDL  G+  L    S +D +T   +  ED  ++ + S D  V++W
Sbjct: 481 GEKLVSGSGDRTVRIWDLRTGQCSL--TLSIEDGVTTVAVSPEDGKYIAAGSLDRAVRVW 538

Query: 190 DLKSQQCVET-------HLAHTGECWSLGIIED--MAVTCSADSQVKLWKLD 232
           D ++   VE           H    +S+    D    V+ S D  VKLW L+
Sbjct: 539 DSETGFLVERLDSENELGTGHKDSVYSVVFTRDGNNVVSGSLDRSVKLWNLN 590

 Score = 55.5 bits (132), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 37/151 (24%), Positives = 74/151 (49%), Gaps = 2/151 (1%)

Query: 571 LPVLSMDISYDSKLIVTCSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLPESYNFFSC 630
           L + S+  S D K + T + D+ I+IW +        L  H+  I ++ + P      S 
Sbjct: 428 LYIRSVCFSPDGKFLATGAEDRLIRIWDIAQKKIIMVLQGHEQDIYSLDYFPSGEKLVSG 487

Query: 631 SKDATVKYWDGQKFECIQKLAAHQSEVWSISVS-NDGTFVISTGHDHSIRVWEETEDQVF 689
           S D TV+ WD +  +C   L+  +  V +++VS  DG ++ +   D ++RVW+     + 
Sbjct: 488 SGDRTVRIWDLRTGQCSLTLSI-EDGVTTVAVSPEDGKYIAAGSLDRAVRVWDSETGFLV 546

Query: 690 LEEEREKEMDEQYEDTLLTSLEGGAGDEMLS 720
              + E E+   ++D++ + +    G+ ++S
Sbjct: 547 ERLDSENELGTGHKDSVYSVVFTRDGNNVVS 577

 Score = 49.7 bits (117), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 52/215 (24%), Positives = 89/215 (41%), Gaps = 43/215 (20%)

Query: 45  GLENILVWDIKTGEQIAQLTDGLPPGASDAKLSKPAETTFLKYHPETNLLAAGYADGVIK 104
           G   + +WD++TG+    LT  +  G +   +S P +  ++         AAG  D  ++
Sbjct: 489 GDRTVRIWDLRTGQ--CSLTLSIEDGVTTVAVS-PEDGKYI---------AAGSLDRAVR 536

Query: 105 IWD-----LISKTVLISFN----GHKSAITVLAFDTTGTRLISASKDSDIIVWDL----- 150
           +WD     L+ +  L S N    GHK ++  + F   G  ++S S D  + +W+L     
Sbjct: 537 VWDSETGFLVER--LDSENELGTGHKDSVYSVVFTRDGNNVVSGSLDRSVKLWNLNDANN 594

Query: 151 ------VGESGLYKLRSHKDAITGLWC-EDENWLISTSKDGLVKIWDLKSQQCVETHLAH 203
                 V  +       HKD +  +   + + +++S SKD  V  WD KS   +     H
Sbjct: 595 KDLKPNVPGTCEVTYTGHKDFVLSVATTQGDEYILSGSKDRGVLFWDTKSGNPLLMLQGH 654

Query: 204 TGECWS--------LGIIEDMAVTCSADSQVKLWK 230
                S        LG    +  T S D + ++WK
Sbjct: 655 RNSVISVAVANGHPLGTEYGVFATGSGDCKARIWK 689

 Score = 42.7 bits (99), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 45/207 (21%), Positives = 86/207 (41%), Gaps = 35/207 (16%)

Query: 7   RFEQANVFGVISSNSNSVWIEPEASKRKTGNLGQVIVGGLEN-ILVWDIKTGEQIAQLT- 64
           R  Q ++   I     +V + PE  K        +  G L+  + VWD +TG  + +L  
Sbjct: 499 RTGQCSLTLSIEDGVTTVAVSPEDGKY-------IAAGSLDRAVRVWDSETGFLVERLDS 551

Query: 65  -DGLPPGASDAKLSKPAETTFLKYHPETNLLAAGYADGVIKIWDL-----------ISKT 112
            + L  G  D+  S      F +   + N + +G  D  +K+W+L           +  T
Sbjct: 552 ENELGTGHKDSVYS----VVFTR---DGNNVVSGSLDRSVKLWNLNDANNKDLKPNVPGT 604

Query: 113 VLISFNGHKSAITVLAFDTTGTRLISASKDSDIIVWDLVGESGLYKLRSHKDAITGLWCE 172
             +++ GHK  +  +A       ++S SKD  ++ WD    + L  L+ H++++  +   
Sbjct: 605 CEVTYTGHKDFVLSVATTQGDEYILSGSKDRGVLFWDTKSGNPLLMLQGHRNSVISVAVA 664

Query: 173 DENWL-------ISTSKDGLVKIWDLK 192
           + + L        + S D   +IW  +
Sbjct: 665 NGHPLGTEYGVFATGSGDCKARIWKYR 691

>KNAG0A02510 Chr1 complement(253245..255794) [2550 bp, 849 aa] {ON}
           Anc_8.435 YLR222C
          Length = 849

 Score =  107 bits (267), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 61/218 (27%), Positives = 108/218 (49%), Gaps = 6/218 (2%)

Query: 485 LVTGSADKTVRFWTFEVSEVPVSDESNKTMPMLQLFHDTTLELDDDILSVVISPDDKFIA 544
           L+T S D T++ W      +P   +  + + +++    T    + DI ++ +SP+D   A
Sbjct: 488 LLTASNDLTIKKWN-----IPKPSDKMEGIHLIKGSEYTRRAHEKDINALSVSPNDSVFA 542

Query: 545 VSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSMDISYDSKLIVTCSADKNIKIWGLDFGDC 604
            +  D T K++ L++ +   +L  HK  +  +      KL+ TCS DK IKIW LD    
Sbjct: 543 TASYDKTSKIWDLETGELTATLANHKRGLWDVSFCQYDKLLATCSGDKTIKIWSLDTFSV 602

Query: 605 HKSLFAHQDSIMNVKFLPESYNFFSCSKDATVKYWDGQKFECIQKLAAHQSEVWSISVSN 664
            ++L  H +++    F+ +     S   D  +K WD    EC++ L  H + +W++++  
Sbjct: 603 VRTLEGHTNAVQRCHFINKQTQLVSSGADGLIKIWDCSSGECVKTLDGHANRIWALTIQR 662

Query: 665 DGTFVISTGHDHSIRVWEE-TEDQVFLEEEREKEMDEQ 701
           DG  + S   D   + W + +E Q   + EREKE+ EQ
Sbjct: 663 DGELIASADADGVFQFWTDCSEQQREQDLEREKELVEQ 700

 Score = 70.5 bits (171), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 138/686 (20%), Positives = 247/686 (36%), Gaps = 133/686 (19%)

Query: 75  KLSKPAETTFLKYHPETNLLAAGYADGVIKIWDLISKTVLISFNGHKSAITVLAFDTTGT 134
           K+S P  +  +     + L+A G  DG I + D+ +  V  SF GH   I+ L F     
Sbjct: 129 KISSP--SYIMDSEATSTLVAVGGTDGSIIVVDIENGYVTHSFKGHGGTISCLKF----- 181

Query: 135 RLISASKDSDIIVWDLVGESGLYKLRSHKDAITGLWCEDENWLISTSKDGLVKIWDLKSQ 194
                            GE+            + +W      L S   +G++K+W+L ++
Sbjct: 182 ----------------FGEAN-----------SNVWL-----LASGDTNGMIKVWNLVTR 209

Query: 195 QCVETHLAHTGECWSLGI---------IEDMAVTCSADSQVKLWKLDLQAENGSKLTEKG 245
           +C  T   HT     + I         ++   ++   D  V  W+LD + +   KL +  
Sbjct: 210 KCTHTVQEHTSAVRGIDIRSISDDTKSMQLQMISGGRDDVVNYWELDNKKK--CKLLQTI 267

Query: 246 IIEKQSKQRGVEIDFAVAPDGVKFFYIQNADKTIEIYRLRKEEEISRALKKREKRLQDKG 305
              +Q +Q G    F  +P      Y    D  ++   L K   + ++ KK  + L   G
Sbjct: 268 PAHQQVEQCG----FIASPGHKNLIYTSGGDAIMQFISLEKGSIVKKS-KKPIEELFIIG 322

Query: 306 MSEEEIKEAMGSPVSLMYHLFQVVRSPYKIKSAQWTVCSNSKLELVVTTSNNSI------ 359
           +      E + S +S     +  V S  K  + +         E  +  ++ +I      
Sbjct: 323 VLPISQGEKLISVMSDQSLHYLDVESNLKATNEE-----ELTYESALAGNHGTIADMVFV 377

Query: 360 --EYYSIPYSKREPTQ---PAPLKLHTIDLH-----------GQRTDIRSTSISDDNKLL 403
             ++  +  +   PT    P PL   T+D +           G    + +   ++D   L
Sbjct: 378 GPKFQHLALATNSPTLRIIPTPLDDSTVDTNNLLPIDVDMYEGHEDLLNAVDATEDGLWL 437

Query: 404 ATASNGSLKI-W-----NIKTKRCIRSFECGYALTCKFLPGGAL------VVVGTRNGEL 451
           ATAS     I W       K K   +      ++T   LP   L      ++  + +  +
Sbjct: 438 ATASKDKTAIVWRYDDETAKFKPYAKFIGHSSSVTAVGLPNVMLRHWPEFLLTASNDLTI 497

Query: 452 QLFDIASSTMLDNKEGAH------------DAAIWSLDLTSDGRKLVTGSADKTVRFWTF 499
           + ++I   +  D  EG H            +  I +L ++ +     T S DKT + W  
Sbjct: 498 KKWNIPKPS--DKMEGIHLIKGSEYTRRAHEKDINALSVSPNDSVFATASYDKTSKIWDL 555

Query: 500 EVSEVPVSDESNKTMPMLQLFHDTTLELDDDILSVVISPDDKFIAVSLLDNTVKVFFLDS 559
           E  E+  +  ++K                  +  V     DK +A    D T+K++ LD+
Sbjct: 556 ETGELTATLANHKR----------------GLWDVSFCQYDKLLATCSGDKTIKIWSLDT 599

Query: 560 MKFFLSLYGHKLPVLSMDISYDSKLIVTCSADKNIKIWGLDFGDCHKSLFAHQDSIMNVK 619
                +L GH   V           +V+  AD  IKIW    G+C K+L  H + I  + 
Sbjct: 600 FSVVRTLEGHTNAVQRCHFINKQTQLVSSGADGLIKIWDCSSGECVKTLDGHANRIWALT 659

Query: 620 FLPESYNFFSCSKDATVKYWDG-------QKFECIQKLAAHQSEVWSISVSND--GTFVI 670
              +     S   D   ++W         Q  E  ++L   +  + +   + D    F++
Sbjct: 660 IQRDGELIASADADGVFQFWTDCSEQQREQDLEREKELVEQEQSLQNYLANEDWANAFLL 719

Query: 671 STGHDHSIRVWEETEDQVFLEEEREK 696
           +   DH +R++      +    E EK
Sbjct: 720 AITLDHPMRLFNVLRQSLHYSPESEK 745

 Score = 56.6 bits (135), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 45/155 (29%), Positives = 72/155 (46%), Gaps = 19/155 (12%)

Query: 51  VWDIKTGEQIAQLTD---GLPPGASDAKLSKPAETTFLKYHPETNLLAAGYADGVIKIWD 107
           +WD++TGE  A L +   GL             + +F +Y     LLA    D  IKIW 
Sbjct: 552 IWDLETGELTATLANHKRGL------------WDVSFCQY---DKLLATCSGDKTIKIWS 596

Query: 108 LISKTVLISFNGHKSAITVLAFDTTGTRLISASKDSDIIVWDLVGESGLYKLRSHKDAIT 167
           L + +V+ +  GH +A+    F    T+L+S+  D  I +WD      +  L  H + I 
Sbjct: 597 LDTFSVVRTLEGHTNAVQRCHFINKQTQLVSSGADGLIKIWDCSSGECVKTLDGHANRIW 656

Query: 168 GLWCEDENWLISTS-KDGLVKIWDLKSQQCVETHL 201
            L  + +  LI+++  DG+ + W   S+Q  E  L
Sbjct: 657 ALTIQRDGELIASADADGVFQFWTDCSEQQREQDL 691

>TBLA0F04240 Chr6 (1043577..1045760) [2184 bp, 727 aa] {ON}
           Anc_6.363 YCR084C
          Length = 727

 Score =  107 bits (266), Expect = 6e-23,   Method: Compositional matrix adjust.
 Identities = 87/344 (25%), Positives = 148/344 (43%), Gaps = 61/344 (17%)

Query: 382 IDLH---GQRTDIRSTSISDDNKLLATASNGSLKIWNIKTKRCIRSFECG---------- 428
           +DLH      + +     S+D + LAT  N + +++   T   I +              
Sbjct: 389 VDLHLSLSHPSVVCCVRFSNDGQFLATGCNKTTRVYKTSTGELIATLLVDPQSSNNSNSE 448

Query: 429 ----------YALTCKFLPGGALVVVGTRNGELQLFDIASSTMLDNKEGAHDAAIWSLDL 478
                     Y  +  F P G  +  G  +  ++++DI +  ++   +G H+  I+SLD 
Sbjct: 449 QQTNPESSDLYIRSVCFSPDGKFLAAGAEDKLIRIWDITTKQIVMILKG-HEQDIYSLDY 507

Query: 479 TSDGRKLVTGSADKTVRFWTFEVSEVPVSDESNKTMPMLQLFHDTTLELDDDILSVVISP 538
              G KLV+GS DKTVR W     +  +                 TL ++D + +V  SP
Sbjct: 508 FPSGEKLVSGSGDKTVRIWDLRTGQCSL-----------------TLSIEDGVTTVSSSP 550

Query: 539 DD-KFIAVSLLDNTVKV------FFLDSMKFFLSLY-GHKLPVLSMDISYDSKLIVTCSA 590
           ++ KFIA   LD + ++      F L  +     L  GHK  + S+  + D K +V+ S 
Sbjct: 551 NNGKFIAAGSLDRSARIWDTETGFLLKRLDSQTDLQNGHKDSIYSVSFTKDGKKLVSGSL 610

Query: 591 DKNIKIWGLDFGD------CHKSLFAHQDSIMNVKFLPESYNFFSCSKDATVKYWDGQKF 644
           D+++K+W LD  +      C  +   H+D +++V          S SKD  V +WD    
Sbjct: 611 DRSVKLWNLDTTNNNSNESCEVTFIGHKDFVLSVTTSQNDEYVLSGSKDRGVLFWDTNSG 670

Query: 645 ECIQKLAAHQSEVWSISVSNDGTF-----VISTGH-DHSIRVWE 682
             +  L  H++ V S++V+N         V STG  D + ++W 
Sbjct: 671 NPLLMLQGHKNSVISVAVANGQPLGPEFGVFSTGSGDFTAKIWR 714

 Score = 75.9 bits (185), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 67/232 (28%), Positives = 107/232 (46%), Gaps = 25/232 (10%)

Query: 37  NLGQVIVGGL-ENILVWDIKTGEQIAQL-TDGLPPGASDAKLSKPAETTFLK-----YHP 89
           N GQ +  G  +   V+   TGE IA L  D      S+++     E++ L      + P
Sbjct: 408 NDGQFLATGCNKTTRVYKTSTGELIATLLVDPQSSNNSNSEQQTNPESSDLYIRSVCFSP 467

Query: 90  ETNLLAAGYADGVIKIWDLISKTVLISFNGHKSAITVLAFDTTGTRLISASKDSDIIVWD 149
           +   LAAG  D +I+IWD+ +K +++   GH+  I  L +  +G +L+S S D  + +WD
Sbjct: 468 DGKFLAAGAEDKLIRIWDITTKQIVMILKGHEQDIYSLDYFPSGEKLVSGSGDKTVRIWD 527

Query: 150 L-VGESGLYKLRSHKDAITGLWCEDEN--WLISTSKDGLVKIWD---------LKSQQCV 197
           L  G+  L    S +D +T +     N  ++ + S D   +IWD         L SQ  +
Sbjct: 528 LRTGQCSL--TLSIEDGVTTVSSSPNNGKFIAAGSLDRSARIWDTETGFLLKRLDSQTDL 585

Query: 198 ETHLAHTGECWSLGIIED--MAVTCSADSQVKLWKLDLQAENGSKLTEKGII 247
           +    H    +S+   +D    V+ S D  VKLW LD    N ++  E   I
Sbjct: 586 QN--GHKDSIYSVSFTKDGKKLVSGSLDRSVKLWNLDTTNNNSNESCEVTFI 635

 Score = 58.2 bits (139), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 42/149 (28%), Positives = 64/149 (42%), Gaps = 12/149 (8%)

Query: 573 VLSMDISYDSKLIVTCSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLPESYNFFSCSK 632
           + S+  S D K +   + DK I+IW +        L  H+  I ++ + P      S S 
Sbjct: 460 IRSVCFSPDGKFLAAGAEDKLIRIWDITTKQIVMILKGHEQDIYSLDYFPSGEKLVSGSG 519

Query: 633 DATVKYWDGQKFECIQKLAAHQSEVWSISVSNDGTFVISTGHDHSIRVWEETEDQVFLEE 692
           D TV+ WD +  +C   L+         S  N+G F+ +   D S R+W +TE    L  
Sbjct: 520 DKTVRIWDLRTGQCSLTLSIEDGVTTVSSSPNNGKFIAAGSLDRSARIW-DTETGFLL-- 576

Query: 693 EREKEMDEQYEDTLLTSLEGGAGDEMLSV 721
              K +D Q      T L+ G  D + SV
Sbjct: 577 ---KRLDSQ------TDLQNGHKDSIYSV 596

 Score = 57.4 bits (137), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 52/208 (25%), Positives = 86/208 (41%), Gaps = 34/208 (16%)

Query: 45  GLENILVWDIKTGEQIAQLTDGLPPGASDAKLSKPAETTFLKYHPETNLLAAGYADGVIK 104
           G + + +WD++TG+    LT  +  G +    S P    F+         AAG  D   +
Sbjct: 519 GDKTVRIWDLRTGQ--CSLTLSIEDGVTTVS-SSPNNGKFI---------AAGSLDRSAR 566

Query: 105 IWDLISKTVLISF-------NGHKSAITVLAFDTTGTRLISASKDSDIIVWDL------V 151
           IWD  +  +L          NGHK +I  ++F   G +L+S S D  + +W+L       
Sbjct: 567 IWDTETGFLLKRLDSQTDLQNGHKDSIYSVSFTKDGKKLVSGSLDRSVKLWNLDTTNNNS 626

Query: 152 GESGLYKLRSHKDAITGLWC-EDENWLISTSKDGLVKIWDLKSQQCVETHLAHTGECWSL 210
            ES       HKD +  +   +++ +++S SKD  V  WD  S   +     H     S+
Sbjct: 627 NESCEVTFIGHKDFVLSVTTSQNDEYVLSGSKDRGVLFWDTNSGNPLLMLQGHKNSVISV 686

Query: 211 GIIEDMAV--------TCSADSQVKLWK 230
            +     +        T S D   K+W+
Sbjct: 687 AVANGQPLGPEFGVFSTGSGDFTAKIWR 714

 Score = 41.2 bits (95), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 46/171 (26%), Positives = 76/171 (44%), Gaps = 26/171 (15%)

Query: 37  NLGQVIVGGL--ENILVWDIKTGEQIAQL---TDGLPPGASDAKLSKPAETTFLKYHPET 91
           N G+ I  G    +  +WD +TG  + +L   TD L  G  D+  S     +F K   + 
Sbjct: 551 NNGKFIAAGSLDRSARIWDTETGFLLKRLDSQTD-LQNGHKDSIYS----VSFTK---DG 602

Query: 92  NLLAAGYADGVIKIWDL------ISKTVLISFNGHKSAITVLAFDTTGTRLISASKDSDI 145
             L +G  D  +K+W+L       +++  ++F GHK  +  +        ++S SKD  +
Sbjct: 603 KKLVSGSLDRSVKLWNLDTTNNNSNESCEVTFIGHKDFVLSVTTSQNDEYVLSGSKDRGV 662

Query: 146 IVWDLVGESGLYKLRSHKDAI------TGLWCEDENWLIST-SKDGLVKIW 189
           + WD    + L  L+ HK+++       G     E  + ST S D   KIW
Sbjct: 663 LFWDTNSGNPLLMLQGHKNSVISVAVANGQPLGPEFGVFSTGSGDFTAKIW 713

>KLLA0F10263g Chr6 (949926..951974) [2049 bp, 682 aa] {ON}
           uniprot|P56094 Kluyveromyces lactis KLLA0F10263g TUP1
           Transcriptional repressor TUP1
          Length = 682

 Score =  106 bits (264), Expect = 8e-23,   Method: Compositional matrix adjust.
 Identities = 78/294 (26%), Positives = 135/294 (45%), Gaps = 41/294 (13%)

Query: 429 YALTCKFLPGGALVVVGTRNGELQLFDIASSTMLDNKEGAHDAAIWSLDLTSDGRKLVTG 488
           Y  +  F P G  +  G  +  ++++D+ +  ++   +G H+  I+SLD    G KLV+G
Sbjct: 408 YIRSVCFSPDGKFLATGAEDKLIRIWDLETKKIVMTLKG-HEQDIYSLDYFPSGNKLVSG 466

Query: 489 SADKTVRFWTFEVSEVPVSDESNKTMPMLQLFHDTTLELDDDILSVVISP-DDKFIAVSL 547
           S D+TVR W        +                 TL ++D + +V +SP + KFIA   
Sbjct: 467 SGDRTVRIWDLTTGTCSL-----------------TLSIEDGVTTVAVSPGEGKFIAAGS 509

Query: 548 LDNTVKVFFLDSMKFFLSL-------YGHKLPVLSMDISYDSKLIVTCSADKNIKIWGLD 600
           LD TV+V+  D+      L        GH+  V S+  + D K +V+ S D+++K+W L+
Sbjct: 510 LDRTVRVWDSDTGFLVERLDSENELGTGHRDSVYSVVFTRDGKGVVSGSLDRSVKLWNLN 569

Query: 601 -------FGDCHKSLFAHQDSIMNVKFLPESYNFFSCSKDATVKYWDGQKFECIQKLAAH 653
                    +C  +   H+D +++V          S SKD  V +WD +    +  L  H
Sbjct: 570 GLSGQKSHAECEVTYTGHKDFVLSVATTQNDEYILSGSKDRGVLFWDTKSGNPLLMLQGH 629

Query: 654 QSEVWSISVSND-------GTFVISTGHDHSIRVWEETEDQVFLEEEREKEMDE 700
           ++ V S++V+N        G F   +G D   R+W+ ++        + KE+ E
Sbjct: 630 RNSVISVTVANGHPLGPEYGVFATGSG-DCKARIWKYSKKNSQQNSTQIKEIKE 682

 Score = 73.2 bits (178), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 70/271 (25%), Positives = 126/271 (46%), Gaps = 38/271 (14%)

Query: 391 IRSTSISDDNKLLATASNGSL-KIWNIKTKRCIRSFECG----YALTCKFLPGGALVVVG 445
           IRS   S D K LAT +   L +IW+++TK+ + + +      Y+L   + P G  +V G
Sbjct: 409 IRSVCFSPDGKFLATGAEDKLIRIWDLETKKIVMTLKGHEQDIYSL--DYFPSGNKLVSG 466

Query: 446 TRNGELQLFDIASST---MLDNKEGAHDAAIWSLDLTSDGRKLVTGSADKTVRFWTFEVS 502
           + +  ++++D+ + T    L  ++G    A+       +G+ +  GS D+TVR W  +  
Sbjct: 467 SGDRTVRIWDLTTGTCSLTLSIEDGVTTVAVSP----GEGKFIAAGSLDRTVRVWDSDTG 522

Query: 503 -EVPVSDESNKTMPMLQLFHDTTLELDDDILSVVISPDDKFIAVSLLDNTVKVFFLDSM- 560
             V   D  N+    L   H       D + SVV + D K +    LD +VK++ L+ + 
Sbjct: 523 FLVERLDSENE----LGTGH------RDSVYSVVFTRDGKGVVSGSLDRSVKLWNLNGLS 572

Query: 561 ------KFFLSLYGHKLPVLSMDISYDSKLIVTCSADKNIKIWGLDFGDCHKSLFAHQDS 614
                 +  ++  GHK  VLS+  + + + I++ S D+ +  W    G+    L  H++S
Sbjct: 573 GQKSHAECEVTYTGHKDFVLSVATTQNDEYILSGSKDRGVLFWDTKSGNPLLMLQGHRNS 632

Query: 615 IMNVKFL------PESYNFFSCSKDATVKYW 639
           +++V         PE   F + S D   + W
Sbjct: 633 VISVTVANGHPLGPEYGVFATGSGDCKARIW 663

 Score = 66.2 bits (160), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 46/158 (29%), Positives = 77/158 (48%), Gaps = 14/158 (8%)

Query: 87  YHPETNLLAAGYADGVIKIWDLISKTVLISFNGHKSAITVLAFDTTGTRLISASKDSDII 146
           + P+   LA G  D +I+IWDL +K ++++  GH+  I  L +  +G +L+S S D  + 
Sbjct: 414 FSPDGKFLATGAEDKLIRIWDLETKKIVMTLKGHEQDIYSLDYFPSGNKLVSGSGDRTVR 473

Query: 147 VWDLVGESGLYKLR-SHKDAITGLWCE--DENWLISTSKDGLVKIWDLKSQQCVET---- 199
           +WDL   +G   L  S +D +T +     +  ++ + S D  V++WD  +   VE     
Sbjct: 474 IWDLT--TGTCSLTLSIEDGVTTVAVSPGEGKFIAAGSLDRTVRVWDSDTGFLVERLDSE 531

Query: 200 ---HLAHTGECWSLGIIED--MAVTCSADSQVKLWKLD 232
                 H    +S+    D    V+ S D  VKLW L+
Sbjct: 532 NELGTGHRDSVYSVVFTRDGKGVVSGSLDRSVKLWNLN 569

 Score = 59.3 bits (142), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 64/264 (24%), Positives = 108/264 (40%), Gaps = 28/264 (10%)

Query: 453 LFDIASSTMLD---NKEGAHDAAIWSLDLTSDGRKLVTGSADKTVRFWTFEVSEV--PVS 507
           L + A  T LD   +K   H + +  +  +SDG  L TG  +KT + +     E+   +S
Sbjct: 301 LHNPALPTDLDVELHKSLEHSSVVCCVRFSSDGEFLATG-CNKTTQVYKVSTGELVARLS 359

Query: 508 DESNKTMPMLQLFHDTTLELDDDILSVVISPDDKFIAVSLLDNTVKVFFLDSMKFFLSLY 567
           D+S             T E      +   + D      S         ++ S+ F     
Sbjct: 360 DDSASQPQPQPQNQTVTAETSTSNSNGSSAEDGTGNQNSAASTASSDLYIRSVCF----- 414

Query: 568 GHKLPVLSMDISYDSKLIVTCSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLPESYNF 627
                      S D K + T + DK I+IW L+      +L  H+  I ++ + P     
Sbjct: 415 -----------SPDGKFLATGAEDKLIRIWDLETKKIVMTLKGHEQDIYSLDYFPSGNKL 463

Query: 628 FSCSKDATVKYWDGQKFECIQKLAAHQSEVWSISVS-NDGTFVISTGHDHSIRVWEETED 686
            S S D TV+ WD     C   L+  +  V +++VS  +G F+ +   D ++RVW+   D
Sbjct: 464 VSGSGDRTVRIWDLTTGTCSLTLSI-EDGVTTVAVSPGEGKFIAAGSLDRTVRVWD--SD 520

Query: 687 QVFLEE--EREKEMDEQYEDTLLT 708
             FL E  + E E+   + D++ +
Sbjct: 521 TGFLVERLDSENELGTGHRDSVYS 544

 Score = 57.8 bits (138), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 57/232 (24%), Positives = 104/232 (44%), Gaps = 26/232 (11%)

Query: 382 IDLHGQRTDIRSTS-ISDDNKLLATASNGSLKIWNIKTKRC--IRSFECGYALTCKFLPG 438
           + L G   DI S       NKL++ + + +++IW++ T  C    S E G   T    PG
Sbjct: 442 MTLKGHEQDIYSLDYFPSGNKLVSGSGDRTVRIWDLTTGTCSLTLSIEDGVT-TVAVSPG 500

Query: 439 -GALVVVGTRNGELQLFDIASSTML-----DNKEG-AHDAAIWSLDLTSDGRKLVTGSAD 491
            G  +  G+ +  ++++D  +  ++     +N+ G  H  +++S+  T DG+ +V+GS D
Sbjct: 501 EGKFIAAGSLDRTVRVWDSDTGFLVERLDSENELGTGHRDSVYSVVFTRDGKGVVSGSLD 560

Query: 492 KTVRFWTFEVSEVPVSDESNKTMPMLQLFHDTTLELDDDILSVVISPDDKFIAVSLLDNT 551
           ++V+ W           +S+    +    H       D +LSV  + +D++I     D  
Sbjct: 561 RSVKLWNLNGLS---GQKSHAECEVTYTGH------KDFVLSVATTQNDEYILSGSKDRG 611

Query: 552 VKVFFLDSMKFFLSLYGHKLPVLSMDISYDSKL------IVTCSADKNIKIW 597
           V  +   S    L L GH+  V+S+ ++    L        T S D   +IW
Sbjct: 612 VLFWDTKSGNPLLMLQGHRNSVISVTVANGHPLGPEYGVFATGSGDCKARIW 663

 Score = 55.5 bits (132), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 55/211 (26%), Positives = 89/211 (42%), Gaps = 39/211 (18%)

Query: 45  GLENILVWDIKTGEQIAQLTDGLPPGASDAKLSKPAETTFLKYHPETNLLAAGYADGVIK 104
           G   + +WD+ TG     LT  +  G +   +S P E  F+         AAG  D  ++
Sbjct: 468 GDRTVRIWDLTTG--TCSLTLSIEDGVTTVAVS-PGEGKFI---------AAGSLDRTVR 515

Query: 105 IWD-----LISKTVLISFN----GHKSAITVLAFDTTGTRLISASKDSDIIVWDLVGESG 155
           +WD     L+ +  L S N    GH+ ++  + F   G  ++S S D  + +W+L G SG
Sbjct: 516 VWDSDTGFLVER--LDSENELGTGHRDSVYSVVFTRDGKGVVSGSLDRSVKLWNLNGLSG 573

Query: 156 L-------YKLRSHKDAITGLWC-EDENWLISTSKDGLVKIWDLKSQQCVETHLAHTGEC 207
                        HKD +  +   +++ +++S SKD  V  WD KS   +     H    
Sbjct: 574 QKSHAECEVTYTGHKDFVLSVATTQNDEYILSGSKDRGVLFWDTKSGNPLLMLQGHRNSV 633

Query: 208 WS--------LGIIEDMAVTCSADSQVKLWK 230
            S        LG    +  T S D + ++WK
Sbjct: 634 ISVTVANGHPLGPEYGVFATGSGDCKARIWK 664

 Score = 49.7 bits (117), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 40/164 (24%), Positives = 69/164 (42%), Gaps = 21/164 (12%)

Query: 85  LKYHPETNLLAAGYADGVIKIWDLISKTVLISFNGHKSAITVLAFDTTGTRLISASKDSD 144
           L Y P  N L +G  D  ++IWDL + T  ++ +      TV      G  + + S D  
Sbjct: 454 LDYFPSGNKLVSGSGDRTVRIWDLTTGTCSLTLSIEDGVTTVAVSPGEGKFIAAGSLDRT 513

Query: 145 IIVWDLVGESGLYKLR---------SHKDAI-TGLWCEDENWLISTSKDGLVKIWDLKS- 193
           + VWD   ++G    R          H+D++ + ++  D   ++S S D  VK+W+L   
Sbjct: 514 VRVWD--SDTGFLVERLDSENELGTGHRDSVYSVVFTRDGKGVVSGSLDRSVKLWNLNGL 571

Query: 194 ------QQCVETHLAHTGECWSLGIIED--MAVTCSADSQVKLW 229
                  +C  T+  H     S+   ++    ++ S D  V  W
Sbjct: 572 SGQKSHAECEVTYTGHKDFVLSVATTQNDEYILSGSKDRGVLFW 615

 Score = 35.8 bits (81), Expect = 0.58,   Method: Compositional matrix adjust.
 Identities = 36/169 (21%), Positives = 71/169 (42%), Gaps = 25/169 (14%)

Query: 39  GQVIVGGL--ENILVWDIKTGEQIAQLT--DGLPPGASDAKLSKPAETTFLKYHPETNLL 94
           G+ I  G     + VWD  TG  + +L   + L  G  D+  S       + +  +   +
Sbjct: 502 GKFIAAGSLDRTVRVWDSDTGFLVERLDSENELGTGHRDSVYS-------VVFTRDGKGV 554

Query: 95  AAGYADGVIKIWDLISKT-------VLISFNGHKSAITVLAFDTTGTRLISASKDSDIIV 147
            +G  D  +K+W+L   +         +++ GHK  +  +A       ++S SKD  ++ 
Sbjct: 555 VSGSLDRSVKLWNLNGLSGQKSHAECEVTYTGHKDFVLSVATTQNDEYILSGSKDRGVLF 614

Query: 148 WDLVGESGLYKLRSHKDAITGLWCEDENWL-------ISTSKDGLVKIW 189
           WD    + L  L+ H++++  +   + + L        + S D   +IW
Sbjct: 615 WDTKSGNPLLMLQGHRNSVISVTVANGHPLGPEYGVFATGSGDCKARIW 663

>KLTH0E10120g Chr5 (916575..919055) [2481 bp, 826 aa] {ON} highly
           similar to uniprot|Q05946 Saccharomyces cerevisiae
           YLR222C UTP13 Nucleolar protein component of the small
           subunit (SSU) processome containing the U3 snoRNA that
           is involved in processing of pre-18S rRNA
          Length = 826

 Score =  106 bits (264), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 64/226 (28%), Positives = 111/226 (49%), Gaps = 9/226 (3%)

Query: 485 LVTGSADKTVRFWTFEVSEVPVSDESNKTMPMLQLFHDTTLELDDDILSVVISPDDKFIA 544
           ++T S D T++ WT     VP          ++++   T    D DI ++ ISP+D   A
Sbjct: 469 IITASNDLTIKKWT-----VPKPGHETAEPHVVKVSDYTRRAHDKDINALSISPNDSTFA 523

Query: 545 VSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSMDISYDSKLIVTCSADKNIKIWGLDFGDC 604
            +  D T KV+ +DS +   +L  HK  +  +      KL+ TCS DK +K+W LD    
Sbjct: 524 TASYDKTCKVWDVDSGELQGTLANHKRGLWDVSFCQYDKLLATCSGDKTVKVWSLDTLSV 583

Query: 605 HKSLFAHQDSIMNVKFLPESYNFFSCSKDATVKYWDGQKFECIQKLAAHQSEVWSISVSN 664
            K+L  H +++    F+ ++    S   D  +K WD    EC++ L AH++ +W++SV +
Sbjct: 584 VKTLEGHTNAVQRCSFINKNKQLVSTGADGLIKLWDLSTGECVRTLDAHENRIWALSVLH 643

Query: 665 DGTFVISTGHDHSIRVW----EETEDQVFLEEEREKEMDEQYEDTL 706
           DG   ++   D   + W    EE E +     +R+ E D+  ++ +
Sbjct: 644 DGDEFVTADADGVFQFWKDCSEEQEKENLENHKRKVEQDQSLQNYM 689

 Score = 72.0 bits (175), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 46/149 (30%), Positives = 70/149 (46%), Gaps = 3/149 (2%)

Query: 85  LKYHPETNLLAAGYADGVIKIWDLISKTVLISFNGHKSAITVLAFDTTGTRLISASKDSD 144
           L   P  +  A    D   K+WD+ S  +  +   HK  +  ++F      L + S D  
Sbjct: 513 LSISPNDSTFATASYDKTCKVWDVDSGELQGTLANHKRGLWDVSFCQYDKLLATCSGDKT 572

Query: 145 IIVWDLVGESGLYKLRSHKDAITGLWCEDEN-WLISTSKDGLVKIWDLKSQQCVETHLAH 203
           + VW L   S +  L  H +A+      ++N  L+ST  DGL+K+WDL + +CV T  AH
Sbjct: 573 VKVWSLDTLSVVKTLEGHTNAVQRCSFINKNKQLVSTGADGLIKLWDLSTGECVRTLDAH 632

Query: 204 TGECWSLGIIEDMA--VTCSADSQVKLWK 230
               W+L ++ D    VT  AD   + WK
Sbjct: 633 ENRIWALSVLHDGDEFVTADADGVFQFWK 661

 Score = 51.6 bits (122), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 41/195 (21%), Positives = 80/195 (41%), Gaps = 47/195 (24%)

Query: 349 ELVVTTSNN-SIEYYSIPYSKREPTQPAPLKLHTIDLHGQRTDIRSTSISDDNKLLATAS 407
           E ++T SN+ +I+ +++P    E  +P  +K+          DI + SIS ++   ATAS
Sbjct: 467 EFIITASNDLTIKKWTVPKPGHETAEPHVVKVSDYTRRAHDKDINALSISPNDSTFATAS 526

Query: 408 -------------------------------------------NGSLKIWNIKTKRCIRS 424
                                                      + ++K+W++ T   +++
Sbjct: 527 YDKTCKVWDVDSGELQGTLANHKRGLWDVSFCQYDKLLATCSGDKTVKVWSLDTLSVVKT 586

Query: 425 FE--CGYALTCKFLPGGALVVVGTRNGELQLFDIASSTMLDNKEGAHDAAIWSLDLTSDG 482
            E        C F+     +V    +G ++L+D+++   +   + AH+  IW+L +  DG
Sbjct: 587 LEGHTNAVQRCSFINKNKQLVSTGADGLIKLWDLSTGECVRTLD-AHENRIWALSVLHDG 645

Query: 483 RKLVTGSADKTVRFW 497
            + VT  AD   +FW
Sbjct: 646 DEFVTADADGVFQFW 660

 Score = 51.2 bits (121), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 36/120 (30%), Positives = 61/120 (50%), Gaps = 10/120 (8%)

Query: 89  PETNLLAAGYADGVIKIWDLISKTVLISFNGHKSAITVLAF----DTTGTRLISASKDSD 144
           P + L+A G  DG + + D+ +  V  S  GH + I+ + F    ++T  RL S   +  
Sbjct: 111 PSSTLVALGGTDGSVSVIDIENGYVTHSLKGHGATISSVKFFGELNSTTWRLGSGDTNGV 170

Query: 145 IIVWDLVGESGLYKLRSHKDAITGL------WCEDENWLISTSKDGLVKIWDLKSQQCVE 198
           + VWDLV  S L+ ++ H  A+ GL        +D   L+S  +D +V ++ L S + V+
Sbjct: 171 VKVWDLVRRSCLHTIQEHAAAVRGLDFRVSDADDDVLELLSGGRDDIVNLYQLGSTKKVK 230

 Score = 42.7 bits (99), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 48/191 (25%), Positives = 87/191 (45%), Gaps = 18/191 (9%)

Query: 375 APLK--LHTIDLHGQRTDIRSTSISDDNKLLATASNGSL-KIWNIKTKRCIRSFECG--- 428
           AP K  LH I+ +    +I +  ++ D + L   S   L +I+++++KR +RS +     
Sbjct: 46  APTKRVLHRIE-NDDEQEITALKLTPDGEYLCYVSQAQLLRIYHLRSKRVVRSMKVSSPV 104

Query: 429 YALTCKFLPGGALVVVGTRNGELQLFDIASSTMLDNKEGAHDAAIWSL----DLTSDGRK 484
           Y + C   P   LV +G  +G + + DI +  +  + +G H A I S+    +L S   +
Sbjct: 105 YVIDCD--PSSTLVALGGTDGSVSVIDIENGYVTHSLKG-HGATISSVKFFGELNSTTWR 161

Query: 485 LVTGSADKTVRFWTF-EVSEVPVSDESNKTMPMLQLFHDTTLELDDDILSVVISPDDKFI 543
           L +G  +  V+ W     S +    E    +  L        + DDD+L ++    D  +
Sbjct: 162 LGSGDTNGVVKVWDLVRRSCLHTIQEHAAAVRGLDF---RVSDADDDVLELLSGGRDDIV 218

Query: 544 AVSLLDNTVKV 554
            +  L +T KV
Sbjct: 219 NLYQLGSTKKV 229

 Score = 39.7 bits (91), Expect = 0.036,   Method: Compositional matrix adjust.
 Identities = 34/135 (25%), Positives = 52/135 (38%), Gaps = 19/135 (14%)

Query: 117 FNGHKSAITVLAFDTTGTR-----LISASKDSDIIVWDL-----------VGESGLYKLR 160
           F GH   +T +             +I+AS D  I  W +           V +   Y  R
Sbjct: 445 FTGHAGPVTAVGLPNVMRSAWPEFIITASNDLTIKKWTVPKPGHETAEPHVVKVSDYTRR 504

Query: 161 SHKDAITGL-WCEDENWLISTSKDGLVKIWDLKSQQCVETHLAHTGECWSLGIIE--DMA 217
           +H   I  L    +++   + S D   K+WD+ S +   T   H    W +   +   + 
Sbjct: 505 AHDKDINALSISPNDSTFATASYDKTCKVWDVDSGELQGTLANHKRGLWDVSFCQYDKLL 564

Query: 218 VTCSADSQVKLWKLD 232
            TCS D  VK+W LD
Sbjct: 565 ATCSGDKTVKVWSLD 579

 Score = 33.1 bits (74), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 37/148 (25%), Positives = 63/148 (42%), Gaps = 25/148 (16%)

Query: 558 DSMKFFLSLY-GHKLPVLSMDISYDSKLIVTCSADKNIKIWG----LDFGDCHKSLFAHQ 612
           D     + LY GH   + ++D S D K + TCS D  + +W     L+    +     H 
Sbjct: 390 DCFPLEVELYEGHTDLLNALDSSEDGKWLATCSKDHTVILWRYSSELEKFKAYAKFTGHA 449

Query: 613 DSIMNVKFLPESYN------FFSCSKDATVKYWDGQKF------ECIQKLA-----AHQS 655
             +  V  LP            + S D T+K W   K         + K++     AH  
Sbjct: 450 GPVTAVG-LPNVMRSAWPEFIITASNDLTIKKWTVPKPGHETAEPHVVKVSDYTRRAHDK 508

Query: 656 EVWSISVS-NDGTFVISTGHDHSIRVWE 682
           ++ ++S+S ND TF  ++ +D + +VW+
Sbjct: 509 DINALSISPNDSTFATAS-YDKTCKVWD 535

>SAKL0A00660g Chr1 (71855..73837) [1983 bp, 660 aa] {ON} some
           similarities with uniprot|P18323 Saccharomyces
           cerevisiae YCR084C
          Length = 660

 Score =  105 bits (262), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 79/300 (26%), Positives = 138/300 (46%), Gaps = 51/300 (17%)

Query: 429 YALTCKFLPGGALVVVGTRNGELQLFDIASSTMLDNKEGAHDAAIWSLDLTSDGRKLVTG 488
           Y  +  F P G  +  G  +  ++++D+++  ++   +G H+  I+SLD    G KLV+G
Sbjct: 380 YIRSVCFSPDGKFLATGAEDKLIRIWDLSTKRIVMTLQG-HEQDIYSLDYFPSGDKLVSG 438

Query: 489 SADKTVRFWTFEVSEVPVSDESNKTMPMLQLFHDTTLELDDDILSVVISPDD-KFIAVSL 547
           S D+TVR W     +  +                 TL ++D + +V +SP + KFIA   
Sbjct: 439 SGDRTVRIWDLRTGQCSL-----------------TLSIEDGVTTVAVSPGEGKFIAAGS 481

Query: 548 LDNTVKVFFLDSMKFFLSLY---------GHKLPVLSMDISYDSKLIVTCSADKNIKIWG 598
           LD T++V+  DS   FL            GHK  V S+  + D + +V+ S D+++K+W 
Sbjct: 482 LDRTLRVW--DSETGFLVERLDSENELGTGHKDSVYSVVFTRDGQGVVSGSLDRSVKLWN 539

Query: 599 LD-------------FGDCHKSLFAHQDSIMNVKFLPESYNFFSCSKDATVKYWDGQKFE 645
           L                 C  +   H+D +++V          S SKD  V +WD Q   
Sbjct: 540 LHNTGSSSKNDSKPTAATCEVTYTGHKDFVLSVATTQNDKYILSGSKDRGVLFWDTQSGN 599

Query: 646 CIQKLAAHQSEVWSISVSND-------GTFVISTGHDHSIRVWEETEDQVFLEEEREKEM 698
            +  L  H++ V S++V+N        G F   +G D   R+W+ ++++    E + +E+
Sbjct: 600 PLLMLQGHRNSVISVAVANGFPLGPDYGVFATGSG-DCKARIWKYSKNKANASEPQVQEV 658

 Score = 83.2 bits (204), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 59/238 (24%), Positives = 107/238 (44%), Gaps = 27/238 (11%)

Query: 469 HDAAIWSLDLTSDGRKLVTGSADKTVRFWTFEVSEV--PVSDESNKTMPMLQLFHDTT-- 524
           H + +  +  ++DG  L TG  +KT + +      +   +SD+S  T     +  D    
Sbjct: 303 HSSVVCCVRFSNDGEYLATG-CNKTTQVYKVSTGALVARLSDDSASTTANSSISQDANNS 361

Query: 525 -------------LELDDDILSVVISPDDKFIAVSLLDNTVKVFFLDSMKFFLSLYGHKL 571
                           D  I SV  SPD KF+A    D  ++++ L + +  ++L GH+ 
Sbjct: 362 GENGENAVSSASTSSSDLYIRSVCFSPDGKFLATGAEDKLIRIWDLSTKRIVMTLQGHEQ 421

Query: 572 PVLSMDISYDSKLIVTCSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLPESYNFFSC- 630
            + S+D       +V+ S D+ ++IW L  G C  +L + +D +  V   P    F +  
Sbjct: 422 DIYSLDYFPSGDKLVSGSGDRTVRIWDLRTGQCSLTL-SIEDGVTTVAVSPGEGKFIAAG 480

Query: 631 SKDATVKYWDGQKFECIQKL-------AAHQSEVWSISVSNDGTFVISTGHDHSIRVW 681
           S D T++ WD +    +++L         H+  V+S+  + DG  V+S   D S+++W
Sbjct: 481 SLDRTLRVWDSETGFLVERLDSENELGTGHKDSVYSVVFTRDGQGVVSGSLDRSVKLW 538

 Score = 65.9 bits (159), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 56/229 (24%), Positives = 105/229 (45%), Gaps = 36/229 (15%)

Query: 37  NLGQVIVGGL-ENILVWDIKTGEQIAQLTDGLPPGASDAKLSKPAETT------------ 83
           N G+ +  G  +   V+ + TG  +A+L+D      +++ +S+ A  +            
Sbjct: 314 NDGEYLATGCNKTTQVYKVSTGALVARLSDDSASTTANSSISQDANNSGENGENAVSSAS 373

Query: 84  ------FLK---YHPETNLLAAGYADGVIKIWDLISKTVLISFNGHKSAITVLAFDTTGT 134
                 +++   + P+   LA G  D +I+IWDL +K ++++  GH+  I  L +  +G 
Sbjct: 374 TSSSDLYIRSVCFSPDGKFLATGAEDKLIRIWDLSTKRIVMTLQGHEQDIYSLDYFPSGD 433

Query: 135 RLISASKDSDIIVWDL-VGESGLYKLRSHKDAITGLWCE--DENWLISTSKDGLVKIWDL 191
           +L+S S D  + +WDL  G+  L    S +D +T +     +  ++ + S D  +++WD 
Sbjct: 434 KLVSGSGDRTVRIWDLRTGQCSL--TLSIEDGVTTVAVSPGEGKFIAAGSLDRTLRVWDS 491

Query: 192 KSQQCVET-------HLAHTGECWSLGIIED--MAVTCSADSQVKLWKL 231
           ++   VE           H    +S+    D    V+ S D  VKLW L
Sbjct: 492 ETGFLVERLDSENELGTGHKDSVYSVVFTRDGQGVVSGSLDRSVKLWNL 540

 Score = 57.4 bits (137), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 36/137 (26%), Positives = 68/137 (49%), Gaps = 2/137 (1%)

Query: 573 VLSMDISYDSKLIVTCSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLPESYNFFSCSK 632
           + S+  S D K + T + DK I+IW L       +L  H+  I ++ + P      S S 
Sbjct: 381 IRSVCFSPDGKFLATGAEDKLIRIWDLSTKRIVMTLQGHEQDIYSLDYFPSGDKLVSGSG 440

Query: 633 DATVKYWDGQKFECIQKLAAHQSEVWSISVS-NDGTFVISTGHDHSIRVWEETEDQVFLE 691
           D TV+ WD +  +C   L+  +  V +++VS  +G F+ +   D ++RVW+     +   
Sbjct: 441 DRTVRIWDLRTGQCSLTLSI-EDGVTTVAVSPGEGKFIAAGSLDRTLRVWDSETGFLVER 499

Query: 692 EEREKEMDEQYEDTLLT 708
            + E E+   ++D++ +
Sbjct: 500 LDSENELGTGHKDSVYS 516

 Score = 52.8 bits (125), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 54/227 (23%), Positives = 93/227 (40%), Gaps = 45/227 (19%)

Query: 45  GLENILVWDIKTGEQIAQLTDGLPPGASDAKLSKPAETTFLKYHPETNLLAAGYADGVIK 104
           G   + +WD++TG+    LT  +  G +   +S P E  F+         AAG  D  ++
Sbjct: 440 GDRTVRIWDLRTGQ--CSLTLSIEDGVTTVAVS-PGEGKFI---------AAGSLDRTLR 487

Query: 105 IWD-----LISKTVLISFN----GHKSAITVLAFDTTGTRLISASKDSDIIVWDLVGESG 155
           +WD     L+ +  L S N    GHK ++  + F   G  ++S S D  + +W+L     
Sbjct: 488 VWDSETGFLVER--LDSENELGTGHKDSVYSVVFTRDGQGVVSGSLDRSVKLWNLHNTGS 545

Query: 156 LYKLRS-------------HKDAITGLW-CEDENWLISTSKDGLVKIWDLKSQQCVETHL 201
             K  S             HKD +  +   +++ +++S SKD  V  WD +S   +    
Sbjct: 546 SSKNDSKPTAATCEVTYTGHKDFVLSVATTQNDKYILSGSKDRGVLFWDTQSGNPLLMLQ 605

Query: 202 AHTGECWSLGIIEDMAV--------TCSADSQVKLWKLDLQAENGSK 240
            H     S+ +     +        T S D + ++WK      N S+
Sbjct: 606 GHRNSVISVAVANGFPLGPDYGVFATGSGDCKARIWKYSKNKANASE 652

 Score = 39.3 bits (90), Expect = 0.049,   Method: Compositional matrix adjust.
 Identities = 38/172 (22%), Positives = 71/172 (41%), Gaps = 30/172 (17%)

Query: 41  VIVGGLENIL-VWDIKTGEQIAQLT--DGLPPGASDAKLSKPAETTFLKYHPETNLLAAG 97
           +  G L+  L VWD +TG  + +L   + L  G  D+  S      F +   +   + +G
Sbjct: 477 IAAGSLDRTLRVWDSETGFLVERLDSENELGTGHKDSVYS----VVFTR---DGQGVVSG 529

Query: 98  YADGVIKIWDL-------------ISKTVLISFNGHKSAITVLAFDTTGTRLISASKDSD 144
             D  +K+W+L              + T  +++ GHK  +  +A       ++S SKD  
Sbjct: 530 SLDRSVKLWNLHNTGSSSKNDSKPTAATCEVTYTGHKDFVLSVATTQNDKYILSGSKDRG 589

Query: 145 IIVWDLVGESGLYKLRSHKDAITGLWC-------EDENWLISTSKDGLVKIW 189
           ++ WD    + L  L+ H++++  +          D     + S D   +IW
Sbjct: 590 VLFWDTQSGNPLLMLQGHRNSVISVAVANGFPLGPDYGVFATGSGDCKARIW 641

>AGR180W Chr7 (1090641..1093061) [2421 bp, 806 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YLR222C (UTP13)
          Length = 806

 Score =  105 bits (263), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 70/282 (24%), Positives = 124/282 (43%), Gaps = 53/282 (18%)

Query: 468 AHDAAIWSLDLTSDGRKLVTGSADKTVRFWTFE------------------VSEVPVSDE 509
            H   + SLD TSDG  L T S D +V  W +                   V+ + + + 
Sbjct: 380 GHTDLLNSLDATSDGLWLATASKDHSVILWRYNEASSSFEPFTKFLGHAGPVTAIALPNV 439

Query: 510 SNKTMP--MLQLFHDTTLEL----------------------------DDDILSVVISPD 539
            N+  P  +L   +D T++                             + DI ++ +SP+
Sbjct: 440 MNRNWPEFLLTASNDLTIKRWKVPNPNDRKAIELPHIVKASEYTRRAHEKDINAISMSPN 499

Query: 540 DKFIAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSMDISYDSKLIVTCSADKNIKIWGL 599
           D   A +  D T K++ +D+ +   +L  HK  +  +       L+ TCS D++I +W L
Sbjct: 500 DSIFATASYDKTCKIWNVDTGEVEATLANHKRGLWGVAFCEYDWLLATCSGDRSINLWSL 559

Query: 600 DFGDCHKSLFAHQDSIMNVKFLPESYNFFSCSKDATVKYWDGQKFECIQKLAAHQSEVWS 659
           +     K+L  H +++  V F+  +    S   D  VK WD    EC++ L AH + +W+
Sbjct: 560 ESFTVLKTLEGHTNAVQRVSFINGNKQLVSTGADGLVKIWDCSTGECVRTLDAHNNRIWA 619

Query: 660 ISVSNDGTFVISTGHDHSIRVWEETEDQVFLEEEREKEMDEQ 701
           ++V+NDG  +I+   D   + WE+       EEE E+ ++++
Sbjct: 620 LAVANDGQLIITADADGVFQFWEDNS-----EEEHERNIEQE 656

 Score = 72.8 bits (177), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 44/145 (30%), Positives = 68/145 (46%), Gaps = 3/145 (2%)

Query: 89  PETNLLAAGYADGVIKIWDLISKTVLISFNGHKSAITVLAFDTTGTRLISASKDSDIIVW 148
           P  ++ A    D   KIW++ +  V  +   HK  +  +AF      L + S D  I +W
Sbjct: 498 PNDSIFATASYDKTCKIWNVDTGEVEATLANHKRGLWGVAFCEYDWLLATCSGDRSINLW 557

Query: 149 DLVGESGLYKLRSHKDAITGL-WCEDENWLISTSKDGLVKIWDLKSQQCVETHLAHTGEC 207
            L   + L  L  H +A+  + +      L+ST  DGLVKIWD  + +CV T  AH    
Sbjct: 558 SLESFTVLKTLEGHTNAVQRVSFINGNKQLVSTGADGLVKIWDCSTGECVRTLDAHNNRI 617

Query: 208 WSLGIIED--MAVTCSADSQVKLWK 230
           W+L +  D  + +T  AD   + W+
Sbjct: 618 WALAVANDGQLIITADADGVFQFWE 642

 Score = 46.2 bits (108), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 36/169 (21%), Positives = 75/169 (44%), Gaps = 8/169 (4%)

Query: 519 LFHDTTLELDDDILSVVISPDDKFIAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSMDI 578
           + H    E + D+ ++ ++PD +++  +  +  ++ + L++ +   S+     P   +D 
Sbjct: 51  IIHKIENEDEQDVTALRLTPDGRYLCYASQNQLLRFYDLETKRTTRSMKISS-PAYVLDC 109

Query: 579 SYDSKLIVTCSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLPE----SYNFFSCSKDA 634
              S L+     D ++ ++ +  G    SL  H  +I +VKF  E     +   S   + 
Sbjct: 110 DESSTLLAVGGTDGSVNVFDIANGYVTHSLKGHGATISSVKFYGEVDSGMWLLASGDTNG 169

Query: 635 TVKYWDGQKFECIQKLAAHQSEVWSISVS-NDG--TFVISTGHDHSIRV 680
            VK WD  K  CI  +  H + V  + +   +G  + ++S G D  + V
Sbjct: 170 MVKIWDLVKRRCIHTVQEHTAAVRGLDIRVQEGAESLLLSGGRDDVVHV 218

 Score = 43.5 bits (101), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 37/182 (20%), Positives = 89/182 (48%), Gaps = 20/182 (10%)

Query: 327 QVVRSPYKIKSAQWTVCSNSKLELVVTTSNNSIEYYSIPYSKREPTQPAPLKLHTID--- 383
           + +  P+ +K++++T  ++ K    ++ S N   + +  Y K         K+  +D   
Sbjct: 469 KAIELPHIVKASEYTRRAHEKDINAISMSPNDSIFATASYDK-------TCKIWNVDTGE 521

Query: 384 ----LHGQRTDIRSTSISDDNKLLATAS-NGSLKIWNIKTKRCIRSFECGYALTCK---F 435
               L   +  +   +  + + LLAT S + S+ +W++++   +++ E G+    +   F
Sbjct: 522 VEATLANHKRGLWGVAFCEYDWLLATCSGDRSINLWSLESFTVLKTLE-GHTNAVQRVSF 580

Query: 436 LPGGALVVVGTRNGELQLFDIASSTMLDNKEGAHDAAIWSLDLTSDGRKLVTGSADKTVR 495
           + G   +V    +G ++++D ++   +   + AH+  IW+L + +DG+ ++T  AD   +
Sbjct: 581 INGNKQLVSTGADGLVKIWDCSTGECVRTLD-AHNNRIWALAVANDGQLIITADADGVFQ 639

Query: 496 FW 497
           FW
Sbjct: 640 FW 641

 Score = 42.4 bits (98), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 33/116 (28%), Positives = 58/116 (50%), Gaps = 11/116 (9%)

Query: 390 DIRSTSISDDNKLLATAS-NGSLKIWNIKTKRCIRSFEC---GYALTCKFLPGGALVVVG 445
           D+ +  ++ D + L  AS N  L+ ++++TKR  RS +     Y L C       L+ VG
Sbjct: 62  DVTALRLTPDGRYLCYASQNQLLRFYDLETKRTTRSMKISSPAYVLDCD--ESSTLLAVG 119

Query: 446 TRNGELQLFDIASSTMLDNKEGAHDAAIWSL----DLTSDGRKLVTGSADKTVRFW 497
             +G + +FDIA+  +  + +G H A I S+    ++ S    L +G  +  V+ W
Sbjct: 120 GTDGSVNVFDIANGYVTHSLKG-HGATISSVKFYGEVDSGMWLLASGDTNGMVKIW 174

 Score = 36.6 bits (83), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 37/145 (25%), Positives = 59/145 (40%), Gaps = 21/145 (14%)

Query: 475 SLDLTSDGRKLVTGSADKTVRFWTFEVSEVPVSDESNKTMPMLQLFHDTTLELDDDILSV 534
           +L LT DGR L   S ++ +RF+  E      S + +    +L     +TL         
Sbjct: 65  ALRLTPDGRYLCYASQNQLLRFYDLETKRTTRSMKISSPAYVLDCDESSTL--------- 115

Query: 535 VISPDDKFIAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSMDI--SYDSKLIVTCSADK 592
                   +AV   D +V VF + +     SL GH   + S+      DS + +  S D 
Sbjct: 116 --------LAVGGTDGSVNVFDIANGYVTHSLKGHGATISSVKFYGEVDSGMWLLASGDT 167

Query: 593 N--IKIWGLDFGDCHKSLFAHQDSI 615
           N  +KIW L    C  ++  H  ++
Sbjct: 168 NGMVKIWDLVKRRCIHTVQEHTAAV 192

>YCR084C Chr3 complement(260311..262452) [2142 bp, 713 aa] {ON}
           TUP1General repressor of transcription, forms complex
           with Cyc8p, involved in the establishment of repressive
           chromatin structure through interactions with histones
           H3 and H4, appears to enhance expression of some genes
          Length = 713

 Score =  105 bits (261), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 79/282 (28%), Positives = 130/282 (46%), Gaps = 48/282 (17%)

Query: 429 YALTCKFLPGGALVVVGTRNGELQLFDIASSTMLDNKEGAHDAAIWSLDLTSDGRKLVTG 488
           Y  +  F P G  +  G  +  ++++DI +  ++   +G H+  I+SLD    G KLV+G
Sbjct: 445 YIRSVCFSPDGKFLATGAEDRLIRIWDIENRKIVMILQG-HEQDIYSLDYFPSGDKLVSG 503

Query: 489 SADKTVRFWTFEVSEVPVSDESNKTMPMLQLFHDTTLELDDDILSVVISPDD-KFIAVSL 547
           S D+TVR W     +  +                 TL ++D + +V +SP D K+IA   
Sbjct: 504 SGDRTVRIWDLRTGQCSL-----------------TLSIEDGVTTVAVSPGDGKYIAAGS 546

Query: 548 LDNTVKVFFLDSMKFFL---------SLYGHKLPVLSMDISYDSKLIVTCSADKNIKIWG 598
           LD  V+V+  DS   FL         S  GHK  V S+  + D + +V+ S D+++K+W 
Sbjct: 547 LDRAVRVW--DSETGFLVERLDSENESGTGHKDSVYSVVFTRDGQSVVSGSLDRSVKLWN 604

Query: 599 L------------DFGDCHKSLFAHQDSIMNVKFLPESYNFFSCSKDATVKYWDGQKFEC 646
           L            + G C  +   H+D +++V          S SKD  V +WD +    
Sbjct: 605 LQNANNKSDSKTPNSGTCEVTYIGHKDFVLSVATTQNDEYILSGSKDRGVLFWDKKSGNP 664

Query: 647 IQKLAAHQSEVWSISVSNDGTF-----VISTGH-DHSIRVWE 682
           +  L  H++ V S++V+N         V +TG  D   R+W+
Sbjct: 665 LLMLQGHRNSVISVAVANGSPLGPEYNVFATGSGDCKARIWK 706

 Score = 68.6 bits (166), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 51/188 (27%), Positives = 90/188 (47%), Gaps = 18/188 (9%)

Query: 77  SKPAETTFLK---YHPETNLLAAGYADGVIKIWDLISKTVLISFNGHKSAITVLAFDTTG 133
           S P+   +++   + P+   LA G  D +I+IWD+ ++ +++   GH+  I  L +  +G
Sbjct: 438 SSPSSDLYIRSVCFSPDGKFLATGAEDRLIRIWDIENRKIVMILQGHEQDIYSLDYFPSG 497

Query: 134 TRLISASKDSDIIVWDL-VGESGLYKLRSHKDAITGLWCE--DENWLISTSKDGLVKIWD 190
            +L+S S D  + +WDL  G+  L    S +D +T +     D  ++ + S D  V++WD
Sbjct: 498 DKLVSGSGDRTVRIWDLRTGQCSL--TLSIEDGVTTVAVSPGDGKYIAAGSLDRAVRVWD 555

Query: 191 LKSQQCV-------ETHLAHTGECWSLGIIED--MAVTCSADSQVKLWKL-DLQAENGSK 240
            ++   V       E+   H    +S+    D    V+ S D  VKLW L +   ++ SK
Sbjct: 556 SETGFLVERLDSENESGTGHKDSVYSVVFTRDGQSVVSGSLDRSVKLWNLQNANNKSDSK 615

Query: 241 LTEKGIIE 248
               G  E
Sbjct: 616 TPNSGTCE 623

 Score = 54.3 bits (129), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 35/139 (25%), Positives = 68/139 (48%), Gaps = 2/139 (1%)

Query: 571 LPVLSMDISYDSKLIVTCSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLPESYNFFSC 630
           L + S+  S D K + T + D+ I+IW ++       L  H+  I ++ + P      S 
Sbjct: 444 LYIRSVCFSPDGKFLATGAEDRLIRIWDIENRKIVMILQGHEQDIYSLDYFPSGDKLVSG 503

Query: 631 SKDATVKYWDGQKFECIQKLAAHQSEVWSISVS-NDGTFVISTGHDHSIRVWEETEDQVF 689
           S D TV+ WD +  +C   L+  +  V +++VS  DG ++ +   D ++RVW+     + 
Sbjct: 504 SGDRTVRIWDLRTGQCSLTLSI-EDGVTTVAVSPGDGKYIAAGSLDRAVRVWDSETGFLV 562

Query: 690 LEEEREKEMDEQYEDTLLT 708
              + E E    ++D++ +
Sbjct: 563 ERLDSENESGTGHKDSVYS 581

 Score = 53.9 bits (128), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 52/223 (23%), Positives = 94/223 (42%), Gaps = 44/223 (19%)

Query: 45  GLENILVWDIKTGEQIAQLTDGLPPGASDAKLSKPAETTFLKYHPETNLLAAGYADGVIK 104
           G   + +WD++TG+    LT  +  G +   +S P +  ++         AAG  D  ++
Sbjct: 505 GDRTVRIWDLRTGQ--CSLTLSIEDGVTTVAVS-PGDGKYI---------AAGSLDRAVR 552

Query: 105 IWDLISKTVLI---------SFNGHKSAITVLAFDTTGTRLISASKDSDIIVWDL----- 150
           +WD  S+T  +         S  GHK ++  + F   G  ++S S D  + +W+L     
Sbjct: 553 VWD--SETGFLVERLDSENESGTGHKDSVYSVVFTRDGQSVVSGSLDRSVKLWNLQNANN 610

Query: 151 -----VGESGLYKLR--SHKDAITGLWC-EDENWLISTSKDGLVKIWDLKSQQCVETHLA 202
                   SG  ++    HKD +  +   +++ +++S SKD  V  WD KS   +     
Sbjct: 611 KSDSKTPNSGTCEVTYIGHKDFVLSVATTQNDEYILSGSKDRGVLFWDKKSGNPLLMLQG 670

Query: 203 HTGECWSLGIIE--------DMAVTCSADSQVKLWKLDLQAEN 237
           H     S+ +          ++  T S D + ++WK    A N
Sbjct: 671 HRNSVISVAVANGSPLGPEYNVFATGSGDCKARIWKYKKIAPN 713

>AGL234W Chr7 (257969..259858) [1890 bp, 629 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YCR084C (TUP1)
          Length = 629

 Score =  104 bits (260), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 78/281 (27%), Positives = 129/281 (45%), Gaps = 45/281 (16%)

Query: 429 YALTCKFLPGGALVVVGTRNGELQLFDIASSTMLDNKEGAHDAAIWSLDLTSDGRKLVTG 488
           Y  +  F P G  +  G  +  ++++D+ +  +L   +G H+  I+SLD    G KLV+G
Sbjct: 354 YIRSVCFSPDGKYLATGAEDKLIRIWDLTTKKILMTLQG-HEQDIYSLDYFPAGDKLVSG 412

Query: 489 SADKTVRFWTFEVSEVPVSDESNKTMPMLQLFHDTTLELDDDILSVVISP-DDKFIAVSL 547
           S D+TVR W     +  +                 TL ++D + +V +SP D K+IA   
Sbjct: 413 SGDRTVRIWDLRTGQCSL-----------------TLSIEDGVTTVAVSPGDGKYIAAGS 455

Query: 548 LDNTVKVFFLDSMKFFLS---------LYGHKLPVLSMDISYDSKLIVTCSADKNIKIWG 598
           LD TV+V+  DS   FL            GHK  V S+  + D + +++ S D+++K+W 
Sbjct: 456 LDRTVRVW--DSETGFLVERLDSENELSTGHKDSVYSVVFTRDGQGVISGSLDRSVKLWD 513

Query: 599 L-------DFGDCHKSLFAHQDSIMNVKFLPESYNFFSCSKDATVKYWDGQKFECIQKLA 651
           L           C  +   H+D +++V    +     S SKD  V +WD      +  L 
Sbjct: 514 LRGLNGQKSHATCEVTYTGHKDFVLSVATTQDDEYILSGSKDRGVLFWDTASGNPLLMLQ 573

Query: 652 AHQSEVWSISVSND-------GTFVISTGHDHSIRVWEETE 685
            H++ V S++V N        G F   +G D   R+W+ T+
Sbjct: 574 GHRNSVISVAVVNGFPLGPDVGVFATGSG-DCKARIWKYTK 613

 Score = 73.9 bits (180), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 61/225 (27%), Positives = 102/225 (45%), Gaps = 39/225 (17%)

Query: 51  VWDIKTGEQIAQLTDGLPPGASDAKLSKPAETT--------------------FLK---Y 87
           V+ + TGE +A+L+D    G ++   + PA                       +++   +
Sbjct: 301 VYKVSTGELLARLSDDSVAGVNNEASTGPANNGTADNGGENSATIQPASSSDLYIRSVCF 360

Query: 88  HPETNLLAAGYADGVIKIWDLISKTVLISFNGHKSAITVLAFDTTGTRLISASKDSDIIV 147
            P+   LA G  D +I+IWDL +K +L++  GH+  I  L +   G +L+S S D  + +
Sbjct: 361 SPDGKYLATGAEDKLIRIWDLTTKKILMTLQGHEQDIYSLDYFPAGDKLVSGSGDRTVRI 420

Query: 148 WDL-VGESGLYKLRSHKDAITGLWCE--DENWLISTSKDGLVKIWDLKSQQCVET----- 199
           WDL  G+  L    S +D +T +     D  ++ + S D  V++WD ++   VE      
Sbjct: 421 WDLRTGQCSL--TLSIEDGVTTVAVSPGDGKYIAAGSLDRTVRVWDSETGFLVERLDSEN 478

Query: 200 --HLAHTGECWSLGIIED--MAVTCSADSQVKLWKLDLQAENGSK 240
                H    +S+    D    ++ S D  VKLW  DL+  NG K
Sbjct: 479 ELSTGHKDSVYSVVFTRDGQGVISGSLDRSVKLW--DLRGLNGQK 521

 Score = 61.2 bits (147), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 51/241 (21%), Positives = 105/241 (43%), Gaps = 26/241 (10%)

Query: 469 HDAAIWSLDLTSDGRKLVTGSADKTVRFWTFEVSEVPVSDESNKTMPMLQLFHDTTLELD 528
           H + +  +  ++DG  L TG  +KT + +     E+           + +L  D+   ++
Sbjct: 275 HSSVVCCVRFSNDGEYLATG-CNKTTQVYKVSTGEL-----------LARLSDDSVAGVN 322

Query: 529 DDILSVVISPDDKFIAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSMDISYDSKLIVTC 588
           ++       P +   A +  +N+  +    S   +         + S+  S D K + T 
Sbjct: 323 NE---ASTGPANNGTADNGGENSATIQPASSSDLY---------IRSVCFSPDGKYLATG 370

Query: 589 SADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLPESYNFFSCSKDATVKYWDGQKFECIQ 648
           + DK I+IW L       +L  H+  I ++ + P      S S D TV+ WD +  +C  
Sbjct: 371 AEDKLIRIWDLTTKKILMTLQGHEQDIYSLDYFPAGDKLVSGSGDRTVRIWDLRTGQCSL 430

Query: 649 KLAAHQSEVWSISVS-NDGTFVISTGHDHSIRVWEETEDQVFLEEEREKEMDEQYEDTLL 707
            L+  +  V +++VS  DG ++ +   D ++RVW+     +    + E E+   ++D++ 
Sbjct: 431 TLSI-EDGVTTVAVSPGDGKYIAAGSLDRTVRVWDSETGFLVERLDSENELSTGHKDSVY 489

Query: 708 T 708
           +
Sbjct: 490 S 490

 Score = 59.3 bits (142), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 59/227 (25%), Positives = 100/227 (44%), Gaps = 42/227 (18%)

Query: 45  GLENILVWDIKTGEQIAQLTDGLPPGASDAKLSKPAETTFLKYHPETNLLAAGYADGVIK 104
           G   + +WD++TG+    LT  +  G +   +S P +  ++         AAG  D  ++
Sbjct: 414 GDRTVRIWDLRTGQ--CSLTLSIEDGVTTVAVS-PGDGKYI---------AAGSLDRTVR 461

Query: 105 IWD-----LISKTVLISFN----GHKSAITVLAFDTTGTRLISASKDSDIIVWDLVGESG 155
           +WD     L+ +  L S N    GHK ++  + F   G  +IS S D  + +WDL G +G
Sbjct: 462 VWDSETGFLVER--LDSENELSTGHKDSVYSVVFTRDGQGVISGSLDRSVKLWDLRGLNG 519

Query: 156 L-------YKLRSHKDAITGLWC-EDENWLISTSKDGLVKIWDLKSQQCVETHLAHTGEC 207
                        HKD +  +   +D+ +++S SKD  V  WD  S   +     H    
Sbjct: 520 QKSHATCEVTYTGHKDFVLSVATTQDDEYILSGSKDRGVLFWDTASGNPLLMLQGHRNSV 579

Query: 208 WSLGII------EDMAV--TCSADSQVKLWKLDLQAE---NGSKLTE 243
            S+ ++       D+ V  T S D + ++WK   ++     G+KL E
Sbjct: 580 ISVAVVNGFPLGPDVGVFATGSGDCKARIWKYTKKSNPTATGAKLQE 626

 Score = 40.0 bits (92), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 39/169 (23%), Positives = 70/169 (41%), Gaps = 25/169 (14%)

Query: 39  GQVIVGGL--ENILVWDIKTGEQIAQLT--DGLPPGASDAKLSKPAETTFLKYHPETNLL 94
           G+ I  G     + VWD +TG  + +L   + L  G  D+  S      F +   +   +
Sbjct: 448 GKYIAAGSLDRTVRVWDSETGFLVERLDSENELSTGHKDSVYS----VVFTR---DGQGV 500

Query: 95  AAGYADGVIKIWDLIS-------KTVLISFNGHKSAITVLAFDTTGTRLISASKDSDIIV 147
            +G  D  +K+WDL          T  +++ GHK  +  +A       ++S SKD  ++ 
Sbjct: 501 ISGSLDRSVKLWDLRGLNGQKSHATCEVTYTGHKDFVLSVATTQDDEYILSGSKDRGVLF 560

Query: 148 WDLVGESGLYKLRSHKDAITGLWC-------EDENWLISTSKDGLVKIW 189
           WD    + L  L+ H++++  +          D     + S D   +IW
Sbjct: 561 WDTASGNPLLMLQGHRNSVISVAVVNGFPLGPDVGVFATGSGDCKARIW 609

>NCAS0A05520 Chr1 complement(1085200..1087215) [2016 bp, 671 aa]
           {ON} Anc_6.363
          Length = 671

 Score =  103 bits (258), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 99/383 (25%), Positives = 168/383 (43%), Gaps = 78/383 (20%)

Query: 374 PA-PLKLHTIDLH---GQRTDIRSTSISDDNKLLATASNGSLKIWNIKTKRCI------- 422
           PA PL+L  ++LH      + +     S+D + LAT  N + +I+ +     I       
Sbjct: 311 PALPLELD-VELHHSLNHSSVVCCVKFSNDGQFLATGCNKTTQIYRVSDGELIAKLSDDS 369

Query: 423 ------RSFECG-------YALTCKFLPGGALVVVGTRNGELQLFDIASSTMLDNKEGAH 469
                  S   G       Y  +  F P G  +  G  +  ++++DI    ++   +G H
Sbjct: 370 VTSPDTSSATSGSTPSTDLYIRSVCFSPDGEFLATGAEDKLIRIWDIQERKIVMVLKG-H 428

Query: 470 DAAIWSLDLTSDGRKLVTGSADKTVRFWTFEVSEVPVSDESNKTMPMLQLFHDTTLELDD 529
           +  ++SLD   +G KLV+GS D+TVR W     +  +                 TL ++ 
Sbjct: 429 EQDVYSLDYFPNGEKLVSGSGDRTVRIWDLRTGQCSL-----------------TLSIEY 471

Query: 530 DILSVVISPDD-KFIAVSLLDNTVKVFFLDSMKFFLSLY---------GHKLPVLSMDIS 579
            + +V +SP+D KFIA   LD  V+V+  DS   FL            GH+  V S+  +
Sbjct: 472 GVTTVAVSPNDGKFIAAGSLDRAVRVW--DSTTGFLVERLDSENELGTGHRDSVYSVVFT 529

Query: 580 YDSKLIVTCSADKNIKIWGL-----------DFGD----CHKSLFAHQDSIMNVKFLPES 624
            D   +V+ S DK +K+W +           D G     C  +   H+D +++V    + 
Sbjct: 530 RDGNEVVSGSLDKTVKLWNMRHSGNSNNESNDKGSASATCEVTYVGHKDFVLSVTTSQDD 589

Query: 625 YNFFSCSKDATVKYWDGQKFECIQKLAAHQSEVWSISVSNDGTF-----VISTGH-DHSI 678
               S SKD  + +WD +    +  L  H++ V S++V+N         V +TG  D   
Sbjct: 590 KYILSGSKDRGILFWDKESGNPLLMLQGHRNSVISVAVANGSALGPKYNVFATGSGDCKA 649

Query: 679 RVWEETEDQVFLEEEREKEMDEQ 701
           R+W+ +  ++  EEE+ KE+ E+
Sbjct: 650 RIWKYS--KISGEEEKIKEVQEE 670

 Score = 74.3 bits (181), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 57/229 (24%), Positives = 101/229 (44%), Gaps = 17/229 (7%)

Query: 34  KTGNLGQVIVGGLENIL-VWDIKTGEQIAQLTDGL---PPGASDAKLSKPAETTFLK--- 86
           K  N GQ +  G      ++ +  GE IA+L+D     P  +S    S P+   +++   
Sbjct: 335 KFSNDGQFLATGCNKTTQIYRVSDGELIAKLSDDSVTSPDTSSATSGSTPSTDLYIRSVC 394

Query: 87  YHPETNLLAAGYADGVIKIWDLISKTVLISFNGHKSAITVLAFDTTGTRLISASKDSDII 146
           + P+   LA G  D +I+IWD+  + +++   GH+  +  L +   G +L+S S D  + 
Sbjct: 395 FSPDGEFLATGAEDKLIRIWDIQERKIVMVLKGHEQDVYSLDYFPNGEKLVSGSGDRTVR 454

Query: 147 VWDL-VGESGLYKLRSHKDAITGLWCEDENWLISTSKDGLVKIWDLKSQQCVET------ 199
           +WDL  G+  L     +      +   D  ++ + S D  V++WD  +   VE       
Sbjct: 455 IWDLRTGQCSLTLSIEYGVTTVAVSPNDGKFIAAGSLDRAVRVWDSTTGFLVERLDSENE 514

Query: 200 -HLAHTGECWSLGIIEDM--AVTCSADSQVKLWKLDLQAENGSKLTEKG 245
               H    +S+    D    V+ S D  VKLW +     + ++  +KG
Sbjct: 515 LGTGHRDSVYSVVFTRDGNEVVSGSLDKTVKLWNMRHSGNSNNESNDKG 563

 Score = 62.4 bits (150), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 39/149 (26%), Positives = 74/149 (49%), Gaps = 2/149 (1%)

Query: 573 VLSMDISYDSKLIVTCSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLPESYNFFSCSK 632
           + S+  S D + + T + DK I+IW +        L  H+  + ++ + P      S S 
Sbjct: 390 IRSVCFSPDGEFLATGAEDKLIRIWDIQERKIVMVLKGHEQDVYSLDYFPNGEKLVSGSG 449

Query: 633 DATVKYWDGQKFECIQKLAAHQSEVWSISVS-NDGTFVISTGHDHSIRVWEETEDQVFLE 691
           D TV+ WD +  +C   L+     V +++VS NDG F+ +   D ++RVW+ T   +   
Sbjct: 450 DRTVRIWDLRTGQCSLTLSIEYG-VTTVAVSPNDGKFIAAGSLDRAVRVWDSTTGFLVER 508

Query: 692 EEREKEMDEQYEDTLLTSLEGGAGDEMLS 720
            + E E+   + D++ + +    G+E++S
Sbjct: 509 LDSENELGTGHRDSVYSVVFTRDGNEVVS 537

 Score = 50.1 bits (118), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 46/218 (21%), Positives = 87/218 (39%), Gaps = 45/218 (20%)

Query: 45  GLENILVWDIKTGEQIAQLTDGLPPGASDAKLSKPAETTFLKYHPETNLLAAGYADGVIK 104
           G   + +WD++TG+    LT  +  G +   +S P +  F+         AAG  D  ++
Sbjct: 449 GDRTVRIWDLRTGQ--CSLTLSIEYGVTTVAVS-PNDGKFI---------AAGSLDRAVR 496

Query: 105 IWDLISKTVLISFN-------GHKSAITVLAFDTTGTRLISASKDSDIIVWDLVGESGLY 157
           +WD  +  ++   +       GH+ ++  + F   G  ++S S D  + +W++   SG  
Sbjct: 497 VWDSTTGFLVERLDSENELGTGHRDSVYSVVFTRDGNEVVSGSLDKTVKLWNMR-HSGNS 555

Query: 158 KLRSHKDAITGLWCE-----------------DENWLISTSKDGLVKIWDLKSQQCVETH 200
              S+        CE                 D+ +++S SKD  +  WD +S   +   
Sbjct: 556 NNESNDKGSASATCEVTYVGHKDFVLSVTTSQDDKYILSGSKDRGILFWDKESGNPLLML 615

Query: 201 LAHTGECWSLGIIEDMAV--------TCSADSQVKLWK 230
             H     S+ +    A+        T S D + ++WK
Sbjct: 616 QGHRNSVISVAVANGSALGPKYNVFATGSGDCKARIWK 653

 Score = 38.5 bits (88), Expect = 0.080,   Method: Compositional matrix adjust.
 Identities = 40/179 (22%), Positives = 72/179 (40%), Gaps = 33/179 (18%)

Query: 37  NLGQVIVGGL--ENILVWDIKTGEQIAQLT--DGLPPGASDAKLSKPAETTFLKYHPETN 92
           N G+ I  G     + VWD  TG  + +L   + L  G  D+  S      F +   + N
Sbjct: 481 NDGKFIAAGSLDRAVRVWDSTTGFLVERLDSENELGTGHRDSVYS----VVFTR---DGN 533

Query: 93  LLAAGYADGVIKIWDL---------------ISKTVLISFNGHKSAITVLAFDTTGTRLI 137
            + +G  D  +K+W++                S T  +++ GHK  +  +        ++
Sbjct: 534 EVVSGSLDKTVKLWNMRHSGNSNNESNDKGSASATCEVTYVGHKDFVLSVTTSQDDKYIL 593

Query: 138 SASKDSDIIVWDLVGESGLYKLRSHKDAITGLWCEDE-------NWLISTSKDGLVKIW 189
           S SKD  I+ WD    + L  L+ H++++  +   +        N   + S D   +IW
Sbjct: 594 SGSKDRGILFWDKESGNPLLMLQGHRNSVISVAVANGSALGPKYNVFATGSGDCKARIW 652

>Kpol_1028.23 s1028 (63032..65266) [2235 bp, 744 aa] {ON}
           (63032..65266) [2235 nt, 745 aa]
          Length = 744

 Score =  103 bits (258), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 80/284 (28%), Positives = 128/284 (45%), Gaps = 49/284 (17%)

Query: 429 YALTCKFLPGGALVVVGTRNGELQLFDIASSTMLDNKEGAHDAAIWSLDLTSDGRKLVTG 488
           Y  +  F P G  +  G  +  ++++DIA   ++   +G H+  I+SLD    G KLV+G
Sbjct: 464 YIRSVCFSPDGKFLATGAEDRLIRIWDIAQKKIVMVLQG-HEQDIYSLDYFPSGDKLVSG 522

Query: 489 SADKTVRFWTFEVSEVPVSDESNKTMPMLQLFHDTTLELDDDILSVVISPDD-KFIAVSL 547
           S D+TVR W     +  +                 TL ++D + +V +SP D K+IA   
Sbjct: 523 SGDRTVRIWDLRNGQCSL-----------------TLSIEDGVTTVAVSPGDGKYIAAGS 565

Query: 548 LDNTVKVFFLDSMKFFLSLY---------GHKLPVLSMDISYDSKLIVTCSADKNIKIWG 598
           LD  V+V+  DS   FL            GHK  V S+  + D   +V+ S D+++K+W 
Sbjct: 566 LDRAVRVW--DSETGFLVERLDSENELGTGHKDSVYSVVFTRDGNNVVSGSLDRSVKLWN 623

Query: 599 LD-----------FGDCHKSLFAHQDSIMNVKFLPESYNFFSCSKDATVKYWDGQKFECI 647
           L             G C  +   H+D +++V          S SKD  V +WD +    +
Sbjct: 624 LRGDNNQDVKPNVPGTCEVTYTGHKDFVLSVATTQNDEYILSGSKDRGVLFWDTKSGNPL 683

Query: 648 QKLAAHQSEVWSISVSND-------GTFVISTGHDHSIRVWEET 684
             L  H++ V S++V+N        G F   +G D   R+W+ T
Sbjct: 684 LMLQGHRNSVISVAVANGFPLGPNVGVFATGSG-DCKARIWKYT 726

 Score = 67.0 bits (162), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 46/157 (29%), Positives = 75/157 (47%), Gaps = 14/157 (8%)

Query: 87  YHPETNLLAAGYADGVIKIWDLISKTVLISFNGHKSAITVLAFDTTGTRLISASKDSDII 146
           + P+   LA G  D +I+IWD+  K +++   GH+  I  L +  +G +L+S S D  + 
Sbjct: 470 FSPDGKFLATGAEDRLIRIWDIAQKKIVMVLQGHEQDIYSLDYFPSGDKLVSGSGDRTVR 529

Query: 147 VWDLVGESGLYKLR-SHKDAITGLWCE--DENWLISTSKDGLVKIWDLKSQQCVET---- 199
           +WDL   +G   L  S +D +T +     D  ++ + S D  V++WD ++   VE     
Sbjct: 530 IWDL--RNGQCSLTLSIEDGVTTVAVSPGDGKYIAAGSLDRAVRVWDSETGFLVERLDSE 587

Query: 200 ---HLAHTGECWSLGIIED--MAVTCSADSQVKLWKL 231
                 H    +S+    D    V+ S D  VKLW L
Sbjct: 588 NELGTGHKDSVYSVVFTRDGNNVVSGSLDRSVKLWNL 624

 Score = 56.2 bits (134), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 36/149 (24%), Positives = 72/149 (48%), Gaps = 2/149 (1%)

Query: 573 VLSMDISYDSKLIVTCSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLPESYNFFSCSK 632
           + S+  S D K + T + D+ I+IW +        L  H+  I ++ + P      S S 
Sbjct: 465 IRSVCFSPDGKFLATGAEDRLIRIWDIAQKKIVMVLQGHEQDIYSLDYFPSGDKLVSGSG 524

Query: 633 DATVKYWDGQKFECIQKLAAHQSEVWSISVS-NDGTFVISTGHDHSIRVWEETEDQVFLE 691
           D TV+ WD +  +C   L+     V +++VS  DG ++ +   D ++RVW+     +   
Sbjct: 525 DRTVRIWDLRNGQCSLTLSIEDG-VTTVAVSPGDGKYIAAGSLDRAVRVWDSETGFLVER 583

Query: 692 EEREKEMDEQYEDTLLTSLEGGAGDEMLS 720
            + E E+   ++D++ + +    G+ ++S
Sbjct: 584 LDSENELGTGHKDSVYSVVFTRDGNNVVS 612

 Score = 53.1 bits (126), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 49/215 (22%), Positives = 90/215 (41%), Gaps = 43/215 (20%)

Query: 45  GLENILVWDIKTGEQIAQLTDGLPPGASDAKLSKPAETTFLKYHPETNLLAAGYADGVIK 104
           G   + +WD++ G+    LT  +  G +   +S P +  ++         AAG  D  ++
Sbjct: 524 GDRTVRIWDLRNGQ--CSLTLSIEDGVTTVAVS-PGDGKYI---------AAGSLDRAVR 571

Query: 105 IWD-----LISKTVLISFN----GHKSAITVLAFDTTGTRLISASKDSDIIVWDLVGESG 155
           +WD     L+ +  L S N    GHK ++  + F   G  ++S S D  + +W+L G++ 
Sbjct: 572 VWDSETGFLVER--LDSENELGTGHKDSVYSVVFTRDGNNVVSGSLDRSVKLWNLRGDNN 629

Query: 156 L-----------YKLRSHKDAITGLWC-EDENWLISTSKDGLVKIWDLKSQQCVETHLAH 203
                            HKD +  +   +++ +++S SKD  V  WD KS   +     H
Sbjct: 630 QDVKPNVPGTCEVTYTGHKDFVLSVATTQNDEYILSGSKDRGVLFWDTKSGNPLLMLQGH 689

Query: 204 TGECWSLGIIEDMAV--------TCSADSQVKLWK 230
                S+ +     +        T S D + ++WK
Sbjct: 690 RNSVISVAVANGFPLGPNVGVFATGSGDCKARIWK 724

 Score = 50.8 bits (120), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 35/133 (26%), Positives = 58/133 (43%), Gaps = 12/133 (9%)

Query: 85  LKYHPETNLLAAGYADGVIKIWDLISKTVLISFNGHKSAITVLAFDTTGTRLISASKDSD 144
           L Y P  + L +G  D  ++IWDL +    ++ +      TV      G  + + S D  
Sbjct: 510 LDYFPSGDKLVSGSGDRTVRIWDLRNGQCSLTLSIEDGVTTVAVSPGDGKYIAAGSLDRA 569

Query: 145 IIVWDLVGESGLYKLR---------SHKDAI-TGLWCEDENWLISTSKDGLVKIWDLKSQ 194
           + VWD   E+G    R          HKD++ + ++  D N ++S S D  VK+W+L+  
Sbjct: 570 VRVWD--SETGFLVERLDSENELGTGHKDSVYSVVFTRDGNNVVSGSLDRSVKLWNLRGD 627

Query: 195 QCVETHLAHTGEC 207
              +      G C
Sbjct: 628 NNQDVKPNVPGTC 640

 Score = 41.6 bits (96), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 33/140 (23%), Positives = 64/140 (45%), Gaps = 21/140 (15%)

Query: 41  VIVGGLEN-ILVWDIKTGEQIAQLT--DGLPPGASDAKLSKPAETTFLKYHPETNLLAAG 97
           +  G L+  + VWD +TG  + +L   + L  G  D+  S      F +   + N + +G
Sbjct: 561 IAAGSLDRAVRVWDSETGFLVERLDSENELGTGHKDSVYS----VVFTR---DGNNVVSG 613

Query: 98  YADGVIKIWDL-----------ISKTVLISFNGHKSAITVLAFDTTGTRLISASKDSDII 146
             D  +K+W+L           +  T  +++ GHK  +  +A       ++S SKD  ++
Sbjct: 614 SLDRSVKLWNLRGDNNQDVKPNVPGTCEVTYTGHKDFVLSVATTQNDEYILSGSKDRGVL 673

Query: 147 VWDLVGESGLYKLRSHKDAI 166
            WD    + L  L+ H++++
Sbjct: 674 FWDTKSGNPLLMLQGHRNSV 693

>Skud_3.156 Chr3 complement(244873..247014) [2142 bp, 713 aa] {ON}
           YCR084C (REAL)
          Length = 713

 Score =  103 bits (257), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 79/282 (28%), Positives = 129/282 (45%), Gaps = 48/282 (17%)

Query: 429 YALTCKFLPGGALVVVGTRNGELQLFDIASSTMLDNKEGAHDAAIWSLDLTSDGRKLVTG 488
           Y  +  F P G  +  G  +  ++++DI +  ++   +G H+  I+SLD    G KLV+G
Sbjct: 445 YIRSVCFSPDGKFLATGAEDRLIRIWDIENRKIVMILQG-HEQDIYSLDYFPSGDKLVSG 503

Query: 489 SADKTVRFWTFEVSEVPVSDESNKTMPMLQLFHDTTLELDDDILSVVISPDD-KFIAVSL 547
           S D+TVR W     +  +                 TL ++D + +V +SP D K+IA   
Sbjct: 504 SGDRTVRIWDLRTGQCSL-----------------TLSIEDGVTTVAVSPGDGKYIAAGS 546

Query: 548 LDNTVKVFFLDSMKFFL---------SLYGHKLPVLSMDISYDSKLIVTCSADKNIKIWG 598
           LD  V+V+  DS   FL         S  GHK  V S+  + D + +V+ S D+++K+W 
Sbjct: 547 LDRAVRVW--DSETGFLVERLDSENESGTGHKDSVYSVVFTRDGQSVVSGSLDRSVKLWN 604

Query: 599 L------------DFGDCHKSLFAHQDSIMNVKFLPESYNFFSCSKDATVKYWDGQKFEC 646
           L            + G C  +   H+D +++V          S SKD  V +WD      
Sbjct: 605 LQNANNKSDSKTPNSGTCEVTYIGHKDFVLSVATTQNDEYILSGSKDRGVLFWDKTSGNP 664

Query: 647 IQKLAAHQSEVWSISVSNDGTF-----VISTGH-DHSIRVWE 682
           +  L  H++ V S++V+N         V +TG  D   R+W+
Sbjct: 665 LLMLQGHRNSVISVAVANGSPLGPEYNVFATGSGDCKARIWK 706

 Score = 67.8 bits (164), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 51/188 (27%), Positives = 90/188 (47%), Gaps = 18/188 (9%)

Query: 77  SKPAETTFLK---YHPETNLLAAGYADGVIKIWDLISKTVLISFNGHKSAITVLAFDTTG 133
           S P+   +++   + P+   LA G  D +I+IWD+ ++ +++   GH+  I  L +  +G
Sbjct: 438 SSPSSDLYIRSVCFSPDGKFLATGAEDRLIRIWDIENRKIVMILQGHEQDIYSLDYFPSG 497

Query: 134 TRLISASKDSDIIVWDL-VGESGLYKLRSHKDAITGLWCE--DENWLISTSKDGLVKIWD 190
            +L+S S D  + +WDL  G+  L    S +D +T +     D  ++ + S D  V++WD
Sbjct: 498 DKLVSGSGDRTVRIWDLRTGQCSL--TLSIEDGVTTVAVSPGDGKYIAAGSLDRAVRVWD 555

Query: 191 LKSQQCV-------ETHLAHTGECWSLGIIED--MAVTCSADSQVKLWKL-DLQAENGSK 240
            ++   V       E+   H    +S+    D    V+ S D  VKLW L +   ++ SK
Sbjct: 556 SETGFLVERLDSENESGTGHKDSVYSVVFTRDGQSVVSGSLDRSVKLWNLQNANNKSDSK 615

Query: 241 LTEKGIIE 248
               G  E
Sbjct: 616 TPNSGTCE 623

 Score = 54.3 bits (129), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 35/139 (25%), Positives = 68/139 (48%), Gaps = 2/139 (1%)

Query: 571 LPVLSMDISYDSKLIVTCSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLPESYNFFSC 630
           L + S+  S D K + T + D+ I+IW ++       L  H+  I ++ + P      S 
Sbjct: 444 LYIRSVCFSPDGKFLATGAEDRLIRIWDIENRKIVMILQGHEQDIYSLDYFPSGDKLVSG 503

Query: 631 SKDATVKYWDGQKFECIQKLAAHQSEVWSISVS-NDGTFVISTGHDHSIRVWEETEDQVF 689
           S D TV+ WD +  +C   L+  +  V +++VS  DG ++ +   D ++RVW+     + 
Sbjct: 504 SGDRTVRIWDLRTGQCSLTLSI-EDGVTTVAVSPGDGKYIAAGSLDRAVRVWDSETGFLV 562

Query: 690 LEEEREKEMDEQYEDTLLT 708
              + E E    ++D++ +
Sbjct: 563 ERLDSENESGTGHKDSVYS 581

 Score = 50.8 bits (120), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 51/223 (22%), Positives = 93/223 (41%), Gaps = 44/223 (19%)

Query: 45  GLENILVWDIKTGEQIAQLTDGLPPGASDAKLSKPAETTFLKYHPETNLLAAGYADGVIK 104
           G   + +WD++TG+    LT  +  G +   +S P +  ++         AAG  D  ++
Sbjct: 505 GDRTVRIWDLRTGQ--CSLTLSIEDGVTTVAVS-PGDGKYI---------AAGSLDRAVR 552

Query: 105 IWDLISKTVLI---------SFNGHKSAITVLAFDTTGTRLISASKDSDIIVWDL----- 150
           +WD  S+T  +         S  GHK ++  + F   G  ++S S D  + +W+L     
Sbjct: 553 VWD--SETGFLVERLDSENESGTGHKDSVYSVVFTRDGQSVVSGSLDRSVKLWNLQNANN 610

Query: 151 -----VGESGLYKLR--SHKDAITGLWC-EDENWLISTSKDGLVKIWDLKSQQCVETHLA 202
                   SG  ++    HKD +  +   +++ +++S SKD  V  WD  S   +     
Sbjct: 611 KSDSKTPNSGTCEVTYIGHKDFVLSVATTQNDEYILSGSKDRGVLFWDKTSGNPLLMLQG 670

Query: 203 HTGECWSLGIIE--------DMAVTCSADSQVKLWKLDLQAEN 237
           H     S+ +          ++  T S D + ++WK    A N
Sbjct: 671 HRNSVISVAVANGSPLGPEYNVFATGSGDCKARIWKYRKIAPN 713

>Smik_3.183 Chr3 complement(259959..262088) [2130 bp, 709 aa] {ON}
           YCR084C (REAL)
          Length = 709

 Score =  103 bits (256), Expect = 9e-22,   Method: Compositional matrix adjust.
 Identities = 79/282 (28%), Positives = 128/282 (45%), Gaps = 48/282 (17%)

Query: 429 YALTCKFLPGGALVVVGTRNGELQLFDIASSTMLDNKEGAHDAAIWSLDLTSDGRKLVTG 488
           Y  +  F P G  +  G  +  ++++DI    ++   +G H+  I+SLD    G KLV+G
Sbjct: 441 YIRSVCFSPDGKFLATGAEDRLIRIWDIEKRKIVMILQG-HEQDIYSLDYFPSGDKLVSG 499

Query: 489 SADKTVRFWTFEVSEVPVSDESNKTMPMLQLFHDTTLELDDDILSVVISPDD-KFIAVSL 547
           S D+TVR W     +  +                 TL ++D + +V +SP D K+IA   
Sbjct: 500 SGDRTVRIWDLRTGQCSL-----------------TLSIEDGVTTVAVSPGDGKYIAAGS 542

Query: 548 LDNTVKVFFLDSMKFFL---------SLYGHKLPVLSMDISYDSKLIVTCSADKNIKIWG 598
           LD  V+V+  DS   FL         S  GHK  V S+  + D   +V+ S D+++K+W 
Sbjct: 543 LDRAVRVW--DSETGFLVERLDSENESGTGHKDSVYSVVFTRDGHSVVSGSLDRSVKLWN 600

Query: 599 L------------DFGDCHKSLFAHQDSIMNVKFLPESYNFFSCSKDATVKYWDGQKFEC 646
           L            + G C  +   H+D +++V          S SKD  V +WD +    
Sbjct: 601 LQNANNKSDSKAPNSGTCEVTYIGHKDFVLSVATTQNDEYILSGSKDRGVLFWDKKSGNP 660

Query: 647 IQKLAAHQSEVWSISVSNDGTF-----VISTGH-DHSIRVWE 682
           +  L  H++ V S++V+N         V +TG  D   R+W+
Sbjct: 661 LLMLQGHRNSVISVAVANGSPLGPEYNVFATGSGDCKARIWK 702

 Score = 67.4 bits (163), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 68/278 (24%), Positives = 117/278 (42%), Gaps = 50/278 (17%)

Query: 77  SKPAETTFLK---YHPETNLLAAGYADGVIKIWDLISKTVLISFNGHKSAITVLAFDTTG 133
           S P+   +++   + P+   LA G  D +I+IWD+  + +++   GH+  I  L +  +G
Sbjct: 434 SSPSSDLYIRSVCFSPDGKFLATGAEDRLIRIWDIEKRKIVMILQGHEQDIYSLDYFPSG 493

Query: 134 TRLISASKDSDIIVWDL-VGESGLYKLRSHKDAITGLWCE--DENWLISTSKDGLVKIWD 190
            +L+S S D  + +WDL  G+  L    S +D +T +     D  ++ + S D  V++WD
Sbjct: 494 DKLVSGSGDRTVRIWDLRTGQCSL--TLSIEDGVTTVAVSPGDGKYIAAGSLDRAVRVWD 551

Query: 191 LKSQQCV-------ETHLAHTGECWSLGIIED--MAVTCSADSQVKLWKL-DLQAENGSK 240
            ++   V       E+   H    +S+    D    V+ S D  VKLW L +   ++ SK
Sbjct: 552 SETGFLVERLDSENESGTGHKDSVYSVVFTRDGHSVVSGSLDRSVKLWNLQNANNKSDSK 611

Query: 241 LTEKGIIEKQSKQRGVEIDFAVAPDGVKFFYIQNADKTIEIYRLRKEEEISRALKKR--- 297
               G  E                      YI + D  + +   + +E I    K R   
Sbjct: 612 APNSGTCE--------------------VTYIGHKDFVLSVATTQNDEYILSGSKDRGVL 651

Query: 298 --EKR-------LQDKGMSEEEIKEAMGSPVSLMYHLF 326
             +K+       LQ    S   +  A GSP+   Y++F
Sbjct: 652 FWDKKSGNPLLMLQGHRNSVISVAVANGSPLGPEYNVF 689

 Score = 53.9 bits (128), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 35/139 (25%), Positives = 68/139 (48%), Gaps = 2/139 (1%)

Query: 571 LPVLSMDISYDSKLIVTCSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLPESYNFFSC 630
           L + S+  S D K + T + D+ I+IW ++       L  H+  I ++ + P      S 
Sbjct: 440 LYIRSVCFSPDGKFLATGAEDRLIRIWDIEKRKIVMILQGHEQDIYSLDYFPSGDKLVSG 499

Query: 631 SKDATVKYWDGQKFECIQKLAAHQSEVWSISVS-NDGTFVISTGHDHSIRVWEETEDQVF 689
           S D TV+ WD +  +C   L+  +  V +++VS  DG ++ +   D ++RVW+     + 
Sbjct: 500 SGDRTVRIWDLRTGQCSLTLSI-EDGVTTVAVSPGDGKYIAAGSLDRAVRVWDSETGFLV 558

Query: 690 LEEEREKEMDEQYEDTLLT 708
              + E E    ++D++ +
Sbjct: 559 ERLDSENESGTGHKDSVYS 577

 Score = 53.1 bits (126), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 52/223 (23%), Positives = 94/223 (42%), Gaps = 44/223 (19%)

Query: 45  GLENILVWDIKTGEQIAQLTDGLPPGASDAKLSKPAETTFLKYHPETNLLAAGYADGVIK 104
           G   + +WD++TG+    LT  +  G +   +S P +  ++         AAG  D  ++
Sbjct: 501 GDRTVRIWDLRTGQ--CSLTLSIEDGVTTVAVS-PGDGKYI---------AAGSLDRAVR 548

Query: 105 IWDLISKTVLI---------SFNGHKSAITVLAFDTTGTRLISASKDSDIIVWDL----- 150
           +WD  S+T  +         S  GHK ++  + F   G  ++S S D  + +W+L     
Sbjct: 549 VWD--SETGFLVERLDSENESGTGHKDSVYSVVFTRDGHSVVSGSLDRSVKLWNLQNANN 606

Query: 151 -----VGESGLYKLR--SHKDAITGLWC-EDENWLISTSKDGLVKIWDLKSQQCVETHLA 202
                   SG  ++    HKD +  +   +++ +++S SKD  V  WD KS   +     
Sbjct: 607 KSDSKAPNSGTCEVTYIGHKDFVLSVATTQNDEYILSGSKDRGVLFWDKKSGNPLLMLQG 666

Query: 203 HTGECWSLGIIE--------DMAVTCSADSQVKLWKLDLQAEN 237
           H     S+ +          ++  T S D + ++WK    A N
Sbjct: 667 HRNSVISVAVANGSPLGPEYNVFATGSGDCKARIWKYKKIAPN 709

>Kwal_23.6429 s23 complement(1577398..1579650) [2253 bp, 750 aa]
           {ON} YCR084C (TUP1) - glucose repression regulatory
           protein, exhibits similarity to beta subunits of G
           proteins [contig 17] FULL
          Length = 750

 Score =  102 bits (255), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 86/336 (25%), Positives = 148/336 (44%), Gaps = 53/336 (15%)

Query: 396 ISDDNKLLATASNGSLKIWNIKTKRCIRSFECG--YALTCKFLPGGALVVVGTRNGELQL 453
           +S+D     + ++ S    N K    + +      Y  +  F P G  +  G  +  +++
Sbjct: 437 LSEDASSAPSGADASATSENAKASPAVATSASSDLYIRSVCFSPDGKFLATGAEDKLIRI 496

Query: 454 FDIASSTMLDNKEGAHDAAIWSLDLTSDGRKLVTGSADKTVRFWTFEVSEVPVSDESNKT 513
           +D+A+  ++   +G H+  I+SLD    G KLV+GS D+TVR W     +  +       
Sbjct: 497 WDLATRRIVMTLQG-HEQDIYSLDYFPSGDKLVSGSGDRTVRIWDLRTGQCSL------- 548

Query: 514 MPMLQLFHDTTLELDDDILSVVISPDD-KFIAVSLLDNTVKVFFLDSMKFFLS------- 565
                     TL ++D + +V +SP D K IA   LD TV+++  DS   FL        
Sbjct: 549 ----------TLSIEDGVTTVAVSPGDGKLIAAGSLDRTVRIW--DSETGFLVERLDSEN 596

Query: 566 --LYGHKLPVLSMDISYDSKLIVTCSADKNIKIWGL------------DFGDCHKSLFAH 611
               GHK  V S+  + D   +V+ S D+++K+W L            +      +   H
Sbjct: 597 ELGTGHKDSVYSVVFTRDGHGVVSGSLDRSVKLWNLRSANGGTAEGKANTAASEVTYTGH 656

Query: 612 QDSIMNVKFLPESYNFFSCSKDATVKYWDGQKFECIQKLAAHQSEVWSISVSND------ 665
           +D +++V          S SKD  V +WD      +  L  H++ V S++V+ND      
Sbjct: 657 KDFVLSVATTQNDEFILSGSKDRGVLFWDTPSGNPLLMLQGHRNSVISVAVANDHPLGPE 716

Query: 666 -GTFVISTGHDHSIRVWEETEDQVFLEEEREKEMDE 700
            G F   +G D   R+W+ ++ Q    E + +E+ E
Sbjct: 717 YGVFATGSG-DCKARIWKYSK-QTSNAEPKLREVKE 750

 Score = 84.3 bits (207), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 59/238 (24%), Positives = 106/238 (44%), Gaps = 31/238 (13%)

Query: 469 HDAAIWSLDLTSDGRKLVTGSADKTVRFWTFEVSEV-----------------PVSDESN 511
           H + +  +  + DG  L TG  +KT + +     E+                   + E+ 
Sbjct: 399 HSSVVCCVRFSHDGEFLATG-CNKTTQVYKVSTGELIARLSEDASSAPSGADASATSENA 457

Query: 512 KTMPMLQLFHDTTLELDDDILSVVISPDDKFIAVSLLDNTVKVFFLDSMKFFLSLYGHKL 571
           K  P +     T+   D  I SV  SPD KF+A    D  ++++ L + +  ++L GH+ 
Sbjct: 458 KASPAVA----TSASSDLYIRSVCFSPDGKFLATGAEDKLIRIWDLATRRIVMTLQGHEQ 513

Query: 572 PVLSMDISYDSKLIVTCSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLPESYNFFSC- 630
            + S+D       +V+ S D+ ++IW L  G C  +L + +D +  V   P      +  
Sbjct: 514 DIYSLDYFPSGDKLVSGSGDRTVRIWDLRTGQCSLTL-SIEDGVTTVAVSPGDGKLIAAG 572

Query: 631 SKDATVKYWDGQKFECIQKL-------AAHQSEVWSISVSNDGTFVISTGHDHSIRVW 681
           S D TV+ WD +    +++L         H+  V+S+  + DG  V+S   D S+++W
Sbjct: 573 SLDRTVRIWDSETGFLVERLDSENELGTGHKDSVYSVVFTRDGHGVVSGSLDRSVKLW 630

 Score = 73.6 bits (179), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 66/239 (27%), Positives = 112/239 (46%), Gaps = 39/239 (16%)

Query: 51  VWDIKTGEQIAQLTD---GLPPGASDAKLSK-----PAETT------FLK---YHPETNL 93
           V+ + TGE IA+L++     P GA  +  S+     PA  T      +++   + P+   
Sbjct: 425 VYKVSTGELIARLSEDASSAPSGADASATSENAKASPAVATSASSDLYIRSVCFSPDGKF 484

Query: 94  LAAGYADGVIKIWDLISKTVLISFNGHKSAITVLAFDTTGTRLISASKDSDIIVWDL-VG 152
           LA G  D +I+IWDL ++ ++++  GH+  I  L +  +G +L+S S D  + +WDL  G
Sbjct: 485 LATGAEDKLIRIWDLATRRIVMTLQGHEQDIYSLDYFPSGDKLVSGSGDRTVRIWDLRTG 544

Query: 153 ESGLYKLRSHKDAITGLWCE--DENWLISTSKDGLVKIWDLKSQQCVET-------HLAH 203
           +  L    S +D +T +     D   + + S D  V+IWD ++   VE           H
Sbjct: 545 QCSL--TLSIEDGVTTVAVSPGDGKLIAAGSLDRTVRIWDSETGFLVERLDSENELGTGH 602

Query: 204 TGECWSLGIIED--MAVTCSADSQVKLWKLDLQAENGSKLTEKGIIEKQSKQRGVEIDF 260
               +S+    D    V+ S D  VKLW  +L++ NG      G  E ++     E+ +
Sbjct: 603 KDSVYSVVFTRDGHGVVSGSLDRSVKLW--NLRSANG------GTAEGKANTAASEVTY 653

 Score = 58.2 bits (139), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 35/137 (25%), Positives = 67/137 (48%), Gaps = 2/137 (1%)

Query: 573 VLSMDISYDSKLIVTCSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLPESYNFFSCSK 632
           + S+  S D K + T + DK I+IW L       +L  H+  I ++ + P      S S 
Sbjct: 473 IRSVCFSPDGKFLATGAEDKLIRIWDLATRRIVMTLQGHEQDIYSLDYFPSGDKLVSGSG 532

Query: 633 DATVKYWDGQKFECIQKLAAHQSEVWSISVS-NDGTFVISTGHDHSIRVWEETEDQVFLE 691
           D TV+ WD +  +C   L+  +  V +++VS  DG  + +   D ++R+W+     +   
Sbjct: 533 DRTVRIWDLRTGQCSLTLSI-EDGVTTVAVSPGDGKLIAAGSLDRTVRIWDSETGFLVER 591

Query: 692 EEREKEMDEQYEDTLLT 708
            + E E+   ++D++ +
Sbjct: 592 LDSENELGTGHKDSVYS 608

 Score = 54.3 bits (129), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 54/225 (24%), Positives = 91/225 (40%), Gaps = 48/225 (21%)

Query: 45  GLENILVWDIKTGEQIAQLT--DGLPPGASDAKLSKPAETTFLKYHPETNLLAAGYADGV 102
           G   + +WD++TG+    L+  DG+              TT      +  L+AAG  D  
Sbjct: 532 GDRTVRIWDLRTGQCSLTLSIEDGV--------------TTVAVSPGDGKLIAAGSLDRT 577

Query: 103 IKIWD-----LISKTVLISFN----GHKSAITVLAFDTTGTRLISASKDSDIIVWDLVGE 153
           ++IWD     L+ +  L S N    GHK ++  + F   G  ++S S D  + +W+L   
Sbjct: 578 VRIWDSETGFLVER--LDSENELGTGHKDSVYSVVFTRDGHGVVSGSLDRSVKLWNLRSA 635

Query: 154 SGL------------YKLRSHKDAITGLWC-EDENWLISTSKDGLVKIWDLKSQQCVETH 200
           +G                  HKD +  +   +++ +++S SKD  V  WD  S   +   
Sbjct: 636 NGGTAEGKANTAASEVTYTGHKDFVLSVATTQNDEFILSGSKDRGVLFWDTPSGNPLLML 695

Query: 201 LAHTGECWSLGIIEDMAV--------TCSADSQVKLWKLDLQAEN 237
             H     S+ +  D  +        T S D + ++WK   Q  N
Sbjct: 696 QGHRNSVISVAVANDHPLGPEYGVFATGSGDCKARIWKYSKQTSN 740

 Score = 37.4 bits (85), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 38/179 (21%), Positives = 76/179 (42%), Gaps = 30/179 (16%)

Query: 39  GQVIVGGL--ENILVWDIKTGEQIAQL--TDGLPPGASDAKLSKPAETTFLKYHPETNLL 94
           G++I  G     + +WD +TG  + +L   + L  G  D+  S      F +   + + +
Sbjct: 566 GKLIAAGSLDRTVRIWDSETGFLVERLDSENELGTGHKDSVYS----VVFTR---DGHGV 618

Query: 95  AAGYADGVIKIWDLISK------------TVLISFNGHKSAITVLAFDTTGTRLISASKD 142
            +G  D  +K+W+L S                +++ GHK  +  +A       ++S SKD
Sbjct: 619 VSGSLDRSVKLWNLRSANGGTAEGKANTAASEVTYTGHKDFVLSVATTQNDEFILSGSKD 678

Query: 143 SDIIVWDLVGESGLYKLRSHKDAITGLWCEDENWL-------ISTSKDGLVKIWDLKSQ 194
             ++ WD    + L  L+ H++++  +   +++ L        + S D   +IW    Q
Sbjct: 679 RGVLFWDTPSGNPLLMLQGHRNSVISVAVANDHPLGPEYGVFATGSGDCKARIWKYSKQ 737

>KNAG0D00250 Chr4 (32581..34548) [1968 bp, 655 aa] {ON} Anc_6.363
           YCR084C
          Length = 655

 Score =  101 bits (252), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 95/388 (24%), Positives = 166/388 (42%), Gaps = 87/388 (22%)

Query: 359 IEYYSIPYSKREPTQ-------PAPLKLHTIDLHGQRTDIRSTSI------SDDNKLLAT 405
           ++Y  +P + R+ T+       PA  +   ++LH     +  TS+      S+D + LAT
Sbjct: 276 LDYKQVPENLRKKTEEYDVLYNPALPRTLEVELH---KSLEHTSVVCCVKFSNDGQYLAT 332

Query: 406 ASNGSLKIWNIKTKRCIR--------SFECG-----------YALTCKFLPGGALVVVGT 446
             N + +++ +     +         S + G           Y  +  F P G  +  G 
Sbjct: 333 GCNKTTQVFRVSDGELVARLSDDNAPSIQNGGNGSDSGSTDLYIRSVCFSPDGKFLATGA 392

Query: 447 RNGELQLFDIASSTMLDNKEGAHDAAIWSLDLTSDGRKLVTGSADKTVRFWTFEVSEVPV 506
            +  ++++D+A   ++   +G HD  ++SLD    G KLV+GS D+TVR W  +  +  +
Sbjct: 393 EDRLIRIWDLAQQKIVMVLQG-HDQDVYSLDYFPSGDKLVSGSGDRTVRIWDLKTGQCSL 451

Query: 507 SDESNKTMPMLQLFHDTTLELDDDILSVVISPDD-KFIAVSLLDNTVKVFFLDSMKFFLS 565
                            TL ++D + +V +SP D K+IA   LD  V+V+  DS   FL 
Sbjct: 452 -----------------TLSIEDGVTTVAVSPGDGKYIAAGSLDRAVRVW--DSETGFLV 492

Query: 566 LY---------GHKLPVLSMDISYDSKLIVTCSADKNIKIWGL-------DFGD------ 603
                      GH+  V S+  + D   +V+ S D+++K+W L       +  D      
Sbjct: 493 ERLDSENELGTGHRDSVYSVVFTRDGNKVVSSSLDRSVKLWNLRGYNEKENAADNNKSQS 552

Query: 604 ---CHKSLFAHQDSIMNVKFLPESYNFFSCSKDATVKYWDGQKFECIQKLAAHQSEVWSI 660
              C  +   H+D +++V          S SKD  V +WD      +  L  H++ V S+
Sbjct: 553 SVVCEVTYIGHKDFVLSVTTTANDEFVLSGSKDRGVLFWDTNTGNPLLMLQGHRNSVISV 612

Query: 661 SVSNDGTF-----VISTGH-DHSIRVWE 682
           +V+N         V +TG  D   R+W+
Sbjct: 613 AVANGHPLGPEYQVFATGSGDCRARIWK 640

 Score = 73.9 bits (180), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 59/216 (27%), Positives = 98/216 (45%), Gaps = 20/216 (9%)

Query: 34  KTGNLGQVIVGGL-ENILVWDIKTGEQIAQLTDGLPPGASDAKLSKPAETTFLK-----Y 87
           K  N GQ +  G  +   V+ +  GE +A+L+D   P   +      + +T L      +
Sbjct: 322 KFSNDGQYLATGCNKTTQVFRVSDGELVARLSDDNAPSIQNGGNGSDSGSTDLYIRSVCF 381

Query: 88  HPETNLLAAGYADGVIKIWDLISKTVLISFNGHKSAITVLAFDTTGTRLISASKDSDIIV 147
            P+   LA G  D +I+IWDL  + +++   GH   +  L +  +G +L+S S D  + +
Sbjct: 382 SPDGKFLATGAEDRLIRIWDLAQQKIVMVLQGHDQDVYSLDYFPSGDKLVSGSGDRTVRI 441

Query: 148 WDL-VGESGLYKLRSHKDAITGLWCE--DENWLISTSKDGLVKIWDLKSQQCVET----- 199
           WDL  G+  L    S +D +T +     D  ++ + S D  V++WD ++   VE      
Sbjct: 442 WDLKTGQCSL--TLSIEDGVTTVAVSPGDGKYIAAGSLDRAVRVWDSETGFLVERLDSEN 499

Query: 200 --HLAHTGECWSLGIIED--MAVTCSADSQVKLWKL 231
                H    +S+    D    V+ S D  VKLW L
Sbjct: 500 ELGTGHRDSVYSVVFTRDGNKVVSSSLDRSVKLWNL 535

 Score = 55.8 bits (133), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 50/229 (21%), Positives = 97/229 (42%), Gaps = 21/229 (9%)

Query: 511 NKTMP-MLQLFHDTTLELDDDILSVVISPDDKFIAVSLLDNTVKVFFLDSMKFFLSLYGH 569
           N  +P  L++    +LE    +  V  S D +++A    + T +VF +   +    L   
Sbjct: 297 NPALPRTLEVELHKSLEHTSVVCCVKFSNDGQYLATGC-NKTTQVFRVSDGELVARLSDD 355

Query: 570 KLP-----------------VLSMDISYDSKLIVTCSADKNIKIWGLDFGDCHKSLFAHQ 612
             P                 + S+  S D K + T + D+ I+IW L        L  H 
Sbjct: 356 NAPSIQNGGNGSDSGSTDLYIRSVCFSPDGKFLATGAEDRLIRIWDLAQQKIVMVLQGHD 415

Query: 613 DSIMNVKFLPESYNFFSCSKDATVKYWDGQKFECIQKLAAHQSEVWSISVS-NDGTFVIS 671
             + ++ + P      S S D TV+ WD +  +C   L+     V +++VS  DG ++ +
Sbjct: 416 QDVYSLDYFPSGDKLVSGSGDRTVRIWDLKTGQCSLTLSIEDG-VTTVAVSPGDGKYIAA 474

Query: 672 TGHDHSIRVWEETEDQVFLEEEREKEMDEQYEDTLLTSLEGGAGDEMLS 720
              D ++RVW+     +    + E E+   + D++ + +    G++++S
Sbjct: 475 GSLDRAVRVWDSETGFLVERLDSENELGTGHRDSVYSVVFTRDGNKVVS 523

 Score = 49.7 bits (117), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 50/233 (21%), Positives = 98/233 (42%), Gaps = 49/233 (21%)

Query: 45  GLENILVWDIKTGEQIAQLTDGLPPGASDAKLSKPAETTFLKYHPETNLLAAGYADGVIK 104
           G   + +WD+KTG+    LT  +  G +   +S P +  ++         AAG  D  ++
Sbjct: 435 GDRTVRIWDLKTGQ--CSLTLSIEDGVTTVAVS-PGDGKYI---------AAGSLDRAVR 482

Query: 105 IWD-----LISKTVLISFN----GHKSAITVLAFDTTGTRLISASKDSDIIVWDLVGESG 155
           +WD     L+ +  L S N    GH+ ++  + F   G +++S+S D  + +W+L G + 
Sbjct: 483 VWDSETGFLVER--LDSENELGTGHRDSVYSVVFTRDGNKVVSSSLDRSVKLWNLRGYNE 540

Query: 156 LYKLRSHKDAITGLWCE-----------------DENWLISTSKDGLVKIWDLKSQQCVE 198
                 +  + + + CE                 ++ +++S SKD  V  WD  +   + 
Sbjct: 541 KENAADNNKSQSSVVCEVTYIGHKDFVLSVTTTANDEFVLSGSKDRGVLFWDTNTGNPLL 600

Query: 199 THLAHTGECWSLGIIEDMAV--------TCSADSQVKLWKLDLQAENGSKLTE 243
               H     S+ +     +        T S D + ++WK   + ++ SK+ E
Sbjct: 601 MLQGHRNSVISVAVANGHPLGPEYQVFATGSGDCRARIWKFS-KLDSASKVKE 652

>KLLA0F13244g Chr6 (1224178..1226622) [2445 bp, 814 aa] {ON} highly
           similar to uniprot|Q05946 Saccharomyces cerevisiae
           YLR222C UTP13 Nucleolar protein component of the small
           subunit (SSU) processome containing the U3 snoRNA
          Length = 814

 Score =  102 bits (253), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 61/218 (27%), Positives = 108/218 (49%), Gaps = 11/218 (5%)

Query: 485 LVTGSADKTVRFWTFEVSEVP-VSDESNKTMPMLQLFHDTTLELDDDILSVVISPDDKFI 543
           ++T S D T++ W     +VP V+ +  + + +++    T    + DI ++ ISP+D   
Sbjct: 456 IITASNDLTIKKW-----KVPKVTSDEPEDLILVKTSEYTRRAHEKDINAISISPNDSLF 510

Query: 544 AVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSMDISYDSKLIVTCSADKNIKIWGLDFGD 603
           A +  D T K++ LD  +F  +L  HK  +  +      KL+ TCS DK IKIW L+   
Sbjct: 511 ATASYDKTCKIWNLDDGEFQATLANHKRGLWDVAFCQYDKLLATCSGDKTIKIWSLESYA 570

Query: 604 CHKSLFAHQDSIMNVKFLPESYNFFSCSKDATVKYWDGQKFECIQKLAAHQSEVWSISVS 663
             K+L  H +++    F+ ++    S   D  V  WD    E ++ L AH + +W+++V 
Sbjct: 571 VVKTLEGHTNAVQRCSFINKNKQLISTGADGLVIIWDLSTGESVKTLDAHNNRIWALAVM 630

Query: 664 NDGTFVISTGHDHSIRVWEETEDQVFLEEEREKEMDEQ 701
           NDG   ++   D     W +       EEE E+ ++++
Sbjct: 631 NDGESFVTADADGFFEFWRDNS-----EEEHERNLEQE 663

 Score = 70.1 bits (170), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 52/166 (31%), Positives = 78/166 (46%), Gaps = 4/166 (2%)

Query: 89  PETNLLAAGYADGVIKIWDLISKTVLISFNGHKSAITVLAFDTTGTRLISASKDSDIIVW 148
           P  +L A    D   KIW+L       +   HK  +  +AF      L + S D  I +W
Sbjct: 505 PNDSLFATASYDKTCKIWNLDDGEFQATLANHKRGLWDVAFCQYDKLLATCSGDKTIKIW 564

Query: 149 DLVGESGLYKLRSHKDAITGLWCEDEN-WLISTSKDGLVKIWDLKSQQCVETHLAHTGEC 207
            L   + +  L  H +A+      ++N  LIST  DGLV IWDL + + V+T  AH    
Sbjct: 565 SLESYAVVKTLEGHTNAVQRCSFINKNKQLISTGADGLVIIWDLSTGESVKTLDAHNNRI 624

Query: 208 WSLGIIEDMA--VTCSADSQVKLWKLDLQAENGSKL-TEKGIIEKQ 250
           W+L ++ D    VT  AD   + W+ + + E+   L  EK  IE++
Sbjct: 625 WALAVMNDGESFVTADADGFFEFWRDNSEEEHERNLEQEKLKIEQE 670

 Score = 46.6 bits (109), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 27/101 (26%), Positives = 54/101 (53%), Gaps = 4/101 (3%)

Query: 400 NKLLATAS-NGSLKIWNIKTKRCIRSFE--CGYALTCKFLPGGALVVVGTRNGELQLFDI 456
           +KLLAT S + ++KIW++++   +++ E        C F+     ++    +G + ++D+
Sbjct: 549 DKLLATCSGDKTIKIWSLESYAVVKTLEGHTNAVQRCSFINKNKQLISTGADGLVIIWDL 608

Query: 457 ASSTMLDNKEGAHDAAIWSLDLTSDGRKLVTGSADKTVRFW 497
           ++   +   + AH+  IW+L + +DG   VT  AD    FW
Sbjct: 609 STGESVKTLD-AHNNRIWALAVMNDGESFVTADADGFFEFW 648

 Score = 39.7 bits (91), Expect = 0.044,   Method: Compositional matrix adjust.
 Identities = 31/115 (26%), Positives = 55/115 (47%), Gaps = 10/115 (8%)

Query: 91  TNLLAAGYADGVIKIWDLISKTVLISFNGHKSAITVLAF----DTTGTRLISASKDSDII 146
           + LLA G  DG + + D+ +  V  S  GH + I+ + F    ++   +L S   +  I 
Sbjct: 113 STLLAIGGTDGSVSVIDIENGYVTHSLKGHGATISSVKFHGELNSEIWKLASGDTNGMIK 172

Query: 147 VWDLVGESGLYKLRSHKDAITGL--WCEDEN----WLISTSKDGLVKIWDLKSQQ 195
           VWDLV  +    ++ H  A+ GL     DE      L+S  +D ++ +++  S +
Sbjct: 173 VWDLVKRNCQCTIQEHTTAVRGLDFRVTDEEKGTLQLLSGGRDNILNLFEFNSTK 227

 Score = 38.9 bits (89), Expect = 0.076,   Method: Compositional matrix adjust.
 Identities = 24/73 (32%), Positives = 40/73 (54%), Gaps = 9/73 (12%)

Query: 80  AETTFLKYHPETNL----LAAGYADGVIKIWDLISKTVLISFNGHKSAITVLAFDTT--- 132
           A  + +K+H E N     LA+G  +G+IK+WDL+ +    +   H +A+  L F  T   
Sbjct: 144 ATISSVKFHGELNSEIWKLASGDTNGMIKVWDLVKRNCQCTIQEHTTAVRGLDFRVTDEE 203

Query: 133 -GT-RLISASKDS 143
            GT +L+S  +D+
Sbjct: 204 KGTLQLLSGGRDN 216

 Score = 35.4 bits (80), Expect = 0.92,   Method: Compositional matrix adjust.
 Identities = 31/129 (24%), Positives = 55/129 (42%), Gaps = 6/129 (4%)

Query: 81  ETTFLKYHPETNLLAAGYADGVIKIWDLISKTVLISFNGHKSAITVLAFDTTGTRLISAS 140
           + T L   P+ + L       +++++ L  + ++ S     S + V+  D T T L    
Sbjct: 62  DITALHLTPDGSYLCFVSQAQLLRVYSLKQERIIRSMK-ISSPVYVMNCDQTSTLLAIGG 120

Query: 141 KDSDIIVWDLVGESGLYKLRSHKDAITGL----WCEDENW-LISTSKDGLVKIWDLKSQQ 195
            D  + V D+      + L+ H   I+ +        E W L S   +G++K+WDL  + 
Sbjct: 121 TDGSVSVIDIENGYVTHSLKGHGATISSVKFHGELNSEIWKLASGDTNGMIKVWDLVKRN 180

Query: 196 CVETHLAHT 204
           C  T   HT
Sbjct: 181 CQCTIQEHT 189

 Score = 33.1 bits (74), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 31/136 (22%), Positives = 56/136 (41%), Gaps = 23/136 (16%)

Query: 568 GHKLPVLSMDISYDSKLIVTCSADKNIKIWGL-----DFGDCHKSLFAHQDSIMNVKF-- 620
           GH   + S+D + D   + T S D ++ +W       DF    K    H  S+  V    
Sbjct: 388 GHTDLLNSLDATADGLWVATASKDHSVILWRYHAKYEDFYPYTK-FVGHVGSVNAVGLPN 446

Query: 621 -LPESYNFF--SCSKDATVKYWDGQKFECIQK------------LAAHQSEVWSISVSND 665
            +P S+  F  + S D T+K W   K    +               AH+ ++ +IS+S +
Sbjct: 447 VMPRSWPEFIITASNDLTIKKWKVPKVTSDEPEDLILVKTSEYTRRAHEKDINAISISPN 506

Query: 666 GTFVISTGHDHSIRVW 681
            +   +  +D + ++W
Sbjct: 507 DSLFATASYDKTCKIW 522

>Suva_3.121 Chr3 complement(177765..179864) [2100 bp, 700 aa] {ON}
           YCR084C (REAL)
          Length = 700

 Score =  101 bits (252), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 73/258 (28%), Positives = 121/258 (46%), Gaps = 42/258 (16%)

Query: 429 YALTCKFLPGGALVVVGTRNGELQLFDIASSTMLDNKEGAHDAAIWSLDLTSDGRKLVTG 488
           Y  +  F P G  +  G  +  ++++DI +  ++   +G H+  I+SLD    G KLV+G
Sbjct: 449 YIRSVCFSPDGKFLATGAEDRLIRIWDIENRKIVMILQG-HEQDIYSLDYFPSGDKLVSG 507

Query: 489 SADKTVRFWTFEVSEVPVSDESNKTMPMLQLFHDTTLELDDDILSVVISPDD-KFIAVSL 547
           S D+TVR W     +  +                 TL ++D + +V +SP D K+IA   
Sbjct: 508 SGDRTVRIWDLRTGQCSL-----------------TLSIEDGVTTVAVSPGDGKYIAAGS 550

Query: 548 LDNTVKVFFLDSMKFFL---------SLYGHKLPVLSMDISYDSKLIVTCSADKNIKIWG 598
           LD  V+V+  DS   FL         S  GHK  V S+  + D + +V+ S D+++K+W 
Sbjct: 551 LDRAVRVW--DSETGFLVERLDSENESGTGHKDSVYSVVFTRDGESVVSGSLDRSVKLWN 608

Query: 599 L------------DFGDCHKSLFAHQDSIMNVKFLPESYNFFSCSKDATVKYWDGQKFEC 646
           L            + G C  +   H+D +++V          S SKD  V +WD +    
Sbjct: 609 LQNANNKSDSKTPNSGTCEVTYIGHKDFVLSVATTQNDEYILSGSKDRGVLFWDKKSGNP 668

Query: 647 IQKLAAHQSEVWSISVSN 664
           +  L  H++ V S++V+N
Sbjct: 669 LLMLQGHRNSVISVAVAN 686

 Score = 78.6 bits (192), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 44/159 (27%), Positives = 80/159 (50%), Gaps = 9/159 (5%)

Query: 531 ILSVVISPDDKFIAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSMDISYDSKLIVTCSA 590
           I SV  SPD KF+A    D  ++++ +++ K  + L GH+  + S+D       +V+ S 
Sbjct: 450 IRSVCFSPDGKFLATGAEDRLIRIWDIENRKIVMILQGHEQDIYSLDYFPSGDKLVSGSG 509

Query: 591 DKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLPESYNFFSC-SKDATVKYWDGQKFECIQK 649
           D+ ++IW L  G C  +L + +D +  V   P    + +  S D  V+ WD +    +++
Sbjct: 510 DRTVRIWDLRTGQCSLTL-SIEDGVTTVAVSPGDGKYIAAGSLDRAVRVWDSETGFLVER 568

Query: 650 L-------AAHQSEVWSISVSNDGTFVISTGHDHSIRVW 681
           L         H+  V+S+  + DG  V+S   D S+++W
Sbjct: 569 LDSENESGTGHKDSVYSVVFTRDGESVVSGSLDRSVKLW 607

 Score = 68.2 bits (165), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 68/278 (24%), Positives = 118/278 (42%), Gaps = 50/278 (17%)

Query: 77  SKPAETTFLK---YHPETNLLAAGYADGVIKIWDLISKTVLISFNGHKSAITVLAFDTTG 133
           S P+   +++   + P+   LA G  D +I+IWD+ ++ +++   GH+  I  L +  +G
Sbjct: 442 STPSSDLYIRSVCFSPDGKFLATGAEDRLIRIWDIENRKIVMILQGHEQDIYSLDYFPSG 501

Query: 134 TRLISASKDSDIIVWDL-VGESGLYKLRSHKDAITGLWCE--DENWLISTSKDGLVKIWD 190
            +L+S S D  + +WDL  G+  L    S +D +T +     D  ++ + S D  V++WD
Sbjct: 502 DKLVSGSGDRTVRIWDLRTGQCSL--TLSIEDGVTTVAVSPGDGKYIAAGSLDRAVRVWD 559

Query: 191 LKSQQCV-------ETHLAHTGECWSLGIIED--MAVTCSADSQVKLWKL-DLQAENGSK 240
            ++   V       E+   H    +S+    D    V+ S D  VKLW L +   ++ SK
Sbjct: 560 SETGFLVERLDSENESGTGHKDSVYSVVFTRDGESVVSGSLDRSVKLWNLQNANNKSDSK 619

Query: 241 LTEKGIIEKQSKQRGVEIDFAVAPDGVKFFYIQNADKTIEIYRLRKEEEISRALKKR--- 297
               G  E                      YI + D  + +   + +E I    K R   
Sbjct: 620 TPNSGTCE--------------------VTYIGHKDFVLSVATTQNDEYILSGSKDRGVL 659

Query: 298 --EKR-------LQDKGMSEEEIKEAMGSPVSLMYHLF 326
             +K+       LQ    S   +  A GSP+   Y++F
Sbjct: 660 FWDKKSGNPLLMLQGHRNSVISVAVANGSPLGPEYNVF 697

 Score = 62.8 bits (151), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 53/211 (25%), Positives = 104/211 (49%), Gaps = 15/211 (7%)

Query: 384 LHGQRTDIRSTS-ISDDNKLLATASNGSLKIWNIKTKRC--IRSFECGYALTCKFLPG-G 439
           L G   DI S       +KL++ + + +++IW+++T +C    S E G   T    PG G
Sbjct: 485 LQGHEQDIYSLDYFPSGDKLVSGSGDRTVRIWDLRTGQCSLTLSIEDGVT-TVAVSPGDG 543

Query: 440 ALVVVGTRNGELQLFDIASSTMLD-----NKEG-AHDAAIWSLDLTSDGRKLVTGSADKT 493
             +  G+ +  ++++D  +  +++     N+ G  H  +++S+  T DG  +V+GS D++
Sbjct: 544 KYIAAGSLDRAVRVWDSETGFLVERLDSENESGTGHKDSVYSVVFTRDGESVVSGSLDRS 603

Query: 494 VRFWTFEVSEVPVSDESNKTMPMLQLFHDTTLELDDDILSVVISPDDKFIAVSLLDNTVK 553
           V+ W  + +    +++S+   P       T +   D +LSV  + +D++I     D  V 
Sbjct: 604 VKLWNLQNA----NNKSDSKTPNSGTCEVTYIGHKDFVLSVATTQNDEYILSGSKDRGVL 659

Query: 554 VFFLDSMKFFLSLYGHKLPVLSMDISYDSKL 584
            +   S    L L GH+  V+S+ ++  S L
Sbjct: 660 FWDKKSGNPLLMLQGHRNSVISVAVANGSPL 690

 Score = 54.7 bits (130), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 37/151 (24%), Positives = 74/151 (49%), Gaps = 2/151 (1%)

Query: 571 LPVLSMDISYDSKLIVTCSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLPESYNFFSC 630
           L + S+  S D K + T + D+ I+IW ++       L  H+  I ++ + P      S 
Sbjct: 448 LYIRSVCFSPDGKFLATGAEDRLIRIWDIENRKIVMILQGHEQDIYSLDYFPSGDKLVSG 507

Query: 631 SKDATVKYWDGQKFECIQKLAAHQSEVWSISVS-NDGTFVISTGHDHSIRVWEETEDQVF 689
           S D TV+ WD +  +C   L+  +  V +++VS  DG ++ +   D ++RVW+     + 
Sbjct: 508 SGDRTVRIWDLRTGQCSLTLSI-EDGVTTVAVSPGDGKYIAAGSLDRAVRVWDSETGFLV 566

Query: 690 LEEEREKEMDEQYEDTLLTSLEGGAGDEMLS 720
              + E E    ++D++ + +    G+ ++S
Sbjct: 567 ERLDSENESGTGHKDSVYSVVFTRDGESVVS 597

 Score = 48.1 bits (113), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 45/190 (23%), Positives = 82/190 (43%), Gaps = 36/190 (18%)

Query: 45  GLENILVWDIKTGEQIAQLTDGLPPGASDAKLSKPAETTFLKYHPETNLLAAGYADGVIK 104
           G   + +WD++TG+    LT  +  G +   +S P +  ++         AAG  D  ++
Sbjct: 509 GDRTVRIWDLRTGQ--CSLTLSIEDGVTTVAVS-PGDGKYI---------AAGSLDRAVR 556

Query: 105 IWDLISKTVLI---------SFNGHKSAITVLAFDTTGTRLISASKDSDIIVWDL----- 150
           +WD  S+T  +         S  GHK ++  + F   G  ++S S D  + +W+L     
Sbjct: 557 VWD--SETGFLVERLDSENESGTGHKDSVYSVVFTRDGESVVSGSLDRSVKLWNLQNANN 614

Query: 151 -----VGESGLYKLR--SHKDAITGLWC-EDENWLISTSKDGLVKIWDLKSQQCVETHLA 202
                   SG  ++    HKD +  +   +++ +++S SKD  V  WD KS   +     
Sbjct: 615 KSDSKTPNSGTCEVTYIGHKDFVLSVATTQNDEYILSGSKDRGVLFWDKKSGNPLLMLQG 674

Query: 203 HTGECWSLGI 212
           H     S+ +
Sbjct: 675 HRNSVISVAV 684

>KLTH0A07282g Chr1 complement(604949..607126) [2178 bp, 725 aa] {ON}
           some similarities with uniprot|P18323 Saccharomyces
           cerevisiae YCR084C
          Length = 725

 Score =  100 bits (250), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 77/286 (26%), Positives = 128/286 (44%), Gaps = 50/286 (17%)

Query: 429 YALTCKFLPGGALVVVGTRNGELQLFDIASSTMLDNKEGAHDAAIWSLDLTSDGRKLVTG 488
           Y  +  F P G  +  G  +  ++++D+ +  ++   +G H+  I+SLD    G KLV+G
Sbjct: 450 YIRSVCFSPDGKFLATGAEDKLIRIWDLTTRRIVMTLQG-HEQDIYSLDYFPSGDKLVSG 508

Query: 489 SADKTVRFWTFEVSEVPVSDESNKTMPMLQLFHDTTLELDDDILSVVISP-DDKFIAVSL 547
           S D+TVR W     +  +                 TL ++D + +V +SP D K IA   
Sbjct: 509 SGDRTVRIWDLRAGQCSL-----------------TLSIEDGVTTVAVSPGDGKLIAAGS 551

Query: 548 LDNTVKVFFLDSMKFFLS---------LYGHKLPVLSMDISYDSKLIVTCSADKNIKIWG 598
           LD TV+++  DS   FL            GHK  V S+  + D   +V+ S D+++K+W 
Sbjct: 552 LDRTVRIW--DSETGFLVERLDSENELGTGHKDSVYSVVFTRDGHGVVSGSLDRSVKLWN 609

Query: 599 LDFGDCHK------------SLFAHQDSIMNVKFLPESYNFFSCSKDATVKYWDGQKFEC 646
           L   +               +   H+D +++V          S SKD  V +WD      
Sbjct: 610 LRSANGGSTEGKANTAASEVTYTGHKDFVLSVATTQNDEFILSGSKDRGVLFWDTPSGNP 669

Query: 647 IQKLAAHQSEVWSISVSND-------GTFVISTGHDHSIRVWEETE 685
           +  L  H++ V S++V+ND       G F   +G D   R+W+ T+
Sbjct: 670 LLMLQGHRNSVISVAVANDHPLGPEYGVFATGSG-DCKARIWKYTK 714

 Score = 83.2 bits (204), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 59/240 (24%), Positives = 108/240 (45%), Gaps = 33/240 (13%)

Query: 469 HDAAIWSLDLTSDGRKLVTGSADKTVRFWTFEVSEV-----------PVSD--------E 509
           H + +  +  ++DG  L TG  +KT + +     E+           P  +        E
Sbjct: 375 HSSVVCCVRFSNDGEYLATG-CNKTTQVYKVSTGELVARLSEDAASAPSGNSGDGASGAE 433

Query: 510 SNKTMPMLQLFHDTTLELDDDILSVVISPDDKFIAVSLLDNTVKVFFLDSMKFFLSLYGH 569
           + +  P +     T+   D  I SV  SPD KF+A    D  ++++ L + +  ++L GH
Sbjct: 434 NAEQTPAVS----TSASSDLYIRSVCFSPDGKFLATGAEDKLIRIWDLTTRRIVMTLQGH 489

Query: 570 KLPVLSMDISYDSKLIVTCSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLPESYNFFS 629
           +  + S+D       +V+ S D+ ++IW L  G C  +L + +D +  V   P      +
Sbjct: 490 EQDIYSLDYFPSGDKLVSGSGDRTVRIWDLRAGQCSLTL-SIEDGVTTVAVSPGDGKLIA 548

Query: 630 C-SKDATVKYWDGQKFECIQKL-------AAHQSEVWSISVSNDGTFVISTGHDHSIRVW 681
             S D TV+ WD +    +++L         H+  V+S+  + DG  V+S   D S+++W
Sbjct: 549 AGSLDRTVRIWDSETGFLVERLDSENELGTGHKDSVYSVVFTRDGHGVVSGSLDRSVKLW 608

 Score = 71.2 bits (173), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 62/219 (28%), Positives = 104/219 (47%), Gaps = 35/219 (15%)

Query: 51  VWDIKTGEQIAQLTD---GLPPGASDAKLS-------KPAETT------FLK---YHPET 91
           V+ + TGE +A+L++     P G S    S        PA +T      +++   + P+ 
Sbjct: 401 VYKVSTGELVARLSEDAASAPSGNSGDGASGAENAEQTPAVSTSASSDLYIRSVCFSPDG 460

Query: 92  NLLAAGYADGVIKIWDLISKTVLISFNGHKSAITVLAFDTTGTRLISASKDSDIIVWDL- 150
             LA G  D +I+IWDL ++ ++++  GH+  I  L +  +G +L+S S D  + +WDL 
Sbjct: 461 KFLATGAEDKLIRIWDLTTRRIVMTLQGHEQDIYSLDYFPSGDKLVSGSGDRTVRIWDLR 520

Query: 151 VGESGLYKLRSHKDAITGLWCE--DENWLISTSKDGLVKIWDLKSQQCVET-------HL 201
            G+  L    S +D +T +     D   + + S D  V+IWD ++   VE          
Sbjct: 521 AGQCSL--TLSIEDGVTTVAVSPGDGKLIAAGSLDRTVRIWDSETGFLVERLDSENELGT 578

Query: 202 AHTGECWSLGIIED--MAVTCSADSQVKLWKLDLQAENG 238
            H    +S+    D    V+ S D  VKLW  +L++ NG
Sbjct: 579 GHKDSVYSVVFTRDGHGVVSGSLDRSVKLW--NLRSANG 615

 Score = 58.2 bits (139), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 36/139 (25%), Positives = 68/139 (48%), Gaps = 2/139 (1%)

Query: 571 LPVLSMDISYDSKLIVTCSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLPESYNFFSC 630
           L + S+  S D K + T + DK I+IW L       +L  H+  I ++ + P      S 
Sbjct: 449 LYIRSVCFSPDGKFLATGAEDKLIRIWDLTTRRIVMTLQGHEQDIYSLDYFPSGDKLVSG 508

Query: 631 SKDATVKYWDGQKFECIQKLAAHQSEVWSISVS-NDGTFVISTGHDHSIRVWEETEDQVF 689
           S D TV+ WD +  +C   L+  +  V +++VS  DG  + +   D ++R+W+     + 
Sbjct: 509 SGDRTVRIWDLRAGQCSLTLSI-EDGVTTVAVSPGDGKLIAAGSLDRTVRIWDSETGFLV 567

Query: 690 LEEEREKEMDEQYEDTLLT 708
              + E E+   ++D++ +
Sbjct: 568 ERLDSENELGTGHKDSVYS 586

 Score = 50.4 bits (119), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 52/224 (23%), Positives = 91/224 (40%), Gaps = 48/224 (21%)

Query: 45  GLENILVWDIKTGEQIAQLT--DGLPPGASDAKLSKPAETTFLKYHPETNLLAAGYADGV 102
           G   + +WD++ G+    L+  DG+              TT      +  L+AAG  D  
Sbjct: 510 GDRTVRIWDLRAGQCSLTLSIEDGV--------------TTVAVSPGDGKLIAAGSLDRT 555

Query: 103 IKIWD-----LISKTVLISFN----GHKSAITVLAFDTTGTRLISASKDSDIIVWDLVGE 153
           ++IWD     L+ +  L S N    GHK ++  + F   G  ++S S D  + +W+L   
Sbjct: 556 VRIWDSETGFLVER--LDSENELGTGHKDSVYSVVFTRDGHGVVSGSLDRSVKLWNLRSA 613

Query: 154 SGL------------YKLRSHKDAITGLWC-EDENWLISTSKDGLVKIWDLKSQQCVETH 200
           +G                  HKD +  +   +++ +++S SKD  V  WD  S   +   
Sbjct: 614 NGGSTEGKANTAASEVTYTGHKDFVLSVATTQNDEFILSGSKDRGVLFWDTPSGNPLLML 673

Query: 201 LAHTGECWSLGIIEDMAV--------TCSADSQVKLWKLDLQAE 236
             H     S+ +  D  +        T S D + ++WK   ++E
Sbjct: 674 QGHRNSVISVAVANDHPLGPEYGVFATGSGDCKARIWKYTKKSE 717

 Score = 37.4 bits (85), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 37/174 (21%), Positives = 75/174 (43%), Gaps = 30/174 (17%)

Query: 39  GQVIVGGL--ENILVWDIKTGEQIAQLT--DGLPPGASDAKLSKPAETTFLKYHPETNLL 94
           G++I  G     + +WD +TG  + +L   + L  G  D+  S      F +   + + +
Sbjct: 544 GKLIAAGSLDRTVRIWDSETGFLVERLDSENELGTGHKDSVYS----VVFTR---DGHGV 596

Query: 95  AAGYADGVIKIWDLISK------------TVLISFNGHKSAITVLAFDTTGTRLISASKD 142
            +G  D  +K+W+L S                +++ GHK  +  +A       ++S SKD
Sbjct: 597 VSGSLDRSVKLWNLRSANGGSTEGKANTAASEVTYTGHKDFVLSVATTQNDEFILSGSKD 656

Query: 143 SDIIVWDLVGESGLYKLRSHKDAITGLWCEDENWL-------ISTSKDGLVKIW 189
             ++ WD    + L  L+ H++++  +   +++ L        + S D   +IW
Sbjct: 657 RGVLFWDTPSGNPLLMLQGHRNSVISVAVANDHPLGPEYGVFATGSGDCKARIW 710

>NCAS0D04780 Chr4 (916321..918186) [1866 bp, 621 aa] {ON} Anc_6.363
          Length = 621

 Score =  100 bits (248), Expect = 6e-21,   Method: Compositional matrix adjust.
 Identities = 76/277 (27%), Positives = 130/277 (46%), Gaps = 44/277 (15%)

Query: 429 YALTCKFLPGGALVVVGTRNGELQLFDIASSTMLDNKEGAHDAAIWSLDLTSDGRKLVTG 488
           Y  +  F P G  +  G  +  +++++I    ++   +G H+  I+SLD   DG+KLV+G
Sbjct: 343 YIRSICFSPDGEFLATGAEDKLIRIWNIKERKIVMVLKG-HEQDIYSLDYFPDGQKLVSG 401

Query: 489 SADKTVRFWTFEVSEVPVSDESNKTMPMLQLFHDTTLELDDDILSVVISPDD-KFIAVSL 547
           S D+++R W  +  +  +                 TL ++D + +V +SP++ K IA   
Sbjct: 402 SGDRSIRIWDLKTGQCSL-----------------TLSIEDGVTTVAVSPNEGKLIAAGS 444

Query: 548 LDNTVKVFFLDSMKFFL---------SLYGHKLPVLSMDISYDSKLIVTCSADKNIKIWG 598
           LD +V+++  DS   FL         S  GH+  V S+  + D + +V+ S D+ +K+W 
Sbjct: 445 LDRSVRIW--DSSTGFLVERLDSDNESGNGHQDSVYSVAFTKDGQHVVSGSLDRTVKLWN 502

Query: 599 LD-----FGDCHKSLFAHQDSIMNVKFLPESYNFFSCSKDATVKYWDGQKFECIQKLAAH 653
           L       G C  +   H+D +++V    +    FS SKD  V  WD      I  L  H
Sbjct: 503 LGDTQSGTGKCEVTYIGHKDFVLSVATSNDDKYIFSGSKDRGVIIWDKDSGNPILMLQGH 562

Query: 654 QSEVWSISVSN----DGT----FVISTGHDHSIRVWE 682
           ++ V S++  N    DG     F   +G D   R+W+
Sbjct: 563 RNSVISVATVNSNVDDGKNYKLFATGSG-DCKARIWK 598

 Score = 87.0 bits (214), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 58/226 (25%), Positives = 109/226 (48%), Gaps = 15/226 (6%)

Query: 469 HDAAIWSLDLTSDGRKLVTGSADKTVRFWTFEVSEVPV---SDESNKTMPMLQLFHDTTL 525
           HD+ +  +  + DG+ L TG  ++T + +     E+ V    D  N  +      ++ T+
Sbjct: 278 HDSVVCCVKFSQDGKYLATG-CNRTTQIFDVATGELYVKLLDDTVNTAIVTTTTENNETV 336

Query: 526 ELDDD--ILSVVISPDDKFIAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSMDISYDSK 583
               D  I S+  SPD +F+A    D  ++++ +   K  + L GH+  + S+D   D +
Sbjct: 337 TTTADLYIRSICFSPDGEFLATGAEDKLIRIWNIKERKIVMVLKGHEQDIYSLDYFPDGQ 396

Query: 584 LIVTCSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLPESYNFFSC-SKDATVKYWDGQ 642
            +V+ S D++I+IW L  G C  +L + +D +  V   P      +  S D +V+ WD  
Sbjct: 397 KLVSGSGDRSIRIWDLKTGQCSLTL-SIEDGVTTVAVSPNEGKLIAAGSLDRSVRIWDSS 455

Query: 643 KFECIQKL-------AAHQSEVWSISVSNDGTFVISTGHDHSIRVW 681
               +++L         HQ  V+S++ + DG  V+S   D ++++W
Sbjct: 456 TGFLVERLDSDNESGNGHQDSVYSVAFTKDGQHVVSGSLDRTVKLW 501

 Score = 74.7 bits (182), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 72/273 (26%), Positives = 125/273 (45%), Gaps = 43/273 (15%)

Query: 391 IRSTSISDDNKLLATASNGSL-KIWNIKTKRCIRSFECG----YALTCKFLPGGALVVVG 445
           IRS   S D + LAT +   L +IWNIK ++ +   +      Y+L   + P G  +V G
Sbjct: 344 IRSICFSPDGEFLATGAEDKLIRIWNIKERKIVMVLKGHEQDIYSL--DYFPDGQKLVSG 401

Query: 446 TRNGELQLFDIAS---STMLDNKEGAHDAAIWSLDLTSDGRKLVTGSADKTVRFW----T 498
           + +  ++++D+ +   S  L  ++G    A+      ++G+ +  GS D++VR W     
Sbjct: 402 SGDRSIRIWDLKTGQCSLTLSIEDGVTTVAVSP----NEGKLIAAGSLDRSVRIWDSSTG 457

Query: 499 FEVSEVPVSDESNKTMPMLQLFHDTTLELDDDILSVVISPDDKFIAVSLLDNTVKVFFLD 558
           F V  +   +ES                  D + SV  + D + +    LD TVK++ L 
Sbjct: 458 FLVERLDSDNESGNGH-------------QDSVYSVAFTKDGQHVVSGSLDRTVKLWNLG 504

Query: 559 -----SMKFFLSLYGHKLPVLSMDISYDSKLIVTCSADKNIKIWGLDFGDCHKSLFAHQD 613
                + K  ++  GHK  VLS+  S D K I + S D+ + IW  D G+    L  H++
Sbjct: 505 DTQSGTGKCEVTYIGHKDFVLSVATSNDDKYIFSGSKDRGVIIWDKDSGNPILMLQGHRN 564

Query: 614 SIMNVKFL------PESYNFFSC-SKDATVKYW 639
           S+++V  +       ++Y  F+  S D   + W
Sbjct: 565 SVISVATVNSNVDDGKNYKLFATGSGDCKARIW 597

 Score = 64.7 bits (156), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 51/165 (30%), Positives = 80/165 (48%), Gaps = 15/165 (9%)

Query: 87  YHPETNLLAAGYADGVIKIWDLISKTVLISFNGHKSAITVLAFDTTGTRLISASKDSDII 146
           + P+   LA G  D +I+IW++  + +++   GH+  I  L +   G +L+S S D  I 
Sbjct: 349 FSPDGEFLATGAEDKLIRIWNIKERKIVMVLKGHEQDIYSLDYFPDGQKLVSGSGDRSIR 408

Query: 147 VWDL-VGESGLYKLRSHKDAITGLWCE-DENWLIST-SKDGLVKIWDLKSQQCV------ 197
           +WDL  G+  L    S +D +T +    +E  LI+  S D  V+IWD  +   V      
Sbjct: 409 IWDLKTGQCSL--TLSIEDGVTTVAVSPNEGKLIAAGSLDRSVRIWDSSTGFLVERLDSD 466

Query: 198 -ETHLAHTGECWSLGIIED--MAVTCSADSQVKLWKL-DLQAENG 238
            E+   H    +S+   +D    V+ S D  VKLW L D Q+  G
Sbjct: 467 NESGNGHQDSVYSVAFTKDGQHVVSGSLDRTVKLWNLGDTQSGTG 511

 Score = 63.5 bits (153), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 60/218 (27%), Positives = 94/218 (43%), Gaps = 40/218 (18%)

Query: 39  GQVIVGGL--ENILVWDIKTGEQIAQLTDGLPPGASDAKLSKPAETTFLKYHPETNLLAA 96
           GQ +V G    +I +WD+KTG+    LT  +  G +   +S            E  L+AA
Sbjct: 395 GQKLVSGSGDRSIRIWDLKTGQ--CSLTLSIEDGVTTVAVSPN----------EGKLIAA 442

Query: 97  GYADGVIKIWDLISKTVLI---------SFNGHKSAITVLAFDTTGTRLISASKDSDIIV 147
           G  D  ++IWD  S T  +         S NGH+ ++  +AF   G  ++S S D  + +
Sbjct: 443 GSLDRSVRIWD--SSTGFLVERLDSDNESGNGHQDSVYSVAFTKDGQHVVSGSLDRTVKL 500

Query: 148 WDLVG-ESGLYKLR----SHKDAITGLWC-EDENWLISTSKDGLVKIWDLKSQQCVETHL 201
           W+L   +SG  K       HKD +  +    D+ ++ S SKD  V IWD  S   +    
Sbjct: 501 WNLGDTQSGTGKCEVTYIGHKDFVLSVATSNDDKYIFSGSKDRGVIIWDKDSGNPILMLQ 560

Query: 202 AHTGECWSLGIIED---------MAVTCSADSQVKLWK 230
            H     S+  +           +  T S D + ++WK
Sbjct: 561 GHRNSVISVATVNSNVDDGKNYKLFATGSGDCKARIWK 598

 Score = 37.7 bits (86), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 35/168 (20%), Positives = 69/168 (41%), Gaps = 20/168 (11%)

Query: 37  NLGQVIVGGL--ENILVWDIKTGEQIAQLTDGLPPGASDAKLSKPAETTFLKYHPETNLL 94
           N G++I  G    ++ +WD  TG  + +L      G  +          F K   +   +
Sbjct: 435 NEGKLIAAGSLDRSVRIWDSSTGFLVERLDSDNESG--NGHQDSVYSVAFTK---DGQHV 489

Query: 95  AAGYADGVIKIWDLI-----SKTVLISFNGHKSAITVLAFDTTGTRLISASKDSDIIVWD 149
            +G  D  +K+W+L      +    +++ GHK  +  +A       + S SKD  +I+WD
Sbjct: 490 VSGSLDRTVKLWNLGDTQSGTGKCEVTYIGHKDFVLSVATSNDDKYIFSGSKDRGVIIWD 549

Query: 150 LVGESGLYKLRSHKDAITGLWCEDEN--------WLISTSKDGLVKIW 189
               + +  L+ H++++  +   + N           + S D   +IW
Sbjct: 550 KDSGNPILMLQGHRNSVISVATVNSNVDDGKNYKLFATGSGDCKARIW 597

>KNAG0A03700 Chr1 complement(477870..480323) [2454 bp, 817 aa] {ON}
           Anc_8.544 YBR198C
          Length = 817

 Score =  100 bits (248), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 71/301 (23%), Positives = 134/301 (44%), Gaps = 40/301 (13%)

Query: 384 LHGQRTDIRSTSISDDNKLLATASNGS-LKIWNIKTKRCIRSFECGYALTCKFLPGGALV 442
            H    D+ S   SDD++L A     S +K+W++           G +L    +P     
Sbjct: 478 FHNTNRDMTSLEFSDDSRLAAAGFQDSYIKLWSLD----------GSSLISNKIPS---- 523

Query: 443 VVGTRNGELQLFDIASSTMLDNKEGAHDAAIWSLDLTSDGRKLVTGSADKTVRFWTFEVS 502
               +  E++  D A+ST++      H  +++S   + D R L++GS DKTVR W+ +  
Sbjct: 524 ---YKRKEMETTDPATSTLI-----GHSGSVYSTSFSPDSRFLLSGSEDKTVRLWSLDTH 575

Query: 503 EVPVSDESNKTMPMLQLFHDTTLELDDDILSVVISPDDKFIAVSLLDNTVKVFFLDSMKF 562
              VS + +                +  +  V  SP   + A +  D T +++  D +  
Sbjct: 576 TALVSYKGH----------------NHPVWDVKFSPLGHYFATASHDQTARLWSCDHIYP 619

Query: 563 FLSLYGHKLPVLSMDISYDSKLIVTCSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLP 622
                GH   V ++    +   + T S+DK  ++W +  GD  +  + H   I++    P
Sbjct: 620 LRIFAGHLSDVDTVSFHPNGCYVFTGSSDKTCRMWDISTGDSVRYFWVHTAPILSTVVTP 679

Query: 623 ESYNFFSCSKDATVKYWDGQKFECIQKLAAH-QSEVWSISVSNDGTFVISTGHDHSIRVW 681
           +     + S D  +  WD    + I+++  H ++ V S++++ +G  ++S G DHS+RVW
Sbjct: 680 DGRWLCTGSDDGLINLWDIGTGKRIKQMRGHGKNAVHSLTLNKEGNVLLSGGADHSVRVW 739

Query: 682 E 682
           +
Sbjct: 740 D 740

 Score = 76.6 bits (187), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 47/185 (25%), Positives = 81/185 (43%), Gaps = 23/185 (12%)

Query: 517 LQLFHDTTLELDDDILSVVISPDDKFIAVSLLDNTVKVFFLDSMKFFL------------ 564
           +  FH+T    + D+ S+  S D +  A    D+ +K++ LD                  
Sbjct: 475 MYTFHNT----NRDMTSLEFSDDSRLAAAGFQDSYIKLWSLDGSSLISNKIPSYKRKEME 530

Query: 565 -------SLYGHKLPVLSMDISYDSKLIVTCSADKNIKIWGLDFGDCHKSLFAHQDSIMN 617
                  +L GH   V S   S DS+ +++ S DK +++W LD      S   H   + +
Sbjct: 531 TTDPATSTLIGHSGSVYSTSFSPDSRFLLSGSEDKTVRLWSLDTHTALVSYKGHNHPVWD 590

Query: 618 VKFLPESYNFFSCSKDATVKYWDGQKFECIQKLAAHQSEVWSISVSNDGTFVISTGHDHS 677
           VKF P  + F + S D T + W       ++  A H S+V ++S   +G +V +   D +
Sbjct: 591 VKFSPLGHYFATASHDQTARLWSCDHIYPLRIFAGHLSDVDTVSFHPNGCYVFTGSSDKT 650

Query: 678 IRVWE 682
            R+W+
Sbjct: 651 CRMWD 655

 Score = 57.8 bits (138), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 36/151 (23%), Positives = 64/151 (42%), Gaps = 9/151 (5%)

Query: 87  YHPETNLLAAGYADGVIKIWDLISKTVLISFNGHKSAITVLAFDTTGTRLISASKDSDII 146
           + P++  L +G  D  +++W L + T L+S+ GH   +  + F   G    +AS D    
Sbjct: 551 FSPDSRFLLSGSEDKTVRLWSLDTHTALVSYKGHNHPVWDVKFSPLGHYFATASHDQTAR 610

Query: 147 VWDLVGESGLYKLR---SH-KDAITGLWCEDENWLISTSKDGLVKIWDLKSQQCVETHLA 202
           +W       +Y LR    H  D  T  +  +  ++ + S D   ++WD+ +   V     
Sbjct: 611 LWSC---DHIYPLRIFAGHLSDVDTVSFHPNGCYVFTGSSDKTCRMWDISTGDSVRYFWV 667

Query: 203 HTGECWSLGIIEDMAVTCSA--DSQVKLWKL 231
           HT    S  +  D    C+   D  + LW +
Sbjct: 668 HTAPILSTVVTPDGRWLCTGSDDGLINLWDI 698

 Score = 57.0 bits (136), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 35/151 (23%), Positives = 66/151 (43%), Gaps = 4/151 (2%)

Query: 85  LKYHPETNLLAAGYADGVIKIWDLISKTVLISFNGHKSAITVLAFDTTGTRLISASKDSD 144
           +K+ P  +  A    D   ++W       L  F GH S +  ++F   G  + + S D  
Sbjct: 591 VKFSPLGHYFATASHDQTARLWSCDHIYPLRIFAGHLSDVDTVSFHPNGCYVFTGSSDKT 650

Query: 145 IIVWDL-VGESGLYKLRSHKDAITGLWCEDENWLISTSKDGLVKIWDLKSQQCVETHLAH 203
             +WD+  G+S  Y        ++ +   D  WL + S DGL+ +WD+ + + ++    H
Sbjct: 651 CRMWDISTGDSVRYFWVHTAPILSTVVTPDGRWLCTGSDDGLINLWDIGTGKRIKQMRGH 710

Query: 204 TGEC---WSLGIIEDMAVTCSADSQVKLWKL 231
                   +L    ++ ++  AD  V++W L
Sbjct: 711 GKNAVHSLTLNKEGNVLLSGGADHSVRVWDL 741

 Score = 49.3 bits (116), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 31/110 (28%), Positives = 52/110 (47%), Gaps = 2/110 (1%)

Query: 85  LKYHPETNLLAAGYADGVIKIWDLISKTVLISFNGHKSAITVLAFDTTGTRLISASKDSD 144
           + +HP    +  G +D   ++WD+ +   +  F  H + I        G  L + S D  
Sbjct: 633 VSFHPNGCYVFTGSSDKTCRMWDISTGDSVRYFWVHTAPILSTVVTPDGRWLCTGSDDGL 692

Query: 145 IIVWDLVGESGLYKLRSH-KDAITGLWCEDE-NWLISTSKDGLVKIWDLK 192
           I +WD+     + ++R H K+A+  L    E N L+S   D  V++WDLK
Sbjct: 693 INLWDIGTGKRIKQMRGHGKNAVHSLTLNKEGNVLLSGGADHSVRVWDLK 742

 Score = 43.1 bits (100), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 34/154 (22%), Positives = 62/154 (40%), Gaps = 24/154 (15%)

Query: 81  ETTFLKYHPETNLLAAGYADGVIKIWDLISKTVLISFNGHKSAITVLAFDTTGTRLISAS 140
           + T L++  ++ L AAG+ D  IK+W L   +++   +    +      +TT        
Sbjct: 484 DMTSLEFSDDSRLAAAGFQDSYIKLWSLDGSSLI---SNKIPSYKRKEMETT-------- 532

Query: 141 KDSDIIVWDLVGESGLYKLRSHKDAITGLWCEDENWLISTSKDGLVKIWDLKSQQCVETH 200
              D     L+G SG           +  +  D  +L+S S+D  V++W L +   + ++
Sbjct: 533 ---DPATSTLIGHSG--------SVYSTSFSPDSRFLLSGSEDKTVRLWSLDTHTALVSY 581

Query: 201 LAHTGECWSLGI--IEDMAVTCSADSQVKLWKLD 232
             H    W +    +     T S D   +LW  D
Sbjct: 582 KGHNHPVWDVKFSPLGHYFATASHDQTARLWSCD 615

>KAFR0C04740 Chr3 complement(941929..943926) [1998 bp, 665 aa] {ON}
           Anc_6.363 YCR084C
          Length = 665

 Score = 99.0 bits (245), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 78/284 (27%), Positives = 126/284 (44%), Gaps = 50/284 (17%)

Query: 429 YALTCKFLPGGALVVVGTRNGELQLFDIASSTMLDNKEGAHDAAIWSLDLTSDGRKLVTG 488
           Y  +  F P G  +  G  +  ++++DI    ++   +G HD  ++SLD    G KLV+G
Sbjct: 385 YIRSVCFSPDGKFLATGAEDKLIRIWDIQQRKIVMVLQG-HDQDVYSLDYFPSGDKLVSG 443

Query: 489 SADKTVRFWTFEVSEVPVSDESNKTMPMLQLFHDTTLELDDDILSVVISPDD-KFIAVSL 547
           S D+TVR W  +  +  +                 TL ++D + +V +SP D KFIA   
Sbjct: 444 SGDRTVRIWDLKTGQCSL-----------------TLSIEDGVTTVAVSPGDGKFIAAGS 486

Query: 548 LDNTVKVFFLDSMKFFLSLY---------GHKLPVLSMDISYDSKLIVTCSADKNIKIWG 598
           LD  V+V+  DS   FL            GHK  V S+  + D   +V+ S D+++K+W 
Sbjct: 487 LDRAVRVW--DSETGFLVERLDSENELGTGHKDSVYSVVFTKDGNKVVSGSLDRSVKLWN 544

Query: 599 L--------------DFGDCHKSLFAHQDSIMNVKFLPESYNFFSCSKDATVKYWDGQKF 644
           L                  C  +   H+D +++V          S SKD  V +WD +  
Sbjct: 545 LRDNNANSSSNNSNKSNATCDVTYVGHKDFVLSVTTTANDEYILSGSKDRGVLFWDTKSG 604

Query: 645 ECIQKLAAHQSEVWSISVSNDGTF-----VISTGH-DHSIRVWE 682
             +  L  H++ V S++V+N         V +TG  D   R+W+
Sbjct: 605 NPLLMLQGHRNSVISVAVANRTPLGPKYQVFATGSGDCRARIWK 648

 Score = 63.5 bits (153), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 44/157 (28%), Positives = 75/157 (47%), Gaps = 14/157 (8%)

Query: 87  YHPETNLLAAGYADGVIKIWDLISKTVLISFNGHKSAITVLAFDTTGTRLISASKDSDII 146
           + P+   LA G  D +I+IWD+  + +++   GH   +  L +  +G +L+S S D  + 
Sbjct: 391 FSPDGKFLATGAEDKLIRIWDIQQRKIVMVLQGHDQDVYSLDYFPSGDKLVSGSGDRTVR 450

Query: 147 VWDL-VGESGLYKLRSHKDAITGLWCE--DENWLISTSKDGLVKIWDLKSQQCVET---- 199
           +WDL  G+  L    S +D +T +     D  ++ + S D  V++WD ++   VE     
Sbjct: 451 IWDLKTGQCSL--TLSIEDGVTTVAVSPGDGKFIAAGSLDRAVRVWDSETGFLVERLDSE 508

Query: 200 ---HLAHTGECWSLGIIED--MAVTCSADSQVKLWKL 231
                 H    +S+   +D    V+ S D  VKLW L
Sbjct: 509 NELGTGHKDSVYSVVFTKDGNKVVSGSLDRSVKLWNL 545

 Score = 56.6 bits (135), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 38/151 (25%), Positives = 74/151 (49%), Gaps = 2/151 (1%)

Query: 571 LPVLSMDISYDSKLIVTCSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLPESYNFFSC 630
           L + S+  S D K + T + DK I+IW +        L  H   + ++ + P      S 
Sbjct: 384 LYIRSVCFSPDGKFLATGAEDKLIRIWDIQQRKIVMVLQGHDQDVYSLDYFPSGDKLVSG 443

Query: 631 SKDATVKYWDGQKFECIQKLAAHQSEVWSISVS-NDGTFVISTGHDHSIRVWEETEDQVF 689
           S D TV+ WD +  +C   L+  +  V +++VS  DG F+ +   D ++RVW+     + 
Sbjct: 444 SGDRTVRIWDLKTGQCSLTLSI-EDGVTTVAVSPGDGKFIAAGSLDRAVRVWDSETGFLV 502

Query: 690 LEEEREKEMDEQYEDTLLTSLEGGAGDEMLS 720
              + E E+   ++D++ + +    G++++S
Sbjct: 503 ERLDSENELGTGHKDSVYSVVFTKDGNKVVS 533

 Score = 50.8 bits (120), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 51/219 (23%), Positives = 89/219 (40%), Gaps = 46/219 (21%)

Query: 45  GLENILVWDIKTGEQIAQLTDGLPPGASDAKLSKPAETTFLKYHPETNLLAAGYADGVIK 104
           G   + +WD+KTG+    LT  +  G +   +S P +  F+         AAG  D  ++
Sbjct: 445 GDRTVRIWDLKTGQ--CSLTLSIEDGVTTVAVS-PGDGKFI---------AAGSLDRAVR 492

Query: 105 IWD-----LISKTVLISFN----GHKSAITVLAFDTTGTRLISASKDSDIIVWDLVGESG 155
           +WD     L+ +  L S N    GHK ++  + F   G +++S S D  + +W+L   + 
Sbjct: 493 VWDSETGFLVER--LDSENELGTGHKDSVYSVVFTKDGNKVVSGSLDRSVKLWNLRDNNA 550

Query: 156 LYKLR--------------SHKDAITGLWC-EDENWLISTSKDGLVKIWDLKSQQCVETH 200
                               HKD +  +    ++ +++S SKD  V  WD KS   +   
Sbjct: 551 NSSSNNSNKSNATCDVTYVGHKDFVLSVTTTANDEYILSGSKDRGVLFWDTKSGNPLLML 610

Query: 201 LAHTGECWSLGIIEDMAV--------TCSADSQVKLWKL 231
             H     S+ +     +        T S D + ++WK 
Sbjct: 611 QGHRNSVISVAVANRTPLGPKYQVFATGSGDCRARIWKF 649

 Score = 38.1 bits (87), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 38/173 (21%), Positives = 72/173 (41%), Gaps = 31/173 (17%)

Query: 41  VIVGGLEN-ILVWDIKTGEQIAQLT--DGLPPGASDAKLSKPAETTFLKYHPETNLLAAG 97
           +  G L+  + VWD +TG  + +L   + L  G  D+  S      F K   + N + +G
Sbjct: 482 IAAGSLDRAVRVWDSETGFLVERLDSENELGTGHKDSVYS----VVFTK---DGNKVVSG 534

Query: 98  YADGVIKIWDL--------------ISKTVLISFNGHKSAITVLAFDTTGTRLISASKDS 143
             D  +K+W+L               + T  +++ GHK  +  +        ++S SKD 
Sbjct: 535 SLDRSVKLWNLRDNNANSSSNNSNKSNATCDVTYVGHKDFVLSVTTTANDEYILSGSKDR 594

Query: 144 DIIVWDLVGESGLYKLRSHKDAITGLWCEDENWL-------ISTSKDGLVKIW 189
            ++ WD    + L  L+ H++++  +   +   L        + S D   +IW
Sbjct: 595 GVLFWDTKSGNPLLMLQGHRNSVISVAVANRTPLGPKYQVFATGSGDCRARIW 647

>CAGL0E00561g Chr5 (49987..52497) [2511 bp, 836 aa] {ON} some
           similarities with uniprot|P16649 Saccharomyces
           cerevisiae YCR084c TUP1
          Length = 836

 Score = 99.4 bits (246), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 93/365 (25%), Positives = 152/365 (41%), Gaps = 78/365 (21%)

Query: 376 PLKLHTIDLHGQRTDIRSTSI------SDDNKLLATASNGSLKIWNIKTKRCIRSFECGY 429
           P    +IDL   +T +  TS+      S+D + LAT  N + +I+ +     +  F    
Sbjct: 474 PALPRSIDLDLHKT-LEHTSVVCCVKFSNDGEFLATGCNKTTQIYRVSDGELVARFSDEN 532

Query: 430 ALTCK-------------------------FLPGGALVVVGTRNGELQLFDIASSTMLDN 464
           A T K                         F P G  +  G  +  ++++DI    ++  
Sbjct: 533 AHTDKADGNDNAEAETSAGATTDLYIRSVCFSPDGKFLATGAEDKLIRIWDIEQKKIVMV 592

Query: 465 KEGAHDAAIWSLDLTSDGRKLVTGSADKTVRFWTFEVSEVPVSDESNKTMPMLQLFHDTT 524
            +G H+  I+SLD    G KLV+GS D+TVR W  +  +  +                 T
Sbjct: 593 LKG-HEQDIYSLDYFPSGDKLVSGSGDRTVRIWDLKTGQCTL-----------------T 634

Query: 525 LELDDDILSVVISPDD-KFIAVSLLDNTVKVFFLDSMKFFLSL-------YGHKLPVLSM 576
           L ++D + +V +SP D KFIA   LD  V+V+  D+      L        GHK  V S+
Sbjct: 635 LSIEDGVTTVAVSPGDGKFIAAGSLDRAVRVWDSDTGFLVERLDSENELGTGHKDSVYSV 694

Query: 577 DISYDSKLIVTCSADKNIKIWGL------------DFGDCHKSLFAHQDSIMNVKFLPES 624
             + D   +V+ S D+++K+W L              G C  +   H+D +++V    + 
Sbjct: 695 VFTRDGNGVVSGSLDRSVKLWNLRNVNHNNADGKPTSGTCEVTYTGHKDFVLSVATTEDD 754

Query: 625 YNFFSCSKDATVKYWDGQKFECIQKLAAHQSEVWSISVS-------NDGTFVISTGHDHS 677
               S SKD  V +WD      +  L  H++ V S++V+       N   F   +G D  
Sbjct: 755 EYILSGSKDRGVLFWDKVSGNPLLMLQGHRNSVISVAVNHGHPLGPNYHIFATGSG-DCK 813

Query: 678 IRVWE 682
            R+W+
Sbjct: 814 ARIWK 818

 Score = 79.7 bits (195), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 65/247 (26%), Positives = 114/247 (46%), Gaps = 20/247 (8%)

Query: 453 LFDIASSTMLD---NKEGAHDAAIWSLDLTSDGRKLVTGSADKTVRFWTFEVSEVPV--S 507
           LF+ A    +D   +K   H + +  +  ++DG  L TG  +KT + +     E+    S
Sbjct: 471 LFNPALPRSIDLDLHKTLEHTSVVCCVKFSNDGEFLATG-CNKTTQIYRVSDGELVARFS 529

Query: 508 DE---SNKTMPMLQLFHDTTLELDDD--ILSVVISPDDKFIAVSLLDNTVKVFFLDSMKF 562
           DE   ++K         +T+     D  I SV  SPD KF+A    D  ++++ ++  K 
Sbjct: 530 DENAHTDKADGNDNAEAETSAGATTDLYIRSVCFSPDGKFLATGAEDKLIRIWDIEQKKI 589

Query: 563 FLSLYGHKLPVLSMDISYDSKLIVTCSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLP 622
            + L GH+  + S+D       +V+ S D+ ++IW L  G C  +L + +D +  V   P
Sbjct: 590 VMVLKGHEQDIYSLDYFPSGDKLVSGSGDRTVRIWDLKTGQCTLTL-SIEDGVTTVAVSP 648

Query: 623 ESYNFFSC-SKDATVKYWDGQKFECIQKL-------AAHQSEVWSISVSNDGTFVISTGH 674
               F +  S D  V+ WD      +++L         H+  V+S+  + DG  V+S   
Sbjct: 649 GDGKFIAAGSLDRAVRVWDSDTGFLVERLDSENELGTGHKDSVYSVVFTRDGNGVVSGSL 708

Query: 675 DHSIRVW 681
           D S+++W
Sbjct: 709 DRSVKLW 715

 Score = 63.5 bits (153), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 46/157 (29%), Positives = 75/157 (47%), Gaps = 14/157 (8%)

Query: 87  YHPETNLLAAGYADGVIKIWDLISKTVLISFNGHKSAITVLAFDTTGTRLISASKDSDII 146
           + P+   LA G  D +I+IWD+  K +++   GH+  I  L +  +G +L+S S D  + 
Sbjct: 563 FSPDGKFLATGAEDKLIRIWDIEQKKIVMVLKGHEQDIYSLDYFPSGDKLVSGSGDRTVR 622

Query: 147 VWDLVGESGLYKLR-SHKDAITGLWCE--DENWLISTSKDGLVKIWDLKSQQCVET---- 199
           +WDL  ++G   L  S +D +T +     D  ++ + S D  V++WD  +   VE     
Sbjct: 623 IWDL--KTGQCTLTLSIEDGVTTVAVSPGDGKFIAAGSLDRAVRVWDSDTGFLVERLDSE 680

Query: 200 ---HLAHTGECWSLGIIED--MAVTCSADSQVKLWKL 231
                 H    +S+    D    V+ S D  VKLW L
Sbjct: 681 NELGTGHKDSVYSVVFTRDGNGVVSGSLDRSVKLWNL 717

 Score = 60.1 bits (144), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 40/139 (28%), Positives = 71/139 (51%), Gaps = 6/139 (4%)

Query: 573 VLSMDISYDSKLIVTCSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLPESYNFFSCSK 632
           + S+  S D K + T + DK I+IW ++       L  H+  I ++ + P      S S 
Sbjct: 558 IRSVCFSPDGKFLATGAEDKLIRIWDIEQKKIVMVLKGHEQDIYSLDYFPSGDKLVSGSG 617

Query: 633 DATVKYWDGQKFECIQKLAAHQSEVWSISVS-NDGTFVISTGHDHSIRVWEETEDQVFLE 691
           D TV+ WD +  +C   L+  +  V +++VS  DG F+ +   D ++RVW+   D  FL 
Sbjct: 618 DRTVRIWDLKTGQCTLTLSI-EDGVTTVAVSPGDGKFIAAGSLDRAVRVWD--SDTGFLV 674

Query: 692 E--EREKEMDEQYEDTLLT 708
           E  + E E+   ++D++ +
Sbjct: 675 ERLDSENELGTGHKDSVYS 693

 Score = 50.8 bits (120), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 56/216 (25%), Positives = 91/216 (42%), Gaps = 44/216 (20%)

Query: 45  GLENILVWDIKTGEQIAQLTDGLPPGASDAKLSKPAETTFLKYHPETNLLAAGYADGVIK 104
           G   + +WD+KTG+    LT  +  G +   +S P +  F+         AAG  D  ++
Sbjct: 617 GDRTVRIWDLKTGQ--CTLTLSIEDGVTTVAVS-PGDGKFI---------AAGSLDRAVR 664

Query: 105 IWD-----LISKTVLISFN----GHKSAITVLAFDTTGTRLISASKDSDIIVWDLVG--- 152
           +WD     L+ +  L S N    GHK ++  + F   G  ++S S D  + +W+L     
Sbjct: 665 VWDSDTGFLVER--LDSENELGTGHKDSVYSVVFTRDGNGVVSGSLDRSVKLWNLRNVNH 722

Query: 153 -------ESGLYKLR--SHKDAITGLWC-EDENWLISTSKDGLVKIWDLKSQQCVETHLA 202
                   SG  ++    HKD +  +   ED+ +++S SKD  V  WD  S   +     
Sbjct: 723 NNADGKPTSGTCEVTYTGHKDFVLSVATTEDDEYILSGSKDRGVLFWDKVSGNPLLMLQG 782

Query: 203 HTGECWS--------LGIIEDMAVTCSADSQVKLWK 230
           H     S        LG    +  T S D + ++WK
Sbjct: 783 HRNSVISVAVNHGHPLGPNYHIFATGSGDCKARIWK 818

 Score = 41.2 bits (95), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 35/141 (24%), Positives = 64/141 (45%), Gaps = 22/141 (15%)

Query: 41  VIVGGLEN-ILVWDIKTGEQIAQLT--DGLPPGASDAKLSKPAETTFLKYHPETNLLAAG 97
           +  G L+  + VWD  TG  + +L   + L  G  D+  S      F +   + N + +G
Sbjct: 654 IAAGSLDRAVRVWDSDTGFLVERLDSENELGTGHKDSVYS----VVFTR---DGNGVVSG 706

Query: 98  YADGVIKIWDL------------ISKTVLISFNGHKSAITVLAFDTTGTRLISASKDSDI 145
             D  +K+W+L             S T  +++ GHK  +  +A       ++S SKD  +
Sbjct: 707 SLDRSVKLWNLRNVNHNNADGKPTSGTCEVTYTGHKDFVLSVATTEDDEYILSGSKDRGV 766

Query: 146 IVWDLVGESGLYKLRSHKDAI 166
           + WD V  + L  L+ H++++
Sbjct: 767 LFWDKVSGNPLLMLQGHRNSV 787

>Kpol_1031.49 s1031
           (132811..133005,133055..133063,133288..133320,
           133324..133428,133432..135372) [2283 bp, 760 aa] {ON}
           (132811..133005,133055..133063,133288..133320,
           133324..133428,133432..135372) [2283 nt, 761 aa]
          Length = 760

 Score = 99.0 bits (245), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 59/213 (27%), Positives = 105/213 (49%), Gaps = 3/213 (1%)

Query: 485 LVTGSADKTVRFWTFEVSEVPVSDESNKTMPMLQLFHDTTLELDDDILSVVISPDDKFIA 544
           ++T S D TV+ W  +V       +++  M ++++   T    + DI ++ I+P+D   A
Sbjct: 396 IITSSNDFTVKKW--KVPSPTKKSDNDDDMHLIKVSEYTRRAHEKDINALSIAPNDSIFA 453

Query: 545 VSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSMDISYDSKLIVTCSADKNIKIWGLDFGDC 604
            +  D T K++ LDS +   +L  HK  +  +      K I T S DK IKIW L+    
Sbjct: 454 TASYDKTCKIWDLDSGELMATLANHKRGLWDVSFCQYDKYIATASGDKTIKIWSLETFKV 513

Query: 605 HKSLFAHQDSIMNVKFLPESYNFFSCSKDATVKYWDGQKFECIQKLAAHQSEVWSISVSN 664
             +L  H +++    F+ +     S   D  +K WD    EC++ L  H + +W++ V  
Sbjct: 514 VNTLEGHTNAVQRCSFINKQKQIVSTGADGLIKIWDCSSGECLKTLDGHANRIWALCVLR 573

Query: 665 DGTFVISTGHDHSIRVWEETEDQVFLEEEREKE 697
           DG  +I+   D   + W++  ++V  E++ EKE
Sbjct: 574 DGDMIITADADGVFQFWKDCTEEV-KEQDLEKE 605

 Score = 76.6 bits (187), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 44/149 (29%), Positives = 71/149 (47%), Gaps = 3/149 (2%)

Query: 85  LKYHPETNLLAAGYADGVIKIWDLISKTVLISFNGHKSAITVLAFDTTGTRLISASKDSD 144
           L   P  ++ A    D   KIWDL S  ++ +   HK  +  ++F      + +AS D  
Sbjct: 443 LSIAPNDSIFATASYDKTCKIWDLDSGELMATLANHKRGLWDVSFCQYDKYIATASGDKT 502

Query: 145 IIVWDLVGESGLYKLRSHKDAITGL-WCEDENWLISTSKDGLVKIWDLKSQQCVETHLAH 203
           I +W L     +  L  H +A+    +   +  ++ST  DGL+KIWD  S +C++T   H
Sbjct: 503 IKIWSLETFKVVNTLEGHTNAVQRCSFINKQKQIVSTGADGLIKIWDCSSGECLKTLDGH 562

Query: 204 TGECWSLGIIE--DMAVTCSADSQVKLWK 230
               W+L ++   DM +T  AD   + WK
Sbjct: 563 ANRIWALCVLRDGDMIITADADGVFQFWK 591

 Score = 67.8 bits (164), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 114/585 (19%), Positives = 214/585 (36%), Gaps = 86/585 (14%)

Query: 157 YKLRSHKDAITGL----WCEDENWLISTSKDGLVKIWDLKSQQCVETHLAHTGECWSLGI 212
           + L+ H   I+ L      ED  WL+++    +VK+WDL  ++C+ T   H+     +  
Sbjct: 83  HSLKGHGATISSLKFYGESEDSVWLLASGDTNMVKVWDLVKRKCIHTLQEHSSAVRGIDF 142

Query: 213 IEDMA-------VTCSADSQVKLWKLDLQAENGSKLTEKGIIEKQSKQRGVEIDFAVAPD 265
            +          VT   D+ +  W   +      KL     + +Q +  G    F  + +
Sbjct: 143 KQSSTDSDIIHLVTGGRDNIINHWT--ISGLKNFKLIRTFPVHQQVEACG----FIKSTE 196

Query: 266 GVKFFYIQNADKTIEIYRLRKEEEISRALKKREKR-----LQDKGMSEEEIKEAMGSPVS 320
                Y    D   +I  L     I +  K  E+      L  K  +  ++   +     
Sbjct: 197 DDNCIYTAGGDAVFQILSLSNGSVIKKTKKPTEELFIIGVLPIKNFT--KLYLVLSDQTL 254

Query: 321 LMYHLFQVVRSPYKIKSAQWTVCSN----SKLELV------VTTSNNSIEYYSIPYSKRE 370
            +  L        +I + + ++  N    + + LV      +  + NS     IP    +
Sbjct: 255 QLIDLIDTFEEDSEIITIKSSIAGNHGTIADMRLVGPELKSIALATNSPTLRIIPVISED 314

Query: 371 PTQPAPLKLHTIDLHGQRTDIRSTSISDDNKLLATAS-NGSLKIWNI-----KTKRCIRS 424
                PL +   D  G    + S   ++D   +ATAS + +  +W       K K+  + 
Sbjct: 315 NKNNIPLGVELYD--GHEDLLNSLDATEDGLWIATASKDNTAMLWRFNDSENKFKKYAQF 372

Query: 425 FECGYALTCKFLPG------GALVVVGTRNGELQLFDIASSTMLDNKEG----------- 467
                ++T   LP          ++  + +  ++ + + S T   + +            
Sbjct: 373 IGHASSVTSVSLPNVINNGWPEFIITSSNDFTVKKWKVPSPTKKSDNDDDMHLIKVSEYT 432

Query: 468 --AHDAAIWSLDLTSDGRKLVTGSADKTVRFWTFEVSEVPVSDESNKTMPMLQLFHDTTL 525
             AH+  I +L +  +     T S DKT + W  +  E+  +  ++K             
Sbjct: 433 RRAHEKDINALSIAPNDSIFATASYDKTCKIWDLDSGELMATLANHKR------------ 480

Query: 526 ELDDDILSVVISPDDKFIAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSMDISYDSKLI 585
                +  V     DK+IA +  D T+K++ L++ K   +L GH   V         K I
Sbjct: 481 ----GLWDVSFCQYDKYIATASGDKTIKIWSLETFKVVNTLEGHTNAVQRCSFINKQKQI 536

Query: 586 VTCSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLPESYNFFSCSKDATVKYWDGQKFE 645
           V+  AD  IKIW    G+C K+L  H + I  +  L +     +   D   ++W     E
Sbjct: 537 VSTGADGLIKIWDCSSGECLKTLDGHANRIWALCVLRDGDMIITADADGVFQFWKDCTEE 596

Query: 646 C------IQKLAAHQSEVWSISVSND---GTFVISTGHDHSIRVW 681
                   +KL   Q +     ++N      F+++   DH +R++
Sbjct: 597 VKEQDLEKEKLRVEQEQSLRNFIANGEWTNAFLLAMTLDHPMRLY 641

 Score = 57.8 bits (138), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 103/518 (19%), Positives = 202/518 (38%), Gaps = 95/518 (18%)

Query: 80  AETTFLKYHPETN----LLAAGYADGVIKIWDLISKTVLISFNGHKSAITVLAFDTTGT- 134
           A  + LK++ E+     LLA+G  + ++K+WDL+ +  + +   H SA+  + F  + T 
Sbjct: 90  ATISSLKFYGESEDSVWLLASGDTN-MVKVWDLVKRKCIHTLQEHSSAVRGIDFKQSSTD 148

Query: 135 ----RLISASKDSDIIVWDLVGESGLYKLRSHKDAITGLWC------EDENWLISTSKDG 184
                L++  +D+ I  W + G      +R+         C      ED+N + +   D 
Sbjct: 149 SDIIHLVTGGRDNIINHWTISGLKNFKLIRTFPVHQQVEACGFIKSTEDDNCIYTAGGDA 208

Query: 185 LVKIWDLKSQQCVETHLAHTGECWSLGIIEDMAVT----CSADSQVKLWKL-DLQAENGS 239
           + +I  L +   ++     T E + +G++     T      +D  ++L  L D   E+  
Sbjct: 209 VFQILSLSNGSVIKKTKKPTEELFIIGVLPIKNFTKLYLVLSDQTLQLIDLIDTFEEDSE 268

Query: 240 KLTEKGIIEKQSKQRGVEIDFAVAPDGVKFFYIQNADKTIEIYRLRKEEEISRA------ 293
            +T K  I   +   G   D  +    +K   +     T+ I  +  E+  +        
Sbjct: 269 IITIKSSI---AGNHGTIADMRLVGPELKSIALATNSPTLRIIPVISEDNKNNIPLGVEL 325

Query: 294 LKKREKRLQDKGMSEEEIKEAMGSP-VSLMYHLFQVVRSPYKIKSAQW------------ 340
               E  L     +E+ +  A  S   + M   F    + +K K AQ+            
Sbjct: 326 YDGHEDLLNSLDATEDGLWIATASKDNTAMLWRFNDSENKFK-KYAQFIGHASSVTSVSL 384

Query: 341 -TVCSNSKLELVVTTSNN-SIEYYSIPYSKREPTQPAPLKLHTIDLHGQRT---DIRSTS 395
             V +N   E ++T+SN+ +++ + +P   ++      + L  +  + +R    DI + S
Sbjct: 385 PNVINNGWPEFIITSSNDFTVKKWKVPSPTKKSDNDDDMHLIKVSEYTRRAHEKDINALS 444

Query: 396 ISDDNKLLATAS-------------------------------------------NGSLK 412
           I+ ++ + ATAS                                           + ++K
Sbjct: 445 IAPNDSIFATASYDKTCKIWDLDSGELMATLANHKRGLWDVSFCQYDKYIATASGDKTIK 504

Query: 413 IWNIKTKRCIRSFE--CGYALTCKFLPGGALVVVGTRNGELQLFDIASSTMLDNKEGAHD 470
           IW+++T + + + E        C F+     +V    +G ++++D +S   L   +G H 
Sbjct: 505 IWSLETFKVVNTLEGHTNAVQRCSFINKQKQIVSTGADGLIKIWDCSSGECLKTLDG-HA 563

Query: 471 AAIWSLDLTSDGRKLVTGSADKTVRFWTFEVSEVPVSD 508
             IW+L +  DG  ++T  AD   +FW     EV   D
Sbjct: 564 NRIWALCVLRDGDMIITADADGVFQFWKDCTEEVKEQD 601

>TBLA0H03620 Chr8 (882587..885025) [2439 bp, 812 aa] {ON} Anc_8.544
           YBR198C
          Length = 812

 Score = 97.8 bits (242), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 79/306 (25%), Positives = 137/306 (44%), Gaps = 41/306 (13%)

Query: 384 LHGQRTDIRSTSISDDNKLLATASNGS-LKIWNIKTKRCIRSFECGYALTCKFLPGGALV 442
            H    D+ S   SDD +L +T    S +KIW++           G +L  KF       
Sbjct: 451 FHNTNQDMTSLEFSDDCRLASTGFQDSYIKIWSLD----------GTSLNTKFTQANK-- 498

Query: 443 VVGTRNGELQLFDIASSTMLDNKEGA----HDAAIWSLDLTSDGRKLVTGSADKTVRFWT 498
               RN  + + D  S T +DN+  A    H   ++S   + D R L++GS DKTVR W+
Sbjct: 499 ---DRN-RITITD-RSLTHMDNELSATLIGHSGTVYSTSFSPDNRYLISGSEDKTVRLWS 553

Query: 499 FEVSEVPVSDESNKTMPMLQLFHDTTLELDDDILSVVISPDDKFIAVSLLDNTVKVFFLD 558
            +     VS + +                +  I  V  SP   + A +  D T +++  D
Sbjct: 554 LDTHTALVSYKGH----------------NHPIWDVQFSPLGHYFATASHDQTARLWSCD 597

Query: 559 SMKFFLSLY-GHKLPVLSMDISYDSKLIVTCSADKNIKIWGLDFGDCHKSLFAHQDSIMN 617
            + F L ++ GH   V  +    +   + T S+DK  ++W +  GD  +    H  ++++
Sbjct: 598 HI-FPLRIFAGHLNDVDCVSFHPNGYYVFTGSSDKTCRMWDISTGDSVRLFLGHTSAVVS 656

Query: 618 VKFLPESYNFFSCSKDATVKYWDGQKFECIQKLAAH-QSEVWSISVSNDGTFVISTGHDH 676
               P+     + S D T+  WD    + ++ L  H ++ V+S++ S +G  ++S+G D 
Sbjct: 657 TAVSPDGRWLTTGSDDGTINVWDIGSGKRLKSLRGHGKNAVYSLTYSKEGNLLVSSGADQ 716

Query: 677 SIRVWE 682
           S+RVW+
Sbjct: 717 SVRVWD 722

 Score = 67.4 bits (163), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 52/214 (24%), Positives = 93/214 (43%), Gaps = 35/214 (16%)

Query: 508 DESNKTMPMLQL--FHDTTLELDDDILSVVISPDDKFIAVSLLDNTVKVFFLD----SMK 561
           D +  ++P + +  FH+T    + D+ S+  S D +  +    D+ +K++ LD    + K
Sbjct: 437 DTNPNSLPSVCMYTFHNT----NQDMTSLEFSDDCRLASTGFQDSYIKIWSLDGTSLNTK 492

Query: 562 FF------------------------LSLYGHKLPVLSMDISYDSKLIVTCSADKNIKIW 597
           F                          +L GH   V S   S D++ +++ S DK +++W
Sbjct: 493 FTQANKDRNRITITDRSLTHMDNELSATLIGHSGTVYSTSFSPDNRYLISGSEDKTVRLW 552

Query: 598 GLDFGDCHKSLFAHQDSIMNVKFLPESYNFFSCSKDATVKYWDGQKFECIQKLAAHQSEV 657
            LD      S   H   I +V+F P  + F + S D T + W       ++  A H ++V
Sbjct: 553 SLDTHTALVSYKGHNHPIWDVQFSPLGHYFATASHDQTARLWSCDHIFPLRIFAGHLNDV 612

Query: 658 WSISVSNDGTFVISTGHDHSIRVWE-ETEDQVFL 690
             +S   +G +V +   D + R+W+  T D V L
Sbjct: 613 DCVSFHPNGYYVFTGSSDKTCRMWDISTGDSVRL 646

 Score = 62.8 bits (151), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 35/109 (32%), Positives = 56/109 (51%), Gaps = 2/109 (1%)

Query: 85  LKYHPETNLLAAGYADGVIKIWDLISKTVLISFNGHKSAITVLAFDTTGTRLISASKDSD 144
           + +HP    +  G +D   ++WD+ +   +  F GH SA+   A    G  L + S D  
Sbjct: 615 VSFHPNGYYVFTGSSDKTCRMWDISTGDSVRLFLGHTSAVVSTAVSPDGRWLTTGSDDGT 674

Query: 145 IIVWDLVGESGLYKLRSH-KDAITGL-WCEDENWLISTSKDGLVKIWDL 191
           I VWD+     L  LR H K+A+  L + ++ N L+S+  D  V++WDL
Sbjct: 675 INVWDIGSGKRLKSLRGHGKNAVYSLTYSKEGNLLVSSGADQSVRVWDL 723

 Score = 57.4 bits (137), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 35/151 (23%), Positives = 63/151 (41%), Gaps = 9/151 (5%)

Query: 87  YHPETNLLAAGYADGVIKIWDLISKTVLISFNGHKSAITVLAFDTTGTRLISASKDSDII 146
           + P+   L +G  D  +++W L + T L+S+ GH   I  + F   G    +AS D    
Sbjct: 533 FSPDNRYLISGSEDKTVRLWSLDTHTALVSYKGHNHPIWDVQFSPLGHYFATASHDQTAR 592

Query: 147 VWDLVGESGLYKLRSHKDAITGLWC----EDENWLISTSKDGLVKIWDLKSQQCVETHLA 202
           +W       ++ LR     +  + C     +  ++ + S D   ++WD+ +   V   L 
Sbjct: 593 LWSC---DHIFPLRIFAGHLNDVDCVSFHPNGYYVFTGSSDKTCRMWDISTGDSVRLFLG 649

Query: 203 HTGECWSLGIIEDMA--VTCSADSQVKLWKL 231
           HT    S  +  D     T S D  + +W +
Sbjct: 650 HTSAVVSTAVSPDGRWLTTGSDDGTINVWDI 680

 Score = 54.7 bits (130), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 37/178 (20%), Positives = 71/178 (39%), Gaps = 4/178 (2%)

Query: 85  LKYHPETNLLAAGYADGVIKIWDLISKTVLISFNGHKSAITVLAFDTTGTRLISASKDSD 144
           +++ P  +  A    D   ++W       L  F GH + +  ++F   G  + + S D  
Sbjct: 573 VQFSPLGHYFATASHDQTARLWSCDHIFPLRIFAGHLNDVDCVSFHPNGYYVFTGSSDKT 632

Query: 145 IIVWDLVGESGLYKLRSHKDAITGLWCE-DENWLISTSKDGLVKIWDLKSQQCVETHLAH 203
             +WD+     +     H  A+       D  WL + S DG + +WD+ S + +++   H
Sbjct: 633 CRMWDISTGDSVRLFLGHTSAVVSTAVSPDGRWLTTGSDDGTINVWDIGSGKRLKSLRGH 692

Query: 204 -TGECWSLGIIE--DMAVTCSADSQVKLWKLDLQAENGSKLTEKGIIEKQSKQRGVEI 258
                +SL   +  ++ V+  AD  V++W L   + N +     G           E+
Sbjct: 693 GKNAVYSLTYSKEGNLLVSSGADQSVRVWDLFKPSANANNNPSSGTTNSNPTTDDSEV 750

 Score = 46.6 bits (109), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 39/157 (24%), Positives = 68/157 (43%), Gaps = 21/157 (13%)

Query: 81  ETTFLKYHPETNLLAAGYADGVIKIWDLISKTVLISF---NGHKSAITVLAFDTTGTRLI 137
           + T L++  +  L + G+ D  IKIW L   ++   F   N  ++ IT+   D + T + 
Sbjct: 457 DMTSLEFSDDCRLASTGFQDSYIKIWSLDGTSLNTKFTQANKDRNRITIT--DRSLTHM- 513

Query: 138 SASKDSDIIVWDLVGESGLYKLRSHKDAITGLWCEDENWLISTSKDGLVKIWDLKSQQCV 197
               D+++    L+G SG     S        +  D  +LIS S+D  V++W L +   +
Sbjct: 514 ----DNELSA-TLIGHSGTVYSTS--------FSPDNRYLISGSEDKTVRLWSLDTHTAL 560

Query: 198 ETHLAHTGECWSLGI--IEDMAVTCSADSQVKLWKLD 232
            ++  H    W +    +     T S D   +LW  D
Sbjct: 561 VSYKGHNHPIWDVQFSPLGHYFATASHDQTARLWSCD 597

>NDAI0K02350 Chr11 complement(524551..526932) [2382 bp, 793 aa] {ON}
           Anc_6.363
          Length = 793

 Score = 97.4 bits (241), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 85/345 (24%), Positives = 141/345 (40%), Gaps = 79/345 (22%)

Query: 397 SDDNKLLATASNGSLKIWNIKTKRCIRSFECG-------------YALTCKFLPGGALVV 443
           S D + LAT  N + +++ + T   I                   Y  +  F P G  + 
Sbjct: 452 SYDGEFLATGCNKTTQVYRVSTGELIAKLSDDNVKLDSNSTSTDLYIRSVCFSPDGKFLA 511

Query: 444 VGTRNGELQLFDIASSTMLDNKEGAHDAAIWSLDLTSDGRKLVTGSADKTVRFWTFEVSE 503
            G  +  ++++DI    ++   +G H+  ++SLD   DG+KLV+GS D+TVR W     +
Sbjct: 512 TGAEDKLIRIWDIQEGKIVMVLKG-HEQDVYSLDYFPDGQKLVSGSGDRTVRIWDLRTGQ 570

Query: 504 VPVSDESNKTMPMLQLFHDTTLELDDDILSVVISP-DDKFIAVSLLDNTVKVFFLDSMKF 562
             +                 TL ++D + +V +SP D +FIA   LD  V+V+  DS   
Sbjct: 571 CSL-----------------TLSIEDGVTTVAVSPHDGRFIAAGSLDRAVRVW--DSTTG 611

Query: 563 FLSLY---------GHKLPVLSMDISYDSKLIVTCSADKNIKIWGLDF------------ 601
           FL            GH+  V S+  + D   +V+ S DK++K+W L              
Sbjct: 612 FLVERLDSENELGTGHQDSVYSVVFTRDGNEVVSGSLDKSVKLWNLGNDVNSNNNGNDSS 671

Query: 602 ------------------GDCHKSLFAHQDSIMNVKFLPESYNFFSCSKDATVKYWDGQK 643
                               C  +   H+D +++V          S SKD  V +WD + 
Sbjct: 672 SNGTNNNNNSNRASNGTSATCEVTYVGHKDFVLSVTTSQNDEYILSGSKDRGVLFWDKKS 731

Query: 644 FECIQKLAAHQSEVWSISVSNDGTF-----VISTGH-DHSIRVWE 682
              +  L  H++ V S++V+N         V +TG  D   R+W+
Sbjct: 732 GNPLLMLQGHKNSVISVAVANGYPLGPKYNVFATGSGDCKARIWK 776

 Score = 90.9 bits (224), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 66/247 (26%), Positives = 111/247 (44%), Gaps = 32/247 (12%)

Query: 453 LFDIASSTMLD---NKEGAHDAAIWSLDLTSDGRKLVTGSADKTVRFWTFEVSEVPVSDE 509
           LF+ A    LD   +K   H + +  +  + DG  L TG  +KT + +     E      
Sbjct: 423 LFNPALPRTLDVELHKSLDHSSVVCCVKFSYDGEFLATG-CNKTTQVYRVSTGE------ 475

Query: 510 SNKTMPMLQLFHDTTLELDDD-------ILSVVISPDDKFIAVSLLDNTVKVFFLDSMKF 562
                 ++    D  ++LD +       I SV  SPD KF+A    D  ++++ +   K 
Sbjct: 476 ------LIAKLSDDNVKLDSNSTSTDLYIRSVCFSPDGKFLATGAEDKLIRIWDIQEGKI 529

Query: 563 FLSLYGHKLPVLSMDISYDSKLIVTCSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLP 622
            + L GH+  V S+D   D + +V+ S D+ ++IW L  G C  +L + +D +  V   P
Sbjct: 530 VMVLKGHEQDVYSLDYFPDGQKLVSGSGDRTVRIWDLRTGQCSLTL-SIEDGVTTVAVSP 588

Query: 623 ESYNFFSC-SKDATVKYWDGQKFECIQKL-------AAHQSEVWSISVSNDGTFVISTGH 674
               F +  S D  V+ WD      +++L         HQ  V+S+  + DG  V+S   
Sbjct: 589 HDGRFIAAGSLDRAVRVWDSTTGFLVERLDSENELGTGHQDSVYSVVFTRDGNEVVSGSL 648

Query: 675 DHSIRVW 681
           D S+++W
Sbjct: 649 DKSVKLW 655

 Score = 70.1 bits (170), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 49/175 (28%), Positives = 87/175 (49%), Gaps = 10/175 (5%)

Query: 547 LLDNTVKVFFLDSMKFFLSLYGHKLPVLSMDISYDSKLIVTCSADKNIKIWGLDFGDCHK 606
           L D+ VK   LDS      LY     + S+  S D K + T + DK I+IW +  G    
Sbjct: 480 LSDDNVK---LDSNSTSTDLY-----IRSVCFSPDGKFLATGAEDKLIRIWDIQEGKIVM 531

Query: 607 SLFAHQDSIMNVKFLPESYNFFSCSKDATVKYWDGQKFECIQKLAAHQSEVWSISVS-ND 665
            L  H+  + ++ + P+     S S D TV+ WD +  +C   L+     V +++VS +D
Sbjct: 532 VLKGHEQDVYSLDYFPDGQKLVSGSGDRTVRIWDLRTGQCSLTLSIEDG-VTTVAVSPHD 590

Query: 666 GTFVISTGHDHSIRVWEETEDQVFLEEEREKEMDEQYEDTLLTSLEGGAGDEMLS 720
           G F+ +   D ++RVW+ T   +    + E E+   ++D++ + +    G+E++S
Sbjct: 591 GRFIAAGSLDRAVRVWDSTTGFLVERLDSENELGTGHQDSVYSVVFTRDGNEVVS 645

 Score = 69.3 bits (168), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 56/198 (28%), Positives = 91/198 (45%), Gaps = 25/198 (12%)

Query: 51  VWDIKTGEQIAQLTDGLPPGASDAKLSKPAETTFLK-----YHPETNLLAAGYADGVIKI 105
           V+ + TGE IA+L+D       + KL   + +T L      + P+   LA G  D +I+I
Sbjct: 468 VYRVSTGELIAKLSD------DNVKLDSNSTSTDLYIRSVCFSPDGKFLATGAEDKLIRI 521

Query: 106 WDLISKTVLISFNGHKSAITVLAFDTTGTRLISASKDSDIIVWDL-VGESGLYKLRSHKD 164
           WD+    +++   GH+  +  L +   G +L+S S D  + +WDL  G+  L    S +D
Sbjct: 522 WDIQEGKIVMVLKGHEQDVYSLDYFPDGQKLVSGSGDRTVRIWDLRTGQCSL--TLSIED 579

Query: 165 AIT--GLWCEDENWLISTSKDGLVKIWDLKSQQCVET-------HLAHTGECWSLGIIED 215
            +T   +   D  ++ + S D  V++WD  +   VE           H    +S+    D
Sbjct: 580 GVTTVAVSPHDGRFIAAGSLDRAVRVWDSTTGFLVERLDSENELGTGHQDSVYSVVFTRD 639

Query: 216 M--AVTCSADSQVKLWKL 231
               V+ S D  VKLW L
Sbjct: 640 GNEVVSGSLDKSVKLWNL 657

>ZYRO0D17292g Chr4 complement(1424965..1427121) [2157 bp, 718 aa]
           {ON} some similarities with uniprot|P16649 Saccharomyces
           cerevisiae YCR084C
          Length = 718

 Score = 96.3 bits (238), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 77/283 (27%), Positives = 127/283 (44%), Gaps = 45/283 (15%)

Query: 429 YALTCKFLPGGALVVVGTRNGELQLFDIASSTMLDNKEGAHDAAIWSLDLTSDGRKLVTG 488
           Y  +  F P G  +  G  +  ++++DIA   ++   +G H+  I+SLD    G KLV+G
Sbjct: 438 YIRSVCFSPDGKFLATGAEDRLIRIWDIAQKKIVMVLQG-HEQDIYSLDYFPSGDKLVSG 496

Query: 489 SADKTVRFWTFEVSEVPVSDESNKTMPMLQLFHDTTLELDDDILSVVIS-PDDKFIAVSL 547
           S D+TVR W     +  +                 TL ++D + +V +S  D K+IA   
Sbjct: 497 SGDRTVRIWDLRTGQCSL-----------------TLSIEDGVTTVAVSLGDGKYIAAGS 539

Query: 548 LDNTVKV------FFLDSMKFFLSL-YGHKLPVLSMDISYDSKLIVTCSADKNIKIWGLD 600
           LD  V+V      F ++ +     L  GHK  V S+  + D   +V+ S D+++K+W L 
Sbjct: 540 LDRAVRVWDAETGFLVERLDSENELGTGHKDSVYSVVFTRDGHGVVSGSLDRSVKLWNLS 599

Query: 601 FGD-------------CHKSLFAHQDSIMNVKFLPESYNFFSCSKDATVKYWDGQKFECI 647
            G              C  +   H+D +++V          S SKD  V +WD +    +
Sbjct: 600 SGQNNTNAETKPAPGTCEVTYTGHKDFVLSVATTRNDEYILSGSKDRGVLFWDTKSGNPL 659

Query: 648 QKLAAHQSEVWSISVSNDGTF-----VISTGH-DHSIRVWEET 684
             L  H++ V S++V+N         V +TG  D   R+W+ T
Sbjct: 660 LMLQGHRNSVISVAVANGYPLGPQYCVFATGSGDCKARIWKYT 702

 Score = 75.1 bits (183), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 63/246 (25%), Positives = 110/246 (44%), Gaps = 31/246 (12%)

Query: 469 HDAAIWSLDLTSDGRKLVTGSADKTVRFWTFEVSE----VPVSDESNKTMPM-------- 516
           H + +  +  ++DG  L TG  +KT +   F VS+      +SD++    P         
Sbjct: 361 HTSVVCCVRFSNDGEYLATG-CNKTTQV--FRVSDGALVARLSDDNATQGPQGPSGGTSD 417

Query: 517 ------LQLFHDT-TLELDDDILSVVISPDDKFIAVSLLDNTVKVFFLDSMKFFLSLYGH 569
                    F +T T   D  I SV  SPD KF+A    D  ++++ +   K  + L GH
Sbjct: 418 DDYNNDANSFANTRTASSDLYIRSVCFSPDGKFLATGAEDRLIRIWDIAQKKIVMVLQGH 477

Query: 570 KLPVLSMDISYDSKLIVTCSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKF-LPESYNFF 628
           +  + S+D       +V+ S D+ ++IW L  G C  +L + +D +  V   L +     
Sbjct: 478 EQDIYSLDYFPSGDKLVSGSGDRTVRIWDLRTGQCSLTL-SIEDGVTTVAVSLGDGKYIA 536

Query: 629 SCSKDATVKYWDGQKFECIQKL-------AAHQSEVWSISVSNDGTFVISTGHDHSIRVW 681
           + S D  V+ WD +    +++L         H+  V+S+  + DG  V+S   D S+++W
Sbjct: 537 AGSLDRAVRVWDAETGFLVERLDSENELGTGHKDSVYSVVFTRDGHGVVSGSLDRSVKLW 596

Query: 682 EETEDQ 687
             +  Q
Sbjct: 597 NLSSGQ 602

 Score = 70.1 bits (170), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 68/283 (24%), Positives = 109/283 (38%), Gaps = 44/283 (15%)

Query: 87  YHPETNLLAAGYADGVIKIWDLISKTVLISFNGHKSAITVLAFDTTGTRLISASKDSDII 146
           + P+   LA G  D +I+IWD+  K +++   GH+  I  L +  +G +L+S S D  + 
Sbjct: 444 FSPDGKFLATGAEDRLIRIWDIAQKKIVMVLQGHEQDIYSLDYFPSGDKLVSGSGDRTVR 503

Query: 147 VWDL-VGESGLYKLRSHKDAITGLWCE--DENWLISTSKDGLVKIWDLKSQQCVET---- 199
           +WDL  G+  L    S +D +T +     D  ++ + S D  V++WD ++   VE     
Sbjct: 504 IWDLRTGQCSL--TLSIEDGVTTVAVSLGDGKYIAAGSLDRAVRVWDAETGFLVERLDSE 561

Query: 200 ---HLAHTGECWSLGIIED--MAVTCSADSQVKLWKLDLQAENGSKLTEKGIIEKQSKQR 254
                 H    +S+    D    V+ S D  VKLW L                   S Q 
Sbjct: 562 NELGTGHKDSVYSVVFTRDGHGVVSGSLDRSVKLWNL------------------SSGQN 603

Query: 255 GVEIDFAVAPDGVKFFYIQNADKTIEIYRLRKEEEISRALKKREK------------RLQ 302
               +   AP   +  Y  + D  + +   R +E I    K R               LQ
Sbjct: 604 NTNAETKPAPGTCEVTYTGHKDFVLSVATTRNDEYILSGSKDRGVLFWDTKSGNPLLMLQ 663

Query: 303 DKGMSEEEIKEAMGSPVSLMYHLFQVVRSPYKIKSAQWTVCSN 345
               S   +  A G P+   Y +F       K +  ++T   N
Sbjct: 664 GHRNSVISVAVANGYPLGPQYCVFATGSGDCKARIWKYTTTGN 706

 Score = 55.1 bits (131), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 35/139 (25%), Positives = 68/139 (48%), Gaps = 2/139 (1%)

Query: 571 LPVLSMDISYDSKLIVTCSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLPESYNFFSC 630
           L + S+  S D K + T + D+ I+IW +        L  H+  I ++ + P      S 
Sbjct: 437 LYIRSVCFSPDGKFLATGAEDRLIRIWDIAQKKIVMVLQGHEQDIYSLDYFPSGDKLVSG 496

Query: 631 SKDATVKYWDGQKFECIQKLAAHQSEVWSISVS-NDGTFVISTGHDHSIRVWEETEDQVF 689
           S D TV+ WD +  +C   L+  +  V +++VS  DG ++ +   D ++RVW+     + 
Sbjct: 497 SGDRTVRIWDLRTGQCSLTLSI-EDGVTTVAVSLGDGKYIAAGSLDRAVRVWDAETGFLV 555

Query: 690 LEEEREKEMDEQYEDTLLT 708
              + E E+   ++D++ +
Sbjct: 556 ERLDSENELGTGHKDSVYS 574

 Score = 48.5 bits (114), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 34/121 (28%), Positives = 55/121 (45%), Gaps = 12/121 (9%)

Query: 85  LKYHPETNLLAAGYADGVIKIWDLISKTVLISFNGHKSAITVLAFDTTGTRLISASKDSD 144
           L Y P  + L +G  D  ++IWDL +    ++ +      TV      G  + + S D  
Sbjct: 484 LDYFPSGDKLVSGSGDRTVRIWDLRTGQCSLTLSIEDGVTTVAVSLGDGKYIAAGSLDRA 543

Query: 145 IIVWDLVGESGLYKLR---------SHKDAITG-LWCEDENWLISTSKDGLVKIWDLKSQ 194
           + VWD   E+G    R          HKD++   ++  D + ++S S D  VK+W+L S 
Sbjct: 544 VRVWD--AETGFLVERLDSENELGTGHKDSVYSVVFTRDGHGVVSGSLDRSVKLWNLSSG 601

Query: 195 Q 195
           Q
Sbjct: 602 Q 602

>TBLA0F00520 Chr6 complement(134791..136782) [1992 bp, 663 aa] {ON}
           Anc_6.363 YCR084C
          Length = 663

 Score = 96.3 bits (238), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 75/298 (25%), Positives = 126/298 (42%), Gaps = 63/298 (21%)

Query: 429 YALTCKFLPGGALVVVGTRNGELQLFDIASSTMLDNKEGAHDAAIWSLDLTSDGRKLVTG 488
           Y  +  F P G  +  G  +  ++++DI    ++    G H+  I+SLD    G K+V+G
Sbjct: 368 YIRSVCFSPDGKFLATGAEDRLIRIWDITLKKIVMILNG-HEQDIYSLDYFPSGDKIVSG 426

Query: 489 SADKTVRFWTFEVSEVPVSDESNKTMPMLQLFHDTTLELDDDILSVVISPDDKFIAVSLL 548
           S D+TVR W     +  +                 TL ++D + +V +SPD KFIA   L
Sbjct: 427 SGDRTVRIWDLNTGQCLL-----------------TLSIEDGVTTVAVSPDGKFIAAGSL 469

Query: 549 DNTVKV------FFLDSMKFFLSLYGHKLPVLSMDISYDSKLIVTCSADKNIKIWGL--- 599
           D  V+V      F ++ +       GH+  V S+  + D K +V+ S DK +K+W L   
Sbjct: 470 DRAVRVWDAETGFLVERLDSNELGTGHEDSVYSVVFTKDGKNVVSGSLDKTVKLWNLKQQ 529

Query: 600 ----------------------------DFGDCHKSLFAHQDSIMNVKFLPESYNFFSCS 631
                                       +   C  +   H+D +++V    +     S S
Sbjct: 530 TTSSNDASKINQNSNSHLDSKINKSNNNNSSTCEVTYMGHKDFVLSVATTNDDQMILSGS 589

Query: 632 KDATVKYWDGQKFECIQKLAAHQSEVWSISVSND-------GTFVISTGHDHSIRVWE 682
           KD +V +WD +    +  L  H++ V S++V+N        G F   +G D   R+W+
Sbjct: 590 KDRSVLFWDTKSGNPLLMLQGHRNSVISVAVANGIPLGPNYGIFATGSG-DCKARIWK 646

 Score = 69.7 bits (169), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 45/157 (28%), Positives = 72/157 (45%), Gaps = 8/157 (5%)

Query: 87  YHPETNLLAAGYADGVIKIWDLISKTVLISFNGHKSAITVLAFDTTGTRLISASKDSDII 146
           + P+   LA G  D +I+IWD+  K +++  NGH+  I  L +  +G +++S S D  + 
Sbjct: 374 FSPDGKFLATGAEDRLIRIWDITLKKIVMILNGHEQDIYSLDYFPSGDKIVSGSGDRTVR 433

Query: 147 VWDLVGESGLYKLRSHKDAITGLWCEDENWLISTSKDGLVKIWDLKSQQCVET------H 200
           +WDL     L  L       T     D  ++ + S D  V++WD ++   VE        
Sbjct: 434 IWDLNTGQCLLTLSIEDGVTTVAVSPDGKFIAAGSLDRAVRVWDAETGFLVERLDSNELG 493

Query: 201 LAHTGECWSLGIIED--MAVTCSADSQVKLWKLDLQA 235
             H    +S+   +D    V+ S D  VKLW L  Q 
Sbjct: 494 TGHEDSVYSVVFTKDGKNVVSGSLDKTVKLWNLKQQT 530

 Score = 67.0 bits (162), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 63/270 (23%), Positives = 126/270 (46%), Gaps = 42/270 (15%)

Query: 384 LHGQRTDIRSTS-ISDDNKLLATASNGSLKIWNIKTKRCIR--SFECGYALTCKFLPGGA 440
           L+G   DI S       +K+++ + + +++IW++ T +C+   S E G   T    P G 
Sbjct: 404 LNGHEQDIYSLDYFPSGDKIVSGSGDRTVRIWDLNTGQCLLTLSIEDGVT-TVAVSPDGK 462

Query: 441 LVVVGTRNGELQLFDIASSTM---LDNKE--GAHDAAIWSLDLTSDGRKLVTGSADKTVR 495
            +  G+ +  ++++D  +  +   LD+ E    H+ +++S+  T DG+ +V+GS DKTV+
Sbjct: 463 FIAAGSLDRAVRVWDAETGFLVERLDSNELGTGHEDSVYSVVFTKDGKNVVSGSLDKTVK 522

Query: 496 FWTFEVSEVPVSDESNKTMPMLQLFHDTTLELDDDILSVVISPDDKFIAVSLLDNTVKVF 555
            W  +      +D S       ++  ++   LD  I            + +   +T +V 
Sbjct: 523 LWNLKQQTTSSNDAS-------KINQNSNSHLDSKINK----------SNNNNSSTCEVT 565

Query: 556 FLDSMKFFLSLYGHKLPVLSMDISYDSKLIVTCSADKNIKIWGLDFGDCHKSLFAHQDSI 615
           ++          GHK  VLS+  + D ++I++ S D+++  W    G+    L  H++S+
Sbjct: 566 YM----------GHKDFVLSVATTNDDQMILSGSKDRSVLFWDTKSGNPLLMLQGHRNSV 615

Query: 616 MNVKF-----LPESYNFFSC-SKDATVKYW 639
           ++V       L  +Y  F+  S D   + W
Sbjct: 616 ISVAVANGIPLGPNYGIFATGSGDCKARIW 645

 Score = 37.7 bits (86), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 17/76 (22%), Positives = 37/76 (48%)

Query: 615 IMNVKFLPESYNFFSCSKDATVKYWDGQKFECIQKLAAHQSEVWSISVSNDGTFVISTGH 674
           I +V F P+     + ++D  ++ WD    + +  L  H+ +++S+     G  ++S   
Sbjct: 369 IRSVCFSPDGKFLATGAEDRLIRIWDITLKKIVMILNGHEQDIYSLDYFPSGDKIVSGSG 428

Query: 675 DHSIRVWEETEDQVFL 690
           D ++R+W+    Q  L
Sbjct: 429 DRTVRIWDLNTGQCLL 444

 Score = 34.3 bits (77), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 45/221 (20%), Positives = 81/221 (36%), Gaps = 73/221 (33%)

Query: 45  GLENILVWDIKTGEQIAQLT--DGL------PPGA--SDAKLSKP-----AETTFLKYHP 89
           G   + +WD+ TG+ +  L+  DG+      P G   +   L +      AET FL    
Sbjct: 428 GDRTVRIWDLNTGQCLLTLSIEDGVTTVAVSPDGKFIAAGSLDRAVRVWDAETGFLVERL 487

Query: 90  ETNLLAAGYADGV--------------------IKIWDLISKTVL--------------- 114
           ++N L  G+ D V                    +K+W+L  +T                 
Sbjct: 488 DSNELGTGHEDSVYSVVFTKDGKNVVSGSLDKTVKLWNLKQQTTSSNDASKINQNSNSHL 547

Query: 115 ----------------ISFNGHKSAITVLAFDTTGTRLISASKDSDIIVWDLVGESGLYK 158
                           +++ GHK  +  +A       ++S SKD  ++ WD    + L  
Sbjct: 548 DSKINKSNNNNSSTCEVTYMGHKDFVLSVATTNDDQMILSGSKDRSVLFWDTKSGNPLLM 607

Query: 159 LRSHKDAITGLWCED-----ENWLI--STSKDGLVKIWDLK 192
           L+ H++++  +   +      N+ I  + S D   +IW  K
Sbjct: 608 LQGHRNSVISVAVANGIPLGPNYGIFATGSGDCKARIWKYK 648

>TPHA0L01080 Chr12 (226790..229297) [2508 bp, 835 aa] {ON} Anc_8.435
           YLR222C
          Length = 835

 Score = 95.5 bits (236), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 64/214 (29%), Positives = 101/214 (47%), Gaps = 7/214 (3%)

Query: 485 LVTGSADKTVRFWTFEVSEVP-VSDESNKTMPMLQLFHDTTLELDDDILSVVISPDDKFI 543
           L+T S D TV+ W     +VP  +D  +  +  +     T    + DI  + ISP+D   
Sbjct: 471 LITASNDLTVKKW-----KVPKPTDRFDIEIYSISSSEYTRRAHEKDINMLSISPNDSIF 525

Query: 544 AVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSMDISYDSKLIVTCSADKNIKIWGLDFGD 603
           A +  D T K++ L++ +   +L  HK  +  +      K I T S DK +KIW LD   
Sbjct: 526 ATASYDKTCKIWDLETGELKATLNNHKRGLWDVSFCQYDKFIATASGDKTVKIWSLDTFT 585

Query: 604 CHKSLFAHQDSIMNVKFLPESYNFFSCSKDATVKYWDGQKFECIQKLAAHQSEVWSISVS 663
             K+L  H +++    F  +     S   D  VK WD    ECI  L  H + +W+++V 
Sbjct: 586 VVKTLEGHSNAVQRCSFFNKQKQLVSTGADGLVKLWDCSTGECINTLDGHDNRIWALNVI 645

Query: 664 NDGTFVISTGHDHSIRVWEETEDQVFLEEEREKE 697
            DG  VI+   D   + W++  ++   EE+ EKE
Sbjct: 646 KDGDIVITADADGVFQFWKDRTEEA-REEDIEKE 678

 Score = 75.9 bits (185), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 43/153 (28%), Positives = 73/153 (47%), Gaps = 3/153 (1%)

Query: 81  ETTFLKYHPETNLLAAGYADGVIKIWDLISKTVLISFNGHKSAITVLAFDTTGTRLISAS 140
           +   L   P  ++ A    D   KIWDL +  +  + N HK  +  ++F      + +AS
Sbjct: 512 DINMLSISPNDSIFATASYDKTCKIWDLETGELKATLNNHKRGLWDVSFCQYDKFIATAS 571

Query: 141 KDSDIIVWDLVGESGLYKLRSHKDAITGL-WCEDENWLISTSKDGLVKIWDLKSQQCVET 199
            D  + +W L   + +  L  H +A+    +   +  L+ST  DGLVK+WD  + +C+ T
Sbjct: 572 GDKTVKIWSLDTFTVVKTLEGHSNAVQRCSFFNKQKQLVSTGADGLVKLWDCSTGECINT 631

Query: 200 HLAHTGECWSLGIIE--DMAVTCSADSQVKLWK 230
              H    W+L +I+  D+ +T  AD   + WK
Sbjct: 632 LDGHDNRIWALNVIKDGDIVITADADGVFQFWK 664

 Score = 72.8 bits (177), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 138/672 (20%), Positives = 251/672 (37%), Gaps = 103/672 (15%)

Query: 81  ETTFLKYHPETNLLAAGYADGVIKIWDLISKTVLISFNGHKSAITVLAFDTTGTRLISAS 140
           E T L   P+   L       ++KI+ L +  ++ S     S   VL  D T T L    
Sbjct: 75  EITALALTPDAQYLCYVSQAQLLKIFKLSTGKIVKSMK-ISSPSYVLETDPTSTLLAIGG 133

Query: 141 KDSDIIVWDLVGESGLYKLRSHKDAITGLWCEDE----NWLISTS-KDGLVKIWDLKSQQ 195
            D  + V D+      + L+ H   I+ L    E     WL+S+   +G+VKIWDL S++
Sbjct: 134 TDGSVTVIDIENGYITHSLKGHGATISSLKFYGEQHTNTWLLSSGDTNGMVKIWDLVSRK 193

Query: 196 CVETHLAHTGECWSLG--IIED-------MAVTCSADSQVKLWKL-DLQAENGSKLTEKG 245
            + T   H      +   +IE          +T + D  +  W+  D+      KL +  
Sbjct: 194 AIHTLQEHNSAVRGIDFKLIEKKNSEDSLQLITGARDDVINHWEFKDVTNLKRCKLLKTI 253

Query: 246 IIEKQSKQRGVEIDFAVAPDGVKFFYIQNADKTIEIYRLRKEEEISRALKKREKRL---- 301
            + +Q +  G  I+           Y    D  ++I  L     + ++ K  E+      
Sbjct: 254 PVHQQIEACGFIINIDGID--DDLIYTSGGDAVLQIVSLNNNSIVKKSKKPLEELFIIGV 311

Query: 302 -------------QDKGMSEEEIKEAMGSPVSLMYHLFQVVRSPYKIKSAQWTVCSNSKL 348
                         D+ +   ++K+   +P   +  +  +  +   I   +    +  KL
Sbjct: 312 LPVRNFTQLYLVFSDQTLQLVDLKDTFSNPKEYIEVVSSLAGNHGTIADMKVVGPNFDKL 371

Query: 349 ELVVTTSNNSIEYYSIPYSKREPTQPAPLKLHTIDLHGQRTDI-RSTSISDDNKLLATAS 407
            L   +S   I    IP S  + +    +   + +L+   TD+  +   ++D   +ATAS
Sbjct: 372 ALATNSSTLRI----IPISDVDDSNSVSI---STELYEGHTDLLNAVDATEDGLWIATAS 424

Query: 408 -NGSLKIWNIKTKRCIRSFECGYA--------LTCKFLP-----GGALVVVGTRNG---- 449
            + S  +W    +    +  C YA        +T   LP     G    ++   N     
Sbjct: 425 KDNSAILWRYNPRT---TLFCKYAHFQGHVSSVTSVGLPNVMNKGWPEYLITASNDLTVK 481

Query: 450 -----------ELQLFDIASSTMLDNKEGAHDAAIWSLDLTSDGRKLVTGSADKTVRFWT 498
                      +++++ I+SS   +    AH+  I  L ++ +     T S DKT + W 
Sbjct: 482 KWKVPKPTDRFDIEIYSISSS---EYTRRAHEKDINMLSISPNDSIFATASYDKTCKIWD 538

Query: 499 FEVSEVPVSDESNKTMPMLQLFHDTTLELDDDILSVVISPDDKFIAVSLLDNTVKVFFLD 558
            E  E+  +  ++K                  +  V     DKFIA +  D TVK++ LD
Sbjct: 539 LETGELKATLNNHKR----------------GLWDVSFCQYDKFIATASGDKTVKIWSLD 582

Query: 559 SMKFFLSLYGHKLPVLSMDISYDSKLIVTCSADKNIKIWGLDFGDCHKSLFAHQDSIMNV 618
           +     +L GH   V         K +V+  AD  +K+W    G+C  +L  H + I  +
Sbjct: 583 TFTVVKTLEGHSNAVQRCSFFNKQKQLVSTGADGLVKLWDCSTGECINTLDGHDNRIWAL 642

Query: 619 KFLPESYNFFSCSKDATVKYWDGQKFECI------QKLAAHQSEVWSISVSND---GTFV 669
             + +     +   D   ++W  +  E        +KL   Q +     +S+      F+
Sbjct: 643 NVIKDGDIVITADADGVFQFWKDRTEEAREEDIEKEKLKVEQMQTLENYISSGDWTNAFL 702

Query: 670 ISTGHDHSIRVW 681
           ++   DH  R++
Sbjct: 703 LAITLDHPARLY 714

 Score = 54.3 bits (129), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 37/130 (28%), Positives = 65/130 (50%), Gaps = 14/130 (10%)

Query: 75  KLSKPAETTFLKYHPETNLLAAGYADGVIKIWDLISKTVLISFNGHKSAITVLAF---DT 131
           K+S P+    L+  P + LLA G  DG + + D+ +  +  S  GH + I+ L F     
Sbjct: 112 KISSPSYV--LETDPTSTLLAIGGTDGSVTVIDIENGYITHSLKGHGATISSLKFYGEQH 169

Query: 132 TGTRLISASKDSDII-VWDLVGESGLYKLRSHKDAITGL--------WCEDENWLISTSK 182
           T T L+S+   + ++ +WDLV    ++ L+ H  A+ G+          ED   LI+ ++
Sbjct: 170 TNTWLLSSGDTNGMVKIWDLVSRKAIHTLQEHNSAVRGIDFKLIEKKNSEDSLQLITGAR 229

Query: 183 DGLVKIWDLK 192
           D ++  W+ K
Sbjct: 230 DDVINHWEFK 239

 Score = 50.1 bits (118), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 38/152 (25%), Positives = 69/152 (45%), Gaps = 19/152 (12%)

Query: 51  VWDIKTGEQIAQLTD---GLPPGASDAKLSKPAETTFLKYHPETNLLAAGYADGVIKIWD 107
           +WD++TGE  A L +   GL             + +F +Y      +A    D  +KIW 
Sbjct: 536 IWDLETGELKATLNNHKRGL------------WDVSFCQYD---KFIATASGDKTVKIWS 580

Query: 108 LISKTVLISFNGHKSAITVLAFDTTGTRLISASKDSDIIVWDLVGESGLYKLRSHKDAIT 167
           L + TV+ +  GH +A+   +F     +L+S   D  + +WD      +  L  H + I 
Sbjct: 581 LDTFTVVKTLEGHSNAVQRCSFFNKQKQLVSTGADGLVKLWDCSTGECINTLDGHDNRIW 640

Query: 168 GL-WCEDENWLISTSKDGLVKIWDLKSQQCVE 198
            L   +D + +I+   DG+ + W  ++++  E
Sbjct: 641 ALNVIKDGDIVITADADGVFQFWKDRTEEARE 672

 Score = 40.8 bits (94), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 40/176 (22%), Positives = 71/176 (40%), Gaps = 12/176 (6%)

Query: 518 QLFHDTTLELDDDILSVVISPDDKFIAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSMD 577
           Q+ H    + + +I ++ ++PD +++        +K+F L + K   S+     P   ++
Sbjct: 63  QILHKIENDDEQEITALALTPDAQYLCYVSQAQLLKIFKLSTGKIVKSMKISS-PSYVLE 121

Query: 578 ISYDSKLIVTCSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLPESYN----FFSCSKD 633
               S L+     D ++ +  ++ G    SL  H  +I ++KF  E +       S   +
Sbjct: 122 TDPTSTLLAIGGTDGSVTVIDIENGYITHSLKGHGATISSLKFYGEQHTNTWLLSSGDTN 181

Query: 634 ATVKYWDGQKFECIQKLAAHQSEVWSISV-------SNDGTFVISTGHDHSIRVWE 682
             VK WD    + I  L  H S V  I         S D   +I+   D  I  WE
Sbjct: 182 GMVKIWDLVSRKAIHTLQEHNSAVRGIDFKLIEKKNSEDSLQLITGARDDVINHWE 237

>SAKL0F15972g Chr6 (1291625..1293037) [1413 bp, 470 aa] {ON} similar
           to uniprot|P20053 Saccharomyces cerevisiae YPR178W PRP4
           Splicing factor component of the U4/U6-U5 snRNP complex
          Length = 470

 Score = 93.6 bits (231), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 74/299 (24%), Positives = 137/299 (45%), Gaps = 26/299 (8%)

Query: 391 IRSTSISDDNKLLATAS-NGSLKIWNIKTKRCIRSFECGYALT---CKFLPGGALVVVGT 446
           +   +IS D+ ++AT S  G LKI + +T   I++F+  +        + P G  +V G 
Sbjct: 185 VSQVAISSDDSMVATCSWGGDLKILSTETLEIIKAFDTAHDSKIGGVDWNPDGTALVTGA 244

Query: 447 RNGELQLFDIASSTMLDNKEG---AHDAAIWSLDLTSDGRKLVTGSADKTVRFWTFEVSE 503
            NGE++++++ + +  ++  G    H+  +  +     G+ + + S D T R W  E   
Sbjct: 245 ANGEIRIWNLNNDS--ESPAGTLTGHENRVARVRFHPSGKYVASASFDMTWRLWDVE--- 299

Query: 504 VPVSDESNKTMPMLQLFHDTTLELDDDILSVVISPDDKFIAVSLLDNTVKVFFLDSMKFF 563
                   +    LQ  H        ++  V    D   +  + LD+   V+ L S K  
Sbjct: 300 -------KQIELQLQEGHAK------EVYCVAFQKDGSLLCSTGLDSVGLVWDLRSGKSI 346

Query: 564 LSLYGHKLPVLSMDISYDSKLIVTCSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLPE 623
           ++L GH  P+  +D S +   I T SAD  I++W +       +L AH   +  VKF   
Sbjct: 347 MALEGHIKPIYGLDWSPNGYDIATGSADGTIRLWDVRKVGILGALPAHNSIVSEVKFDKA 406

Query: 624 SYNFF-SCSKDATVKYWDGQKFECIQKLAAHQSEVWSISVSNDGTFVISTGHDHSIRVW 681
           + ++  S S D T+  + G  +  +  +  H  ++ S+ +S DG+ + S+G D S++ W
Sbjct: 407 NGHYLVSSSYDKTLNIYSGDNWTKLSVIQGHTDKILSVDISTDGSHLFSSGWDRSLKQW 465

 Score = 66.6 bits (161), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 48/183 (26%), Positives = 83/183 (45%), Gaps = 4/183 (2%)

Query: 503 EVPVSDESNKTMPMLQLFHDTTLELDDDILSVVISPDDKFIAVSLLDNTVKVFFLDSMKF 562
           E+    E NK++   +L   + L     +  V IS DD  +A       +K+   ++++ 
Sbjct: 158 EILYRRELNKSLKKFEL-SGSQLVSSRPVSQVAISSDDSMVATCSWGGDLKILSTETLEI 216

Query: 563 FLSL-YGHKLPVLSMDISYDSKLIVTCSADKNIKIWGL--DFGDCHKSLFAHQDSIMNVK 619
             +    H   +  +D + D   +VT +A+  I+IW L  D      +L  H++ +  V+
Sbjct: 217 IKAFDTAHDSKIGGVDWNPDGTALVTGAANGEIRIWNLNNDSESPAGTLTGHENRVARVR 276

Query: 620 FLPESYNFFSCSKDATVKYWDGQKFECIQKLAAHQSEVWSISVSNDGTFVISTGHDHSIR 679
           F P      S S D T + WD +K   +Q    H  EV+ ++   DG+ + STG D    
Sbjct: 277 FHPSGKYVASASFDMTWRLWDVEKQIELQLQEGHAKEVYCVAFQKDGSLLCSTGLDSVGL 336

Query: 680 VWE 682
           VW+
Sbjct: 337 VWD 339

 Score = 58.2 bits (139), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 42/169 (24%), Positives = 72/169 (42%), Gaps = 13/169 (7%)

Query: 39  GQVIVGGLEN--ILVWDIKTGEQIAQLTDGLPPGASDAKLSKPAETTFLKYHPETNLLAA 96
           G  +V G  N  I +W++    +        P G      ++ A    +++HP    +A+
Sbjct: 237 GTALVTGAANGEIRIWNLNNDSES-------PAGTLTGHENRVAR---VRFHPSGKYVAS 286

Query: 97  GYADGVIKIWDLISKTVLISFNGHKSAITVLAFDTTGTRLISASKDSDIIVWDLVGESGL 156
              D   ++WD+  +  L    GH   +  +AF   G+ L S   DS  +VWDL     +
Sbjct: 287 ASFDMTWRLWDVEKQIELQLQEGHAKEVYCVAFQKDGSLLCSTGLDSVGLVWDLRSGKSI 346

Query: 157 YKLRSHKDAITGL-WCEDENWLISTSKDGLVKIWDLKSQQCVETHLAHT 204
             L  H   I GL W  +   + + S DG +++WD++    +    AH 
Sbjct: 347 MALEGHIKPIYGLDWSPNGYDIATGSADGTIRLWDVRKVGILGALPAHN 395

 Score = 53.9 bits (128), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 42/149 (28%), Positives = 73/149 (48%), Gaps = 7/149 (4%)

Query: 87  YHPETNLLAAGYADGVIKIWDLI--SKTVLISFNGHKSAITVLAFDTTGTRLISASKDSD 144
           ++P+   L  G A+G I+IW+L   S++   +  GH++ +  + F  +G  + SAS D  
Sbjct: 233 WNPDGTALVTGAANGEIRIWNLNNDSESPAGTLTGHENRVARVRFHPSGKYVASASFDMT 292

Query: 145 IIVWDLVGESGLYKLRSH-KDAITGLWCEDENWLISTSKDGLVKIWDLKSQQCVETHLAH 203
             +WD+  +  L     H K+     + +D + L ST  D +  +WDL+S + +     H
Sbjct: 293 WRLWDVEKQIELQLQEGHAKEVYCVAFQKDGSLLCSTGLDSVGLVWDLRSGKSIMALEGH 352

Query: 204 TGECWSLGIIE---DMAVTCSADSQVKLW 229
               + L       D+A T SAD  ++LW
Sbjct: 353 IKPIYGLDWSPNGYDIA-TGSADGTIRLW 380

 Score = 52.0 bits (123), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 57/254 (22%), Positives = 108/254 (42%), Gaps = 30/254 (11%)

Query: 350 LVVTTSNNSIEYYSIPYSKREPTQPAPLKLHTIDLHGQRTDIRSTSISDDNKLLATAS-N 408
           LV   +N  I  +++      P            L G    +         K +A+AS +
Sbjct: 240 LVTGAANGEIRIWNLNNDSESPAGT---------LTGHENRVARVRFHPSGKYVASASFD 290

Query: 409 GSLKIWNIKTKRCIRSFECGYA--LTC-KFLPGGALVVVGTRNGELQLFDIASSTMLDNK 465
            + ++W+++ K+     + G+A  + C  F   G+L+     +    ++D+ S   +   
Sbjct: 291 MTWRLWDVE-KQIELQLQEGHAKEVYCVAFQKDGSLLCSTGLDSVGLVWDLRSGKSIMAL 349

Query: 466 EGAHDAAIWSLDLTSDGRKLVTGSADKTVRFWTFEVSEVPVSDESNKTMPMLQLFHDTTL 525
           EG H   I+ LD + +G  + TGSAD T+R W  +V +V +       +  L   +    
Sbjct: 350 EG-HIKPIYGLDWSPNGYDIATGSADGTIRLW--DVRKVGI-------LGALPAHNSIVS 399

Query: 526 ELDDDILSVVISPDDKFIAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSMDISYDSKLI 585
           E+  D        +  ++  S  D T+ ++  D+      + GH   +LS+DIS D   +
Sbjct: 400 EVKFD------KANGHYLVSSSYDKTLNIYSGDNWTKLSVIQGHTDKILSVDISTDGSHL 453

Query: 586 VTCSADKNIKIWGL 599
            +   D+++K W L
Sbjct: 454 FSSGWDRSLKQWSL 467

 Score = 44.3 bits (103), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 38/157 (24%), Positives = 70/157 (44%), Gaps = 4/157 (2%)

Query: 81  ETTFLKYHPETNLLAAGYADGVIKIWDLISKTVLISFNGHKSAITVLAFDTTGTRLISAS 140
           E   + +  + +LL +   D V  +WDL S   +++  GH   I  L +   G  + + S
Sbjct: 313 EVYCVAFQKDGSLLCSTGLDSVGLVWDLRSGKSIMALEGHIKPIYGLDWSPNGYDIATGS 372

Query: 141 KDSDIIVWDLVGESGLYKLRSHKDAITGLWCEDEN--WLISTSKDGLVKIWDLKSQQCVE 198
            D  I +WD+     L  L +H   ++ +  +  N  +L+S+S D  + I+   +   + 
Sbjct: 373 ADGTIRLWDVRKVGILGALPAHNSIVSEVKFDKANGHYLVSSSYDKTLNIYSGDNWTKLS 432

Query: 199 THLAHTGECWSLGIIEDMAVTCSA--DSQVKLWKLDL 233
               HT +  S+ I  D +   S+  D  +K W L +
Sbjct: 433 VIQGHTDKILSVDISTDGSHLFSSGWDRSLKQWSLKI 469

 Score = 38.5 bits (88), Expect = 0.082,   Method: Compositional matrix adjust.
 Identities = 32/137 (23%), Positives = 67/137 (48%), Gaps = 6/137 (4%)

Query: 101 GVIKIWDLISKTVLISFN-GHKSAITVLAFDTTGTRLISASKDSDIIVWDLVG--ESGLY 157
           G +KI    +  ++ +F+  H S I  + ++  GT L++ + + +I +W+L    ES   
Sbjct: 204 GDLKILSTETLEIIKAFDTAHDSKIGGVDWNPDGTALVTGAANGEIRIWNLNNDSESPAG 263

Query: 158 KLRSHKDAITGL-WCEDENWLISTSKDGLVKIWDLKSQQCVETHLAHTGECWSLGIIEDM 216
            L  H++ +  + +     ++ S S D   ++WD++ Q  ++    H  E + +   +D 
Sbjct: 264 TLTGHENRVARVRFHPSGKYVASASFDMTWRLWDVEKQIELQLQEGHAKEVYCVAFQKDG 323

Query: 217 AVTCSA--DSQVKLWKL 231
           ++ CS   DS   +W L
Sbjct: 324 SLLCSTGLDSVGLVWDL 340

 Score = 32.3 bits (72), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 23/104 (22%), Positives = 55/104 (52%), Gaps = 5/104 (4%)

Query: 403 LATAS-NGSLKIWNIKTKRCIRSFECGYALT--CKF-LPGGALVVVGTRNGELQLFDIAS 458
           +AT S +G++++W+++    + +     ++    KF    G  +V  + +  L ++   +
Sbjct: 368 IATGSADGTIRLWDVRKVGILGALPAHNSIVSEVKFDKANGHYLVSSSYDKTLNIYSGDN 427

Query: 459 STMLDNKEGAHDAAIWSLDLTSDGRKLVTGSADKTVRFWTFEVS 502
            T L   +G H   I S+D+++DG  L +   D++++ W+ ++S
Sbjct: 428 WTKLSVIQG-HTDKILSVDISTDGSHLFSSGWDRSLKQWSLKIS 470

>KLTH0D04466g Chr4 (413024..413560,413816..414238) [960 bp, 319 aa]
           {ON} highly similar to uniprot|P38011 Saccharomyces
           cerevisiae YMR116C ASC1 WD repeat protein (G-beta like
           protein) involved in translation regulation required for
           repression of Gcn4p activity in the absence of
           amino-acid starvation core component of the ribosome
           ortholog of mammalian RACK1
          Length = 319

 Score = 89.7 bits (221), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 60/220 (27%), Positives = 97/220 (44%), Gaps = 18/220 (8%)

Query: 485 LVTGSADKTVRFWTFEVSEVPVSDESNKTMPMLQLFHDTTLELDDDILSVVISPDDKFIA 544
           L++GS DK++  W          D+    +P+      + +  D       ++PD ++  
Sbjct: 33  LLSGSRDKSLITWKL------TGDDQQYGVPVRSFRGHSHIVQD-----CTVTPDGEYAL 81

Query: 545 VSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSMDISYDSKLIVTCSADKNIKIWGLDFGDC 604
            +  D TV+++ L S K      GHK  VLS+ I   +  IV+ S DK +K+W    G+C
Sbjct: 82  SASWDKTVRLWELASGKCIQRFVGHKSDVLSVTIDRRASQIVSASRDKTVKVWNT-LGEC 140

Query: 605 HKSLFAHQDSIMNVKFLP------ESYNFFSCSKDATVKYWDGQKFECIQKLAAHQSEVW 658
             +L  H D +  V+  P      E+    S   D  VK W+   F+       H + V 
Sbjct: 141 MVTLLGHNDWVSQVRVAPNETPEDETVTVISAGMDKVVKVWNLHSFQIEADFIGHNNYVN 200

Query: 659 SISVSNDGTFVISTGHDHSIRVWEETEDQVFLEEEREKEM 698
           +++ S DGT V S G D  I +W  TE +       + E+
Sbjct: 201 TVTASPDGTLVASAGKDGQIMLWNLTEKEALYTLNAQDEV 240

 Score = 65.1 bits (157), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 55/211 (26%), Positives = 95/211 (45%), Gaps = 23/211 (10%)

Query: 89  PETNLLAAGYADGVIKIWDLISKTVLISFNGHKSAITVLAFDTTGTRLISASKDSDIIVW 148
           P+     +   D  +++W+L S   +  F GHKS +  +  D   ++++SAS+D  + VW
Sbjct: 75  PDGEYALSASWDKTVRLWELASGKCIQRFVGHKSDVLSVTIDRRASQIVSASRDKTVKVW 134

Query: 149 DLVGESGLYKLRSHKDAITGLWC------EDEN-WLISTSKDGLVKIWDLKSQQCVETHL 201
           + +GE  +  L  H D ++ +        EDE   +IS   D +VK+W+L S Q     +
Sbjct: 135 NTLGEC-MVTLLGHNDWVSQVRVAPNETPEDETVTVISAGMDKVVKVWNLHSFQIEADFI 193

Query: 202 AHTGECWSLGIIEDMAVTCSA--DSQVKLWKLDLQAENGSKLTEKGIIEKQSKQRGVEID 259
            H     ++    D  +  SA  D Q+ LW           LTEK  +   + Q  V   
Sbjct: 194 GHNNYVNTVTASPDGTLVASAGKDGQIMLW----------NLTEKEALYTLNAQDEV--- 240

Query: 260 FAVAPDGVKFFYIQNADKTIEIYRLRKEEEI 290
           FAVA    +++        I+I+ L + + +
Sbjct: 241 FAVAFSPNRYWLTAATSSGIKIFNLEERKVV 271

 Score = 57.4 bits (137), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 33/123 (26%), Positives = 60/123 (48%), Gaps = 6/123 (4%)

Query: 565 SLYGHKLPVLSMDIS-YDSKLIVTCSADKNIKIWGL-----DFGDCHKSLFAHQDSIMNV 618
           +L GH   V S+  S     L+++ S DK++  W L      +G   +S   H   + + 
Sbjct: 12  TLEGHNGWVTSLATSPAQPNLLLSGSRDKSLITWKLTGDDQQYGVPVRSFRGHSHIVQDC 71

Query: 619 KFLPESYNFFSCSKDATVKYWDGQKFECIQKLAAHQSEVWSISVSNDGTFVISTGHDHSI 678
              P+     S S D TV+ W+    +CIQ+   H+S+V S+++    + ++S   D ++
Sbjct: 72  TVTPDGEYALSASWDKTVRLWELASGKCIQRFVGHKSDVLSVTIDRRASQIVSASRDKTV 131

Query: 679 RVW 681
           +VW
Sbjct: 132 KVW 134

 Score = 55.1 bits (131), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 30/109 (27%), Positives = 57/109 (52%), Gaps = 1/109 (0%)

Query: 90  ETNLLAAGYADGVIKIWDLISKTVLISFNGHKSAITVLAFDTTGTRLISASKDSDIIVWD 149
           ET  + +   D V+K+W+L S  +   F GH + +  +     GT + SA KD  I++W+
Sbjct: 165 ETVTVISAGMDKVVKVWNLHSFQIEADFIGHNNYVNTVTASPDGTLVASAGKDGQIMLWN 224

Query: 150 LVGESGLYKLRSHKDAITGLWCEDENWLISTSKDGLVKIWDLKSQQCVE 198
           L  +  LY L +  +     +  +  WL + +  G +KI++L+ ++ V+
Sbjct: 225 LTEKEALYTLNAQDEVFAVAFSPNRYWLTAATSSG-IKIFNLEERKVVD 272

 Score = 52.8 bits (125), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 59/255 (23%), Positives = 107/255 (41%), Gaps = 43/255 (16%)

Query: 468 AHDAAIWSLDLTSDGRKLVTGSADKTVRFWTF-----------------------EVSEV 504
            H   +    +T DG   ++ S DKTVR W                           S++
Sbjct: 63  GHSHIVQDCTVTPDGEYALSASWDKTVRLWELASGKCIQRFVGHKSDVLSVTIDRRASQI 122

Query: 505 PVSDESNKTMPMLQLFHD---TTLELDDDILSVVISPD----DKFIAV--SLLDNTVKVF 555
            VS   +KT+ +     +   T L  +D +  V ++P+    D+ + V  + +D  VKV+
Sbjct: 123 -VSASRDKTVKVWNTLGECMVTLLGHNDWVSQVRVAPNETPEDETVTVISAGMDKVVKVW 181

Query: 556 FLDSMKFFLSLYGHKLPVLSMDISYDSKLIVTCSADKNIKIWGLDFGDCHKSLFAHQDSI 615
            L S +      GH   V ++  S D  L+ +   D  I +W L   +   +L A QD +
Sbjct: 182 NLHSFQIEADFIGHNNYVNTVTASPDGTLVASAGKDGQIMLWNLTEKEALYTLNA-QDEV 240

Query: 616 MNVKFLPESYNFFSCSKDATVKYWDGQKFECIQKL--------AAHQSEVWSISVSNDGT 667
             V F P  Y + + +  + +K ++ ++ + + +L         A +    S++ S DG 
Sbjct: 241 FAVAFSPNRY-WLTAATSSGIKIFNLEERKVVDELKPEFAGYTKAAEPHAISLAWSADGQ 299

Query: 668 FVISTGHDHSIRVWE 682
            + +   D+ IRVW+
Sbjct: 300 TLFAGYTDNVIRVWQ 314

 Score = 48.1 bits (113), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 35/126 (27%), Positives = 56/126 (44%), Gaps = 13/126 (10%)

Query: 116 SFNGHKSAITVLAFDTTGTRLI-SASKDSDIIVWDLVGESGLY-----KLRSHKDAITGL 169
           +  GH   +T LA       L+ S S+D  +I W L G+   Y       R H   +   
Sbjct: 12  TLEGHNGWVTSLATSPAQPNLLLSGSRDKSLITWKLTGDDQQYGVPVRSFRGHSHIVQD- 70

Query: 170 WC---EDENWLISTSKDGLVKIWDLKSQQCVETHLAHTGECWSLGIIEDMA--VTCSADS 224
            C    D  + +S S D  V++W+L S +C++  + H  +  S+ I    +  V+ S D 
Sbjct: 71  -CTVTPDGEYALSASWDKTVRLWELASGKCIQRFVGHKSDVLSVTIDRRASQIVSASRDK 129

Query: 225 QVKLWK 230
            VK+W 
Sbjct: 130 TVKVWN 135

 Score = 34.3 bits (77), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 28/112 (25%), Positives = 48/112 (42%), Gaps = 11/112 (9%)

Query: 89  PETNLLAAGYADGVIKIWDLISKTVLISFNGHKSAITVLAFDTTGTRLISASKDSDI--- 145
           P+  L+A+   DG I +W+L  K  L + N       V AF +     ++A+  S I   
Sbjct: 206 PDGTLVASAGKDGQIMLWNLTEKEALYTLNAQDEVFAV-AF-SPNRYWLTAATSSGIKIF 263

Query: 146 ------IVWDLVGESGLYKLRSHKDAITGLWCEDENWLISTSKDGLVKIWDL 191
                 +V +L  E   Y   +   AI+  W  D   L +   D ++++W +
Sbjct: 264 NLEERKVVDELKPEFAGYTKAAEPHAISLAWSADGQTLFAGYTDNVIRVWQV 315

>AEL246C Chr5 complement(172849..175296) [2448 bp, 815 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YBR198C
           (TAF5)
          Length = 815

 Score = 92.4 bits (228), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 69/294 (23%), Positives = 132/294 (44%), Gaps = 34/294 (11%)

Query: 407 SNGSLKIWNIKTKR---CIRSFE-CGYALTC-KFLPGGALVVVGTRNGELQLFDIASSTM 461
           S  ++K+ N++T     C+ +F      +TC +F     LV  G ++  ++L+ +  + +
Sbjct: 462 SRDAIKMDNLQTSAPSVCMYTFHNTNREMTCLRFSDDSRLVAAGFQDSYIKLWSLDGTPL 521

Query: 462 ---LDNKEG---------AHDAAIWSLDLTSDGRKLVTGSADKTVRFWTFEVSEVPVSDE 509
              L +K            H   ++S+  + D R LV+ S DKTVR W+ +     VS +
Sbjct: 522 ESQLPSKAKDASNTVTLIGHSGPVYSVSFSPDNRYLVSASEDKTVRLWSLDTYTCLVSYK 581

Query: 510 SNKTMPMLQLFHDTTLELDDDILSVVISPDDKFIAVSLLDNTVKVFFLDSMKFFLSLYGH 569
            +                +  +  V  SP   + A    D T +++  D +       GH
Sbjct: 582 GH----------------NHPVWDVKFSPLGHYFATGSHDQTARLWSCDHIYPLRIFAGH 625

Query: 570 KLPVLSMDISYDSKLIVTCSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLPESYNFFS 629
              V  +    +   ++T S+DK  ++W +  GD  +    H  S+++V   P+     +
Sbjct: 626 LNDVDCVTFHPNGTYVLTGSSDKTCRMWDIQTGDSVRLFLGHTASVVSVAVSPDGRWLTT 685

Query: 630 CSKDATVKYWDGQKFECIQKLAAH-QSEVWSISVSNDGTFVISTGHDHSIRVWE 682
            S+D  +  WD    + I+++  H +S V+S+S + +G  ++S G D S+RVW+
Sbjct: 686 GSEDGVIIVWDIGTGKRIKQMRGHGKSAVYSLSFNKEGNILVSGGADQSVRVWD 739

 Score = 88.2 bits (217), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 51/188 (27%), Positives = 90/188 (47%), Gaps = 18/188 (9%)

Query: 517 LQLFHDTTLELDDDILSVVISPDDKFIAVSLLDNTVKVFFLDSMKF-------------F 563
           +  FH+T  E+      +  S D + +A    D+ +K++ LD                  
Sbjct: 480 MYTFHNTNREM----TCLRFSDDSRLVAAGFQDSYIKLWSLDGTPLESQLPSKAKDASNT 535

Query: 564 LSLYGHKLPVLSMDISYDSKLIVTCSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLPE 623
           ++L GH  PV S+  S D++ +V+ S DK +++W LD   C  S   H   + +VKF P 
Sbjct: 536 VTLIGHSGPVYSVSFSPDNRYLVSASEDKTVRLWSLDTYTCLVSYKGHNHPVWDVKFSPL 595

Query: 624 SYNFFSCSKDATVKYWDGQKFECIQKLAAHQSEVWSISVSNDGTFVISTGHDHSIRVWE- 682
            + F + S D T + W       ++  A H ++V  ++   +GT+V++   D + R+W+ 
Sbjct: 596 GHYFATGSHDQTARLWSCDHIYPLRIFAGHLNDVDCVTFHPNGTYVLTGSSDKTCRMWDI 655

Query: 683 ETEDQVFL 690
           +T D V L
Sbjct: 656 QTGDSVRL 663

 Score = 68.9 bits (167), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 55/225 (24%), Positives = 107/225 (47%), Gaps = 23/225 (10%)

Query: 380 HTIDLHGQRTDIRSTSISDDNKLLATAS-NGSLKIWNIKTKRCIRSFECGYALTC---KF 435
           +T+ L G    + S S S DN+ L +AS + ++++W++ T  C+ S++ G+       KF
Sbjct: 534 NTVTLIGHSGPVYSVSFSPDNRYLVSASEDKTVRLWSLDTYTCLVSYK-GHNHPVWDVKF 592

Query: 436 LPGGALVVVGTRNGELQLFDIASSTMLDNKEGAHDAAIWSLDLTSDGRKLVTGSADKTVR 495
            P G     G+ +   +L+       L    G H   +  +    +G  ++TGS+DKT R
Sbjct: 593 SPLGHYFATGSHDQTARLWSCDHIYPLRIFAG-HLNDVDCVTFHPNGTYVLTGSSDKTCR 651

Query: 496 FWTFEVSEVPVSDESNKTMPMLQLFHDTTLELDDDILSVVISPDDKFIAVSLLDNTVKVF 555
            W  +  +             ++LF   T      ++SV +SPD +++     D  + V+
Sbjct: 652 MWDIQTGD------------SVRLFLGHTAS----VVSVAVSPDGRWLTTGSEDGVIIVW 695

Query: 556 FLDSMKFFLSLYGH-KLPVLSMDISYDSKLIVTCSADKNIKIWGL 599
            + + K    + GH K  V S+  + +  ++V+  AD+++++W L
Sbjct: 696 DIGTGKRIKQMRGHGKSAVYSLSFNKEGNILVSGGADQSVRVWDL 740

 Score = 62.0 bits (149), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 33/110 (30%), Positives = 59/110 (53%), Gaps = 2/110 (1%)

Query: 85  LKYHPETNLLAAGYADGVIKIWDLISKTVLISFNGHKSAITVLAFDTTGTRLISASKDSD 144
           + +HP    +  G +D   ++WD+ +   +  F GH +++  +A    G  L + S+D  
Sbjct: 632 VTFHPNGTYVLTGSSDKTCRMWDIQTGDSVRLFLGHTASVVSVAVSPDGRWLTTGSEDGV 691

Query: 145 IIVWDLVGESGLYKLRSH-KDAITGL-WCEDENWLISTSKDGLVKIWDLK 192
           IIVWD+     + ++R H K A+  L + ++ N L+S   D  V++WDLK
Sbjct: 692 IIVWDIGTGKRIKQMRGHGKSAVYSLSFNKEGNILVSGGADQSVRVWDLK 741

 Score = 57.4 bits (137), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 33/153 (21%), Positives = 65/153 (42%), Gaps = 9/153 (5%)

Query: 85  LKYHPETNLLAAGYADGVIKIWDLISKTVLISFNGHKSAITVLAFDTTGTRLISASKDSD 144
           + + P+   L +   D  +++W L + T L+S+ GH   +  + F   G    + S D  
Sbjct: 548 VSFSPDNRYLVSASEDKTVRLWSLDTYTCLVSYKGHNHPVWDVKFSPLGHYFATGSHDQT 607

Query: 145 IIVWDLVGESGLYKLRSHKDAITGLWC----EDENWLISTSKDGLVKIWDLKSQQCVETH 200
             +W       +Y LR     +  + C     +  ++++ S D   ++WD+++   V   
Sbjct: 608 ARLWSC---DHIYPLRIFAGHLNDVDCVTFHPNGTYVLTGSSDKTCRMWDIQTGDSVRLF 664

Query: 201 LAHTGECWSLGIIEDMA--VTCSADSQVKLWKL 231
           L HT    S+ +  D     T S D  + +W +
Sbjct: 665 LGHTASVVSVAVSPDGRWLTTGSEDGVIIVWDI 697

 Score = 53.5 bits (127), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 42/155 (27%), Positives = 68/155 (43%), Gaps = 32/155 (20%)

Query: 81  ETTFLKYHPETNLLAAGYADGVIKIWDLISKTVLISFNGHKSAITVLAFDTTGTRLISAS 140
           E T L++  ++ L+AAG+ D  IK+W L   T L S                  +L S +
Sbjct: 489 EMTCLRFSDDSRLVAAGFQDSYIKLWSL-DGTPLES------------------QLPSKA 529

Query: 141 KDSDIIVWDLVGESG-LYKLRSHKDAITGLWCEDENWLISTSKDGLVKIWDLKSQQCVET 199
           KD+   V  L+G SG +Y +          +  D  +L+S S+D  V++W L +  C+ +
Sbjct: 530 KDASNTV-TLIGHSGPVYSVS---------FSPDNRYLVSASEDKTVRLWSLDTYTCLVS 579

Query: 200 HLAHTGECWSLGI--IEDMAVTCSADSQVKLWKLD 232
           +  H    W +    +     T S D   +LW  D
Sbjct: 580 YKGHNHPVWDVKFSPLGHYFATGSHDQTARLWSCD 614

 Score = 37.7 bits (86), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 26/86 (30%), Positives = 42/86 (48%), Gaps = 18/86 (20%)

Query: 23  SVWIEPEASKRKTGNLGQVIVGGLENILVWDIKTGEQIAQLTDGLPPGASDAKLSKPAET 82
           SV + P+     TG+   VI+       VWDI TG++I Q+      G   + +      
Sbjct: 673 SVAVSPDGRWLTTGSEDGVII-------VWDIGTGKRIKQMR-----GHGKSAVYS---- 716

Query: 83  TFLKYHPETNLLAAGYADGVIKIWDL 108
             L ++ E N+L +G AD  +++WDL
Sbjct: 717 --LSFNKEGNILVSGGADQSVRVWDL 740

>KAFR0E03180 Chr5 (637055..639499) [2445 bp, 814 aa] {ON} Anc_8.544
           YBR198C
          Length = 814

 Score = 91.7 bits (226), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 71/301 (23%), Positives = 125/301 (41%), Gaps = 39/301 (12%)

Query: 384 LHGQRTDIRSTSISDDNKLLATASNGS-LKIWNIKTKRCIRSFECGYALTCKFLPGGALV 442
            H    D+     SDD +L AT    S +KIW++           G +L    LP     
Sbjct: 475 FHNTNKDMSCLEFSDDCRLAATGFQDSFIKIWSLD----------GSSLVTNKLPSYKKE 524

Query: 443 VVGTRNGELQLFDIASSTMLDNKEGAHDAAIWSLDLTSDGRKLVTGSADKTVRFWTFEVS 502
            + T   E       SS ++      H  A++S   + D + L++GS DKTVR W+ +  
Sbjct: 525 EILTTGDE------TSSLLI-----GHSGAVYSTSFSPDNKFLLSGSEDKTVRLWSMDTH 573

Query: 503 EVPVSDESNKTMPMLQLFHDTTLELDDDILSVVISPDDKFIAVSLLDNTVKVFFLDSMKF 562
              VS + +                +  +  V  SP   + A +  D T +++  D +  
Sbjct: 574 TTLVSYKGH----------------NHPVWDVKFSPMGHYFATASHDQTARLWSCDHIYP 617

Query: 563 FLSLYGHKLPVLSMDISYDSKLIVTCSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLP 622
                GH   V ++    +   + T SADK  ++W +  GD  +    H   ++     P
Sbjct: 618 LRIFAGHLNDVETVSFHPNGCYVFTGSADKTCRMWDISTGDSVRLFLGHTAPVLTTAVTP 677

Query: 623 ESYNFFSCSKDATVKYWDGQKFECIQKLAAH-QSEVWSISVSNDGTFVISTGHDHSIRVW 681
           +     +  +D  +  WD    + ++++  H ++ + S S + +G  +IS G DHS+RVW
Sbjct: 678 DGRWLCTGGEDGVINVWDIGTGKRLKQMRGHGKNAIHSFSFNKEGNILISGGADHSVRVW 737

Query: 682 E 682
           +
Sbjct: 738 D 738

 Score = 71.2 bits (173), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 48/195 (24%), Positives = 84/195 (43%), Gaps = 25/195 (12%)

Query: 517 LQLFHDTTLELDDDILSVVISPDDKFIAVSLLDNTVKVFFLDSMKFFLS----------- 565
           +  FH+T    + D+  +  S D +  A    D+ +K++ LD      +           
Sbjct: 472 MYTFHNT----NKDMSCLEFSDDCRLAATGFQDSFIKIWSLDGSSLVTNKLPSYKKEEIL 527

Query: 566 ---------LYGHKLPVLSMDISYDSKLIVTCSADKNIKIWGLDFGDCHKSLFAHQDSIM 616
                    L GH   V S   S D+K +++ S DK +++W +D      S   H   + 
Sbjct: 528 TTGDETSSLLIGHSGAVYSTSFSPDNKFLLSGSEDKTVRLWSMDTHTTLVSYKGHNHPVW 587

Query: 617 NVKFLPESYNFFSCSKDATVKYWDGQKFECIQKLAAHQSEVWSISVSNDGTFVISTGHDH 676
           +VKF P  + F + S D T + W       ++  A H ++V ++S   +G +V +   D 
Sbjct: 588 DVKFSPMGHYFATASHDQTARLWSCDHIYPLRIFAGHLNDVETVSFHPNGCYVFTGSADK 647

Query: 677 SIRVWE-ETEDQVFL 690
           + R+W+  T D V L
Sbjct: 648 TCRMWDISTGDSVRL 662

 Score = 58.2 bits (139), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 34/151 (22%), Positives = 64/151 (42%), Gaps = 9/151 (5%)

Query: 87  YHPETNLLAAGYADGVIKIWDLISKTVLISFNGHKSAITVLAFDTTGTRLISASKDSDII 146
           + P+   L +G  D  +++W + + T L+S+ GH   +  + F   G    +AS D    
Sbjct: 549 FSPDNKFLLSGSEDKTVRLWSMDTHTTLVSYKGHNHPVWDVKFSPMGHYFATASHDQTAR 608

Query: 147 VWDLVGESGLYKLR---SH-KDAITGLWCEDENWLISTSKDGLVKIWDLKSQQCVETHLA 202
           +W       +Y LR    H  D  T  +  +  ++ + S D   ++WD+ +   V   L 
Sbjct: 609 LWSC---DHIYPLRIFAGHLNDVETVSFHPNGCYVFTGSADKTCRMWDISTGDSVRLFLG 665

Query: 203 HTGECWSLGIIEDMAVTCSA--DSQVKLWKL 231
           HT    +  +  D    C+   D  + +W +
Sbjct: 666 HTAPVLTTAVTPDGRWLCTGGEDGVINVWDI 696

 Score = 57.4 bits (137), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 34/110 (30%), Positives = 55/110 (50%), Gaps = 2/110 (1%)

Query: 85  LKYHPETNLLAAGYADGVIKIWDLISKTVLISFNGHKSAITVLAFDTTGTRLISASKDSD 144
           + +HP    +  G AD   ++WD+ +   +  F GH + +   A    G  L +  +D  
Sbjct: 631 VSFHPNGCYVFTGSADKTCRMWDISTGDSVRLFLGHTAPVLTTAVTPDGRWLCTGGEDGV 690

Query: 145 IIVWDLVGESGLYKLRSH-KDAITGL-WCEDENWLISTSKDGLVKIWDLK 192
           I VWD+     L ++R H K+AI    + ++ N LIS   D  V++WDLK
Sbjct: 691 INVWDIGTGKRLKQMRGHGKNAIHSFSFNKEGNILISGGADHSVRVWDLK 740

 Score = 41.2 bits (95), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 34/151 (22%), Positives = 59/151 (39%), Gaps = 25/151 (16%)

Query: 85  LKYHPETNLLAAGYADGVIKIWDLISKTVLIS-FNGHKSAITVLAFDTTGTRLISASKDS 143
           L++  +  L A G+ D  IKIW L   +++ +    +K    +   D T + LI      
Sbjct: 485 LEFSDDCRLAATGFQDSFIKIWSLDGSSLVTNKLPSYKKEEILTTGDETSSLLI------ 538

Query: 144 DIIVWDLVGESGLYKLRSHKDAITGLWCEDENWLISTSKDGLVKIWDLKSQQCVETHLAH 203
                   G SG     S        +  D  +L+S S+D  V++W + +   + ++  H
Sbjct: 539 --------GHSGAVYSTS--------FSPDNKFLLSGSEDKTVRLWSMDTHTTLVSYKGH 582

Query: 204 TGECWSLGI--IEDMAVTCSADSQVKLWKLD 232
               W +    +     T S D   +LW  D
Sbjct: 583 NHPVWDVKFSPMGHYFATASHDQTARLWSCD 613

 Score = 33.9 bits (76), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 21/69 (30%), Positives = 37/69 (53%), Gaps = 12/69 (17%)

Query: 41  VIVGGLENIL-VWDIKTGEQIAQLTDGLPPGASDAKLSKPAETTFLKYHPETNLLAAGYA 99
           +  GG + ++ VWDI TG+++ Q+              K A  +F  ++ E N+L +G A
Sbjct: 682 LCTGGEDGVINVWDIGTGKRLKQMRGH----------GKNAIHSF-SFNKEGNILISGGA 730

Query: 100 DGVIKIWDL 108
           D  +++WDL
Sbjct: 731 DHSVRVWDL 739

>ZYRO0D01122g Chr4 complement(86927..88327) [1401 bp, 466 aa] {ON}
           similar to uniprot|P20053 Saccharomyces cerevisiae
           YPR178W PRP4 Splicing factor component of the U4/U6-U5
           snRNP complex
          Length = 466

 Score = 89.4 bits (220), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 74/314 (23%), Positives = 132/314 (42%), Gaps = 25/314 (7%)

Query: 377 LKLHTIDLHGQRT----DIRSTSISDDNKLLATAS-NGSLKIWNIKTKRCIRS---FECG 428
           +K   I+L G +      +   S+S +  L+A AS  G L I N +T   +++      G
Sbjct: 165 MKTKNIELMGSQVVSTRPVSQVSLSPNGSLVAAASWAGDLTILNSQTLEILQNKPQIHMG 224

Query: 429 YALTCKFLPGGALVVVGTRNGELQLFDIASSTMLDNKE-GAHDAAIWSLDLTSDGRKLVT 487
                 + P G L+  G   G ++LF   S+T+ +      H+  +        GR + +
Sbjct: 225 KIGGIHWSPTGDLITAGGEEGSVKLFGYKSNTLEEMATLNGHENRVTDSKFHPSGRFIAS 284

Query: 488 GSADKTVRFWTFEVSEVPVSDESNKTMPMLQLFHDTTLELDDDILSVVISPDDKFIAVSL 547
            S D T R W  E  E            +LQ  H        ++ S+    D   +    
Sbjct: 285 ASFDMTWRLWDVETQE----------ELLLQEGHGK------ELYSLGFQCDGSLVCSGG 328

Query: 548 LDNTVKVFFLDSMKFFLSLYGHKLPVLSMDISYDSKLIVTCSADKNIKIWGLDFGDCHKS 607
           +D    V+ + S K  +SL GH  P+ S+D S +   + T S D  I+IW L   + +++
Sbjct: 329 IDCKGLVWDIRSGKRAMSLSGHTKPIYSLDWSPNGYQVATGSGDGTIRIWDLRKPEEYQT 388

Query: 608 LFAHQDSIMNVKFLPESYNFFSCSKDATVKYWDGQKFECIQKLAAHQSEVWSISVSNDGT 667
           + AH+  +  V F        S   D ++  +    +  +  L  H  ++  + +S + +
Sbjct: 389 ILAHKSIVTKVAFEKNGNCLVSSGYDKSINLYGAYNWAQLTTLQGHMDKILCVDISENAS 448

Query: 668 FVISTGHDHSIRVW 681
            V+S G D S+++W
Sbjct: 449 SVVSCGWDRSVKLW 462

 Score = 62.4 bits (150), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 34/119 (28%), Positives = 56/119 (47%), Gaps = 1/119 (0%)

Query: 86  KYHPETNLLAAGYADGVIKIWDLISKTVLISFNGHKSAITVLAFDTTGTRLISASKDSDI 145
           K+HP    +A+   D   ++WD+ ++  L+   GH   +  L F   G+ + S   D   
Sbjct: 274 KFHPSGRFIASASFDMTWRLWDVETQEELLLQEGHGKELYSLGFQCDGSLVCSGGIDCKG 333

Query: 146 IVWDLVGESGLYKLRSHKDAITGL-WCEDENWLISTSKDGLVKIWDLKSQQCVETHLAH 203
           +VWD+        L  H   I  L W  +   + + S DG ++IWDL+  +  +T LAH
Sbjct: 334 LVWDIRSGKRAMSLSGHTKPIYSLDWSPNGYQVATGSGDGTIRIWDLRKPEEYQTILAH 392

 Score = 62.0 bits (149), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 45/155 (29%), Positives = 74/155 (47%), Gaps = 14/155 (9%)

Query: 41  VIVGGLE-NILVWDIKTGEQIAQLTDGLPPGASDAKLSKPAETTFLKYHPETNLLAAGYA 99
           V  GG++   LVWDI++G++   L+    P  S            L + P    +A G  
Sbjct: 324 VCSGGIDCKGLVWDIRSGKRAMSLSGHTKPIYS------------LDWSPNGYQVATGSG 371

Query: 100 DGVIKIWDLISKTVLISFNGHKSAITVLAFDTTGTRLISASKDSDIIVWDLVGESGLYKL 159
           DG I+IWDL       +   HKS +T +AF+  G  L+S+  D  I ++     + L  L
Sbjct: 372 DGTIRIWDLRKPEEYQTILAHKSIVTKVAFEKNGNCLVSSGYDKSINLYGAYNWAQLTTL 431

Query: 160 RSHKDAITGL-WCEDENWLISTSKDGLVKIWDLKS 193
           + H D I  +   E+ + ++S   D  VK+W +++
Sbjct: 432 QGHMDKILCVDISENASSVVSCGWDRSVKLWTMQN 466

 Score = 55.1 bits (131), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 45/184 (24%), Positives = 83/184 (45%), Gaps = 15/184 (8%)

Query: 51  VWDIKTGEQIAQLTDGLPPGASDAKLSKPAETTFLKYHPETNLLAAGYADGVIKIWDLIS 110
           +WD++T E++  L +G              E   L +  + +L+ +G  D    +WD+ S
Sbjct: 293 LWDVETQEELL-LQEG-----------HGKELYSLGFQCDGSLVCSGGIDCKGLVWDIRS 340

Query: 111 KTVLISFNGHKSAITVLAFDTTGTRLISASKDSDIIVWDLVGESGLYKLRSHKDAITGLW 170
               +S +GH   I  L +   G ++ + S D  I +WDL        + +HK  +T + 
Sbjct: 341 GKRAMSLSGHTKPIYSLDWSPNGYQVATGSGDGTIRIWDLRKPEEYQTILAHKSIVTKVA 400

Query: 171 CE-DENWLISTSKDGLVKIWDLKSQQCVETHLAHTGECWSLGIIEDMA--VTCSADSQVK 227
            E + N L+S+  D  + ++   +   + T   H  +   + I E+ +  V+C  D  VK
Sbjct: 401 FEKNGNCLVSSGYDKSINLYGAYNWAQLTTLQGHMDKILCVDISENASSVVSCGWDRSVK 460

Query: 228 LWKL 231
           LW +
Sbjct: 461 LWTM 464

 Score = 53.9 bits (128), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 44/171 (25%), Positives = 78/171 (45%), Gaps = 7/171 (4%)

Query: 85  LKYHPETNLLAAGYADGVIKIWDLISKTV--LISFNGHKSAITVLAFDTTGTRLISASKD 142
           + + P  +L+ AG  +G +K++   S T+  + + NGH++ +T   F  +G  + SAS D
Sbjct: 229 IHWSPTGDLITAGGEEGSVKLFGYKSNTLEEMATLNGHENRVTDSKFHPSGRFIASASFD 288

Query: 143 SDIIVWDLVGESGLYKLRSHKDAI--TGLWCEDENWLISTSKDGLVKIWDLKSQQCVETH 200
               +WD+  +  L     H   +   G  C D + + S   D    +WD++S +   + 
Sbjct: 289 MTWRLWDVETQEELLLQEGHGKELYSLGFQC-DGSLVCSGGIDCKGLVWDIRSGKRAMSL 347

Query: 201 LAHTGECWSLGIIED--MAVTCSADSQVKLWKLDLQAENGSKLTEKGIIEK 249
             HT   +SL    +     T S D  +++W L    E  + L  K I+ K
Sbjct: 348 SGHTKPIYSLDWSPNGYQVATGSGDGTIRIWDLRKPEEYQTILAHKSIVTK 398

 Score = 41.6 bits (96), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 27/101 (26%), Positives = 46/101 (45%), Gaps = 2/101 (1%)

Query: 584 LIVTCSADKNIKIWGLDFGDCHK--SLFAHQDSIMNVKFLPESYNFFSCSKDATVKYWDG 641
           LI     + ++K++G       +  +L  H++ + + KF P      S S D T + WD 
Sbjct: 237 LITAGGEEGSVKLFGYKSNTLEEMATLNGHENRVTDSKFHPSGRFIASASFDMTWRLWDV 296

Query: 642 QKFECIQKLAAHQSEVWSISVSNDGTFVISTGHDHSIRVWE 682
           +  E +     H  E++S+    DG+ V S G D    VW+
Sbjct: 297 ETQEELLLQEGHGKELYSLGFQCDGSLVCSGGIDCKGLVWD 337

 Score = 32.3 bits (72), Expect = 6.5,   Method: Compositional matrix adjust.
 Identities = 22/92 (23%), Positives = 45/92 (48%), Gaps = 5/92 (5%)

Query: 611 HQDSIMNVKFLPESYNFFSCSKDATVKYWDGQKFECIQKLA---AHQSEVWSISVSNDGT 667
           H   I  + + P      +  ++ +VK + G K   ++++A    H++ V        G 
Sbjct: 222 HMGKIGGIHWSPTGDLITAGGEEGSVKLF-GYKSNTLEEMATLNGHENRVTDSKFHPSGR 280

Query: 668 FVISTGHDHSIRVWE-ETEDQVFLEEEREKEM 698
           F+ S   D + R+W+ ET++++ L+E   KE+
Sbjct: 281 FIASASFDMTWRLWDVETQEELLLQEGHGKEL 312

>Ecym_7038 Chr7 (80529..82931) [2403 bp, 800 aa] {ON} similar to
           Ashbya gossypii AEL246C
          Length = 800

 Score = 90.1 bits (222), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 52/188 (27%), Positives = 91/188 (48%), Gaps = 18/188 (9%)

Query: 517 LQLFHDTTLELDDDILSVVISPDDKFIAVSLLDNTVKVFFLDSMKF-------------F 563
           +  FH+T    + D+ S+  S D + +A    D+ +K++ LD                  
Sbjct: 465 MYTFHNT----NRDMTSLQFSEDSRLVAAGFQDSHIKIWSLDGTPLESKLPSKSKEASNT 520

Query: 564 LSLYGHKLPVLSMDISYDSKLIVTCSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLPE 623
            +L GH  PV S+  S D++ +V+ S DK +++W LD   C  S   H   + +VKF P 
Sbjct: 521 TTLIGHSGPVYSVSFSPDNRYLVSASEDKTVRLWSLDTFTCLVSYKGHNHPVWDVKFSPL 580

Query: 624 SYNFFSCSKDATVKYWDGQKFECIQKLAAHQSEVWSISVSNDGTFVISTGHDHSIRVWE- 682
            + F + S D T + W       ++  A H ++V  ++   +GT+V++   D + R+W+ 
Sbjct: 581 GHYFATVSHDQTARLWSCDHIYPLRIFAGHLNDVDCVAFHPNGTYVLTGSSDKTCRMWDI 640

Query: 683 ETEDQVFL 690
           +T D V L
Sbjct: 641 QTGDSVRL 648

 Score = 87.0 bits (214), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 71/301 (23%), Positives = 128/301 (42%), Gaps = 46/301 (15%)

Query: 384 LHGQRTDIRSTSISDDNKLLATA-SNGSLKIWNIKTKRCIRSFECGYALTCKFLPGGALV 442
            H    D+ S   S+D++L+A    +  +KIW++           G  L  K LP  +  
Sbjct: 468 FHNTNRDMTSLQFSEDSRLVAAGFQDSHIKIWSLD----------GTPLESK-LPSKSKE 516

Query: 443 VVGTRNGELQLFDIASSTMLDNKEGAHDAAIWSLDLTSDGRKLVTGSADKTVRFWTFEVS 502
              T            +T++      H   ++S+  + D R LV+ S DKTVR W+ +  
Sbjct: 517 ASNT------------TTLI-----GHSGPVYSVSFSPDNRYLVSASEDKTVRLWSLDTF 559

Query: 503 EVPVSDESNKTMPMLQLFHDTTLELDDDILSVVISPDDKFIAVSLLDNTVKVFFLDSMKF 562
              VS + +                +  +  V  SP   + A    D T +++  D +  
Sbjct: 560 TCLVSYKGH----------------NHPVWDVKFSPLGHYFATVSHDQTARLWSCDHIYP 603

Query: 563 FLSLYGHKLPVLSMDISYDSKLIVTCSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLP 622
                GH   V  +    +   ++T S+DK  ++W +  GD  +    H  S+++V   P
Sbjct: 604 LRIFAGHLNDVDCVAFHPNGTYVLTGSSDKTCRMWDIQTGDSVRLFLGHTASVVSVAVSP 663

Query: 623 ESYNFFSCSKDATVKYWDGQKFECIQKLAAH-QSEVWSISVSNDGTFVISTGHDHSIRVW 681
           +     + S+D  +  WD    + I+++  H +S V S+S + +G  ++S G D S+RVW
Sbjct: 664 DGRWLTTGSEDGVIIVWDIGTGKRIKQMRGHGKSAVNSLSFNKEGNILVSGGADQSVRVW 723

Query: 682 E 682
           +
Sbjct: 724 D 724

 Score = 62.8 bits (151), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 33/110 (30%), Positives = 59/110 (53%), Gaps = 2/110 (1%)

Query: 85  LKYHPETNLLAAGYADGVIKIWDLISKTVLISFNGHKSAITVLAFDTTGTRLISASKDSD 144
           + +HP    +  G +D   ++WD+ +   +  F GH +++  +A    G  L + S+D  
Sbjct: 617 VAFHPNGTYVLTGSSDKTCRMWDIQTGDSVRLFLGHTASVVSVAVSPDGRWLTTGSEDGV 676

Query: 145 IIVWDLVGESGLYKLRSH-KDAITGL-WCEDENWLISTSKDGLVKIWDLK 192
           IIVWD+     + ++R H K A+  L + ++ N L+S   D  V++WDLK
Sbjct: 677 IIVWDIGTGKRIKQMRGHGKSAVNSLSFNKEGNILVSGGADQSVRVWDLK 726

 Score = 61.2 bits (147), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 54/225 (24%), Positives = 105/225 (46%), Gaps = 23/225 (10%)

Query: 380 HTIDLHGQRTDIRSTSISDDNKLLATAS-NGSLKIWNIKTKRCIRSFECGYALTC---KF 435
           +T  L G    + S S S DN+ L +AS + ++++W++ T  C+ S++ G+       KF
Sbjct: 519 NTTTLIGHSGPVYSVSFSPDNRYLVSASEDKTVRLWSLDTFTCLVSYK-GHNHPVWDVKF 577

Query: 436 LPGGALVVVGTRNGELQLFDIASSTMLDNKEGAHDAAIWSLDLTSDGRKLVTGSADKTVR 495
            P G      + +   +L+       L    G H   +  +    +G  ++TGS+DKT R
Sbjct: 578 SPLGHYFATVSHDQTARLWSCDHIYPLRIFAG-HLNDVDCVAFHPNGTYVLTGSSDKTCR 636

Query: 496 FWTFEVSEVPVSDESNKTMPMLQLFHDTTLELDDDILSVVISPDDKFIAVSLLDNTVKVF 555
            W  +  +             ++LF   T      ++SV +SPD +++     D  + V+
Sbjct: 637 MWDIQTGD------------SVRLFLGHTAS----VVSVAVSPDGRWLTTGSEDGVIIVW 680

Query: 556 FLDSMKFFLSLYGH-KLPVLSMDISYDSKLIVTCSADKNIKIWGL 599
            + + K    + GH K  V S+  + +  ++V+  AD+++++W L
Sbjct: 681 DIGTGKRIKQMRGHGKSAVNSLSFNKEGNILVSGGADQSVRVWDL 725

 Score = 57.0 bits (136), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 41/180 (22%), Positives = 75/180 (41%), Gaps = 11/180 (6%)

Query: 85  LKYHPETNLLAAGYADGVIKIWDLISKTVLISFNGHKSAITVLAFDTTGTRLISASKDSD 144
           +K+ P  +  A    D   ++W       L  F GH + +  +AF   GT +++ S D  
Sbjct: 575 VKFSPLGHYFATVSHDQTARLWSCDHIYPLRIFAGHLNDVDCVAFHPNGTYVLTGSSDKT 634

Query: 145 IIVWDL-VGESGLYKLRSHKDAITGLWCEDENWLISTSKDGLVKIWDLKSQQCVETHLAH 203
             +WD+  G+S    L      ++     D  WL + S+DG++ +WD+ + + ++    H
Sbjct: 635 CRMWDIQTGDSVRLFLGHTASVVSVAVSPDGRWLTTGSEDGVIIVWDIGTGKRIKQMRGH 694

Query: 204 TGEC---WSLGIIEDMAVTCSADSQVKLWKLDLQAENGSKLTEKGIIEKQSKQRGVEIDF 260
                   S     ++ V+  AD  V++W L        K T +  +E +    G   D 
Sbjct: 695 GKSAVNSLSFNKEGNILVSGGADQSVRVWDL-------KKFTNEPALEPEQPYSGYSGDM 747

 Score = 56.2 bits (134), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 33/153 (21%), Positives = 65/153 (42%), Gaps = 9/153 (5%)

Query: 85  LKYHPETNLLAAGYADGVIKIWDLISKTVLISFNGHKSAITVLAFDTTGTRLISASKDSD 144
           + + P+   L +   D  +++W L + T L+S+ GH   +  + F   G    + S D  
Sbjct: 533 VSFSPDNRYLVSASEDKTVRLWSLDTFTCLVSYKGHNHPVWDVKFSPLGHYFATVSHDQT 592

Query: 145 IIVWDLVGESGLYKLRSHKDAITGLWC----EDENWLISTSKDGLVKIWDLKSQQCVETH 200
             +W       +Y LR     +  + C     +  ++++ S D   ++WD+++   V   
Sbjct: 593 ARLWSC---DHIYPLRIFAGHLNDVDCVAFHPNGTYVLTGSSDKTCRMWDIQTGDSVRLF 649

Query: 201 LAHTGECWSLGIIEDMA--VTCSADSQVKLWKL 231
           L HT    S+ +  D     T S D  + +W +
Sbjct: 650 LGHTASVVSVAVSPDGRWLTTGSEDGVIIVWDI 682

 Score = 53.5 bits (127), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 31/101 (30%), Positives = 46/101 (45%), Gaps = 13/101 (12%)

Query: 51  VWDIKTGEQIAQLTDGLPPGASDAKLSKPAETTFLKYHPETNLLAAGYADGVIKIWDLIS 110
           +WDI+TG+ +               L   A    +   P+   L  G  DGVI +WD+ +
Sbjct: 637 MWDIQTGDSVRLF------------LGHTASVVSVAVSPDGRWLTTGSEDGVIIVWDIGT 684

Query: 111 KTVLISFNGH-KSAITVLAFDTTGTRLISASKDSDIIVWDL 150
              +    GH KSA+  L+F+  G  L+S   D  + VWDL
Sbjct: 685 GKRIKQMRGHGKSAVNSLSFNKEGNILVSGGADQSVRVWDL 725

 Score = 49.7 bits (117), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 41/155 (26%), Positives = 67/155 (43%), Gaps = 32/155 (20%)

Query: 81  ETTFLKYHPETNLLAAGYADGVIKIWDLISKTVLISFNGHKSAITVLAFDTTGTRLISAS 140
           + T L++  ++ L+AAG+ D  IKIW L   T L S                  +L S S
Sbjct: 474 DMTSLQFSEDSRLVAAGFQDSHIKIWSL-DGTPLES------------------KLPSKS 514

Query: 141 KDSDIIVWDLVGESG-LYKLRSHKDAITGLWCEDENWLISTSKDGLVKIWDLKSQQCVET 199
           K++      L+G SG +Y +          +  D  +L+S S+D  V++W L +  C+ +
Sbjct: 515 KEASNTT-TLIGHSGPVYSVS---------FSPDNRYLVSASEDKTVRLWSLDTFTCLVS 564

Query: 200 HLAHTGECWSLGI--IEDMAVTCSADSQVKLWKLD 232
           +  H    W +    +     T S D   +LW  D
Sbjct: 565 YKGHNHPVWDVKFSPLGHYFATVSHDQTARLWSCD 599

 Score = 38.9 bits (89), Expect = 0.068,   Method: Compositional matrix adjust.
 Identities = 26/86 (30%), Positives = 43/86 (50%), Gaps = 18/86 (20%)

Query: 23  SVWIEPEASKRKTGNLGQVIVGGLENILVWDIKTGEQIAQLTDGLPPGASDAKLSKPAET 82
           SV + P+     TG+   VI+       VWDI TG++I Q+      G   + ++     
Sbjct: 658 SVAVSPDGRWLTTGSEDGVII-------VWDIGTGKRIKQMR-----GHGKSAVNS---- 701

Query: 83  TFLKYHPETNLLAAGYADGVIKIWDL 108
             L ++ E N+L +G AD  +++WDL
Sbjct: 702 --LSFNKEGNILVSGGADQSVRVWDL 725

>Kwal_23.5351 s23 (1122565..1123989) [1425 bp, 474 aa] {ON} YPR178W
           (PRP4) - associated with the U4/U6 snRNP [contig 8] FULL
          Length = 474

 Score = 88.6 bits (218), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 61/245 (24%), Positives = 110/245 (44%), Gaps = 13/245 (5%)

Query: 437 PGGALVVVGTRNGELQLFDIASSTMLDNKEGAHDAAIWSLDLTSDGRKLVTGSADKTVRF 496
           P GA +  G+ NG++++    S  ++ + +GAHD  I  +  +SD + L TG AD  V+ 
Sbjct: 192 PDGASLAAGSWNGDVKILHPQSLEVVRSLDGAHDDKIGGVAWSSDSQLLATGGADNLVKI 251

Query: 497 WTFEVSEVPVSDESNKTMPMLQLFHDTTLELDDDILSVVISPDDKFIAVSLLDNTVKVFF 556
           W       P +   ++   ++   H+        +  V   P D+F+A +  D T +++ 
Sbjct: 252 WN------PQAQSHSEASRVVLRGHEAR------VSKVKFHPSDRFVASASFDMTWRLWD 299

Query: 557 LDSMKFFLSLYGHKLPVLSMDISYDSKLIVTCSADKNIKIWGLDFGDCHKSLFAHQDSIM 616
           ++         GH   V  +D   D  L+ +   D    +W +  G     L  H   I 
Sbjct: 300 VERETELQLQEGHAKEVYCLDFQCDGSLLCSAGLDSVGHVWDMRTGRSLMVLEGHAKPIY 359

Query: 617 NVKFLPESYNFFSCSKDATVKYWDGQKFECIQKLAAHQSEVWSISVSN-DGTFVISTGHD 675
            V + P  ++  + S D TV+ WD +K      + AH S V  ++    +G F++S+ +D
Sbjct: 360 GVSWSPNGHHVATGSGDGTVQVWDIRKANKPSSILAHNSIVSEVNFEKENGNFLVSSSYD 419

Query: 676 HSIRV 680
            +I V
Sbjct: 420 RTIGV 424

 Score = 63.9 bits (154), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 38/126 (30%), Positives = 60/126 (47%), Gaps = 1/126 (0%)

Query: 80  AETTFLKYHPETNLLAAGYADGVIKIWDLISKTVLISFNGHKSAITVLAFDTTGTRLISA 139
           A  + +K+HP    +A+   D   ++WD+  +T L    GH   +  L F   G+ L SA
Sbjct: 272 ARVSKVKFHPSDRFVASASFDMTWRLWDVERETELQLQEGHAKEVYCLDFQCDGSLLCSA 331

Query: 140 SKDSDIIVWDLVGESGLYKLRSHKDAITGL-WCEDENWLISTSKDGLVKIWDLKSQQCVE 198
             DS   VWD+     L  L  H   I G+ W  + + + + S DG V++WD++      
Sbjct: 332 GLDSVGHVWDMRTGRSLMVLEGHAKPIYGVSWSPNGHHVATGSGDGTVQVWDIRKANKPS 391

Query: 199 THLAHT 204
           + LAH 
Sbjct: 392 SILAHN 397

 Score = 63.5 bits (153), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 46/168 (27%), Positives = 72/168 (42%), Gaps = 5/168 (2%)

Query: 520 FHDTTLELDDDILSVVISPDDKFIAVSLLDNTVKVFFLDSMKFFLSLYG-HKLPVLSMDI 578
            H + +     +  V  SPD   +A    +  VK+    S++   SL G H   +  +  
Sbjct: 174 LHGSQVVFSRPVSQVARSPDGASLAAGSWNGDVKILHPQSLEVVRSLDGAHDDKIGGVAW 233

Query: 579 SYDSKLIVTCSADKNIKIWGLDFGDCHKS----LFAHQDSIMNVKFLPESYNFFSCSKDA 634
           S DS+L+ T  AD  +KIW        ++    L  H+  +  VKF P      S S D 
Sbjct: 234 SSDSQLLATGGADNLVKIWNPQAQSHSEASRVVLRGHEARVSKVKFHPSDRFVASASFDM 293

Query: 635 TVKYWDGQKFECIQKLAAHQSEVWSISVSNDGTFVISTGHDHSIRVWE 682
           T + WD ++   +Q    H  EV+ +    DG+ + S G D    VW+
Sbjct: 294 TWRLWDVERETELQLQEGHAKEVYCLDFQCDGSLLCSAGLDSVGHVWD 341

 Score = 56.2 bits (134), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 60/252 (23%), Positives = 102/252 (40%), Gaps = 27/252 (10%)

Query: 397 SDDNKLLATASNGSL-KIWNIK-------TKRCIRSFECGYALTCKFLPGGALVVVGTRN 448
           S D++LLAT    +L KIWN +       ++  +R  E   +   KF P    V   + +
Sbjct: 234 SSDSQLLATGGADNLVKIWNPQAQSHSEASRVVLRGHEARVS-KVKFHPSDRFVASASFD 292

Query: 449 GELQLFDIASSTMLDNKEGAHDAAIWSLDLTSDGRKLVTGSADKTVRFWTFEVSEVPVSD 508
              +L+D+   T L  +EG H   ++ LD   DG  L +   D     W           
Sbjct: 293 MTWRLWDVERETELQLQEG-HAKEVYCLDFQCDGSLLCSAGLDSVGHVWDMR-------- 343

Query: 509 ESNKTMPMLQLFHDTTLELDDDILSVVISPDDKFIAVSLLDNTVKVFFLDSMKFFLSLYG 568
            + +++ +L+            I  V  SP+   +A    D TV+V+ +       S+  
Sbjct: 344 -TGRSLMVLEGHAKP-------IYGVSWSPNGHHVATGSGDGTVQVWDIRKANKPSSILA 395

Query: 569 HKLPVLSMDISYDS-KLIVTCSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLPESYNF 627
           H   V  ++   ++   +V+ S D+ I ++         SL  H D I++V       N 
Sbjct: 396 HNSIVSEVNFEKENGNFLVSSSYDRTIGVFATGSWIKLASLQGHTDKILSVDISRGGANL 455

Query: 628 FSCSKDATVKYW 639
           +S   D +VK W
Sbjct: 456 WSSGWDRSVKIW 467

 Score = 54.3 bits (129), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 63/283 (22%), Positives = 122/283 (43%), Gaps = 36/283 (12%)

Query: 326 FQVVRS-----PYKIKSAQWTVCSNSKLELVVTTSNNSIEYYSIPYSKREPTQPAPLKLH 380
            +VVRS       KI    W+  S+S+L L    ++N ++ ++       P   +  +  
Sbjct: 214 LEVVRSLDGAHDDKIGGVAWS--SDSQL-LATGGADNLVKIWN-------PQAQSHSEAS 263

Query: 381 TIDLHGQRTDIRSTSISDDNKLLATAS-NGSLKIWNIKTKRCIRSFECGYA--LTC-KFL 436
            + L G    +        ++ +A+AS + + ++W+++ +  ++  + G+A  + C  F 
Sbjct: 264 RVVLRGHEARVSKVKFHPSDRFVASASFDMTWRLWDVERETELQ-LQEGHAKEVYCLDFQ 322

Query: 437 PGGALVVVGTRNGELQLFDIASSTMLDNKEGAHDAAIWSLDLTSDGRKLVTGSADKTVRF 496
             G+L+     +    ++D+ +   L   EG H   I+ +  + +G  + TGS D TV+ 
Sbjct: 323 CDGSLLCSAGLDSVGHVWDMRTGRSLMVLEG-HAKPIYGVSWSPNGHHVATGSGDGTVQV 381

Query: 497 WTFEVSEVPVSDESNKTMPMLQLFHDTTLELDDDILSVVISPDDKFIAVSLLDNTVKVFF 556
           W    +  P S      +    +  +   E ++            F+  S  D T+ VF 
Sbjct: 382 WDIRKANKPSS-----ILAHNSIVSEVNFEKENG----------NFLVSSSYDRTIGVFA 426

Query: 557 LDSMKFFLSLYGHKLPVLSMDISYDSKLIVTCSADKNIKIWGL 599
             S     SL GH   +LS+DIS     + +   D+++KIW L
Sbjct: 427 TGSWIKLASLQGHTDKILSVDISRGGANLWSSGWDRSVKIWAL 469

 Score = 49.7 bits (117), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 38/159 (23%), Positives = 74/159 (46%), Gaps = 4/159 (2%)

Query: 81  ETTFLKYHPETNLLAAGYADGVIKIWDLISKTVLISFNGHKSAITVLAFDTTGTRLISAS 140
           E   L +  + +LL +   D V  +WD+ +   L+   GH   I  +++   G  + + S
Sbjct: 315 EVYCLDFQCDGSLLCSAGLDSVGHVWDMRTGRSLMVLEGHAKPIYGVSWSPNGHHVATGS 374

Query: 141 KDSDIIVWDLVGESGLYKLRSHKDAITGLWCEDE--NWLISTSKDGLVKIWDLKSQQCVE 198
            D  + VWD+   +    + +H   ++ +  E E  N+L+S+S D  + ++   S   + 
Sbjct: 375 GDGTVQVWDIRKANKPSSILAHNSIVSEVNFEKENGNFLVSSSYDRTIGVFATGSWIKLA 434

Query: 199 THLAHTGECWSLGIIEDMAVTCSA--DSQVKLWKLDLQA 235
           +   HT +  S+ I    A   S+  D  VK+W L +++
Sbjct: 435 SLQGHTDKILSVDISRGGANLWSSGWDRSVKIWALGVRS 473

 Score = 48.9 bits (115), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 53/223 (23%), Positives = 93/223 (41%), Gaps = 29/223 (13%)

Query: 70  GASDAKLSKPAETTFLKYHPETNLLAAGYADGVIKIWDLI----SKTVLISFNGHKSAIT 125
           GA D K+   A      +  ++ LLA G AD ++KIW+      S+   +   GH++ ++
Sbjct: 222 GAHDDKIGGVA------WSSDSQLLATGGADNLVKIWNPQAQSHSEASRVVLRGHEARVS 275

Query: 126 VLAFDTTGTRLISASKDSDIIVWDLVGESGLYKLRSHKDAITGL--WCEDENWLISTSKD 183
            + F  +   + SAS D    +WD+  E+ L     H   +  L   C D + L S   D
Sbjct: 276 KVKFHPSDRFVASASFDMTWRLWDVERETELQLQEGHAKEVYCLDFQC-DGSLLCSAGLD 334

Query: 184 GLVKIWDLKSQQCVETHLAHT----GECWSLGIIEDMAVTCSADSQVKLWKLDLQAENGS 239
            +  +WD+++ + +     H     G  WS         T S D  V++W +    +  S
Sbjct: 335 SVGHVWDMRTGRSLMVLEGHAKPIYGVSWSPN--GHHVATGSGDGTVQVWDIRKANKPSS 392

Query: 240 KLTEKGIIEKQSKQRGVEIDFAVAPDGVKFFYIQNADKTIEIY 282
            L    I+         E++F    +   F    + D+TI ++
Sbjct: 393 ILAHNSIVS--------EVNF--EKENGNFLVSSSYDRTIGVF 425

>TDEL0H00370 Chr8 complement(57487..58884) [1398 bp, 465 aa] {ON}
           Anc_7.534 YPR178W
          Length = 465

 Score = 88.2 bits (217), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 66/251 (26%), Positives = 109/251 (43%), Gaps = 15/251 (5%)

Query: 432 TCKFLPGGALVVVGTRNGELQLFDIASSTMLDNKEGAHDAAIWSLDLTSDGRKLVTGSAD 491
           + KF P    + VG+ +G ++     S  +  + E AH   +  +D  S G  L TG  D
Sbjct: 183 SVKFSPDDKHLAVGSWDGGIKTISAGSLNIKSSVENAHTGKVGEVDWNSSGDLLATGGED 242

Query: 492 KTVRFWTFEVSEVPVSDESNKTMPMLQLFHDTTLELDDDILSVVISPDDKFIAVSLLDNT 551
             V+ +T +  E+       + +  LQ  H+        +      P  ++IA +  DNT
Sbjct: 243 GLVKLFTVQSGEL-------RQVADLQ-GHERR------VAGCRFHPFGRYIASASFDNT 288

Query: 552 VKVFFLDSMKFFLSLYGHKLPVLSMDISYDSKLIVTCSADKNIKIWGLDFGDCHKSLFAH 611
            +++  ++    L   GH   V  +    D  L+ +   D    IW +  G+C   L  H
Sbjct: 289 WRLWDAETNHELLLQEGHGKEVFCLAFQSDGSLLCSAGLDCTGMIWDIRSGNCAMVLSGH 348

Query: 612 QDSIMNVKFLPESYNFFSCSKDATVKYWDGQKFECIQKLAAHQSEVWSISV-SNDGTFVI 670
              I +V + P  +   + S D TV  WD +K    Q L AH S V  I    ++G F++
Sbjct: 349 TKPIYSVDWSPRGFEVATASGDGTVNIWDIRKTNQPQVLLAHNSIVSGIRFEKHNGKFLM 408

Query: 671 STGHDHSIRVW 681
           S G+D +I V+
Sbjct: 409 SCGYDKNINVY 419

 Score = 76.6 bits (187), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 67/297 (22%), Positives = 120/297 (40%), Gaps = 22/297 (7%)

Query: 391 IRSTSISDDNKLLATAS-NGSLKI---WNIKTKRCIRSFECGYALTCKFLPGGALVVVGT 446
           I S   S D+K LA  S +G +K     ++  K  + +   G      +   G L+  G 
Sbjct: 181 ISSVKFSPDDKHLAVGSWDGGIKTISAGSLNIKSSVENAHTGKVGEVDWNSSGDLLATGG 240

Query: 447 RNGELQLFDIASSTMLDNKE-GAHDAAIWSLDLTSDGRKLVTGSADKTVRFWTFEVSEVP 505
            +G ++LF + S  +    +   H+  +        GR + + S D T R W        
Sbjct: 241 EDGLVKLFTVQSGELRQVADLQGHERRVAGCRFHPFGRYIASASFDNTWRLW-------- 292

Query: 506 VSDESNKTMPMLQLFHDTTLELDDDILSVVISPDDKFIAVSLLDNTVKVFFLDSMKFFLS 565
              E+N  + +LQ  H        ++  +    D   +  + LD T  ++ + S    + 
Sbjct: 293 -DAETNHEL-LLQEGHGK------EVFCLAFQSDGSLLCSAGLDCTGMIWDIRSGNCAMV 344

Query: 566 LYGHKLPVLSMDISYDSKLIVTCSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLPESY 625
           L GH  P+ S+D S     + T S D  + IW +   +  + L AH   +  ++F   + 
Sbjct: 345 LSGHTKPIYSVDWSPRGFEVATASGDGTVNIWDIRKTNQPQVLLAHNSIVSGIRFEKHNG 404

Query: 626 NFF-SCSKDATVKYWDGQKFECIQKLAAHQSEVWSISVSNDGTFVISTGHDHSIRVW 681
            F  SC  D  +  + G  +  I  L  H  ++ ++ +      V+S G D S++ W
Sbjct: 405 KFLMSCGYDKNINVYSGDSWNKITILKGHTDKILALDLGTHDGSVVSAGWDRSVKSW 461

 Score = 58.2 bits (139), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 41/155 (26%), Positives = 69/155 (44%), Gaps = 3/155 (1%)

Query: 531 ILSVVISPDDKFIAVSLLDNTVKVFFLDSMKFFLSL-YGHKLPVLSMDISYDSKLIVTCS 589
           I SV  SPDDK +AV   D  +K     S+    S+   H   V  +D +    L+ T  
Sbjct: 181 ISSVKFSPDDKHLAVGSWDGGIKTISAGSLNIKSSVENAHTGKVGEVDWNSSGDLLATGG 240

Query: 590 ADKNIKIWGLDFGDCHK--SLFAHQDSIMNVKFLPESYNFFSCSKDATVKYWDGQKFECI 647
            D  +K++ +  G+  +   L  H+  +   +F P      S S D T + WD +    +
Sbjct: 241 EDGLVKLFTVQSGELRQVADLQGHERRVAGCRFHPFGRYIASASFDNTWRLWDAETNHEL 300

Query: 648 QKLAAHQSEVWSISVSNDGTFVISTGHDHSIRVWE 682
                H  EV+ ++  +DG+ + S G D +  +W+
Sbjct: 301 LLQEGHGKEVFCLAFQSDGSLLCSAGLDCTGMIWD 335

 Score = 57.8 bits (138), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 49/203 (24%), Positives = 85/203 (41%), Gaps = 25/203 (12%)

Query: 15  GVISSNSNSVWIEPEASKRKTGNLGQV--------IVGGLENILV--WDIKTGE--QIAQ 62
           G+ + ++ S+ I+       TG +G+V        +  G E+ LV  + +++GE  Q+A 
Sbjct: 201 GIKTISAGSLNIKSSVENAHTGKVGEVDWNSSGDLLATGGEDGLVKLFTVQSGELRQVAD 260

Query: 63  LTDGLPPGASDAKLSKPAETTFLKYHPETNLLAAGYADGVIKIWDLISKTVLISFNGHKS 122
           L                      ++HP    +A+   D   ++WD  +   L+   GH  
Sbjct: 261 LQ------------GHERRVAGCRFHPFGRYIASASFDNTWRLWDAETNHELLLQEGHGK 308

Query: 123 AITVLAFDTTGTRLISASKDSDIIVWDLVGESGLYKLRSHKDAITGL-WCEDENWLISTS 181
            +  LAF + G+ L SA  D   ++WD+   +    L  H   I  + W      + + S
Sbjct: 309 EVFCLAFQSDGSLLCSAGLDCTGMIWDIRSGNCAMVLSGHTKPIYSVDWSPRGFEVATAS 368

Query: 182 KDGLVKIWDLKSQQCVETHLAHT 204
            DG V IWD++     +  LAH 
Sbjct: 369 GDGTVNIWDIRKTNQPQVLLAHN 391

 Score = 49.7 bits (117), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 37/156 (23%), Positives = 67/156 (42%), Gaps = 4/156 (2%)

Query: 81  ETTFLKYHPETNLLAAGYADGVIKIWDLISKTVLISFNGHKSAITVLAFDTTGTRLISAS 140
           E   L +  + +LL +   D    IWD+ S    +  +GH   I  + +   G  + +AS
Sbjct: 309 EVFCLAFQSDGSLLCSAGLDCTGMIWDIRSGNCAMVLSGHTKPIYSVDWSPRGFEVATAS 368

Query: 141 KDSDIIVWDLVGESGLYKLRSHKDAITGLWCEDEN--WLISTSKDGLVKIWDLKSQQCVE 198
            D  + +WD+   +    L +H   ++G+  E  N  +L+S   D  + ++   S   + 
Sbjct: 369 GDGTVNIWDIRKTNQPQVLLAHNSIVSGIRFEKHNGKFLMSCGYDKNINVYSGDSWNKIT 428

Query: 199 THLAHTGECWS--LGIIEDMAVTCSADSQVKLWKLD 232
               HT +  +  LG  +   V+   D  VK W +D
Sbjct: 429 ILKGHTDKILALDLGTHDGSVVSAGWDRSVKSWNVD 464

 Score = 48.9 bits (115), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 51/223 (22%), Positives = 92/223 (41%), Gaps = 23/223 (10%)

Query: 383 DLHGQRTDIRSTSISDDNKLLATAS-NGSLKIWNIKTKRCIRSFEC-GYALTC-KFLPGG 439
           DL G    +         + +A+AS + + ++W+ +T   +   E  G  + C  F   G
Sbjct: 260 DLQGHERRVAGCRFHPFGRYIASASFDNTWRLWDAETNHELLLQEGHGKEVFCLAFQSDG 319

Query: 440 ALVVVGTRNGELQLFDIASSTMLDNKEGAHDAAIWSLDLTSDGRKLVTGSADKTVRFWTF 499
           +L+     +    ++DI S        G H   I+S+D +  G ++ T S D TV  W  
Sbjct: 320 SLLCSAGLDCTGMIWDIRSGNCAMVLSG-HTKPIYSVDWSPRGFEVATASGDGTVNIW-- 376

Query: 500 EVSEVPVSDESNKTMPMLQLFHDTTLELDDDILSVVI--SPDDKFIAVSLLDNTVKVFFL 557
                   D      P + L H++       I+S +     + KF+     D  + V+  
Sbjct: 377 --------DIRKTNQPQVLLAHNS-------IVSGIRFEKHNGKFLMSCGYDKNINVYSG 421

Query: 558 DSMKFFLSLYGHKLPVLSMDISYDSKLIVTCSADKNIKIWGLD 600
           DS      L GH   +L++D+      +V+   D+++K W +D
Sbjct: 422 DSWNKITILKGHTDKILALDLGTHDGSVVSAGWDRSVKSWNVD 464

 Score = 48.9 bits (115), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 49/209 (23%), Positives = 81/209 (38%), Gaps = 18/209 (8%)

Query: 433 CKFLPGGALVVVGTRNGELQLFDIASSTMLDNKEGAHDAAIWSLDLTSDGRKLVTGSADK 492
           C+F P G  +   + +   +L+D  ++  L  +EG H   ++ L   SDG  L +   D 
Sbjct: 271 CRFHPFGRYIASASFDNTWRLWDAETNHELLLQEG-HGKEVFCLAFQSDGSLLCSAGLDC 329

Query: 493 TVRFWTFEVSEVPVSDESNKTMPMLQLFHDTTLELDDDILSVVISPDDKFIAVSLLDNTV 552
           T   W        +   S  T P               I SV  SP    +A +  D TV
Sbjct: 330 TGMIWDIRSGNCAMV-LSGHTKP---------------IYSVDWSPRGFEVATASGDGTV 373

Query: 553 KVFFLDSMKFFLSLYGHKLPVLSMDIS-YDSKLIVTCSADKNIKIWGLDFGDCHKSLFAH 611
            ++ +        L  H   V  +    ++ K +++C  DKNI ++  D  +    L  H
Sbjct: 374 NIWDIRKTNQPQVLLAHNSIVSGIRFEKHNGKFLMSCGYDKNINVYSGDSWNKITILKGH 433

Query: 612 QDSIMNVKFLPESYNFFSCSKDATVKYWD 640
            D I+ +       +  S   D +VK W+
Sbjct: 434 TDKILALDLGTHDGSVVSAGWDRSVKSWN 462

 Score = 42.4 bits (98), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 33/145 (22%), Positives = 57/145 (39%), Gaps = 6/145 (4%)

Query: 542 FIAVSLLDNTVKVFFLDS--MKFFLSLYGHKLPVLSMDISYDSKLIVTCSADKNIKIWGL 599
            +A    D  VK+F + S  ++    L GH+  V         + I + S D   ++W  
Sbjct: 235 LLATGGEDGLVKLFTVQSGELRQVADLQGHERRVAGCRFHPFGRYIASASFDNTWRLW-- 292

Query: 600 DFGDCHKSLF--AHQDSIMNVKFLPESYNFFSCSKDATVKYWDGQKFECIQKLAAHQSEV 657
           D    H+ L    H   +  + F  +     S   D T   WD +   C   L+ H   +
Sbjct: 293 DAETNHELLLQEGHGKEVFCLAFQSDGSLLCSAGLDCTGMIWDIRSGNCAMVLSGHTKPI 352

Query: 658 WSISVSNDGTFVISTGHDHSIRVWE 682
           +S+  S  G  V +   D ++ +W+
Sbjct: 353 YSVDWSPRGFEVATASGDGTVNIWD 377

 Score = 39.7 bits (91), Expect = 0.036,   Method: Compositional matrix adjust.
 Identities = 55/250 (22%), Positives = 104/250 (41%), Gaps = 33/250 (13%)

Query: 53  DIKTGEQIAQLTDGLPPGASDAKLSKPAETTFLKYHPETNLLAAGYADGVIKIWDLISKT 112
           +IK    +A   + +    S    S+P  +  +K+ P+   LA G  DG IK     S  
Sbjct: 154 EIKYRRTLAHQLENIGLLGSQIASSRPISS--VKFSPDDKHLAVGSWDGGIKTISAGSLN 211

Query: 113 VLISF-NGHKSAITVLAFDTTGTRLISASKDSDIIVWDLVGESG----LYKLRSHKDAIT 167
           +  S  N H   +  + ++++G  L +  +D  + ++ +  +SG    +  L+ H+  + 
Sbjct: 212 IKSSVENAHTGKVGEVDWNSSGDLLATGGEDGLVKLFTV--QSGELRQVADLQGHERRVA 269

Query: 168 GLWCEDE---NWLISTSKDGLVKIWDLKSQQCVETHLAHTGECWSLGIIEDMAVTCSA-- 222
           G  C       ++ S S D   ++WD ++   +     H  E + L    D ++ CSA  
Sbjct: 270 G--CRFHPFGRYIASASFDNTWRLWDAETNHELLLQEGHGKEVFCLAFQSDGSLLCSAGL 327

Query: 223 DSQVKLWKLDLQAENGSKLTE---KGIIEKQSKQRGVEIDFAVAPDGVKFFYIQNADKTI 279
           D    +W  D+++ N + +     K I       RG E+  A            + D T+
Sbjct: 328 DCTGMIW--DIRSGNCAMVLSGHTKPIYSVDWSPRGFEVATA------------SGDGTV 373

Query: 280 EIYRLRKEEE 289
            I+ +RK  +
Sbjct: 374 NIWDIRKTNQ 383

>NDAI0C05490 Chr3 (1275046..1277625) [2580 bp, 859 aa] {ON} 
          Length = 859

 Score = 89.0 bits (219), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 51/216 (23%), Positives = 100/216 (46%), Gaps = 17/216 (7%)

Query: 468 AHDAAIWSLDLTSDGRKLVTGSADKTVRFWTFEVSEVPVSDESNKTMPMLQLFHDTTLEL 527
            H  A++S   + D + L++GS DKTVR W+ + +   VS + +                
Sbjct: 584 GHSGAVYSTSFSPDNKYLISGSEDKTVRLWSLDTNTTLVSYKGH---------------- 627

Query: 528 DDDILSVVISPDDKFIAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSMDISYDSKLIVT 587
           +  +  V  SP   + A +  D T +++  D +       GH   V  +    +   + T
Sbjct: 628 NHPVWDVKFSPLGHYFATASHDQTARLWSCDHIYPLRIFAGHLSDVDCVSFHPNGCYVFT 687

Query: 588 CSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLPESYNFFSCSKDATVKYWDGQKFECI 647
            S+DK  ++W +  GD  +    H   +++    P+     + S+D  +  WD    + +
Sbjct: 688 GSSDKTCRMWDVSTGDSVRLFLGHTAPVISTAVSPDGRWLSTGSEDGIINVWDIGTGKRL 747

Query: 648 QKLAAH-QSEVWSISVSNDGTFVISTGHDHSIRVWE 682
           + +  H ++ ++S+S S +G  ++S+G DHS+RVW+
Sbjct: 748 KLMRGHGKNAIYSLSYSKEGNVLVSSGADHSVRVWD 783

 Score = 75.9 bits (185), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 55/217 (25%), Positives = 91/217 (41%), Gaps = 9/217 (4%)

Query: 475 SLDLTSDGRKLVTGSADKTVRFWTFEVSEVPVSDESNKTMPMLQL--------FHDTTL- 525
           SLD + D R    G  D  ++ W+ + S +    + + +              F +TTL 
Sbjct: 524 SLDFSEDSRLAAGGFQDSYIKLWSLDGSSLKKYGDVSSSPSPSATTADKYSKDFTNTTLI 583

Query: 526 ELDDDILSVVISPDDKFIAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSMDISYDSKLI 585
                + S   SPD+K++     D TV+++ LD+    +S  GH  PV  +  S      
Sbjct: 584 GHSGAVYSTSFSPDNKYLISGSEDKTVRLWSLDTNTTLVSYKGHNHPVWDVKFSPLGHYF 643

Query: 586 VTCSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLPESYNFFSCSKDATVKYWDGQKFE 645
            T S D+  ++W  D     +    H   +  V F P     F+ S D T + WD    +
Sbjct: 644 ATASHDQTARLWSCDHIYPLRIFAGHLSDVDCVSFHPNGCYVFTGSSDKTCRMWDVSTGD 703

Query: 646 CIQKLAAHQSEVWSISVSNDGTFVISTGHDHSIRVWE 682
            ++    H + V S +VS DG ++ +   D  I VW+
Sbjct: 704 SVRLFLGHTAPVISTAVSPDGRWLSTGSEDGIINVWD 740

 Score = 74.7 bits (182), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 54/200 (27%), Positives = 88/200 (44%), Gaps = 30/200 (15%)

Query: 517 LQLFHDTTLELDDDILSVVISPDDKFIAVSLLDNTVKVFFLD--SMKFF----------- 563
           L  FH+T    + D+ S+  S D +  A    D+ +K++ LD  S+K +           
Sbjct: 512 LYTFHNT----NRDMTSLDFSEDSRLAAGGFQDSYIKLWSLDGSSLKKYGDVSSSPSPSA 567

Query: 564 ------------LSLYGHKLPVLSMDISYDSKLIVTCSADKNIKIWGLDFGDCHKSLFAH 611
                        +L GH   V S   S D+K +++ S DK +++W LD      S   H
Sbjct: 568 TTADKYSKDFTNTTLIGHSGAVYSTSFSPDNKYLISGSEDKTVRLWSLDTNTTLVSYKGH 627

Query: 612 QDSIMNVKFLPESYNFFSCSKDATVKYWDGQKFECIQKLAAHQSEVWSISVSNDGTFVIS 671
              + +VKF P  + F + S D T + W       ++  A H S+V  +S   +G +V +
Sbjct: 628 NHPVWDVKFSPLGHYFATASHDQTARLWSCDHIYPLRIFAGHLSDVDCVSFHPNGCYVFT 687

Query: 672 TGHDHSIRVWE-ETEDQVFL 690
              D + R+W+  T D V L
Sbjct: 688 GSSDKTCRMWDVSTGDSVRL 707

 Score = 59.3 bits (142), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 58/265 (21%), Positives = 106/265 (40%), Gaps = 65/265 (24%)

Query: 384 LHGQRTDIRSTSISDDNKLLATAS-NGSLKIWNIKTKRCIRSFECGYALTCKFLPGGALV 442
           L G    + STS S DNK L + S + ++++W++ T   + S++                
Sbjct: 582 LIGHSGAVYSTSFSPDNKYLISGSEDKTVRLWSLDTNTTLVSYK---------------- 625

Query: 443 VVGTRNGELQLFDIASSTMLDNKEGAHDAAIWSLDLTSDGRKLVTGSADKTVRFWTFEVS 502
                                     H+  +W +  +  G    T S D+T R W+ +  
Sbjct: 626 -------------------------GHNHPVWDVKFSPLGHYFATASHDQTARLWSCD-- 658

Query: 503 EVPVSDESNKTMPMLQLFHDTTLELDDDILSVVISPDDKFIAVSLLDNTVKVFFL---DS 559
                       P L++F     ++D     V   P+  ++     D T +++ +   DS
Sbjct: 659 ---------HIYP-LRIFAGHLSDVD----CVSFHPNGCYVFTGSSDKTCRMWDVSTGDS 704

Query: 560 MKFFLSLYGHKLPVLSMDISYDSKLIVTCSADKNIKIWGLDFGDCHKSLFAH-QDSIMNV 618
           ++ FL   GH  PV+S  +S D + + T S D  I +W +  G   K +  H +++I ++
Sbjct: 705 VRLFL---GHTAPVISTAVSPDGRWLSTGSEDGIINVWDIGTGKRLKLMRGHGKNAIYSL 761

Query: 619 KFLPESYNFFSCSKDATVKYWDGQK 643
            +  E     S   D +V+ WD +K
Sbjct: 762 SYSKEGNVLVSSGADHSVRVWDLKK 786

 Score = 58.9 bits (141), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 35/151 (23%), Positives = 64/151 (42%), Gaps = 9/151 (5%)

Query: 87  YHPETNLLAAGYADGVIKIWDLISKTVLISFNGHKSAITVLAFDTTGTRLISASKDSDII 146
           + P+   L +G  D  +++W L + T L+S+ GH   +  + F   G    +AS D    
Sbjct: 594 FSPDNKYLISGSEDKTVRLWSLDTNTTLVSYKGHNHPVWDVKFSPLGHYFATASHDQTAR 653

Query: 147 VWDLVGESGLYKLRSHKDAITGLWC----EDENWLISTSKDGLVKIWDLKSQQCVETHLA 202
           +W       +Y LR     ++ + C     +  ++ + S D   ++WD+ +   V   L 
Sbjct: 654 LWSC---DHIYPLRIFAGHLSDVDCVSFHPNGCYVFTGSSDKTCRMWDVSTGDSVRLFLG 710

Query: 203 HTGECWSLGIIEDMA--VTCSADSQVKLWKL 231
           HT    S  +  D     T S D  + +W +
Sbjct: 711 HTAPVISTAVSPDGRWLSTGSEDGIINVWDI 741

 Score = 58.5 bits (140), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 34/110 (30%), Positives = 57/110 (51%), Gaps = 2/110 (1%)

Query: 85  LKYHPETNLLAAGYADGVIKIWDLISKTVLISFNGHKSAITVLAFDTTGTRLISASKDSD 144
           + +HP    +  G +D   ++WD+ +   +  F GH + +   A    G  L + S+D  
Sbjct: 676 VSFHPNGCYVFTGSSDKTCRMWDVSTGDSVRLFLGHTAPVISTAVSPDGRWLSTGSEDGI 735

Query: 145 IIVWDLVGESGLYKLRSH-KDAITGL-WCEDENWLISTSKDGLVKIWDLK 192
           I VWD+     L  +R H K+AI  L + ++ N L+S+  D  V++WDLK
Sbjct: 736 INVWDIGTGKRLKLMRGHGKNAIYSLSYSKEGNVLVSSGADHSVRVWDLK 785

 Score = 57.4 bits (137), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 37/151 (24%), Positives = 68/151 (45%), Gaps = 4/151 (2%)

Query: 85  LKYHPETNLLAAGYADGVIKIWDLISKTVLISFNGHKSAITVLAFDTTGTRLISASKDSD 144
           +K+ P  +  A    D   ++W       L  F GH S +  ++F   G  + + S D  
Sbjct: 634 VKFSPLGHYFATASHDQTARLWSCDHIYPLRIFAGHLSDVDCVSFHPNGCYVFTGSSDKT 693

Query: 145 IIVWDL-VGESGLYKLRSHKDAITGLWCEDENWLISTSKDGLVKIWDLKSQQCVETHLAH 203
             +WD+  G+S    L      I+     D  WL + S+DG++ +WD+ + + ++    H
Sbjct: 694 CRMWDVSTGDSVRLFLGHTAPVISTAVSPDGRWLSTGSEDGIINVWDIGTGKRLKLMRGH 753

Query: 204 -TGECWSLGIIE--DMAVTCSADSQVKLWKL 231
                +SL   +  ++ V+  AD  V++W L
Sbjct: 754 GKNAIYSLSYSKEGNVLVSSGADHSVRVWDL 784

 Score = 52.8 bits (125), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 38/159 (23%), Positives = 72/159 (45%), Gaps = 9/159 (5%)

Query: 376 PLKLHTIDLHGQRTDIRSTSISDDNKLLAT-ASNGSLKIWNIKTKRCIRSF--ECGYALT 432
           PL++      G  +D+   S   +   + T +S+ + ++W++ T   +R F       ++
Sbjct: 662 PLRI----FAGHLSDVDCVSFHPNGCYVFTGSSDKTCRMWDVSTGDSVRLFLGHTAPVIS 717

Query: 433 CKFLPGGALVVVGTRNGELQLFDIASSTMLDNKEGAHDAAIWSLDLTSDGRKLVTGSADK 492
               P G  +  G+ +G + ++DI +   L    G    AI+SL  + +G  LV+  AD 
Sbjct: 718 TAVSPDGRWLSTGSEDGIINVWDIGTGKRLKLMRGHGKNAIYSLSYSKEGNVLVSSGADH 777

Query: 493 TVRFWTFEVSEVPVSDESNKTMPMLQLFHDTTLELDDDI 531
           +VR W  + +    S E  +  P +    D T  ++ DI
Sbjct: 778 SVRVWDLKKATAEPSAEPEE--PFVGYLGDVTASINQDI 814

 Score = 40.8 bits (94), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 36/182 (19%), Positives = 64/182 (35%), Gaps = 34/182 (18%)

Query: 81  ETTFLKYHPETNLLAAGYADGVIKIWDL----------------------------ISKT 112
           + T L +  ++ L A G+ D  IK+W L                             + T
Sbjct: 521 DMTSLDFSEDSRLAAGGFQDSYIKLWSLDGSSLKKYGDVSSSPSPSATTADKYSKDFTNT 580

Query: 113 VLISFNGHKSAITVLAFDTTGTRLISASKDSDIIVWDLVGESGLYKLRSHKDAITGL-WC 171
            LI   GH  A+   +F      LIS S+D  + +W L   + L   + H   +  + + 
Sbjct: 581 TLI---GHSGAVYSTSFSPDNKYLISGSEDKTVRLWSLDTNTTLVSYKGHNHPVWDVKFS 637

Query: 172 EDENWLISTSKDGLVKIWDLKSQQCVETHLAHTG--ECWSLGIIEDMAVTCSADSQVKLW 229
              ++  + S D   ++W       +     H    +C S         T S+D   ++W
Sbjct: 638 PLGHYFATASHDQTARLWSCDHIYPLRIFAGHLSDVDCVSFHPNGCYVFTGSSDKTCRMW 697

Query: 230 KL 231
            +
Sbjct: 698 DV 699

>TDEL0B03020 Chr2 complement(534847..537342) [2496 bp, 831 aa] {ON}
           Anc_8.544 YBR198C
          Length = 831

 Score = 89.0 bits (219), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 70/301 (23%), Positives = 130/301 (43%), Gaps = 39/301 (12%)

Query: 384 LHGQRTDIRSTSISDDNKLLATA-SNGSLKIWNIKTKRCIRSFECGYALTCKFLPGGALV 442
            H    D+ S   SDD +L A    +  +KI+++           G +L  K      L 
Sbjct: 492 FHNTDRDMTSLEFSDDCRLAAAGFQDSQIKIFSLD----------GSSLNSK------LT 535

Query: 443 VVGTRNGELQLFDIASSTMLDNKEGAHDAAIWSLDLTSDGRKLVTGSADKTVRFWTFEVS 502
               +  +L   D ++ST++      H   ++S   + D R LV+GS DKTVR W+ +  
Sbjct: 536 ESNKKTNKLLNNDESTSTLI-----GHSGTVYSTSFSPDNRYLVSGSEDKTVRLWSMDTH 590

Query: 503 EVPVSDESNKTMPMLQLFHDTTLELDDDILSVVISPDDKFIAVSLLDNTVKVFFLDSMKF 562
              VS + +                +  +  V  SP   + A +  D+T +++  D +  
Sbjct: 591 TSLVSYKGH----------------NHPVWDVEFSPLGHYFATASHDHTARLWSCDHIYP 634

Query: 563 FLSLYGHKLPVLSMDISYDSKLIVTCSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLP 622
                GH   V  +    +   + T S+DK  ++W +  GD  +        +M+    P
Sbjct: 635 LRIFAGHLNDVDCVSFHPNGCYLFTGSSDKTCRMWDITTGDSVRLFLGLTAPVMSTSVSP 694

Query: 623 ESYNFFSCSKDATVKYWDGQKFECIQKLAAH-QSEVWSISVSNDGTFVISTGHDHSIRVW 681
           +     + S+D  +  WD    + ++++  H ++ ++S+S + +G  +IS G DHS+RVW
Sbjct: 695 DGRWLSTGSEDGVINVWDIGTGKRLKQMRGHGKNAIYSLSYNKEGNVLISGGADHSVRVW 754

Query: 682 E 682
           +
Sbjct: 755 D 755

 Score = 73.6 bits (179), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 49/195 (25%), Positives = 84/195 (43%), Gaps = 25/195 (12%)

Query: 517 LQLFHDTTLELDDDILSVVISPDDKFIAVSLLDNTVKVFFLDSMKF-------------- 562
           +  FH+T    D D+ S+  S D +  A    D+ +K+F LD                  
Sbjct: 489 MYTFHNT----DRDMTSLEFSDDCRLAAAGFQDSQIKIFSLDGSSLNSKLTESNKKTNKL 544

Query: 563 ------FLSLYGHKLPVLSMDISYDSKLIVTCSADKNIKIWGLDFGDCHKSLFAHQDSIM 616
                   +L GH   V S   S D++ +V+ S DK +++W +D      S   H   + 
Sbjct: 545 LNNDESTSTLIGHSGTVYSTSFSPDNRYLVSGSEDKTVRLWSMDTHTSLVSYKGHNHPVW 604

Query: 617 NVKFLPESYNFFSCSKDATVKYWDGQKFECIQKLAAHQSEVWSISVSNDGTFVISTGHDH 676
           +V+F P  + F + S D T + W       ++  A H ++V  +S   +G ++ +   D 
Sbjct: 605 DVEFSPLGHYFATASHDHTARLWSCDHIYPLRIFAGHLNDVDCVSFHPNGCYLFTGSSDK 664

Query: 677 SIRVWE-ETEDQVFL 690
           + R+W+  T D V L
Sbjct: 665 TCRMWDITTGDSVRL 679

 Score = 57.4 bits (137), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 57/268 (21%), Positives = 106/268 (39%), Gaps = 65/268 (24%)

Query: 381 TIDLHGQRTDIRSTSISDDNKLLATAS-NGSLKIWNIKTKRCIRSFECGYALTCKFLPGG 439
           T  L G    + STS S DN+ L + S + ++++W++ T   + S++             
Sbjct: 551 TSTLIGHSGTVYSTSFSPDNRYLVSGSEDKTVRLWSMDTHTSLVSYK------------- 597

Query: 440 ALVVVGTRNGELQLFDIASSTMLDNKEGAHDAAIWSLDLTSDGRKLVTGSADKTVRFWTF 499
                                        H+  +W ++ +  G    T S D T R W+ 
Sbjct: 598 ----------------------------GHNHPVWDVEFSPLGHYFATASHDHTARLWSC 629

Query: 500 EVSEVPVSDESNKTMPMLQLFHDTTLELDDDILSVVISPDDKFIAVSLLDNTVKVFFL-- 557
           +              P L++F        +D+  V   P+  ++     D T +++ +  
Sbjct: 630 D-----------HIYP-LRIFAGHL----NDVDCVSFHPNGCYLFTGSSDKTCRMWDITT 673

Query: 558 -DSMKFFLSLYGHKLPVLSMDISYDSKLIVTCSADKNIKIWGLDFGDCHKSLFAH-QDSI 615
            DS++ FL L     PV+S  +S D + + T S D  I +W +  G   K +  H +++I
Sbjct: 674 GDSVRLFLGLTA---PVMSTSVSPDGRWLSTGSEDGVINVWDIGTGKRLKQMRGHGKNAI 730

Query: 616 MNVKFLPESYNFFSCSKDATVKYWDGQK 643
            ++ +  E     S   D +V+ WD +K
Sbjct: 731 YSLSYNKEGNVLISGGADHSVRVWDLKK 758

 Score = 55.5 bits (132), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 34/110 (30%), Positives = 56/110 (50%), Gaps = 2/110 (1%)

Query: 85  LKYHPETNLLAAGYADGVIKIWDLISKTVLISFNGHKSAITVLAFDTTGTRLISASKDSD 144
           + +HP    L  G +D   ++WD+ +   +  F G  + +   +    G  L + S+D  
Sbjct: 648 VSFHPNGCYLFTGSSDKTCRMWDITTGDSVRLFLGLTAPVMSTSVSPDGRWLSTGSEDGV 707

Query: 145 IIVWDLVGESGLYKLRSH-KDAITGL-WCEDENWLISTSKDGLVKIWDLK 192
           I VWD+     L ++R H K+AI  L + ++ N LIS   D  V++WDLK
Sbjct: 708 INVWDIGTGKRLKQMRGHGKNAIYSLSYNKEGNVLISGGADHSVRVWDLK 757

 Score = 55.5 bits (132), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 42/174 (24%), Positives = 74/174 (42%), Gaps = 11/174 (6%)

Query: 402 LLATASNGSLKIWNIKTKRCIRSFE--CGYALTCKFLPGGALVVVGTRNGELQLFDIASS 459
           L   +S+ + ++W+I T   +R F       ++    P G  +  G+ +G + ++DI + 
Sbjct: 657 LFTGSSDKTCRMWDITTGDSVRLFLGLTAPVMSTSVSPDGRWLSTGSEDGVINVWDIGTG 716

Query: 460 TMLDNKEGAHDAAIWSLDLTSDGRKLVTGSADKTVRFWTFEVSEVPVSDESNKTMPMLQL 519
             L    G    AI+SL    +G  L++G AD +VR W  + +      E  +  P +  
Sbjct: 717 KRLKQMRGHGKNAIYSLSYNKEGNVLISGGADHSVRVWDLKKATTESGAEPEE--PFVGY 774

Query: 520 FHDTTLELDDDI-----LSVVISPDDKFIAVSLLDNTVKVFFLDSMKFFLSLYG 568
             D T  ++ DI        VI  +D  +  S       VF +   +  L+L G
Sbjct: 775 LGDVTTSINQDIKEYGRRRTVIPTND--LVASFYTKKTPVFKVKFTRSNLALAG 826

 Score = 54.3 bits (129), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 34/151 (22%), Positives = 62/151 (41%), Gaps = 9/151 (5%)

Query: 87  YHPETNLLAAGYADGVIKIWDLISKTVLISFNGHKSAITVLAFDTTGTRLISASKDSDII 146
           + P+   L +G  D  +++W + + T L+S+ GH   +  + F   G    +AS D    
Sbjct: 566 FSPDNRYLVSGSEDKTVRLWSMDTHTSLVSYKGHNHPVWDVEFSPLGHYFATASHDHTAR 625

Query: 147 VWDLVGESGLYKLRSHKDAITGLWC----EDENWLISTSKDGLVKIWDLKSQQCVETHLA 202
           +W       +Y LR     +  + C     +  +L + S D   ++WD+ +   V   L 
Sbjct: 626 LWSC---DHIYPLRIFAGHLNDVDCVSFHPNGCYLFTGSSDKTCRMWDITTGDSVRLFLG 682

Query: 203 HTGECWSLGIIEDMA--VTCSADSQVKLWKL 231
            T    S  +  D     T S D  + +W +
Sbjct: 683 LTAPVMSTSVSPDGRWLSTGSEDGVINVWDI 713

 Score = 52.0 bits (123), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 36/151 (23%), Positives = 67/151 (44%), Gaps = 4/151 (2%)

Query: 85  LKYHPETNLLAAGYADGVIKIWDLISKTVLISFNGHKSAITVLAFDTTGTRLISASKDSD 144
           +++ P  +  A    D   ++W       L  F GH + +  ++F   G  L + S D  
Sbjct: 606 VEFSPLGHYFATASHDHTARLWSCDHIYPLRIFAGHLNDVDCVSFHPNGCYLFTGSSDKT 665

Query: 145 IIVWDL-VGESGLYKLRSHKDAITGLWCEDENWLISTSKDGLVKIWDLKSQQCVETHLAH 203
             +WD+  G+S    L      ++     D  WL + S+DG++ +WD+ + + ++    H
Sbjct: 666 CRMWDITTGDSVRLFLGLTAPVMSTSVSPDGRWLSTGSEDGVINVWDIGTGKRLKQMRGH 725

Query: 204 TGEC-WSLGIIEDMAVTCS--ADSQVKLWKL 231
                +SL   ++  V  S  AD  V++W L
Sbjct: 726 GKNAIYSLSYNKEGNVLISGGADHSVRVWDL 756

 Score = 36.2 bits (82), Expect = 0.51,   Method: Compositional matrix adjust.
 Identities = 33/174 (18%), Positives = 64/174 (36%), Gaps = 23/174 (13%)

Query: 81  ETTFLKYHPETNLLAAGYADGVIKIWDLISKTV---LISFN-----------------GH 120
           + T L++  +  L AAG+ D  IKI+ L   ++   L   N                 GH
Sbjct: 498 DMTSLEFSDDCRLAAAGFQDSQIKIFSLDGSSLNSKLTESNKKTNKLLNNDESTSTLIGH 557

Query: 121 KSAITVLAFDTTGTRLISASKDSDIIVWDLVGESGLYKLRSHKDAITGL-WCEDENWLIS 179
              +   +F      L+S S+D  + +W +   + L   + H   +  + +    ++  +
Sbjct: 558 SGTVYSTSFSPDNRYLVSGSEDKTVRLWSMDTHTSLVSYKGHNHPVWDVEFSPLGHYFAT 617

Query: 180 TSKDGLVKIWDLKSQQCVETHLAHTG--ECWSLGIIEDMAVTCSADSQVKLWKL 231
            S D   ++W       +     H    +C S         T S+D   ++W +
Sbjct: 618 ASHDHTARLWSCDHIYPLRIFAGHLNDVDCVSFHPNGCYLFTGSSDKTCRMWDI 671

 Score = 35.4 bits (80), Expect = 0.79,   Method: Compositional matrix adjust.
 Identities = 22/65 (33%), Positives = 33/65 (50%), Gaps = 11/65 (16%)

Query: 49  ILVWDIKTGEQIAQLTDGLPPGASDAKLSKPAETTFLKYHPETNLLAAGYADGVIKIWDL 108
           I VWDI TG+++ Q+         +A  S       L Y+ E N+L +G AD  +++WDL
Sbjct: 708 INVWDIGTGKRLKQMRGH----GKNAIYS-------LSYNKEGNVLISGGADHSVRVWDL 756

Query: 109 ISKTV 113
              T 
Sbjct: 757 KKATT 761

>AEL269C Chr5 complement(134760..136127) [1368 bp, 455 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPR178W
           (PRP4)
          Length = 455

 Score = 87.4 bits (215), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 63/269 (23%), Positives = 116/269 (43%), Gaps = 26/269 (9%)

Query: 439 GALVVVGTRNGELQLFDIASSTMLDNKEGAHDAAIWSLDLTSDGRKLVTGSADKTVRFW- 497
           G  +  G   G +++    +  +  + + AH+  I  LD   DG  L++G  D  V+ W 
Sbjct: 184 GQQLATGCWGGSIKVVSCETLGIAKSIDAAHEGKIGGLDWHPDGNHLLSGGGDNLVKLWD 243

Query: 498 ----TFE--------VSEVPV--------SDESNKTMPMLQLFHDTTLELDDD----ILS 533
               +FE        VS V V        S   + T  +  L     L+L +     + +
Sbjct: 244 MTSNSFEELRGHAGRVSRVKVHPSGRLAASASFDLTWILWDLERKVELQLQEGHSKAVYT 303

Query: 534 VVISPDDKFIAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSMDISYDSKLIVTCSADKN 593
           +    D   +A + LD    ++ L S +  + L GH   +  +D S +   + T  AD  
Sbjct: 304 IAFQSDGALLASAGLDAVCAIWDLRSGEPIMKLEGHAGAISGVDWSPNGYQLATAGADGT 363

Query: 594 IKIWGLDFGDCHKSLFAHQDSIMNVKFLPESYNFF-SCSKDATVKYWDGQKFECIQKLAA 652
           +++W +       +L AHQ + ++VKF   +  F  SC  D  V  ++   ++ +  L  
Sbjct: 364 VRVWDIRNVGTESALLAHQVAALDVKFKKNNGTFLVSCGHDRLVNIFNADNWQKLASLEG 423

Query: 653 HQSEVWSISVSNDGTFVISTGHDHSIRVW 681
           H   V+++ ++ DG+ + S G D S++ W
Sbjct: 424 HTDRVFTVDITEDGSTIYSGGKDRSLKQW 452

 Score = 69.3 bits (168), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 45/152 (29%), Positives = 69/152 (45%), Gaps = 4/152 (2%)

Query: 85  LKYHPETNLLAAGYADGVIKIWDLISKTVLISFNGHKSAITVLAFDTTGTRLISASKDSD 144
           +K HP   L A+   D    +WDL  K  L    GH  A+  +AF + G  L SA  D+ 
Sbjct: 262 VKVHPSGRLAASASFDLTWILWDLERKVELQLQEGHSKAVYTIAFQSDGALLASAGLDAV 321

Query: 145 IIVWDLVGESGLYKLRSHKDAITGL-WCEDENWLISTSKDGLVKIWDLKSQQCVETHLAH 203
             +WDL     + KL  H  AI+G+ W  +   L +   DG V++WD+++       LAH
Sbjct: 322 CAIWDLRSGEPIMKLEGHAGAISGVDWSPNGYQLATAGADGTVRVWDIRNVGTESALLAH 381

Query: 204 TGECWSLGIIEDMA---VTCSADSQVKLWKLD 232
                 +   ++     V+C  D  V ++  D
Sbjct: 382 QVAALDVKFKKNNGTFLVSCGHDRLVNIFNAD 413

 Score = 57.8 bits (138), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 41/149 (27%), Positives = 70/149 (46%), Gaps = 4/149 (2%)

Query: 85  LKYHPETNLLAAGYADGVIKIWDLISKTVLISFNGHKSAITVLAFDTTGTRLISASKDSD 144
           + +  +  LLA+   D V  IWDL S   ++   GH  AI+ + +   G +L +A  D  
Sbjct: 304 IAFQSDGALLASAGLDAVCAIWDLRSGEPIMKLEGHAGAISGVDWSPNGYQLATAGADGT 363

Query: 145 IIVWDLVGESGLYKLRSHKDAITGLWCEDEN--WLISTSKDGLVKIWDLKSQQCVETHLA 202
           + VWD+        L +H+ A   +  +  N  +L+S   D LV I++  + Q + +   
Sbjct: 364 VRVWDIRNVGTESALLAHQVAALDVKFKKNNGTFLVSCGHDRLVNIFNADNWQKLASLEG 423

Query: 203 HTGECWSLGIIEDMAVTCSA--DSQVKLW 229
           HT   +++ I ED +   S   D  +K W
Sbjct: 424 HTDRVFTVDITEDGSTIYSGGKDRSLKQW 452

 Score = 49.7 bits (117), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 35/161 (21%), Positives = 68/161 (42%), Gaps = 2/161 (1%)

Query: 523 TTLELDDDILSVVISPDDKFIAVSLLDNTVKVFFLDSMKFFLSL-YGHKLPVLSMDISYD 581
           + L  D  +  V +  D + +A      ++KV   +++    S+   H+  +  +D   D
Sbjct: 167 SQLVADKHVSQVAVHRDGQQLATGCWGGSIKVVSCETLGIAKSIDAAHEGKIGGLDWHPD 226

Query: 582 SKLIVTCSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLPESYNFFSCSKDATVKYWDG 641
              +++   D  +K+W +   +  + L  H   +  VK  P      S S D T   WD 
Sbjct: 227 GNHLLSGGGDNLVKLWDM-TSNSFEELRGHAGRVSRVKVHPSGRLAASASFDLTWILWDL 285

Query: 642 QKFECIQKLAAHQSEVWSISVSNDGTFVISTGHDHSIRVWE 682
           ++   +Q    H   V++I+  +DG  + S G D    +W+
Sbjct: 286 ERKVELQLQEGHSKAVYTIAFQSDGALLASAGLDAVCAIWD 326

>YBR198C Chr2 complement(616127..618523) [2397 bp, 798 aa] {ON}
           TAF5Subunit (90 kDa) of TFIID and SAGA complexes,
           involved in RNA polymerase II transcription initiation
           and in chromatin modification
          Length = 798

 Score = 88.2 bits (217), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 50/216 (23%), Positives = 99/216 (45%), Gaps = 17/216 (7%)

Query: 468 AHDAAIWSLDLTSDGRKLVTGSADKTVRFWTFEVSEVPVSDESNKTMPMLQLFHDTTLEL 527
            H   ++S   + D + L++GS DKTVR W+ +     VS + +                
Sbjct: 523 GHSGTVYSTSFSPDNKYLLSGSEDKTVRLWSMDTHTALVSYKGH---------------- 566

Query: 528 DDDILSVVISPDDKFIAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSMDISYDSKLIVT 587
           +  +  V  SP   + A +  D T +++  D +       GH   V  +    +   + T
Sbjct: 567 NHPVWDVSFSPLGHYFATASHDQTARLWSCDHIYPLRIFAGHLNDVDCVSFHPNGCYVFT 626

Query: 588 CSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLPESYNFFSCSKDATVKYWDGQKFECI 647
            S+DK  ++W +  GD  +    H   ++++   P+     + S+D  +  WD    + +
Sbjct: 627 GSSDKTCRMWDVSTGDSVRLFLGHTAPVISIAVCPDGRWLSTGSEDGIINVWDIGTGKRL 686

Query: 648 QKLAAH-QSEVWSISVSNDGTFVISTGHDHSIRVWE 682
           +++  H ++ ++S+S S +G  +IS G DH++RVW+
Sbjct: 687 KQMRGHGKNAIYSLSYSKEGNVLISGGADHTVRVWD 722

 Score = 66.6 bits (161), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 44/179 (24%), Positives = 76/179 (42%), Gaps = 18/179 (10%)

Query: 530 DILSVVISPDDKFIAVSLLDNTVKVFFLDSMKFFL-----------------SLYGHKLP 572
           D+  +  S D +  A    D+ +K++ LD                       +L GH   
Sbjct: 468 DMSCLDFSDDCRIAAAGFQDSYIKIWSLDGSSLNNPNIALNNNDKDEDPTCKTLVGHSGT 527

Query: 573 VLSMDISYDSKLIVTCSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLPESYNFFSCSK 632
           V S   S D+K +++ S DK +++W +D      S   H   + +V F P  + F + S 
Sbjct: 528 VYSTSFSPDNKYLLSGSEDKTVRLWSMDTHTALVSYKGHNHPVWDVSFSPLGHYFATASH 587

Query: 633 DATVKYWDGQKFECIQKLAAHQSEVWSISVSNDGTFVISTGHDHSIRVWE-ETEDQVFL 690
           D T + W       ++  A H ++V  +S   +G +V +   D + R+W+  T D V L
Sbjct: 588 DQTARLWSCDHIYPLRIFAGHLNDVDCVSFHPNGCYVFTGSSDKTCRMWDVSTGDSVRL 646

 Score = 62.0 bits (149), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 58/265 (21%), Positives = 107/265 (40%), Gaps = 65/265 (24%)

Query: 384 LHGQRTDIRSTSISDDNK-LLATASNGSLKIWNIKTKRCIRSFECGYALTCKFLPGGALV 442
           L G    + STS S DNK LL+ + + ++++W++ T   + S++                
Sbjct: 521 LVGHSGTVYSTSFSPDNKYLLSGSEDKTVRLWSMDTHTALVSYK---------------- 564

Query: 443 VVGTRNGELQLFDIASSTMLDNKEGAHDAAIWSLDLTSDGRKLVTGSADKTVRFWTFEVS 502
                                     H+  +W +  +  G    T S D+T R W+    
Sbjct: 565 -------------------------GHNHPVWDVSFSPLGHYFATASHDQTARLWS---- 595

Query: 503 EVPVSDESNKTMPMLQLFHDTTLELDDDILSVVISPDDKFIAVSLLDNTVKVFFL---DS 559
                   +   P L++F        +D+  V   P+  ++     D T +++ +   DS
Sbjct: 596 -------CDHIYP-LRIFAGHL----NDVDCVSFHPNGCYVFTGSSDKTCRMWDVSTGDS 643

Query: 560 MKFFLSLYGHKLPVLSMDISYDSKLIVTCSADKNIKIWGLDFGDCHKSLFAH-QDSIMNV 618
           ++ FL   GH  PV+S+ +  D + + T S D  I +W +  G   K +  H +++I ++
Sbjct: 644 VRLFL---GHTAPVISIAVCPDGRWLSTGSEDGIINVWDIGTGKRLKQMRGHGKNAIYSL 700

Query: 619 KFLPESYNFFSCSKDATVKYWDGQK 643
            +  E     S   D TV+ WD +K
Sbjct: 701 SYSKEGNVLISGGADHTVRVWDLKK 725

 Score = 60.5 bits (145), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 35/110 (31%), Positives = 58/110 (52%), Gaps = 2/110 (1%)

Query: 85  LKYHPETNLLAAGYADGVIKIWDLISKTVLISFNGHKSAITVLAFDTTGTRLISASKDSD 144
           + +HP    +  G +D   ++WD+ +   +  F GH + +  +A    G  L + S+D  
Sbjct: 615 VSFHPNGCYVFTGSSDKTCRMWDVSTGDSVRLFLGHTAPVISIAVCPDGRWLSTGSEDGI 674

Query: 145 IIVWDLVGESGLYKLRSH-KDAITGL-WCEDENWLISTSKDGLVKIWDLK 192
           I VWD+     L ++R H K+AI  L + ++ N LIS   D  V++WDLK
Sbjct: 675 INVWDIGTGKRLKQMRGHGKNAIYSLSYSKEGNVLISGGADHTVRVWDLK 724

 Score = 60.1 bits (144), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 34/151 (22%), Positives = 65/151 (43%), Gaps = 9/151 (5%)

Query: 87  YHPETNLLAAGYADGVIKIWDLISKTVLISFNGHKSAITVLAFDTTGTRLISASKDSDII 146
           + P+   L +G  D  +++W + + T L+S+ GH   +  ++F   G    +AS D    
Sbjct: 533 FSPDNKYLLSGSEDKTVRLWSMDTHTALVSYKGHNHPVWDVSFSPLGHYFATASHDQTAR 592

Query: 147 VWDLVGESGLYKLRSHKDAITGLWC----EDENWLISTSKDGLVKIWDLKSQQCVETHLA 202
           +W       +Y LR     +  + C     +  ++ + S D   ++WD+ +   V   L 
Sbjct: 593 LWSC---DHIYPLRIFAGHLNDVDCVSFHPNGCYVFTGSSDKTCRMWDVSTGDSVRLFLG 649

Query: 203 HTGECWSLGIIEDMA--VTCSADSQVKLWKL 231
           HT    S+ +  D     T S D  + +W +
Sbjct: 650 HTAPVISIAVCPDGRWLSTGSEDGIINVWDI 680

 Score = 59.7 bits (143), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 39/159 (24%), Positives = 73/159 (45%), Gaps = 9/159 (5%)

Query: 376 PLKLHTIDLHGQRTDIRSTSISDDNKLLAT-ASNGSLKIWNIKTKRCIRSF--ECGYALT 432
           PL++      G   D+   S   +   + T +S+ + ++W++ T   +R F       ++
Sbjct: 601 PLRI----FAGHLNDVDCVSFHPNGCYVFTGSSDKTCRMWDVSTGDSVRLFLGHTAPVIS 656

Query: 433 CKFLPGGALVVVGTRNGELQLFDIASSTMLDNKEGAHDAAIWSLDLTSDGRKLVTGSADK 492
               P G  +  G+ +G + ++DI +   L    G    AI+SL  + +G  L++G AD 
Sbjct: 657 IAVCPDGRWLSTGSEDGIINVWDIGTGKRLKQMRGHGKNAIYSLSYSKEGNVLISGGADH 716

Query: 493 TVRFWTFEVSEVPVSDESNKTMPMLQLFHDTTLELDDDI 531
           TVR W  + +    S E ++  P +    D T  ++ DI
Sbjct: 717 TVRVWDLKKATTEPSAEPDE--PFIGYLGDVTASINQDI 753

 Score = 56.6 bits (135), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 37/151 (24%), Positives = 67/151 (44%), Gaps = 4/151 (2%)

Query: 85  LKYHPETNLLAAGYADGVIKIWDLISKTVLISFNGHKSAITVLAFDTTGTRLISASKDSD 144
           + + P  +  A    D   ++W       L  F GH + +  ++F   G  + + S D  
Sbjct: 573 VSFSPLGHYFATASHDQTARLWSCDHIYPLRIFAGHLNDVDCVSFHPNGCYVFTGSSDKT 632

Query: 145 IIVWDL-VGESGLYKLRSHKDAITGLWCEDENWLISTSKDGLVKIWDLKSQQCVETHLAH 203
             +WD+  G+S    L      I+   C D  WL + S+DG++ +WD+ + + ++    H
Sbjct: 633 CRMWDVSTGDSVRLFLGHTAPVISIAVCPDGRWLSTGSEDGIINVWDIGTGKRLKQMRGH 692

Query: 204 TGEC-WSLGIIEDMAVTCS--ADSQVKLWKL 231
                +SL   ++  V  S  AD  V++W L
Sbjct: 693 GKNAIYSLSYSKEGNVLISGGADHTVRVWDL 723

 Score = 35.4 bits (80), Expect = 0.83,   Method: Compositional matrix adjust.
 Identities = 22/65 (33%), Positives = 32/65 (49%), Gaps = 11/65 (16%)

Query: 49  ILVWDIKTGEQIAQLTDGLPPGASDAKLSKPAETTFLKYHPETNLLAAGYADGVIKIWDL 108
           I VWDI TG+++ Q+         +A  S       L Y  E N+L +G AD  +++WDL
Sbjct: 675 INVWDIGTGKRLKQMRGH----GKNAIYS-------LSYSKEGNVLISGGADHTVRVWDL 723

Query: 109 ISKTV 113
              T 
Sbjct: 724 KKATT 728

>Smik_2.338 Chr2 complement(602610..605012) [2403 bp, 800 aa] {ON}
           YBR198C (REAL)
          Length = 800

 Score = 87.8 bits (216), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 51/216 (23%), Positives = 99/216 (45%), Gaps = 17/216 (7%)

Query: 468 AHDAAIWSLDLTSDGRKLVTGSADKTVRFWTFEVSEVPVSDESNKTMPMLQLFHDTTLEL 527
            H   ++S   + D + L++GS DKTVR W+ +     VS + +                
Sbjct: 525 GHSGTVYSTSFSPDNKYLLSGSEDKTVRLWSMDTHTALVSYKGH---------------- 568

Query: 528 DDDILSVVISPDDKFIAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSMDISYDSKLIVT 587
           +  +  V  SP   + A +  D T +++  D +       GH   V  +    +   + T
Sbjct: 569 NHPVWDVNFSPLGHYFATASHDQTARLWSCDHIYPLRIFAGHLNDVDCVSFHPNGCYLFT 628

Query: 588 CSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLPESYNFFSCSKDATVKYWDGQKFECI 647
            S+DK  ++W +  GD  +    H   ++++   P+     + S+D  +  WD    + +
Sbjct: 629 GSSDKTCRMWNVSTGDSVRLFLGHTAPVISIAVSPDGRWLSTGSEDGIINVWDIGTGKRL 688

Query: 648 QKLAAH-QSEVWSISVSNDGTFVISTGHDHSIRVWE 682
           +++  H ++ ++S+S S +G  +IS G DHS+RVW+
Sbjct: 689 KQMRGHGKNAIYSLSYSKEGNVLISGGADHSVRVWD 724

 Score = 83.6 bits (205), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 55/218 (25%), Positives = 94/218 (43%), Gaps = 19/218 (8%)

Query: 476 LDLTSDGRKLVTGSADKTVRFWTFEVSEVPVSDESNKTMPMLQLFHDTTLELDDD----- 530
           LD + D R    G  D  ++ W+         D S+   P + L ++T  + DD      
Sbjct: 472 LDFSDDCRVAAAGFQDSYIKIWSL--------DGSSLNNPNIVLNNETNYKDDDPTCKTL 523

Query: 531 ------ILSVVISPDDKFIAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSMDISYDSKL 584
                 + S   SPD+K++     D TV+++ +D+    +S  GH  PV  ++ S     
Sbjct: 524 VGHSGTVYSTSFSPDNKYLLSGSEDKTVRLWSMDTHTALVSYKGHNHPVWDVNFSPLGHY 583

Query: 585 IVTCSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLPESYNFFSCSKDATVKYWDGQKF 644
             T S D+  ++W  D     +    H + +  V F P     F+ S D T + W+    
Sbjct: 584 FATASHDQTARLWSCDHIYPLRIFAGHLNDVDCVSFHPNGCYLFTGSSDKTCRMWNVSTG 643

Query: 645 ECIQKLAAHQSEVWSISVSNDGTFVISTGHDHSIRVWE 682
           + ++    H + V SI+VS DG ++ +   D  I VW+
Sbjct: 644 DSVRLFLGHTAPVISIAVSPDGRWLSTGSEDGIINVWD 681

 Score = 62.8 bits (151), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 58/265 (21%), Positives = 109/265 (41%), Gaps = 65/265 (24%)

Query: 384 LHGQRTDIRSTSISDDNK-LLATASNGSLKIWNIKTKRCIRSFECGYALTCKFLPGGALV 442
           L G    + STS S DNK LL+ + + ++++W++ T   + S++                
Sbjct: 523 LVGHSGTVYSTSFSPDNKYLLSGSEDKTVRLWSMDTHTALVSYK---------------- 566

Query: 443 VVGTRNGELQLFDIASSTMLDNKEGAHDAAIWSLDLTSDGRKLVTGSADKTVRFWTFEVS 502
                                     H+  +W ++ +  G    T S D+T R W+ +  
Sbjct: 567 -------------------------GHNHPVWDVNFSPLGHYFATASHDQTARLWSCD-- 599

Query: 503 EVPVSDESNKTMPMLQLFHDTTLELDDDILSVVISPDDKFIAVSLLDNTVKVFFL---DS 559
                       P L++F        +D+  V   P+  ++     D T +++ +   DS
Sbjct: 600 ---------HIYP-LRIFAGHL----NDVDCVSFHPNGCYLFTGSSDKTCRMWNVSTGDS 645

Query: 560 MKFFLSLYGHKLPVLSMDISYDSKLIVTCSADKNIKIWGLDFGDCHKSLFAH-QDSIMNV 618
           ++ FL   GH  PV+S+ +S D + + T S D  I +W +  G   K +  H +++I ++
Sbjct: 646 VRLFL---GHTAPVISIAVSPDGRWLSTGSEDGIINVWDIGTGKRLKQMRGHGKNAIYSL 702

Query: 619 KFLPESYNFFSCSKDATVKYWDGQK 643
            +  E     S   D +V+ WD +K
Sbjct: 703 SYSKEGNVLISGGADHSVRVWDLKK 727

 Score = 60.8 bits (146), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 34/132 (25%), Positives = 63/132 (47%), Gaps = 4/132 (3%)

Query: 402 LLATASNGSLKIWNIKTKRCIRSF--ECGYALTCKFLPGGALVVVGTRNGELQLFDIASS 459
           L   +S+ + ++WN+ T   +R F       ++    P G  +  G+ +G + ++DI + 
Sbjct: 626 LFTGSSDKTCRMWNVSTGDSVRLFLGHTAPVISIAVSPDGRWLSTGSEDGIINVWDIGTG 685

Query: 460 TMLDNKEGAHDAAIWSLDLTSDGRKLVTGSADKTVRFWTFEVSEVPVSDESNKTMPMLQL 519
             L    G    AI+SL  + +G  L++G AD +VR W  + +    S E ++  P +  
Sbjct: 686 KRLKQMRGHGKNAIYSLSYSKEGNVLISGGADHSVRVWDLKKATTEPSAEPDE--PFIGY 743

Query: 520 FHDTTLELDDDI 531
             D T  ++ DI
Sbjct: 744 LGDVTASINQDI 755

 Score = 60.5 bits (145), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 35/110 (31%), Positives = 58/110 (52%), Gaps = 2/110 (1%)

Query: 85  LKYHPETNLLAAGYADGVIKIWDLISKTVLISFNGHKSAITVLAFDTTGTRLISASKDSD 144
           + +HP    L  G +D   ++W++ +   +  F GH + +  +A    G  L + S+D  
Sbjct: 617 VSFHPNGCYLFTGSSDKTCRMWNVSTGDSVRLFLGHTAPVISIAVSPDGRWLSTGSEDGI 676

Query: 145 IIVWDLVGESGLYKLRSH-KDAITGL-WCEDENWLISTSKDGLVKIWDLK 192
           I VWD+     L ++R H K+AI  L + ++ N LIS   D  V++WDLK
Sbjct: 677 INVWDIGTGKRLKQMRGHGKNAIYSLSYSKEGNVLISGGADHSVRVWDLK 726

 Score = 58.2 bits (139), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 34/151 (22%), Positives = 64/151 (42%), Gaps = 9/151 (5%)

Query: 87  YHPETNLLAAGYADGVIKIWDLISKTVLISFNGHKSAITVLAFDTTGTRLISASKDSDII 146
           + P+   L +G  D  +++W + + T L+S+ GH   +  + F   G    +AS D    
Sbjct: 535 FSPDNKYLLSGSEDKTVRLWSMDTHTALVSYKGHNHPVWDVNFSPLGHYFATASHDQTAR 594

Query: 147 VWDLVGESGLYKLRSHKDAITGLWC----EDENWLISTSKDGLVKIWDLKSQQCVETHLA 202
           +W       +Y LR     +  + C     +  +L + S D   ++W++ +   V   L 
Sbjct: 595 LWSC---DHIYPLRIFAGHLNDVDCVSFHPNGCYLFTGSSDKTCRMWNVSTGDSVRLFLG 651

Query: 203 HTGECWSLGIIEDMA--VTCSADSQVKLWKL 231
           HT    S+ +  D     T S D  + +W +
Sbjct: 652 HTAPVISIAVSPDGRWLSTGSEDGIINVWDI 682

 Score = 52.4 bits (124), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 36/151 (23%), Positives = 66/151 (43%), Gaps = 4/151 (2%)

Query: 85  LKYHPETNLLAAGYADGVIKIWDLISKTVLISFNGHKSAITVLAFDTTGTRLISASKDSD 144
           + + P  +  A    D   ++W       L  F GH + +  ++F   G  L + S D  
Sbjct: 575 VNFSPLGHYFATASHDQTARLWSCDHIYPLRIFAGHLNDVDCVSFHPNGCYLFTGSSDKT 634

Query: 145 IIVWDL-VGESGLYKLRSHKDAITGLWCEDENWLISTSKDGLVKIWDLKSQQCVETHLAH 203
             +W++  G+S    L      I+     D  WL + S+DG++ +WD+ + + ++    H
Sbjct: 635 CRMWNVSTGDSVRLFLGHTAPVISIAVSPDGRWLSTGSEDGIINVWDIGTGKRLKQMRGH 694

Query: 204 TGEC-WSLGIIEDMAVTCS--ADSQVKLWKL 231
                +SL   ++  V  S  AD  V++W L
Sbjct: 695 GKNAIYSLSYSKEGNVLISGGADHSVRVWDL 725

 Score = 50.4 bits (119), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 29/101 (28%), Positives = 45/101 (44%), Gaps = 13/101 (12%)

Query: 51  VWDIKTGEQIAQLTDGLPPGASDAKLSKPAETTFLKYHPETNLLAAGYADGVIKIWDLIS 110
           +W++ TG+ +               L   A    +   P+   L+ G  DG+I +WD+ +
Sbjct: 637 MWNVSTGDSVRLF------------LGHTAPVISIAVSPDGRWLSTGSEDGIINVWDIGT 684

Query: 111 KTVLISFNGH-KSAITVLAFDTTGTRLISASKDSDIIVWDL 150
              L    GH K+AI  L++   G  LIS   D  + VWDL
Sbjct: 685 GKRLKQMRGHGKNAIYSLSYSKEGNVLISGGADHSVRVWDL 725

 Score = 34.7 bits (78), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 22/65 (33%), Positives = 32/65 (49%), Gaps = 11/65 (16%)

Query: 49  ILVWDIKTGEQIAQLTDGLPPGASDAKLSKPAETTFLKYHPETNLLAAGYADGVIKIWDL 108
           I VWDI TG+++ Q+         +A  S       L Y  E N+L +G AD  +++WDL
Sbjct: 677 INVWDIGTGKRLKQMRGH----GKNAIYS-------LSYSKEGNVLISGGADHSVRVWDL 725

Query: 109 ISKTV 113
              T 
Sbjct: 726 KKATT 730

>Ecym_2498 Chr2 complement(974601..976229) [1629 bp, 542 aa] {ON}
           similar to Ashbya gossypii AER263C
          Length = 542

 Score = 87.0 bits (214), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 97/436 (22%), Positives = 177/436 (40%), Gaps = 96/436 (22%)

Query: 87  YHPETN-LLAAGYADGVIKIWDLISKTVLISFNGHKSAITVLAFDTTGTRLISASKDSDI 145
           + P T+  +  G  D   +IWD  ++T + +  GH + +  +A+   G  + + S D+ I
Sbjct: 178 FAPHTSSRMVTGSGDNNARIWDCDTQTPIYTLKGHTNWVLCVAWSADGEVIATGSMDNTI 237

Query: 146 IVWDL-VGESGLYKLRSHKDAITGLWCE--------DENWLISTSKDGLVKIWDLKSQQC 196
            +WD   G+S    LR H   IT +  E        ++  + S SKDG +K+WD   +QC
Sbjct: 238 RLWDAQTGDSKGDALRGHSKWITSMSWEPIHLVTPGNKPRIASASKDGTIKVWDTVRRQC 297

Query: 197 VETHLAHTG--ECWSLGIIEDMAVTCSADSQVKLWKLDLQAENGSKLTEKGIIEKQS--- 251
           + T   HT    C   G  + +  T S D  ++ W  D+ A  G K     I++  +   
Sbjct: 298 ILTLSGHTSSVSCIKWG-GQGVIYTGSHDRTIRCW--DMNA--GGKCIN--ILKSHAHWV 350

Query: 252 KQRGVEIDFAVAPDGVKFFYIQNADKTIEIYRLRKEEEISRALKKREKRLQDKGMSEEEI 311
               +  D+A+        Y + A           EE   RALK  EK  +  G+ E   
Sbjct: 351 NHLSLSTDYALKVGAFDHTYSRPA---------TAEEAQKRALKNYEKVAKRNGVLE--- 398

Query: 312 KEAMGSPVSLMYHLFQVVRSPYKIKSAQWTVCSNSKLELVVTTSNNSIEYYSIPYSKREP 371
                                                EL+ T S++   Y   P    +P
Sbjct: 399 -------------------------------------ELIATASDDFTMYLWNPLKGTKP 421

Query: 372 TQPAPLKLHTIDLHGQRTDIRSTSISDDNKLLATAS-NGSLKIWNIKTKRCIRSF----- 425
                       + G +  +   + S D + + +AS + S+K+W   + + I +F     
Sbjct: 422 ---------LTRMTGHQKLVNHVAFSPDGRYIVSASFDNSIKLWEGSSGKFISTFRGHVA 472

Query: 426 ---ECGYALTCKFLPGGALVVVGTRNGELQLFDIASSTMLDNKEGAHDAAIWSLDLTSDG 482
              +  ++  C+ L      V  +++  L+++D+ +  +  +  G H+  ++++D ++DG
Sbjct: 473 SVYQVAWSSDCRLL------VSCSKDTTLKVWDVRTRKLAVDLPG-HNDEVYTVDWSADG 525

Query: 483 RKLVTGSADKTVRFWT 498
           + + +G  DK VR WT
Sbjct: 526 KSVCSGGKDKMVRLWT 541

 Score = 77.4 bits (189), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 66/284 (23%), Positives = 121/284 (42%), Gaps = 23/284 (8%)

Query: 401 KLLATASNGSLKIWNIKTKRCIRSFECGY--ALTCKFLPGGALVVVGTRNGELQLFDIAS 458
           ++ + + +G++K+W+   ++CI +   G+  +++C    G  ++  G+ +  ++ +D+ +
Sbjct: 277 RIASASKDGTIKVWDTVRRQCILTLS-GHTSSVSCIKWGGQGVIYTGSHDRTIRCWDMNA 335

Query: 459 STMLDNKEGAHDAAIWSLDLTSDGRKLVTGSADKTV-RFWTFEVSEVPVSDESNKTMPML 517
                N   +H   +  L L++D   L  G+ D T  R  T E ++        K     
Sbjct: 336 GGKCINILKSHAHWVNHLSLSTD-YALKVGAFDHTYSRPATAEEAQKRALKNYEKVAKRN 394

Query: 518 QLFHDTTLELDDDILSVVISPDDKFIAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSMD 577
            +  +      DD    + +P                  L   K    + GH+  V  + 
Sbjct: 395 GVLEELIATASDDFTMYLWNP------------------LKGTKPLTRMTGHQKLVNHVA 436

Query: 578 ISYDSKLIVTCSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLPESYNFFSCSKDATVK 637
            S D + IV+ S D +IK+W    G    +   H  S+  V +  +     SCSKD T+K
Sbjct: 437 FSPDGRYIVSASFDNSIKLWEGSSGKFISTFRGHVASVYQVAWSSDCRLLVSCSKDTTLK 496

Query: 638 YWDGQKFECIQKLAAHQSEVWSISVSNDGTFVISTGHDHSIRVW 681
            WD +  +    L  H  EV+++  S DG  V S G D  +R+W
Sbjct: 497 VWDVRTRKLAVDLPGHNDEVYTVDWSADGKSVCSGGKDKMVRLW 540

 Score = 69.3 bits (168), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 47/143 (32%), Positives = 67/143 (46%), Gaps = 11/143 (7%)

Query: 549 DNTVKVFFLDSMKFFLSLYGHKLPVLSMDISYDSKLIVTCSADKNIKIWGLDFGDCH-KS 607
           DN  +++  D+     +L GH   VL +  S D ++I T S D  I++W    GD    +
Sbjct: 192 DNNARIWDCDTQTPIYTLKGHTNWVLCVAWSADGEVIATGSMDNTIRLWDAQTGDSKGDA 251

Query: 608 LFAHQDSIMNVKFLP-------ESYNFFSCSKDATVKYWDGQKFECIQKLAAHQSEVWSI 660
           L  H   I ++ + P             S SKD T+K WD  + +CI  L+ H S V  I
Sbjct: 252 LRGHSKWITSMSWEPIHLVTPGNKPRIASASKDGTIKVWDTVRRQCILTLSGHTSSVSCI 311

Query: 661 SVSNDGTFVISTG-HDHSIRVWE 682
                G  VI TG HD +IR W+
Sbjct: 312 KWGGQG--VIYTGSHDRTIRCWD 332

 Score = 60.8 bits (146), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 60/231 (25%), Positives = 98/231 (42%), Gaps = 37/231 (16%)

Query: 34  KTGNLGQVIVGGLE-NILVWDIKTGEQIAQL--------------TD-GLPPGASDAKLS 77
           K G  G +  G  +  I  WD+  G +   +              TD  L  GA D   S
Sbjct: 312 KWGGQGVIYTGSHDRTIRCWDMNAGGKCINILKSHAHWVNHLSLSTDYALKVGAFDHTYS 371

Query: 78  KPA-----ETTFLKYHPET--------NLLAAGYADGVIKIWDLISKT-VLISFNGHKSA 123
           +PA     +   LK + +          L+A    D  + +W+ +  T  L    GH+  
Sbjct: 372 RPATAEEAQKRALKNYEKVAKRNGVLEELIATASDDFTMYLWNPLKGTKPLTRMTGHQKL 431

Query: 124 ITVLAFDTTGTRLISASKDSDIIVWDLVGESGLY--KLRSHKDAITGL-WCEDENWLIST 180
           +  +AF   G  ++SAS D+ I +W+  G SG +    R H  ++  + W  D   L+S 
Sbjct: 432 VNHVAFSPDGRYIVSASFDNSIKLWE--GSSGKFISTFRGHVASVYQVAWSSDCRLLVSC 489

Query: 181 SKDGLVKIWDLKSQQCVETHLAHTGECWSLGIIEDMAVTCSA--DSQVKLW 229
           SKD  +K+WD+++++       H  E +++    D    CS   D  V+LW
Sbjct: 490 SKDTTLKVWDVRTRKLAVDLPGHNDEVYTVDWSADGKSVCSGGKDKMVRLW 540

 Score = 52.8 bits (125), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 55/229 (24%), Positives = 93/229 (40%), Gaps = 34/229 (14%)

Query: 484 KLVTGSADKTVRFWTFEVSEVPVSDESNKTMPMLQLFHDTTLELDDDILSVVISPDDKFI 543
           ++VTGS D   R W           + +   P+  L   T       +L V  S D + I
Sbjct: 185 RMVTGSGDNNARIW-----------DCDTQTPIYTLKGHTNW-----VLCVAWSADGEVI 228

Query: 544 AVSLLDNTVKVFFLDSMKF-FLSLYGHKLPVLSMD-------ISYDSKLIVTCSADKNIK 595
           A   +DNT++++   +      +L GH   + SM           +   I + S D  IK
Sbjct: 229 ATGSMDNTIRLWDAQTGDSKGDALRGHSKWITSMSWEPIHLVTPGNKPRIASASKDGTIK 288

Query: 596 IWGLDFGDCHKSLFAHQDSIMNVKFLPESYNFFSCSKDATVKYWD-GQKFECIQKLAAHQ 654
           +W      C  +L  H  S+  +K+  +    ++ S D T++ WD     +CI  L +H 
Sbjct: 289 VWDTVRRQCILTLSGHTSSVSCIKWGGQGV-IYTGSHDRTIRCWDMNAGGKCINILKSHA 347

Query: 655 SEVWSISVSNDGTFVISTGHDHSIRVWEETEDQVFLEEEREKEMDEQYE 703
             V  +S+S D  + +  G       ++ T  +    EE +K   + YE
Sbjct: 348 HWVNHLSLSTD--YALKVG------AFDHTYSRPATAEEAQKRALKNYE 388

 Score = 51.6 bits (122), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 61/294 (20%), Positives = 115/294 (39%), Gaps = 52/294 (17%)

Query: 431 LTCKFLP-GGALVVVGTRNGELQLFDIASSTMLDNKEGAHDAAIWSLDLTSDGRKLVTGS 489
           L   F P   + +V G+ +   +++D  + T +   +G H   +  +  ++DG  + TGS
Sbjct: 174 LCSTFAPHTSSRMVTGSGDNNARIWDCDTQTPIYTLKG-HTNWVLCVAWSADGEVIATGS 232

Query: 490 ADKTVRFWTFEVSEVPVSDESNKTMPMLQLFHDTTLELDDDILSVVISPDDKFIAVSLLD 549
            D T+R W  +  +             L+        +  + + +V   +   IA +  D
Sbjct: 233 MDNTIRLWDAQTGD--------SKGDALRGHSKWITSMSWEPIHLVTPGNKPRIASASKD 284

Query: 550 NTVKVFFLDSMKFFLSLYGHKLPVLSMDISYDSKLIVTCSADKNIKIWGLDFGD-CHKSL 608
            T+KV+     +  L+L GH   V  +       +I T S D+ I+ W ++ G  C   L
Sbjct: 285 GTIKVWDTVRRQCILTLSGHTSSVSCIKWG-GQGVIYTGSHDRTIRCWDMNAGGKCINIL 343

Query: 609 FAHQ----------DSIMNVKFLPESYN-----------------------------FFS 629
            +H           D  + V     +Y+                               +
Sbjct: 344 KSHAHWVNHLSLSTDYALKVGAFDHTYSRPATAEEAQKRALKNYEKVAKRNGVLEELIAT 403

Query: 630 CSKDATVKYWDGQK-FECIQKLAAHQSEVWSISVSNDGTFVISTGHDHSIRVWE 682
            S D T+  W+  K  + + ++  HQ  V  ++ S DG +++S   D+SI++WE
Sbjct: 404 ASDDFTMYLWNPLKGTKPLTRMTGHQKLVNHVAFSPDGRYIVSASFDNSIKLWE 457

 Score = 48.1 bits (113), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 27/101 (26%), Positives = 49/101 (48%), Gaps = 1/101 (0%)

Query: 583 KLIVTCSADKNIKIWG-LDFGDCHKSLFAHQDSIMNVKFLPESYNFFSCSKDATVKYWDG 641
           +LI T S D  + +W  L        +  HQ  + +V F P+     S S D ++K W+G
Sbjct: 399 ELIATASDDFTMYLWNPLKGTKPLTRMTGHQKLVNHVAFSPDGRYIVSASFDNSIKLWEG 458

Query: 642 QKFECIQKLAAHQSEVWSISVSNDGTFVISTGHDHSIRVWE 682
              + I     H + V+ ++ S+D   ++S   D +++VW+
Sbjct: 459 SSGKFISTFRGHVASVYQVAWSSDCRLLVSCSKDTTLKVWD 499

 Score = 40.4 bits (93), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 32/136 (23%), Positives = 59/136 (43%), Gaps = 11/136 (8%)

Query: 565 SLYGHKLPVLSMDIS-YDSKLIVTCSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLPE 623
           ++ GH   +L    + + S  +VT S D N +IW  D      +L  H + ++ V +  +
Sbjct: 165 AIAGHSSTILCSTFAPHTSSRMVTGSGDNNARIWDCDTQTPIYTLKGHTNWVLCVAWSAD 224

Query: 624 SYNFFSCSKDATVKYWDGQKFECIQKLAAHQSEVWSISVSNDGTFVISTGH--------- 674
                + S D T++ WD Q  +         S+ W  S+S +   +++ G+         
Sbjct: 225 GEVIATGSMDNTIRLWDAQTGDSKGDALRGHSK-WITSMSWEPIHLVTPGNKPRIASASK 283

Query: 675 DHSIRVWEETEDQVFL 690
           D +I+VW+    Q  L
Sbjct: 284 DGTIKVWDTVRRQCIL 299

>Kpol_1013.37 s1013
           complement(88637..88936,88986..88994,89037..90134) [1407
           bp, 468 aa] {ON}
           complement(88637..88936,88986..88994,89037..90134) [1407
           nt, 469 aa]
          Length = 468

 Score = 86.7 bits (213), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 71/274 (25%), Positives = 117/274 (42%), Gaps = 30/274 (10%)

Query: 437 PGGALVVVGTRNGELQLFDIASSTMLDNKEGAHDAAIWSLDLTSDGRKLVTGSADKTVRF 496
           P G     G+  G++ +F+  +   +      H   I  +D +SD R LV+G  D  V+ 
Sbjct: 191 PEGTCTAAGSWAGDISIFNTKTLAPVITSRETHSGKISGIDWSSDSRHLVSGGEDGIVKL 250

Query: 497 WTFEVSEVPVSDE--------SNKTMPMLQLF-----HDTTLELDD-------------- 529
           + F+ + + V+          +N      Q +      DTT  L D              
Sbjct: 251 YNFDSNSIQVATSFIGHDARVTNVKFHPSQKYIGSASFDTTWRLWDIVTNSELLLQEGHS 310

Query: 530 -DILSVVISPDDKFIAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSMDISYDSKLIVTC 588
            +I S+    D   IA +  D    ++ L S K  LSL GH  P+   D S +       
Sbjct: 311 KEIYSLSFQTDGSLIATAGADKVGIIWDLRSGKNILSLVGHAKPIYCSDWSQNG-YQXXX 369

Query: 589 SADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLPESYNFF-SCSKDATVKYWDGQKFECI 647
           S D  IKIW L   D  +++ AH++ + ++KF  E+  F  S S D  +  +    +  I
Sbjct: 370 SGDGTIKIWDLRKVDDVETILAHKNVVTDLKFEKENSKFLISSSYDKDINVFSSDSWVKI 429

Query: 648 QKLAAHQSEVWSISVSNDGTFVISTGHDHSIRVW 681
             L  H  ++ SI +S+D   ++S G D S+++W
Sbjct: 430 HTLQGHNDKILSIDISSDYQTIVSGGWDRSVKLW 463

 Score = 72.8 bits (177), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 41/127 (32%), Positives = 62/127 (48%), Gaps = 6/127 (4%)

Query: 80  AETTFLKYHPETNLLAAGYADGVIKIWDLISKTVLISFNGHKSAITVLAFDTTGTRLISA 139
           A  T +K+HP    + +   D   ++WD+++ + L+   GH   I  L+F T G+ + +A
Sbjct: 269 ARVTNVKFHPSQKYIGSASFDTTWRLWDIVTNSELLLQEGHSKEIYSLSFQTDGSLIATA 328

Query: 140 SKDSDIIVWDLVGESGLYKLRSHKDAITGLWCED---ENWLISTSKDGLVKIWDLKSQQC 196
             D   I+WDL     +  L  H   I   +C D     +    S DG +KIWDL+    
Sbjct: 329 GADKVGIIWDLRSGKNILSLVGHAKPI---YCSDWSQNGYQXXXSGDGTIKIWDLRKVDD 385

Query: 197 VETHLAH 203
           VET LAH
Sbjct: 386 VETILAH 392

 Score = 56.2 bits (134), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 57/234 (24%), Positives = 97/234 (41%), Gaps = 31/234 (13%)

Query: 397 SDDNKLLATASNGSLKIWNIKTK--RCIRSF--ECGYALTCKFLPGGALVVVGTRNGELQ 452
           SD   L++   +G +K++N  +   +   SF          KF P    +   + +   +
Sbjct: 234 SDSRHLVSGGEDGIVKLYNFDSNSIQVATSFIGHDARVTNVKFHPSQKYIGSASFDTTWR 293

Query: 453 LFDIASSTMLDNKEGAHDAAIWSLDLTSDGRKLVTGSADKTVRFWTFEVSE--------- 503
           L+DI +++ L  +EG H   I+SL   +DG  + T  ADK    W     +         
Sbjct: 294 LWDIVTNSELLLQEG-HSKEIYSLSFQTDGSLIATAGADKVGIIWDLRSGKNILSLVGHA 352

Query: 504 --VPVSDESNKTMPMLQLFHDTT----LELDDDILSVVI-----------SPDDKFIAVS 546
             +  SD S            T     L   DD+ +++              + KF+  S
Sbjct: 353 KPIYCSDWSQNGYQXXXSGDGTIKIWDLRKVDDVETILAHKNVVTDLKFEKENSKFLISS 412

Query: 547 LLDNTVKVFFLDSMKFFLSLYGHKLPVLSMDISYDSKLIVTCSADKNIKIWGLD 600
             D  + VF  DS     +L GH   +LS+DIS D + IV+   D+++K+W ++
Sbjct: 413 SYDKDINVFSSDSWVKIHTLQGHNDKILSIDISSDYQTIVSGGWDRSVKLWSME 466

 Score = 55.5 bits (132), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 47/202 (23%), Positives = 91/202 (45%), Gaps = 14/202 (6%)

Query: 85  LKYHPETNLLAAGYADGVIKIWDLISKTVLI--SFNGHKSAITVLAFDTTGTRLISASKD 142
           + +  ++  L +G  DG++K+++  S ++ +  SF GH + +T + F  +   + SAS D
Sbjct: 230 IDWSSDSRHLVSGGEDGIVKLYNFDSNSIQVATSFIGHDARVTNVKFHPSQKYIGSASFD 289

Query: 143 SDIIVWDLVGESGLYKLRSHKDAITGLWCEDENWLISTS-KDGLVKIWDLKSQQCVETHL 201
           +   +WD+V  S L     H   I  L  + +  LI+T+  D +  IWDL+S + + + +
Sbjct: 290 TTWRLWDIVTNSELLLQEGHSKEIYSLSFQTDGSLIATAGADKVGIIWDLRSGKNILSLV 349

Query: 202 AHTGECWSLGIIED-MAVTCSADSQVKLWKLDLQAENGSKLTEKGIIEKQSKQRGVEIDF 260
            H    +     ++      S D  +K+W L    +  + L  K ++           D 
Sbjct: 350 GHAKPIYCSDWSQNGYQXXXSGDGTIKIWDLRKVDDVETILAHKNVV----------TDL 399

Query: 261 AVAPDGVKFFYIQNADKTIEIY 282
               +  KF    + DK I ++
Sbjct: 400 KFEKENSKFLISSSYDKDINVF 421

 Score = 52.8 bits (125), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 38/155 (24%), Positives = 63/155 (40%), Gaps = 3/155 (1%)

Query: 531 ILSVVISPDDKFIAVSLLDNTVKVFFLDSMK-FFLSLYGHKLPVLSMDISYDSKLIVTCS 589
           I  + ISP+    A       + +F   ++     S   H   +  +D S DS+ +V+  
Sbjct: 184 ISKICISPEGTCTAAGSWAGDISIFNTKTLAPVITSRETHSGKISGIDWSSDSRHLVSGG 243

Query: 590 ADKNIKIWGLDFGDCH--KSLFAHQDSIMNVKFLPESYNFFSCSKDATVKYWDGQKFECI 647
            D  +K++  D        S   H   + NVKF P      S S D T + WD      +
Sbjct: 244 EDGIVKLYNFDSNSIQVATSFIGHDARVTNVKFHPSQKYIGSASFDTTWRLWDIVTNSEL 303

Query: 648 QKLAAHQSEVWSISVSNDGTFVISTGHDHSIRVWE 682
                H  E++S+S   DG+ + + G D    +W+
Sbjct: 304 LLQEGHSKEIYSLSFQTDGSLIATAGADKVGIIWD 338

 Score = 46.6 bits (109), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 37/146 (25%), Positives = 64/146 (43%), Gaps = 15/146 (10%)

Query: 50  LVWDIKTGEQIAQLTDGLPPGASDAKLSKPAETTFLKYHPETNLLAAGYADGVIKIWDLI 109
           ++WD+++G+ I  L     P              +     +         DG IKIWDL 
Sbjct: 335 IIWDLRSGKNILSLVGHAKP-------------IYCSDWSQNGYQXXXSGDGTIKIWDLR 381

Query: 110 SKTVLISFNGHKSAITVLAFDTTGTR-LISASKDSDIIVWDLVGESGLYKLRSHKDAITG 168
               + +   HK+ +T L F+   ++ LIS+S D DI V+       ++ L+ H D I  
Sbjct: 382 KVDDVETILAHKNVVTDLKFEKENSKFLISSSYDKDINVFSSDSWVKIHTLQGHNDKILS 441

Query: 169 L-WCEDENWLISTSKDGLVKIWDLKS 193
           +    D   ++S   D  VK+W +++
Sbjct: 442 IDISSDYQTIVSGGWDRSVKLWSMEA 467

>SAKL0H09988g Chr8 complement(853060..855309) [2250 bp, 749 aa] {ON}
           similar to uniprot|P38129 Saccharomyces cerevisiae
           YBR198C TAF5 Subunit (90 kDa) of TFIID and SAGA
           complexes involved in RNA polymerase II transcription
           initiation and in chromatin modification
          Length = 749

 Score = 87.4 bits (215), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 66/300 (22%), Positives = 126/300 (42%), Gaps = 33/300 (11%)

Query: 421 CIRSFE-CGYALTC-KFLPGGALVVVGTRNGELQLFDIASSTMLDNKEGA---------- 468
           C+ +F      +TC +F     L   G ++  ++L+ +   T LD+K  +          
Sbjct: 413 CMYTFHNTNRDMTCLEFSDDATLAAAGFQDSYIKLWSL-DGTPLDSKLPSKQREKINNTT 471

Query: 469 ---HDAAIWSLDLTSDGRKLVTGSADKTVRFWTFEVSEVPVSDESNKTMPMLQLFHDTTL 525
              H   ++S   + D + L++ S DKTVR W+ +     VS + +              
Sbjct: 472 LIGHSGTVYSTSFSPDNKYLLSASEDKTVRLWSMDTYSSLVSYKGH-------------- 517

Query: 526 ELDDDILSVVISPDDKFIAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSMDISYDSKLI 585
             +  +  V  SP   + A +  D T +++  D +       GH   V  +    +   +
Sbjct: 518 --NHPVWDVSFSPLGHYFATASHDQTARLWSCDHIYPLRIFAGHLNDVDCVSFHPNGTYV 575

Query: 586 VTCSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLPESYNFFSCSKDATVKYWDGQKFE 645
            T S DK  ++W +  GD  +    H   +++    P+     + S+D  +  WD    +
Sbjct: 576 FTGSTDKTCRMWDIGTGDSVRLFLGHTAPVISTAVSPDGRWLSTGSEDGIINVWDIGTGK 635

Query: 646 CIQKLAAH-QSEVWSISVSNDGTFVISTGHDHSIRVWEETEDQVFLEEEREKEMDEQYED 704
            ++++  H ++ V+S+S S +GT ++S G DHS+RVW+          E E+     + D
Sbjct: 636 RLKQMRGHGKNAVYSLSYSKEGTVLVSGGADHSVRVWDLKRSTAEPNTEPEQPFTSYFGD 695

 Score = 64.3 bits (155), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 61/282 (21%), Positives = 113/282 (40%), Gaps = 72/282 (25%)

Query: 364 IPYSKREPTQPAPLKLHTIDLHGQRTDIRSTSISDDNKLLATAS-NGSLKIWNIKTKRCI 422
           +P  +RE       K++   L G    + STS S DNK L +AS + ++++W++ T   +
Sbjct: 459 LPSKQRE-------KINNTTLIGHSGTVYSTSFSPDNKYLLSASEDKTVRLWSMDTYSSL 511

Query: 423 RSFECGYALTCKFLPGGALVVVGTRNGELQLFDIASSTMLDNKEGAHDAAIWSLDLTSDG 482
            S++                                          H+  +W +  +  G
Sbjct: 512 VSYK-----------------------------------------GHNHPVWDVSFSPLG 530

Query: 483 RKLVTGSADKTVRFWTFEVSEVPVSDESNKTMPMLQLFHDTTLELDDDILSVVISPDDKF 542
               T S D+T R W+ +              P L++F        +D+  V   P+  +
Sbjct: 531 HYFATASHDQTARLWSCD-----------HIYP-LRIFAGHL----NDVDCVSFHPNGTY 574

Query: 543 IAVSLLDNTVKVFFL---DSMKFFLSLYGHKLPVLSMDISYDSKLIVTCSADKNIKIWGL 599
           +     D T +++ +   DS++ FL   GH  PV+S  +S D + + T S D  I +W +
Sbjct: 575 VFTGSTDKTCRMWDIGTGDSVRLFL---GHTAPVISTAVSPDGRWLSTGSEDGIINVWDI 631

Query: 600 DFGDCHKSLFAH-QDSIMNVKFLPESYNFFSCSKDATVKYWD 640
             G   K +  H ++++ ++ +  E     S   D +V+ WD
Sbjct: 632 GTGKRLKQMRGHGKNAVYSLSYSKEGTVLVSGGADHSVRVWD 673

 Score = 59.7 bits (143), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 40/159 (25%), Positives = 72/159 (45%), Gaps = 9/159 (5%)

Query: 376 PLKLHTIDLHGQRTDIRSTSISDDNKLLATAS-NGSLKIWNIKTKRCIRSF--ECGYALT 432
           PL++      G   D+   S   +   + T S + + ++W+I T   +R F       ++
Sbjct: 552 PLRI----FAGHLNDVDCVSFHPNGTYVFTGSTDKTCRMWDIGTGDSVRLFLGHTAPVIS 607

Query: 433 CKFLPGGALVVVGTRNGELQLFDIASSTMLDNKEGAHDAAIWSLDLTSDGRKLVTGSADK 492
               P G  +  G+ +G + ++DI +   L    G    A++SL  + +G  LV+G AD 
Sbjct: 608 TAVSPDGRWLSTGSEDGIINVWDIGTGKRLKQMRGHGKNAVYSLSYSKEGTVLVSGGADH 667

Query: 493 TVRFWTFEVSEVPVSDESNKTMPMLQLFHDTTLELDDDI 531
           +VR W  + S    + E  +  P    F D T  +++DI
Sbjct: 668 SVRVWDLKRSTAEPNTEPEQ--PFTSYFGDATTSVNNDI 704

 Score = 56.2 bits (134), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 37/151 (24%), Positives = 67/151 (44%), Gaps = 4/151 (2%)

Query: 85  LKYHPETNLLAAGYADGVIKIWDLISKTVLISFNGHKSAITVLAFDTTGTRLISASKDSD 144
           + + P  +  A    D   ++W       L  F GH + +  ++F   GT + + S D  
Sbjct: 524 VSFSPLGHYFATASHDQTARLWSCDHIYPLRIFAGHLNDVDCVSFHPNGTYVFTGSTDKT 583

Query: 145 IIVWDL-VGESGLYKLRSHKDAITGLWCEDENWLISTSKDGLVKIWDLKSQQCVETHLAH 203
             +WD+  G+S    L      I+     D  WL + S+DG++ +WD+ + + ++    H
Sbjct: 584 CRMWDIGTGDSVRLFLGHTAPVISTAVSPDGRWLSTGSEDGIINVWDIGTGKRLKQMRGH 643

Query: 204 -TGECWSLGIIEDMAVTCS--ADSQVKLWKL 231
                +SL   ++  V  S  AD  V++W L
Sbjct: 644 GKNAVYSLSYSKEGTVLVSGGADHSVRVWDL 674

 Score = 55.8 bits (133), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 32/110 (29%), Positives = 55/110 (50%), Gaps = 2/110 (1%)

Query: 85  LKYHPETNLLAAGYADGVIKIWDLISKTVLISFNGHKSAITVLAFDTTGTRLISASKDSD 144
           + +HP    +  G  D   ++WD+ +   +  F GH + +   A    G  L + S+D  
Sbjct: 566 VSFHPNGTYVFTGSTDKTCRMWDIGTGDSVRLFLGHTAPVISTAVSPDGRWLSTGSEDGI 625

Query: 145 IIVWDLVGESGLYKLRSH-KDAITGL-WCEDENWLISTSKDGLVKIWDLK 192
           I VWD+     L ++R H K+A+  L + ++   L+S   D  V++WDLK
Sbjct: 626 INVWDIGTGKRLKQMRGHGKNAVYSLSYSKEGTVLVSGGADHSVRVWDLK 675

 Score = 53.5 bits (127), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 32/151 (21%), Positives = 63/151 (41%), Gaps = 9/151 (5%)

Query: 87  YHPETNLLAAGYADGVIKIWDLISKTVLISFNGHKSAITVLAFDTTGTRLISASKDSDII 146
           + P+   L +   D  +++W + + + L+S+ GH   +  ++F   G    +AS D    
Sbjct: 484 FSPDNKYLLSASEDKTVRLWSMDTYSSLVSYKGHNHPVWDVSFSPLGHYFATASHDQTAR 543

Query: 147 VWDLVGESGLYKLRSHKDAITGLWC----EDENWLISTSKDGLVKIWDLKSQQCVETHLA 202
           +W       +Y LR     +  + C     +  ++ + S D   ++WD+ +   V   L 
Sbjct: 544 LWSC---DHIYPLRIFAGHLNDVDCVSFHPNGTYVFTGSTDKTCRMWDIGTGDSVRLFLG 600

Query: 203 HTGECWSLGIIEDMA--VTCSADSQVKLWKL 231
           HT    S  +  D     T S D  + +W +
Sbjct: 601 HTAPVISTAVSPDGRWLSTGSEDGIINVWDI 631

 Score = 47.4 bits (111), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 37/170 (21%), Positives = 65/170 (38%), Gaps = 22/170 (12%)

Query: 81  ETTFLKYHPETNLLAAGYADGVIKIWDL----------------ISKTVLISFNGHKSAI 124
           + T L++  +  L AAG+ D  IK+W L                I+ T LI   GH   +
Sbjct: 423 DMTCLEFSDDATLAAAGFQDSYIKLWSLDGTPLDSKLPSKQREKINNTTLI---GHSGTV 479

Query: 125 TVLAFDTTGTRLISASKDSDIIVWDLVGESGLYKLRSHKDAITGL-WCEDENWLISTSKD 183
              +F      L+SAS+D  + +W +   S L   + H   +  + +    ++  + S D
Sbjct: 480 YSTSFSPDNKYLLSASEDKTVRLWSMDTYSSLVSYKGHNHPVWDVSFSPLGHYFATASHD 539

Query: 184 GLVKIWDLKSQQCVETHLAHTG--ECWSLGIIEDMAVTCSADSQVKLWKL 231
              ++W       +     H    +C S         T S D   ++W +
Sbjct: 540 QTARLWSCDHIYPLRIFAGHLNDVDCVSFHPNGTYVFTGSTDKTCRMWDI 589

 Score = 40.8 bits (94), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 31/135 (22%), Positives = 53/135 (39%), Gaps = 16/135 (11%)

Query: 114 LISFNGHKSAITVLAFDTTGTRLISASKDSDIIVWDLVGESGLYKLRS------------ 161
           + +F+     +T L F    T   +  +DS I +W L G     KL S            
Sbjct: 414 MYTFHNTNRDMTCLEFSDDATLAAAGFQDSYIKLWSLDGTPLDSKLPSKQREKINNTTLI 473

Query: 162 -HKDAI-TGLWCEDENWLISTSKDGLVKIWDLKSQQCVETHLAHTGECW--SLGIIEDMA 217
            H   + +  +  D  +L+S S+D  V++W + +   + ++  H    W  S   +    
Sbjct: 474 GHSGTVYSTSFSPDNKYLLSASEDKTVRLWSMDTYSSLVSYKGHNHPVWDVSFSPLGHYF 533

Query: 218 VTCSADSQVKLWKLD 232
            T S D   +LW  D
Sbjct: 534 ATASHDQTARLWSCD 548

 Score = 32.7 bits (73), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 21/65 (32%), Positives = 31/65 (47%), Gaps = 11/65 (16%)

Query: 49  ILVWDIKTGEQIAQLTDGLPPGASDAKLSKPAETTFLKYHPETNLLAAGYADGVIKIWDL 108
           I VWDI TG+++ Q+         +A  S       L Y  E  +L +G AD  +++WDL
Sbjct: 626 INVWDIGTGKRLKQMRGH----GKNAVYS-------LSYSKEGTVLVSGGADHSVRVWDL 674

Query: 109 ISKTV 113
              T 
Sbjct: 675 KRSTA 679

>TPHA0I01880 Chr9 complement(418620..421724) [3105 bp, 1034 aa] {ON}
           Anc_8.544 YBR198C
          Length = 1034

 Score = 87.8 bits (216), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 55/209 (26%), Positives = 97/209 (46%), Gaps = 4/209 (1%)

Query: 475 SLDLTSDGRKLVTGSADKTVRFWTFEVSEVPVSDESNKTMPMLQLFHDTTLELDDDILSV 534
           SLD +SD     TG  D  ++ W+ E + +   +E+ +    +     T +   D + SV
Sbjct: 710 SLDFSSDYTLAATGFQDSYIKIWSLEGTSI---NENEQNYSQINSIFKTLVGHSDAVYSV 766

Query: 535 VISPDDKFIAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSMDIS-YDSKLIVTCSADKN 593
             SP ++F+     D T +++  D+ K  +S  GH+ P+  ++ S   + L  T S+D  
Sbjct: 767 NFSPCNRFLLSGSGDKTARLWSTDTYKGLVSYKGHEKPIWDVNFSPTGNNLFATASSDNT 826

Query: 594 IKIWGLDFGDCHKSLFAHQDSIMNVKFLPESYNFFSCSKDATVKYWDGQKFECIQKLAAH 653
            ++W  D     + L  H   +  V F P     F+ S D T + WD    + ++    H
Sbjct: 827 ARVWSCDRVYPVRILAGHLSDVDCVSFHPNGQYVFTGSSDKTSRMWDLSSGDSVRLFIGH 886

Query: 654 QSEVWSISVSNDGTFVISTGHDHSIRVWE 682
            S V + +VS DG ++ +   D +I VW+
Sbjct: 887 SSAVTATAVSPDGRWLSTANEDGTITVWD 915

 Score = 84.0 bits (206), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 53/217 (24%), Positives = 102/217 (47%), Gaps = 18/217 (8%)

Query: 468 AHDAAIWSLDLTSDGRKLVTGSADKTVRFWTFEVSEVPVSDESNKTMPMLQLFHDTTLEL 527
            H  A++S++ +   R L++GS DKT R W+ +  +  VS + +                
Sbjct: 758 GHSDAVYSVNFSPCNRFLLSGSGDKTARLWSTDTYKGLVSYKGH---------------- 801

Query: 528 DDDILSVVISP-DDKFIAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSMDISYDSKLIV 586
           +  I  V  SP  +   A +  DNT +V+  D +     L GH   V  +    + + + 
Sbjct: 802 EKPIWDVNFSPTGNNLFATASSDNTARVWSCDRVYPVRILAGHLSDVDCVSFHPNGQYVF 861

Query: 587 TCSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLPESYNFFSCSKDATVKYWDGQKFEC 646
           T S+DK  ++W L  GD  +    H  ++      P+     + ++D T+  WD    + 
Sbjct: 862 TGSSDKTSRMWDLSSGDSVRLFIGHSSAVTATAVSPDGRWLSTANEDGTITVWDIGSGKK 921

Query: 647 IQKLAAH-QSEVWSISVSNDGTFVISTGHDHSIRVWE 682
           ++ +  H ++ ++S+S +  G  ++S+G D+S+RVW+
Sbjct: 922 LKSMRGHGKNSIYSLSYNKTGNILVSSGADNSVRVWD 958

 Score = 68.2 bits (165), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 37/110 (33%), Positives = 59/110 (53%), Gaps = 2/110 (1%)

Query: 85  LKYHPETNLLAAGYADGVIKIWDLISKTVLISFNGHKSAITVLAFDTTGTRLISASKDSD 144
           + +HP    +  G +D   ++WDL S   +  F GH SA+T  A    G  L +A++D  
Sbjct: 851 VSFHPNGQYVFTGSSDKTSRMWDLSSGDSVRLFIGHSSAVTATAVSPDGRWLSTANEDGT 910

Query: 145 IIVWDLVGESGLYKLRSH-KDAITGL-WCEDENWLISTSKDGLVKIWDLK 192
           I VWD+     L  +R H K++I  L + +  N L+S+  D  V++WD+K
Sbjct: 911 ITVWDIGSGKKLKSMRGHGKNSIYSLSYNKTGNILVSSGADNSVRVWDIK 960

 Score = 51.6 bits (122), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 39/169 (23%), Positives = 70/169 (41%), Gaps = 17/169 (10%)

Query: 70  GASDAKLSKPAETTFLKYHPETNLLAAGYADGVIKIWDLISKTVLISFNGHKSAITVLAF 129
           G SDA  S       + + P    L +G  D   ++W   +   L+S+ GH+  I  + F
Sbjct: 758 GHSDAVYS-------VNFSPCNRFLLSGSGDKTARLWSTDTYKGLVSYKGHEKPIWDVNF 810

Query: 130 DTTGTRLI-SASKDSDIIVWDLVGESGLYKLRSHKDAITGLWC----EDENWLISTSKDG 184
             TG  L  +AS D+   VW       +Y +R     ++ + C     +  ++ + S D 
Sbjct: 811 SPTGNNLFATASSDNTARVWSC---DRVYPVRILAGHLSDVDCVSFHPNGQYVFTGSSDK 867

Query: 185 LVKIWDLKSQQCVETHLAHTGECWSLGIIEDMA--VTCSADSQVKLWKL 231
             ++WDL S   V   + H+    +  +  D     T + D  + +W +
Sbjct: 868 TSRMWDLSSGDSVRLFIGHSSAVTATAVSPDGRWLSTANEDGTITVWDI 916

 Score = 47.4 bits (111), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 49/217 (22%), Positives = 77/217 (35%), Gaps = 28/217 (12%)

Query: 85  LKYHPETNLLAAGYADGVIKIWDLIS-------------KTVLISFNGHKSAITVLAFDT 131
           L +  +  L A G+ D  IKIW L                ++  +  GH  A+  + F  
Sbjct: 711 LDFSSDYTLAATGFQDSYIKIWSLEGTSINENEQNYSQINSIFKTLVGHSDAVYSVNFSP 770

Query: 132 TGTRLISASKDSDIIVWDLVGESGLYKLRSHKDAI--TGLWCEDENWLISTSKDGLVKIW 189
               L+S S D    +W      GL   + H+  I          N   + S D   ++W
Sbjct: 771 CNRFLLSGSGDKTARLWSTDTYKGLVSYKGHEKPIWDVNFSPTGNNLFATASSDNTARVW 830

Query: 190 DLKSQQCVETHLAHTG--ECWSLGIIEDMAVTCSADSQVKLWKLDLQAENGSKLTEKGII 247
                  V     H    +C S         T S+D   ++W  DL + +  +L     I
Sbjct: 831 SCDRVYPVRILAGHLSDVDCVSFHPNGQYVFTGSSDKTSRMW--DLSSGDSVRL----FI 884

Query: 248 EKQSKQRGVEIDFAVAPDGVKFFYIQNADKTIEIYRL 284
              S         AV+PDG ++    N D TI ++ +
Sbjct: 885 GHSSAVTAT----AVSPDG-RWLSTANEDGTITVWDI 916

 Score = 45.8 bits (107), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 38/152 (25%), Positives = 71/152 (46%), Gaps = 7/152 (4%)

Query: 384 LHGQRTDIRSTSISDDNKLLAT-ASNGSLKIWNIKTKRCIRSFECGY--ALTCKFL-PGG 439
           L G  +D+   S   + + + T +S+ + ++W++ +   +R F  G+  A+T   + P G
Sbjct: 841 LAGHLSDVDCVSFHPNGQYVFTGSSDKTSRMWDLSSGDSVRLF-IGHSSAVTATAVSPDG 899

Query: 440 ALVVVGTRNGELQLFDIASSTMLDNKEGAHDAAIWSLDLTSDGRKLVTGSADKTVRFWTF 499
             +     +G + ++DI S   L +  G    +I+SL     G  LV+  AD +VR W  
Sbjct: 900 RWLSTANEDGTITVWDIGSGKKLKSMRGHGKNSIYSLSYNKTGNILVSSGADNSVRVWDI 959

Query: 500 EVSEVPVSDESNKTMPMLQLFHDTTLELDDDI 531
           + +    S E  +  P L   +D    ++ DI
Sbjct: 960 KKNTHEPSLEPEEIYPGLG--NDNVTSMNQDI 989

 Score = 35.4 bits (80), Expect = 0.88,   Method: Compositional matrix adjust.
 Identities = 27/136 (19%), Positives = 58/136 (42%), Gaps = 17/136 (12%)

Query: 114 LISFNGHKSAITVLAFDTTGTRLISASKDSDIIVWDLVGES------------GLYK-LR 160
           + ++   +  ++ L F +  T   +  +DS I +W L G S             ++K L 
Sbjct: 698 MYTYTNTEKNMSSLDFSSDYTLAATGFQDSYIKIWSLEGTSINENEQNYSQINSIFKTLV 757

Query: 161 SHKDAITGL-WCEDENWLISTSKDGLVKIWDLKSQQCVETHLAHTGECWSLGII---EDM 216
            H DA+  + +     +L+S S D   ++W   + + + ++  H    W +       ++
Sbjct: 758 GHSDAVYSVNFSPCNRFLLSGSGDKTARLWSTDTYKGLVSYKGHEKPIWDVNFSPTGNNL 817

Query: 217 AVTCSADSQVKLWKLD 232
             T S+D+  ++W  D
Sbjct: 818 FATASSDNTARVWSCD 833

>CAGL0M05335g Chr13 complement(569132..571552) [2421 bp, 806 aa]
           {ON} similar to uniprot|P38129 Saccharomyces cerevisiae
           YBR198c Transcription initiation factor TFIID 90
          Length = 806

 Score = 87.4 bits (215), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 70/303 (23%), Positives = 127/303 (41%), Gaps = 45/303 (14%)

Query: 384 LHGQRTDIRSTSISDDNKLLATASNGS-LKIWNIKTKRCIRSFECGYALTCKFLPGGALV 442
            H    D+ S   SDD +L A     S +KIW+                    L G +L+
Sbjct: 469 FHNTNRDMTSLEFSDDCRLAAAGFQDSYIKIWS--------------------LDGSSLI 508

Query: 443 VVGTRNGELQLF--DIASSTMLDNKEGAHDAAIWSLDLTSDGRKLVTGSADKTVRFWTFE 500
                + +   F  D   ST++      H   ++S   + D   LV+GS DKTV+ W+ +
Sbjct: 509 NPKYSSSQFDRFSQDNTCSTLV-----GHSGTVYSTSFSPDNMYLVSGSEDKTVKLWSMD 563

Query: 501 VSEVPVSDESNKTMPMLQLFHDTTLELDDDILSVVISPDDKFIAVSLLDNTVKVFFLDSM 560
                V+ + +                +  +  V  SP   + A +  D T +++  D +
Sbjct: 564 THTALVNYKGH----------------NHPVWDVKFSPLGHYFASASHDQTARLWACDHI 607

Query: 561 KFFLSLYGHKLPVLSMDISYDSKLIVTCSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKF 620
                  GH   V ++    +   + T S+DK  ++W +  GD  +    H   +++ + 
Sbjct: 608 YPLRIFAGHTNDVDTVSFHPNGCYVFTGSSDKTCRMWDVSTGDSVRLFLGHTAPVLSTQV 667

Query: 621 LPESYNFFSCSKDATVKYWDGQKFECIQKLAAH-QSEVWSISVSNDGTFVISTGHDHSIR 679
            P+     + S+D  +  WD    + I+++  H ++ V S+S + +G  +IS G DHS+R
Sbjct: 668 SPDGRWLATGSEDGVICLWDIGTGKRIKQMRGHGKNAVHSLSFNKEGNVLISGGADHSVR 727

Query: 680 VWE 682
           VW+
Sbjct: 728 VWD 730

 Score = 72.4 bits (176), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 50/193 (25%), Positives = 84/193 (43%), Gaps = 23/193 (11%)

Query: 517 LQLFHDTTLELDDDILSVVISPDDKFIAVSLLDNTVKVFFLDSMKFF------------- 563
           +  FH+T    + D+ S+  S D +  A    D+ +K++ LD                  
Sbjct: 466 MYTFHNT----NRDMTSLEFSDDCRLAAAGFQDSYIKIWSLDGSSLINPKYSSSQFDRFS 521

Query: 564 -----LSLYGHKLPVLSMDISYDSKLIVTCSADKNIKIWGLDFGDCHKSLFAHQDSIMNV 618
                 +L GH   V S   S D+  +V+ S DK +K+W +D      +   H   + +V
Sbjct: 522 QDNTCSTLVGHSGTVYSTSFSPDNMYLVSGSEDKTVKLWSMDTHTALVNYKGHNHPVWDV 581

Query: 619 KFLPESYNFFSCSKDATVKYWDGQKFECIQKLAAHQSEVWSISVSNDGTFVISTGHDHSI 678
           KF P  + F S S D T + W       ++  A H ++V ++S   +G +V +   D + 
Sbjct: 582 KFSPLGHYFASASHDQTARLWACDHIYPLRIFAGHTNDVDTVSFHPNGCYVFTGSSDKTC 641

Query: 679 RVWE-ETEDQVFL 690
           R+W+  T D V L
Sbjct: 642 RMWDVSTGDSVRL 654

 Score = 56.2 bits (134), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 38/151 (25%), Positives = 64/151 (42%), Gaps = 9/151 (5%)

Query: 87  YHPETNLLAAGYADGVIKIWDLISKTVLISFNGHKSAITVLAFDTTGTRLISASKDSDII 146
           + P+   L +G  D  +K+W + + T L+++ GH   +  + F   G    SAS D    
Sbjct: 541 FSPDNMYLVSGSEDKTVKLWSMDTHTALVNYKGHNHPVWDVKFSPLGHYFASASHDQTAR 600

Query: 147 VWDLVGESGLYKLR---SH-KDAITGLWCEDENWLISTSKDGLVKIWDLKSQQCVETHLA 202
           +W       +Y LR    H  D  T  +  +  ++ + S D   ++WD+ +   V   L 
Sbjct: 601 LWAC---DHIYPLRIFAGHTNDVDTVSFHPNGCYVFTGSSDKTCRMWDVSTGDSVRLFLG 657

Query: 203 HTGECWSLGIIEDMA--VTCSADSQVKLWKL 231
           HT    S  +  D     T S D  + LW +
Sbjct: 658 HTAPVLSTQVSPDGRWLATGSEDGVICLWDI 688

 Score = 53.1 bits (126), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 30/110 (27%), Positives = 56/110 (50%), Gaps = 2/110 (1%)

Query: 85  LKYHPETNLLAAGYADGVIKIWDLISKTVLISFNGHKSAITVLAFDTTGTRLISASKDSD 144
           + +HP    +  G +D   ++WD+ +   +  F GH + +        G  L + S+D  
Sbjct: 623 VSFHPNGCYVFTGSSDKTCRMWDVSTGDSVRLFLGHTAPVLSTQVSPDGRWLATGSEDGV 682

Query: 145 IIVWDLVGESGLYKLRSH-KDAITGL-WCEDENWLISTSKDGLVKIWDLK 192
           I +WD+     + ++R H K+A+  L + ++ N LIS   D  V++WD+K
Sbjct: 683 ICLWDIGTGKRIKQMRGHGKNAVHSLSFNKEGNVLISGGADHSVRVWDVK 732

 Score = 52.4 bits (124), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 31/125 (24%), Positives = 59/125 (47%), Gaps = 7/125 (5%)

Query: 376 PLKLHTIDLHGQRTDIRSTSISDDNKLLAT-ASNGSLKIWNIKTKRCIRSF--ECGYALT 432
           PL++      G   D+ + S   +   + T +S+ + ++W++ T   +R F       L+
Sbjct: 609 PLRI----FAGHTNDVDTVSFHPNGCYVFTGSSDKTCRMWDVSTGDSVRLFLGHTAPVLS 664

Query: 433 CKFLPGGALVVVGTRNGELQLFDIASSTMLDNKEGAHDAAIWSLDLTSDGRKLVTGSADK 492
            +  P G  +  G+ +G + L+DI +   +    G    A+ SL    +G  L++G AD 
Sbjct: 665 TQVSPDGRWLATGSEDGVICLWDIGTGKRIKQMRGHGKNAVHSLSFNKEGNVLISGGADH 724

Query: 493 TVRFW 497
           +VR W
Sbjct: 725 SVRVW 729

 Score = 51.2 bits (121), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 32/151 (21%), Positives = 66/151 (43%), Gaps = 4/151 (2%)

Query: 85  LKYHPETNLLAAGYADGVIKIWDLISKTVLISFNGHKSAITVLAFDTTGTRLISASKDSD 144
           +K+ P  +  A+   D   ++W       L  F GH + +  ++F   G  + + S D  
Sbjct: 581 VKFSPLGHYFASASHDQTARLWACDHIYPLRIFAGHTNDVDTVSFHPNGCYVFTGSSDKT 640

Query: 145 IIVWDL-VGESGLYKLRSHKDAITGLWCEDENWLISTSKDGLVKIWDLKSQQCVETHLAH 203
             +WD+  G+S    L      ++     D  WL + S+DG++ +WD+ + + ++    H
Sbjct: 641 CRMWDVSTGDSVRLFLGHTAPVLSTQVSPDGRWLATGSEDGVICLWDIGTGKRIKQMRGH 700

Query: 204 TGEC---WSLGIIEDMAVTCSADSQVKLWKL 231
                   S     ++ ++  AD  V++W +
Sbjct: 701 GKNAVHSLSFNKEGNVLISGGADHSVRVWDV 731

 Score = 44.3 bits (103), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 38/154 (24%), Positives = 60/154 (38%), Gaps = 25/154 (16%)

Query: 81  ETTFLKYHPETNLLAAGYADGVIKIWDLISKTVLISFNGHKSAITVLAFDTTGTRLISAS 140
           + T L++  +  L AAG+ D  IKIW L   + LI+     S     + D T +      
Sbjct: 475 DMTSLEFSDDCRLAAAGFQDSYIKIWSLDGSS-LINPKYSSSQFDRFSQDNTCST----- 528

Query: 141 KDSDIIVWDLVGESGLYKLRSHKDAITGLWCEDENWLISTSKDGLVKIWDLKSQQCVETH 200
                    LVG SG     S        +  D  +L+S S+D  VK+W + +   +  +
Sbjct: 529 ---------LVGHSGTVYSTS--------FSPDNMYLVSGSEDKTVKLWSMDTHTALVNY 571

Query: 201 LAHTGECWSLGI--IEDMAVTCSADSQVKLWKLD 232
             H    W +    +     + S D   +LW  D
Sbjct: 572 KGHNHPVWDVKFSPLGHYFASASHDQTARLWACD 605

 Score = 33.9 bits (76), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 28/96 (29%), Positives = 44/96 (45%), Gaps = 19/96 (19%)

Query: 39  GQVIVGGLEN--ILVWDIKTGEQIAQLTDGLPPGASDAKLSKPAETTFLKYHPETNLLAA 96
           G+ +  G E+  I +WDI TG++I Q+  G    A  +          L ++ E N+L +
Sbjct: 671 GRWLATGSEDGVICLWDIGTGKRIKQMR-GHGKNAVHS----------LSFNKEGNVLIS 719

Query: 97  GYADGVIKIWDLISKTVLIS------FNGHKSAITV 126
           G AD  +++WD+   T          FN H   IT 
Sbjct: 720 GGADHSVRVWDVKHGTTEQGPEPEQPFNAHVGDITA 755

>Skud_2.324 Chr2 complement(583774..586182) [2409 bp, 802 aa] {ON}
           YBR198C (REAL)
          Length = 802

 Score = 87.0 bits (214), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 65/295 (22%), Positives = 127/295 (43%), Gaps = 39/295 (13%)

Query: 390 DIRSTSISDDNKLLATASNGS-LKIWNIKTKRCIRSFECGYALTCKFLPGGALVVVGTRN 448
           D+   + SDD ++ A     S +KIW++           G +L          +++ + N
Sbjct: 469 DMSCLNFSDDCRIAAAGFQDSYIKIWSLD----------GSSLN------NPNIMLNSAN 512

Query: 449 GELQLFDIASSTMLDNKEGAHDAAIWSLDLTSDGRKLVTGSADKTVRFWTFEVSEVPVSD 508
              +  D    T++      H   ++S   + D + L++GS DKTVR W+ +     VS 
Sbjct: 513 NNYRDDDPTCKTLV-----GHSGTVYSTSFSPDNKYLLSGSEDKTVRLWSMDTHTALVSY 567

Query: 509 ESNKTMPMLQLFHDTTLELDDDILSVVISPDDKFIAVSLLDNTVKVFFLDSMKFFLSLYG 568
           + +                +  +  V  SP   + A +  D T +++  D +       G
Sbjct: 568 KGH----------------NHPVWDVNFSPLGHYFATASHDQTARLWSCDHIYPLRIFAG 611

Query: 569 HKLPVLSMDISYDSKLIVTCSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLPESYNFF 628
           H   V  +    +   + T S+DK  ++W +  GD  +    H   ++ +   P+     
Sbjct: 612 HLNDVDCVSFHPNGCYVFTGSSDKTCRMWDVSTGDSVRLFLGHTAPVICIAVSPDGRWLS 671

Query: 629 SCSKDATVKYWDGQKFECIQKLAAH-QSEVWSISVSNDGTFVISTGHDHSIRVWE 682
           + S+D  +  WD    + ++++  H ++ ++S+S S +G  +IS G DHS+RVW+
Sbjct: 672 TGSEDGIINIWDIGTGKRLKQMRGHGKNAIYSLSYSKEGNVLISGGADHSVRVWD 726

 Score = 67.0 bits (162), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 45/180 (25%), Positives = 75/180 (41%), Gaps = 12/180 (6%)

Query: 523 TTLELDDDILSVVISPDDKFIAVSLLD-----------NTVKVFFLDSMKFFLSLYGHKL 571
           + L   DD         D +I +  LD           N+    + D      +L GH  
Sbjct: 471 SCLNFSDDCRIAAAGFQDSYIKIWSLDGSSLNNPNIMLNSANNNYRDDDPTCKTLVGHSG 530

Query: 572 PVLSMDISYDSKLIVTCSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLPESYNFFSCS 631
            V S   S D+K +++ S DK +++W +D      S   H   + +V F P  + F + S
Sbjct: 531 TVYSTSFSPDNKYLLSGSEDKTVRLWSMDTHTALVSYKGHNHPVWDVNFSPLGHYFATAS 590

Query: 632 KDATVKYWDGQKFECIQKLAAHQSEVWSISVSNDGTFVISTGHDHSIRVWE-ETEDQVFL 690
            D T + W       ++  A H ++V  +S   +G +V +   D + R+W+  T D V L
Sbjct: 591 HDQTARLWSCDHIYPLRIFAGHLNDVDCVSFHPNGCYVFTGSSDKTCRMWDVSTGDSVRL 650

 Score = 62.0 bits (149), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 58/265 (21%), Positives = 108/265 (40%), Gaps = 65/265 (24%)

Query: 384 LHGQRTDIRSTSISDDNK-LLATASNGSLKIWNIKTKRCIRSFECGYALTCKFLPGGALV 442
           L G    + STS S DNK LL+ + + ++++W++ T   + S++                
Sbjct: 525 LVGHSGTVYSTSFSPDNKYLLSGSEDKTVRLWSMDTHTALVSYK---------------- 568

Query: 443 VVGTRNGELQLFDIASSTMLDNKEGAHDAAIWSLDLTSDGRKLVTGSADKTVRFWTFEVS 502
                                     H+  +W ++ +  G    T S D+T R W+ +  
Sbjct: 569 -------------------------GHNHPVWDVNFSPLGHYFATASHDQTARLWSCD-- 601

Query: 503 EVPVSDESNKTMPMLQLFHDTTLELDDDILSVVISPDDKFIAVSLLDNTVKVFFL---DS 559
                       P L++F        +D+  V   P+  ++     D T +++ +   DS
Sbjct: 602 ---------HIYP-LRIFAGHL----NDVDCVSFHPNGCYVFTGSSDKTCRMWDVSTGDS 647

Query: 560 MKFFLSLYGHKLPVLSMDISYDSKLIVTCSADKNIKIWGLDFGDCHKSLFAH-QDSIMNV 618
           ++ FL   GH  PV+ + +S D + + T S D  I IW +  G   K +  H +++I ++
Sbjct: 648 VRLFL---GHTAPVICIAVSPDGRWLSTGSEDGIINIWDIGTGKRLKQMRGHGKNAIYSL 704

Query: 619 KFLPESYNFFSCSKDATVKYWDGQK 643
            +  E     S   D +V+ WD +K
Sbjct: 705 SYSKEGNVLISGGADHSVRVWDLKK 729

 Score = 61.2 bits (147), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 34/110 (30%), Positives = 58/110 (52%), Gaps = 2/110 (1%)

Query: 85  LKYHPETNLLAAGYADGVIKIWDLISKTVLISFNGHKSAITVLAFDTTGTRLISASKDSD 144
           + +HP    +  G +D   ++WD+ +   +  F GH + +  +A    G  L + S+D  
Sbjct: 619 VSFHPNGCYVFTGSSDKTCRMWDVSTGDSVRLFLGHTAPVICIAVSPDGRWLSTGSEDGI 678

Query: 145 IIVWDLVGESGLYKLRSH-KDAITGL-WCEDENWLISTSKDGLVKIWDLK 192
           I +WD+     L ++R H K+AI  L + ++ N LIS   D  V++WDLK
Sbjct: 679 INIWDIGTGKRLKQMRGHGKNAIYSLSYSKEGNVLISGGADHSVRVWDLK 728

 Score = 57.4 bits (137), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 33/151 (21%), Positives = 63/151 (41%), Gaps = 9/151 (5%)

Query: 87  YHPETNLLAAGYADGVIKIWDLISKTVLISFNGHKSAITVLAFDTTGTRLISASKDSDII 146
           + P+   L +G  D  +++W + + T L+S+ GH   +  + F   G    +AS D    
Sbjct: 537 FSPDNKYLLSGSEDKTVRLWSMDTHTALVSYKGHNHPVWDVNFSPLGHYFATASHDQTAR 596

Query: 147 VWDLVGESGLYKLRSHKDAITGLWC----EDENWLISTSKDGLVKIWDLKSQQCVETHLA 202
           +W       +Y LR     +  + C     +  ++ + S D   ++WD+ +   V   L 
Sbjct: 597 LWSC---DHIYPLRIFAGHLNDVDCVSFHPNGCYVFTGSSDKTCRMWDVSTGDSVRLFLG 653

Query: 203 HTGECWSLGIIEDMA--VTCSADSQVKLWKL 231
           HT     + +  D     T S D  + +W +
Sbjct: 654 HTAPVICIAVSPDGRWLSTGSEDGIINIWDI 684

 Score = 57.0 bits (136), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 38/159 (23%), Positives = 72/159 (45%), Gaps = 9/159 (5%)

Query: 376 PLKLHTIDLHGQRTDIRSTSISDDNKLLAT-ASNGSLKIWNIKTKRCIRSF--ECGYALT 432
           PL++      G   D+   S   +   + T +S+ + ++W++ T   +R F       + 
Sbjct: 605 PLRI----FAGHLNDVDCVSFHPNGCYVFTGSSDKTCRMWDVSTGDSVRLFLGHTAPVIC 660

Query: 433 CKFLPGGALVVVGTRNGELQLFDIASSTMLDNKEGAHDAAIWSLDLTSDGRKLVTGSADK 492
               P G  +  G+ +G + ++DI +   L    G    AI+SL  + +G  L++G AD 
Sbjct: 661 IAVSPDGRWLSTGSEDGIINIWDIGTGKRLKQMRGHGKNAIYSLSYSKEGNVLISGGADH 720

Query: 493 TVRFWTFEVSEVPVSDESNKTMPMLQLFHDTTLELDDDI 531
           +VR W  + +    S E ++  P +    D T  ++ DI
Sbjct: 721 SVRVWDLKKATTEPSAEPDE--PFIGYLGDVTASINQDI 757

 Score = 53.1 bits (126), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 31/101 (30%), Positives = 45/101 (44%), Gaps = 13/101 (12%)

Query: 51  VWDIKTGEQIAQLTDGLPPGASDAKLSKPAETTFLKYHPETNLLAAGYADGVIKIWDLIS 110
           +WD+ TG+ +               L   A    +   P+   L+ G  DG+I IWD+ +
Sbjct: 639 MWDVSTGDSVRLF------------LGHTAPVICIAVSPDGRWLSTGSEDGIINIWDIGT 686

Query: 111 KTVLISFNGH-KSAITVLAFDTTGTRLISASKDSDIIVWDL 150
              L    GH K+AI  L++   G  LIS   D  + VWDL
Sbjct: 687 GKRLKQMRGHGKNAIYSLSYSKEGNVLISGGADHSVRVWDL 727

 Score = 52.8 bits (125), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 37/151 (24%), Positives = 65/151 (43%), Gaps = 4/151 (2%)

Query: 85  LKYHPETNLLAAGYADGVIKIWDLISKTVLISFNGHKSAITVLAFDTTGTRLISASKDSD 144
           + + P  +  A    D   ++W       L  F GH + +  ++F   G  + + S D  
Sbjct: 577 VNFSPLGHYFATASHDQTARLWSCDHIYPLRIFAGHLNDVDCVSFHPNGCYVFTGSSDKT 636

Query: 145 IIVWDL-VGESGLYKLRSHKDAITGLWCEDENWLISTSKDGLVKIWDLKSQQCVETHLAH 203
             +WD+  G+S    L      I      D  WL + S+DG++ IWD+ + + ++    H
Sbjct: 637 CRMWDVSTGDSVRLFLGHTAPVICIAVSPDGRWLSTGSEDGIINIWDIGTGKRLKQMRGH 696

Query: 204 TGEC-WSLGIIEDMAVTCS--ADSQVKLWKL 231
                +SL   ++  V  S  AD  V++W L
Sbjct: 697 GKNAIYSLSYSKEGNVLISGGADHSVRVWDL 727

 Score = 40.0 bits (92), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 33/170 (19%), Positives = 62/170 (36%), Gaps = 23/170 (13%)

Query: 85  LKYHPETNLLAAGYADGVIKIWDLISKT------VLISFN--------------GHKSAI 124
           L +  +  + AAG+ D  IKIW L   +      +L S N              GH   +
Sbjct: 473 LNFSDDCRIAAAGFQDSYIKIWSLDGSSLNNPNIMLNSANNNYRDDDPTCKTLVGHSGTV 532

Query: 125 TVLAFDTTGTRLISASKDSDIIVWDLVGESGLYKLRSHKDAITGL-WCEDENWLISTSKD 183
              +F      L+S S+D  + +W +   + L   + H   +  + +    ++  + S D
Sbjct: 533 YSTSFSPDNKYLLSGSEDKTVRLWSMDTHTALVSYKGHNHPVWDVNFSPLGHYFATASHD 592

Query: 184 GLVKIWDLKSQQCVETHLAHTG--ECWSLGIIEDMAVTCSADSQVKLWKL 231
              ++W       +     H    +C S         T S+D   ++W +
Sbjct: 593 QTARLWSCDHIYPLRIFAGHLNDVDCVSFHPNGCYVFTGSSDKTCRMWDV 642

 Score = 34.3 bits (77), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 21/65 (32%), Positives = 32/65 (49%), Gaps = 11/65 (16%)

Query: 49  ILVWDIKTGEQIAQLTDGLPPGASDAKLSKPAETTFLKYHPETNLLAAGYADGVIKIWDL 108
           I +WDI TG+++ Q+         +A  S       L Y  E N+L +G AD  +++WDL
Sbjct: 679 INIWDIGTGKRLKQMRGH----GKNAIYS-------LSYSKEGNVLISGGADHSVRVWDL 727

Query: 109 ISKTV 113
              T 
Sbjct: 728 KKATT 732

>KAFR0A00510 Chr1 (93452..93988,94240..94662) [960 bp, 319 aa] {ON}
           Anc_2.431 YMR116C
          Length = 319

 Score = 84.0 bits (206), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 60/223 (26%), Positives = 102/223 (45%), Gaps = 21/223 (9%)

Query: 468 AHDAAIWSLDLTSDGRK--LVTGSADKTVRFWTFEVSEVPVSDESNKTMPMLQLFHDTTL 525
            H+  + SL  TS G+   LV+ S DKT+  W          D+    +P+      + +
Sbjct: 15  GHNGWVTSL-ATSAGQPNLLVSASRDKTLISWKL------TGDDQKVGVPVRSFKGHSHI 67

Query: 526 ELDDDILSVVISPDDKFIAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSMDISYDSKLI 585
             D     V ++PD  +   +  D T++++ + + + F    GHK  V+S+ I   + +I
Sbjct: 68  VQD-----VTLTPDGAYALSASWDKTLRLWEVATGETFQRFVGHKSDVMSVAIDRKASMI 122

Query: 586 VTCSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLP------ESYNFFSCSKDATVKYW 639
           ++ S DK+IK+W +  G C  +L  H D +  V+  P      E+    S   D  VK W
Sbjct: 123 ISGSRDKSIKVWTIK-GQCLATLLGHNDWVSQVRVAPNDKDDDETVTVISAGNDKMVKAW 181

Query: 640 DGQKFECIQKLAAHQSEVWSISVSNDGTFVISTGHDHSIRVWE 682
           +  +F+       H   V +I+ S DG+ + S G D  I +W 
Sbjct: 182 NLNQFQIEADFVGHNGNVNTITASPDGSLIASAGKDGEIMLWN 224

 Score = 57.0 bits (136), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 38/124 (30%), Positives = 58/124 (46%), Gaps = 8/124 (6%)

Query: 565 SLYGHKLPVLSMDISY-DSKLIVTCSADKNIKIWGLDFGDCHK------SLFAHQDSIMN 617
           +L GH   V S+  S     L+V+ S DK +  W L  GD  K      S   H   + +
Sbjct: 12  TLEGHNGWVTSLATSAGQPNLLVSASRDKTLISWKLT-GDDQKVGVPVRSFKGHSHIVQD 70

Query: 618 VKFLPESYNFFSCSKDATVKYWDGQKFECIQKLAAHQSEVWSISVSNDGTFVISTGHDHS 677
           V   P+     S S D T++ W+    E  Q+   H+S+V S+++    + +IS   D S
Sbjct: 71  VTLTPDGAYALSASWDKTLRLWEVATGETFQRFVGHKSDVMSVAIDRKASMIISGSRDKS 130

Query: 678 IRVW 681
           I+VW
Sbjct: 131 IKVW 134

 Score = 56.6 bits (135), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 40/141 (28%), Positives = 67/141 (47%), Gaps = 10/141 (7%)

Query: 100 DGVIKIWDLISKTVLISFNGHKSAITVLAFDTTGTRLISASKDSDIIVWDLVGESGLYKL 159
           D  +++W++ +      F GHKS +  +A D   + +IS S+D  I VW + G+  L  L
Sbjct: 86  DKTLRLWEVATGETFQRFVGHKSDVMSVAIDRKASMIISGSRDKSIKVWTIKGQC-LATL 144

Query: 160 RSHKDAITGLWC------EDEN-WLISTSKDGLVKIWDLKSQQCVETHLAHTGECWSLGI 212
             H D ++ +        +DE   +IS   D +VK W+L   Q     + H G   ++  
Sbjct: 145 LGHNDWVSQVRVAPNDKDDDETVTVISAGNDKMVKAWNLNQFQIEADFVGHNGNVNTITA 204

Query: 213 IEDMAVTCSA--DSQVKLWKL 231
             D ++  SA  D ++ LW L
Sbjct: 205 SPDGSLIASAGKDGEIMLWNL 225

 Score = 55.8 bits (133), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 67/317 (21%), Positives = 134/317 (42%), Gaps = 29/317 (9%)

Query: 381 TIDLHGQRTDIRSTSISDDNKLLATASNGSLKIWNI-----KTKRCIRSFECGYALT--C 433
           T++ H       +TS    N L++ + + +L  W +     K    +RSF+    +    
Sbjct: 12  TLEGHNGWVTSLATSAGQPNLLVSASRDKTLISWKLTGDDQKVGVPVRSFKGHSHIVQDV 71

Query: 434 KFLPGGALVVVGTRNGELQLFDIASSTMLDNKEGAHDAAIWSLDLTSDGRKLVTGSADKT 493
              P GA  +  + +  L+L+++A+        G H + + S+ +      +++GS DK+
Sbjct: 72  TLTPDGAYALSASWDKTLRLWEVATGETFQRFVG-HKSDVMSVAIDRKASMIISGSRDKS 130

Query: 494 VRFWTFEVSEVPVSDESNKTMPMLQLFHDTTLELDDDILSVVISPDDKFIAVSLLDNTVK 553
           ++ WT +   +      N  +  +++  +   + DD+ ++V+ + +DK          VK
Sbjct: 131 IKVWTIKGQCLATLLGHNDWVSQVRVAPND--KDDDETVTVISAGNDKM---------VK 179

Query: 554 VFFLDSMKFFLSLYGHKLPVLSMDISYDSKLIVTCSADKNIKIWGLDFGDCHKSLFAHQD 613
            + L+  +      GH   V ++  S D  LI +   D  I +W L       +L A QD
Sbjct: 180 AWNLNQFQIEADFVGHNGNVNTITASPDGSLIASAGKDGEIMLWNLADKVPMYTLNA-QD 238

Query: 614 SIMNVKFLPESYNFFSCSKDATVKYWDGQKFECIQKL--------AAHQSEVWSISVSND 665
            +  + F P  Y + + +  + +K +       I  L         A +    S++ S D
Sbjct: 239 EVFALAFSPNRY-WLAAATASGIKVFSLDPQALIDDLRPEFAGYNKAAEPHAVSLTWSAD 297

Query: 666 GTFVISTGHDHSIRVWE 682
           G  + +   D+ IRVW+
Sbjct: 298 GQTLFAGYTDNVIRVWQ 314

 Score = 52.0 bits (123), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 38/164 (23%), Positives = 71/164 (43%), Gaps = 10/164 (6%)

Query: 565 SLYGHKLPVLSMDISYDSKLIVTCSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLPES 624
           S  GH   V  + ++ D    ++ S DK +++W +  G+  +    H+  +M+V    ++
Sbjct: 60  SFKGHSHIVQDVTLTPDGAYALSASWDKTLRLWEVATGETFQRFVGHKSDVMSVAIDRKA 119

Query: 625 YNFFSCSKDATVKYWDGQKFECIQKLAAHQSEVWSISVS------NDGTFVISTGHDHSI 678
               S S+D ++K W   K +C+  L  H   V  + V+      ++   VIS G+D  +
Sbjct: 120 SMIISGSRDKSIKVWT-IKGQCLATLLGHNDWVSQVRVAPNDKDDDETVTVISAGNDKMV 178

Query: 679 RVWEETEDQV---FLEEEREKEMDEQYEDTLLTSLEGGAGDEML 719
           + W   + Q+   F+             D  L +  G  G+ ML
Sbjct: 179 KAWNLNQFQIEADFVGHNGNVNTITASPDGSLIASAGKDGEIML 222

 Score = 45.8 bits (107), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 25/109 (22%), Positives = 52/109 (47%), Gaps = 1/109 (0%)

Query: 90  ETNLLAAGYADGVIKIWDLISKTVLISFNGHKSAITVLAFDTTGTRLISASKDSDIIVWD 149
           ET  + +   D ++K W+L    +   F GH   +  +     G+ + SA KD +I++W+
Sbjct: 165 ETVTVISAGNDKMVKAWNLNQFQIEADFVGHNGNVNTITASPDGSLIASAGKDGEIMLWN 224

Query: 150 LVGESGLYKLRSHKDAITGLWCEDENWLISTSKDGLVKIWDLKSQQCVE 198
           L  +  +Y L +  +     +  +  WL + +  G +K++ L  Q  ++
Sbjct: 225 LADKVPMYTLNAQDEVFALAFSPNRYWLAAATASG-IKVFSLDPQALID 272

 Score = 40.8 bits (94), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 36/165 (21%), Positives = 66/165 (40%), Gaps = 15/165 (9%)

Query: 82  TTFLKYHPETNLLAAGYADGVIKIWDLISK-----TVLISFNGHKSAITVLAFDTTGTRL 136
           T+      + NLL +   D  +  W L          + SF GH   +  +     G   
Sbjct: 21  TSLATSAGQPNLLVSASRDKTLISWKLTGDDQKVGVPVRSFKGHSHIVQDVTLTPDGAYA 80

Query: 137 ISASKDSDIIVWDLVGESGLYKLRSHKDAITGLWCEDE-NWLISTSKDGLVKIWDLKSQQ 195
           +SAS D  + +W++       +   HK  +  +  + + + +IS S+D  +K+W +K  Q
Sbjct: 81  LSASWDKTLRLWEVATGETFQRFVGHKSDVMSVAIDRKASMIISGSRDKSIKVWTIKG-Q 139

Query: 196 CVETHLAHTGECWSLGIIED--------MAVTCSADSQVKLWKLD 232
           C+ T L H      + +  +          ++   D  VK W L+
Sbjct: 140 CLATLLGHNDWVSQVRVAPNDKDDDETVTVISAGNDKMVKAWNLN 184

 Score = 33.1 bits (74), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 18/68 (26%), Positives = 32/68 (47%), Gaps = 5/68 (7%)

Query: 627 FFSCSKDATVKYW----DGQKFEC-IQKLAAHQSEVWSISVSNDGTFVISTGHDHSIRVW 681
             S S+D T+  W    D QK    ++    H   V  ++++ DG + +S   D ++R+W
Sbjct: 33  LVSASRDKTLISWKLTGDDQKVGVPVRSFKGHSHIVQDVTLTPDGAYALSASWDKTLRLW 92

Query: 682 EETEDQVF 689
           E    + F
Sbjct: 93  EVATGETF 100

>Kpol_1024.42 s1024 complement(112044..114575) [2532 bp, 843 aa]
           {ON} complement(112044..114575) [2532 nt, 844 aa]
          Length = 843

 Score = 86.7 bits (213), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 59/255 (23%), Positives = 111/255 (43%), Gaps = 23/255 (9%)

Query: 468 AHDAAIWSLDLTSDGRKLVTGSADKTVRFWTFEVSEVPVSDESNKTMPMLQLFHDTTLEL 527
            H  A++S   + D + L++GS DKTVR W  +     VS + +                
Sbjct: 561 GHSGAVYSTSFSPDNKLLISGSEDKTVRLWAMDTQSTLVSYKGH---------------- 604

Query: 528 DDDILSVVISPDDKFIAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSMDISYDSKLIVT 587
           +  +  V  SP   + A +  D T +++  D +       GH   V  +    +   + T
Sbjct: 605 NHPVWDVAFSPMGHYFATASHDQTARLWSCDHIYSLRIFAGHLSDVDCVTFHPNGCYVFT 664

Query: 588 CSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLPESYNFFSCSKDATVKYWDGQKFECI 647
            S+DK  ++W +  G+  +    H   ++++   P+     S S+D  +  WD    + +
Sbjct: 665 GSSDKTCRMWDVSTGETVRLFLGHTAPVVSLGVSPDGRWLASGSEDGLINVWDIGSGKRL 724

Query: 648 QKLAAH-QSEVWSISVSNDGTFVISTGHDHSIRVWEETEDQVFLEEEREKEMDEQYEDTL 706
           +++  H ++ V SI  S +GT +IS G D+S+RVW+        +   E  ++   E   
Sbjct: 725 KQMRGHGRNAVNSIVFSQEGTVIISGGTDNSVRVWD------MYKSNNESSINNDTESDF 778

Query: 707 LTSLEGGAGDEMLSV 721
             S+ G  G+ + +V
Sbjct: 779 SQSIVGYFGNTLPAV 793

 Score = 79.7 bits (195), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 56/227 (24%), Positives = 89/227 (39%), Gaps = 17/227 (7%)

Query: 473 IWSLDLTSDGRKLVTGSADKTVRFWTFEVSEVPVSDESNKTMPMLQLFHDTTLELDDD-- 530
           + SLD + D R    G  D  ++ W+ + S +     +N T    +   D  L       
Sbjct: 491 MLSLDFSDDCRLAAAGFQDSYIKIWSLDGSSLDTLTSTNNTHFTKKNTADNNLHSKKKHQ 550

Query: 531 ---------------ILSVVISPDDKFIAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLS 575
                          + S   SPD+K +     D TV+++ +D+    +S  GH  PV  
Sbjct: 551 EHVNTNTKLVGHSGAVYSTSFSPDNKLLISGSEDKTVRLWAMDTQSTLVSYKGHNHPVWD 610

Query: 576 MDISYDSKLIVTCSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLPESYNFFSCSKDAT 635
           +  S       T S D+  ++W  D     +    H   +  V F P     F+ S D T
Sbjct: 611 VAFSPMGHYFATASHDQTARLWSCDHIYSLRIFAGHLSDVDCVTFHPNGCYVFTGSSDKT 670

Query: 636 VKYWDGQKFECIQKLAAHQSEVWSISVSNDGTFVISTGHDHSIRVWE 682
            + WD    E ++    H + V S+ VS DG ++ S   D  I VW+
Sbjct: 671 CRMWDVSTGETVRLFLGHTAPVVSLGVSPDGRWLASGSEDGLINVWD 717

 Score = 65.5 bits (158), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 36/151 (23%), Positives = 70/151 (46%), Gaps = 9/151 (5%)

Query: 87  YHPETNLLAAGYADGVIKIWDLISKTVLISFNGHKSAITVLAFDTTGTRLISASKDSDII 146
           + P+  LL +G  D  +++W + +++ L+S+ GH   +  +AF   G    +AS D    
Sbjct: 571 FSPDNKLLISGSEDKTVRLWAMDTQSTLVSYKGHNHPVWDVAFSPMGHYFATASHDQTAR 630

Query: 147 VWDLVGESGLYKLRSHKDAITGLWC----EDENWLISTSKDGLVKIWDLKSQQCVETHLA 202
           +W       +Y LR     ++ + C     +  ++ + S D   ++WD+ + + V   L 
Sbjct: 631 LWSC---DHIYSLRIFAGHLSDVDCVTFHPNGCYVFTGSSDKTCRMWDVSTGETVRLFLG 687

Query: 203 HTGECWSLGIIEDMA--VTCSADSQVKLWKL 231
           HT    SLG+  D     + S D  + +W +
Sbjct: 688 HTAPVVSLGVSPDGRWLASGSEDGLINVWDI 718

 Score = 59.3 bits (142), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 52/259 (20%), Positives = 102/259 (39%), Gaps = 59/259 (22%)

Query: 384 LHGQRTDIRSTSISDDNKLLATAS-NGSLKIWNIKTKRCIRSFECGYALTCKFLPGGALV 442
           L G    + STS S DNKLL + S + ++++W + T+  + S++                
Sbjct: 559 LVGHSGAVYSTSFSPDNKLLISGSEDKTVRLWAMDTQSTLVSYK---------------- 602

Query: 443 VVGTRNGELQLFDIASSTMLDNKEGAHDAAIWSLDLTSDGRKLVTGSADKTVRFWTFEVS 502
                                     H+  +W +  +  G    T S D+T R W+ +  
Sbjct: 603 -------------------------GHNHPVWDVAFSPMGHYFATASHDQTARLWSCD-- 635

Query: 503 EVPVSDESNKTMPMLQLFHDTTLELDDDILSVVISPDDKFIAVSLLDNTVKVFFLDSMKF 562
                      +  L++F     ++D     V   P+  ++     D T +++ + + + 
Sbjct: 636 ----------HIYSLRIFAGHLSDVD----CVTFHPNGCYVFTGSSDKTCRMWDVSTGET 681

Query: 563 FLSLYGHKLPVLSMDISYDSKLIVTCSADKNIKIWGLDFGDCHKSLFAH-QDSIMNVKFL 621
                GH  PV+S+ +S D + + + S D  I +W +  G   K +  H ++++ ++ F 
Sbjct: 682 VRLFLGHTAPVVSLGVSPDGRWLASGSEDGLINVWDIGSGKRLKQMRGHGRNAVNSIVFS 741

Query: 622 PESYNFFSCSKDATVKYWD 640
            E     S   D +V+ WD
Sbjct: 742 QEGTVIISGGTDNSVRVWD 760

 Score = 55.8 bits (133), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 31/101 (30%), Positives = 47/101 (46%), Gaps = 13/101 (12%)

Query: 51  VWDIKTGEQIAQLTDGLPPGASDAKLSKPAETTFLKYHPETNLLAAGYADGVIKIWDLIS 110
           +WD+ TGE +               L   A    L   P+   LA+G  DG+I +WD+ S
Sbjct: 673 MWDVSTGETVRLF------------LGHTAPVVSLGVSPDGRWLASGSEDGLINVWDIGS 720

Query: 111 KTVLISFNGH-KSAITVLAFDTTGTRLISASKDSDIIVWDL 150
              L    GH ++A+  + F   GT +IS   D+ + VWD+
Sbjct: 721 GKRLKQMRGHGRNAVNSIVFSQEGTVIISGGTDNSVRVWDM 761

 Score = 55.8 bits (133), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 29/109 (26%), Positives = 55/109 (50%), Gaps = 2/109 (1%)

Query: 85  LKYHPETNLLAAGYADGVIKIWDLISKTVLISFNGHKSAITVLAFDTTGTRLISASKDSD 144
           + +HP    +  G +D   ++WD+ +   +  F GH + +  L     G  L S S+D  
Sbjct: 653 VTFHPNGCYVFTGSSDKTCRMWDVSTGETVRLFLGHTAPVVSLGVSPDGRWLASGSEDGL 712

Query: 145 IIVWDLVGESGLYKLRSH-KDAITGL-WCEDENWLISTSKDGLVKIWDL 191
           I VWD+     L ++R H ++A+  + + ++   +IS   D  V++WD+
Sbjct: 713 INVWDIGSGKRLKQMRGHGRNAVNSIVFSQEGTVIISGGTDNSVRVWDM 761

 Score = 46.6 bits (109), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 39/152 (25%), Positives = 63/152 (41%), Gaps = 14/152 (9%)

Query: 85  LKYHPETNLLAAGYADGVIKIWDLISKTVLISFNGHKSAITVLAFDTTGTRLISASKDSD 144
           L +  +  L AAG+ D  IKIW L   ++    + + +  T    +T    L S  K  +
Sbjct: 494 LDFSDDCRLAAAGFQDSYIKIWSLDGSSLDTLTSTNNTHFT--KKNTADNNLHSKKKHQE 551

Query: 145 IIVWD--LVGESGLYKLRSHKDAITGLWCEDENWLISTSKDGLVKIWDLKSQQCVETHLA 202
            +  +  LVG SG     S        +  D   LIS S+D  V++W + +Q  + ++  
Sbjct: 552 HVNTNTKLVGHSGAVYSTS--------FSPDNKLLISGSEDKTVRLWAMDTQSTLVSYKG 603

Query: 203 HTGECWSLGI--IEDMAVTCSADSQVKLWKLD 232
           H    W +    +     T S D   +LW  D
Sbjct: 604 HNHPVWDVAFSPMGHYFATASHDQTARLWSCD 635

>Suva_4.452 Chr4 complement(786121..788523) [2403 bp, 800 aa] {ON}
           YBR198C (REAL)
          Length = 800

 Score = 85.9 bits (211), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 50/216 (23%), Positives = 98/216 (45%), Gaps = 17/216 (7%)

Query: 468 AHDAAIWSLDLTSDGRKLVTGSADKTVRFWTFEVSEVPVSDESNKTMPMLQLFHDTTLEL 527
            H   +++   + D + L++GS DKTVR W+ +     VS + +                
Sbjct: 525 GHSGTVYATSFSPDNKYLLSGSEDKTVRLWSMDTHTALVSYKGH---------------- 568

Query: 528 DDDILSVVISPDDKFIAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSMDISYDSKLIVT 587
           +  +  V  SP   + A +  D T +++  D +       GH   V  +    +   + T
Sbjct: 569 NHPVWDVNFSPLGHYFATASHDQTARLWSCDHIYPLRIFAGHLNDVDCVSFHPNGCYVFT 628

Query: 588 CSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLPESYNFFSCSKDATVKYWDGQKFECI 647
            S+DK  ++W +  GD  +    H   ++ +   P+     + S+D  +  WD    + +
Sbjct: 629 GSSDKTCRMWDVSTGDSVRLFLGHTAPVICIAVSPDGRWLSTGSEDGIINIWDIGTGKRL 688

Query: 648 QKLAAH-QSEVWSISVSNDGTFVISTGHDHSIRVWE 682
           +++  H ++ ++S+S S +G  +IS G DHS+RVW+
Sbjct: 689 KQMRGHGKNAIYSLSYSKEGNVLISGGADHSVRVWD 724

 Score = 78.2 bits (191), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 51/216 (23%), Positives = 91/216 (42%), Gaps = 13/216 (6%)

Query: 476 LDLTSDGRKLVTGSADKTVRFWTFEVSEVPV---------SDESNKTMPMLQLFHDTTLE 526
           LD + D R    G  D  ++ W+ + S +           SD  +   P  +    T + 
Sbjct: 470 LDFSDDCRIAAAGFQDSYIKIWSLDGSSLNNPNIMPNINNSDHKDADDPTCK----TLVG 525

Query: 527 LDDDILSVVISPDDKFIAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSMDISYDSKLIV 586
               + +   SPD+K++     D TV+++ +D+    +S  GH  PV  ++ S       
Sbjct: 526 HSGTVYATSFSPDNKYLLSGSEDKTVRLWSMDTHTALVSYKGHNHPVWDVNFSPLGHYFA 585

Query: 587 TCSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLPESYNFFSCSKDATVKYWDGQKFEC 646
           T S D+  ++W  D     +    H + +  V F P     F+ S D T + WD    + 
Sbjct: 586 TASHDQTARLWSCDHIYPLRIFAGHLNDVDCVSFHPNGCYVFTGSSDKTCRMWDVSTGDS 645

Query: 647 IQKLAAHQSEVWSISVSNDGTFVISTGHDHSIRVWE 682
           ++    H + V  I+VS DG ++ +   D  I +W+
Sbjct: 646 VRLFLGHTAPVICIAVSPDGRWLSTGSEDGIINIWD 681

 Score = 65.5 bits (158), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 35/127 (27%), Positives = 61/127 (48%), Gaps = 1/127 (0%)

Query: 565 SLYGHKLPVLSMDISYDSKLIVTCSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLPES 624
           +L GH   V +   S D+K +++ S DK +++W +D      S   H   + +V F P  
Sbjct: 522 TLVGHSGTVYATSFSPDNKYLLSGSEDKTVRLWSMDTHTALVSYKGHNHPVWDVNFSPLG 581

Query: 625 YNFFSCSKDATVKYWDGQKFECIQKLAAHQSEVWSISVSNDGTFVISTGHDHSIRVWE-E 683
           + F + S D T + W       ++  A H ++V  +S   +G +V +   D + R+W+  
Sbjct: 582 HYFATASHDQTARLWSCDHIYPLRIFAGHLNDVDCVSFHPNGCYVFTGSSDKTCRMWDVS 641

Query: 684 TEDQVFL 690
           T D V L
Sbjct: 642 TGDSVRL 648

 Score = 61.2 bits (147), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 34/110 (30%), Positives = 58/110 (52%), Gaps = 2/110 (1%)

Query: 85  LKYHPETNLLAAGYADGVIKIWDLISKTVLISFNGHKSAITVLAFDTTGTRLISASKDSD 144
           + +HP    +  G +D   ++WD+ +   +  F GH + +  +A    G  L + S+D  
Sbjct: 617 VSFHPNGCYVFTGSSDKTCRMWDVSTGDSVRLFLGHTAPVICIAVSPDGRWLSTGSEDGI 676

Query: 145 IIVWDLVGESGLYKLRSH-KDAITGL-WCEDENWLISTSKDGLVKIWDLK 192
           I +WD+     L ++R H K+AI  L + ++ N LIS   D  V++WDLK
Sbjct: 677 INIWDIGTGKRLKQMRGHGKNAIYSLSYSKEGNVLISGGADHSVRVWDLK 726

 Score = 57.4 bits (137), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 33/151 (21%), Positives = 63/151 (41%), Gaps = 9/151 (5%)

Query: 87  YHPETNLLAAGYADGVIKIWDLISKTVLISFNGHKSAITVLAFDTTGTRLISASKDSDII 146
           + P+   L +G  D  +++W + + T L+S+ GH   +  + F   G    +AS D    
Sbjct: 535 FSPDNKYLLSGSEDKTVRLWSMDTHTALVSYKGHNHPVWDVNFSPLGHYFATASHDQTAR 594

Query: 147 VWDLVGESGLYKLRSHKDAITGLWC----EDENWLISTSKDGLVKIWDLKSQQCVETHLA 202
           +W       +Y LR     +  + C     +  ++ + S D   ++WD+ +   V   L 
Sbjct: 595 LWSC---DHIYPLRIFAGHLNDVDCVSFHPNGCYVFTGSSDKTCRMWDVSTGDSVRLFLG 651

Query: 203 HTGECWSLGIIEDMA--VTCSADSQVKLWKL 231
           HT     + +  D     T S D  + +W +
Sbjct: 652 HTAPVICIAVSPDGRWLSTGSEDGIINIWDI 682

 Score = 57.0 bits (136), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 38/159 (23%), Positives = 71/159 (44%), Gaps = 9/159 (5%)

Query: 376 PLKLHTIDLHGQRTDIRSTSISDDNKLLAT-ASNGSLKIWNIKTKRCIRSF--ECGYALT 432
           PL++      G   D+   S   +   + T +S+ + ++W++ T   +R F       + 
Sbjct: 603 PLRI----FAGHLNDVDCVSFHPNGCYVFTGSSDKTCRMWDVSTGDSVRLFLGHTAPVIC 658

Query: 433 CKFLPGGALVVVGTRNGELQLFDIASSTMLDNKEGAHDAAIWSLDLTSDGRKLVTGSADK 492
               P G  +  G+ +G + ++DI +   L    G    AI+SL  + +G  L++G AD 
Sbjct: 659 IAVSPDGRWLSTGSEDGIINIWDIGTGKRLKQMRGHGKNAIYSLSYSKEGNVLISGGADH 718

Query: 493 TVRFWTFEVSEVPVSDESNKTMPMLQLFHDTTLELDDDI 531
           +VR W  + +    S E  +  P +    D T  ++ DI
Sbjct: 719 SVRVWDLKKATTEPSAEPEE--PFIGYLGDVTASINQDI 755

 Score = 53.1 bits (126), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 37/151 (24%), Positives = 65/151 (43%), Gaps = 4/151 (2%)

Query: 85  LKYHPETNLLAAGYADGVIKIWDLISKTVLISFNGHKSAITVLAFDTTGTRLISASKDSD 144
           + + P  +  A    D   ++W       L  F GH + +  ++F   G  + + S D  
Sbjct: 575 VNFSPLGHYFATASHDQTARLWSCDHIYPLRIFAGHLNDVDCVSFHPNGCYVFTGSSDKT 634

Query: 145 IIVWDL-VGESGLYKLRSHKDAITGLWCEDENWLISTSKDGLVKIWDLKSQQCVETHLAH 203
             +WD+  G+S    L      I      D  WL + S+DG++ IWD+ + + ++    H
Sbjct: 635 CRMWDVSTGDSVRLFLGHTAPVICIAVSPDGRWLSTGSEDGIINIWDIGTGKRLKQMRGH 694

Query: 204 TGEC-WSLGIIEDMAVTCS--ADSQVKLWKL 231
                +SL   ++  V  S  AD  V++W L
Sbjct: 695 GKNAIYSLSYSKEGNVLISGGADHSVRVWDL 725

 Score = 53.1 bits (126), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 31/101 (30%), Positives = 45/101 (44%), Gaps = 13/101 (12%)

Query: 51  VWDIKTGEQIAQLTDGLPPGASDAKLSKPAETTFLKYHPETNLLAAGYADGVIKIWDLIS 110
           +WD+ TG+ +               L   A    +   P+   L+ G  DG+I IWD+ +
Sbjct: 637 MWDVSTGDSVRLF------------LGHTAPVICIAVSPDGRWLSTGSEDGIINIWDIGT 684

Query: 111 KTVLISFNGH-KSAITVLAFDTTGTRLISASKDSDIIVWDL 150
              L    GH K+AI  L++   G  LIS   D  + VWDL
Sbjct: 685 GKRLKQMRGHGKNAIYSLSYSKEGNVLISGGADHSVRVWDL 725

 Score = 38.9 bits (89), Expect = 0.065,   Method: Compositional matrix adjust.
 Identities = 30/171 (17%), Positives = 60/171 (35%), Gaps = 24/171 (14%)

Query: 85  LKYHPETNLLAAGYADGVIKIWDLISKTVLI---------------------SFNGHKSA 123
           L +  +  + AAG+ D  IKIW L   ++                       +  GH   
Sbjct: 470 LDFSDDCRIAAAGFQDSYIKIWSLDGSSLNNPNIMPNINNSDHKDADDPTCKTLVGHSGT 529

Query: 124 ITVLAFDTTGTRLISASKDSDIIVWDLVGESGLYKLRSHKDAITGL-WCEDENWLISTSK 182
           +   +F      L+S S+D  + +W +   + L   + H   +  + +    ++  + S 
Sbjct: 530 VYATSFSPDNKYLLSGSEDKTVRLWSMDTHTALVSYKGHNHPVWDVNFSPLGHYFATASH 589

Query: 183 DGLVKIWDLKSQQCVETHLAHTG--ECWSLGIIEDMAVTCSADSQVKLWKL 231
           D   ++W       +     H    +C S         T S+D   ++W +
Sbjct: 590 DQTARLWSCDHIYPLRIFAGHLNDVDCVSFHPNGCYVFTGSSDKTCRMWDV 640

 Score = 34.3 bits (77), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 21/65 (32%), Positives = 32/65 (49%), Gaps = 11/65 (16%)

Query: 49  ILVWDIKTGEQIAQLTDGLPPGASDAKLSKPAETTFLKYHPETNLLAAGYADGVIKIWDL 108
           I +WDI TG+++ Q+         +A  S       L Y  E N+L +G AD  +++WDL
Sbjct: 677 INIWDIGTGKRLKQMRGH----GKNAIYS-------LSYSKEGNVLISGGADHSVRVWDL 725

Query: 109 ISKTV 113
              T 
Sbjct: 726 KKATT 730

>ZYRO0A12980g Chr1 (1025863..1028337) [2475 bp, 824 aa] {ON} similar
           to uniprot|P38129 Saccharomyces cerevisiae YBR198C TAF5
           Subunit (90 kDa) of TFIID and SAGA complexes involved in
           RNA polymerase II transcription initiation and in
           chromatin modification
          Length = 824

 Score = 85.5 bits (210), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 74/314 (23%), Positives = 133/314 (42%), Gaps = 39/314 (12%)

Query: 382 IDLHGQRTDIRSTSISDDNKLLATASNGSLKIWNIKTKRCIRSFECGYALTCKFLPGGAL 441
           I L  QR      +I  DN  LA  S       N  T R + S E  ++  C+      L
Sbjct: 461 IKLEVQRVKESRDAIKLDNLQLALPSVCMYTFHN--TNRDMTSLE--FSDDCR------L 510

Query: 442 VVVGTRNGELQLFDIASSTM-----LDNKEGA-------HDAAIWSLDLTSDGRKLVTGS 489
              G ++ +++LF +  S +      D  E A       H   ++S   + D R LV+ S
Sbjct: 511 AAAGFQDSQIKLFSLDGSPLGNRYDPDLPEDATSKTLVGHSGTVYSTSFSPDNRYLVSSS 570

Query: 490 ADKTVRFWTFEVSEVPVSDESNKTMPMLQLFHDTTLELDDDILSVVISPDDKFIAVSLLD 549
            DKTVR W+ +     VS + +                +  +  V  SP   + A +  D
Sbjct: 571 EDKTVRLWSLDTHSALVSYKGH----------------NHPVWDVKFSPLGHYFATASHD 614

Query: 550 NTVKVFFLDSMKFFLSLYGHKLPVLSMDISYDSKLIVTCSADKNIKIWGLDFGDCHKSLF 609
           +T +++  D +       GH   V  +    +   + T S+DK  ++W +  GDC +   
Sbjct: 615 HTARLWSCDHIYPLRIFAGHLNDVDCVSFHPNGCYLFTGSSDKTCRMWDIATGDCVRLFL 674

Query: 610 AHQDSIMNVKFLPESYNFFSCSKDATVKYWDGQKFECIQKLAAH-QSEVWSISVSNDGTF 668
                +++    P+     + S+D  +  WD    + ++++  H ++ ++S++   +G  
Sbjct: 675 GLTAPVISTCVSPDGRWLSTGSEDGIINVWDIGTGKRLKQMRGHGKNAIYSLAYCKEGNA 734

Query: 669 VISTGHDHSIRVWE 682
           +IS G DHS+RVW+
Sbjct: 735 LISGGADHSVRVWD 748

 Score = 60.5 bits (145), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 35/110 (31%), Positives = 56/110 (50%), Gaps = 2/110 (1%)

Query: 85  LKYHPETNLLAAGYADGVIKIWDLISKTVLISFNGHKSAITVLAFDTTGTRLISASKDSD 144
           + +HP    L  G +D   ++WD+ +   +  F G  + +        G  L + S+D  
Sbjct: 641 VSFHPNGCYLFTGSSDKTCRMWDIATGDCVRLFLGLTAPVISTCVSPDGRWLSTGSEDGI 700

Query: 145 IIVWDLVGESGLYKLRSH-KDAITGL-WCEDENWLISTSKDGLVKIWDLK 192
           I VWD+     L ++R H K+AI  L +C++ N LIS   D  V++WDLK
Sbjct: 701 INVWDIGTGKRLKQMRGHGKNAIYSLAYCKEGNALISGGADHSVRVWDLK 750

 Score = 55.8 bits (133), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 36/128 (28%), Positives = 60/128 (46%), Gaps = 13/128 (10%)

Query: 376 PLKLHTIDLHGQRTDIRSTSISDDNKLLAT-ASNGSLKIWNIKTKRCIRSFECGYALTCK 434
           PL++      G   D+   S   +   L T +S+ + ++W+I T  C+R F     LT  
Sbjct: 627 PLRI----FAGHLNDVDCVSFHPNGCYLFTGSSDKTCRMWDIATGDCVRLF---LGLTAP 679

Query: 435 FL-----PGGALVVVGTRNGELQLFDIASSTMLDNKEGAHDAAIWSLDLTSDGRKLVTGS 489
            +     P G  +  G+ +G + ++DI +   L    G    AI+SL    +G  L++G 
Sbjct: 680 VISTCVSPDGRWLSTGSEDGIINVWDIGTGKRLKQMRGHGKNAIYSLAYCKEGNALISGG 739

Query: 490 ADKTVRFW 497
           AD +VR W
Sbjct: 740 ADHSVRVW 747

 Score = 55.1 bits (131), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 39/172 (22%), Positives = 70/172 (40%), Gaps = 10/172 (5%)

Query: 67  LPPGASDAKLSKPAETTF-LKYHPETNLLAAGYADGVIKIWDLISKTVLISFNGHKSAIT 125
           LP  A+   L   + T +   + P+   L +   D  +++W L + + L+S+ GH   + 
Sbjct: 538 LPEDATSKTLVGHSGTVYSTSFSPDNRYLVSSSEDKTVRLWSLDTHSALVSYKGHNHPVW 597

Query: 126 VLAFDTTGTRLISASKDSDIIVWDLVGESGLYKLRSHKDAITGLWC----EDENWLISTS 181
            + F   G    +AS D    +W       +Y LR     +  + C     +  +L + S
Sbjct: 598 DVKFSPLGHYFATASHDHTARLWSC---DHIYPLRIFAGHLNDVDCVSFHPNGCYLFTGS 654

Query: 182 KDGLVKIWDLKSQQCVETHLAHTGECWSLGIIEDMA--VTCSADSQVKLWKL 231
            D   ++WD+ +  CV   L  T    S  +  D     T S D  + +W +
Sbjct: 655 SDKTCRMWDIATGDCVRLFLGLTAPVISTCVSPDGRWLSTGSEDGIINVWDI 706

 Score = 41.2 bits (95), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 35/171 (20%), Positives = 66/171 (38%), Gaps = 24/171 (14%)

Query: 81  ETTFLKYHPETNLLAAGYADGVIKIW-----------------DLISKTVLISFNGHKSA 123
           + T L++  +  L AAG+ D  IK++                 D  SKT++    GH   
Sbjct: 498 DMTSLEFSDDCRLAAAGFQDSQIKLFSLDGSPLGNRYDPDLPEDATSKTLV----GHSGT 553

Query: 124 ITVLAFDTTGTRLISASKDSDIIVWDLVGESGLYKLRSHKDAITGL-WCEDENWLISTSK 182
           +   +F      L+S+S+D  + +W L   S L   + H   +  + +    ++  + S 
Sbjct: 554 VYSTSFSPDNRYLVSSSEDKTVRLWSLDTHSALVSYKGHNHPVWDVKFSPLGHYFATASH 613

Query: 183 DGLVKIWDLKSQQCVETHLAHTG--ECWSLGIIEDMAVTCSADSQVKLWKL 231
           D   ++W       +     H    +C S         T S+D   ++W +
Sbjct: 614 DHTARLWSCDHIYPLRIFAGHLNDVDCVSFHPNGCYLFTGSSDKTCRMWDI 664

>KLLA0C08547g Chr3 (749737..751284) [1548 bp, 515 aa] {ON} highly
           similar to uniprot|P25382 Saccharomyces cerevisiae
           YCR072C Protein required for cell viability,
          Length = 515

 Score = 84.7 bits (208), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 76/287 (26%), Positives = 129/287 (44%), Gaps = 24/287 (8%)

Query: 399 DNKLLATAS-NGSLKIWNIKTKRCIRSFECGY--ALTCKFLPGGALVVVGTRNGELQLFD 455
           D   LATAS +G++KIW+   + C+ +  CG+  +++C    G  ++  G+ +  ++ +D
Sbjct: 247 DKPRLATASKDGTIKIWDTTRRVCLLTL-CGHTSSVSCVKWGGKNVLYSGSHDKTIRCWD 305

Query: 456 IASSTMLDNKEGAHDAAIWSLDLTSDGRKLVTGSADKTVRFWTFE-VSEVPVSDESNKTM 514
           +  +    N   +H   +  L L          S D  +R   F+   E P S E  +  
Sbjct: 306 MNLNGKCINILKSHAHWVNHLSL----------STDYALRLGAFDHKGETPASPEEAQQK 355

Query: 515 PMLQLFHDTTLELDDDILSVVISPDDKFIAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVL 574
            +    ++   +   D   ++++  D F     L N +K     S K    + GH+  V 
Sbjct: 356 ALKN--YEKVAKRKGDFEELMVTASDDFTM--YLWNPLK-----STKPITRMTGHQKLVN 406

Query: 575 SMDISYDSKLIVTCSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLPESYNFFSCSKDA 634
            +  S D + IV+ S D +IK+W    G    +   H  S+  V +  +     SCSKD 
Sbjct: 407 HVAFSPDGRYIVSASFDNSIKLWDGRDGKFLSTFRGHVASVYQVAWSSDCRLLVSCSKDT 466

Query: 635 TVKYWDGQKFECIQKLAAHQSEVWSISVSNDGTFVISTGHDHSIRVW 681
           T+K WD +  +    L  HQ EV+++  S DG  V S G D  +R+W
Sbjct: 467 TLKVWDVKTRKLSVDLPGHQDEVYTVDWSVDGKRVCSGGKDKMVRIW 513

 Score = 75.9 bits (185), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 92/433 (21%), Positives = 174/433 (40%), Gaps = 90/433 (20%)

Query: 87  YHPETN-LLAAGYADGVIKIWDLISKTVLISFNGHKSAITVLAFDTTGTRLISASKDSDI 145
           + P T+  +  G  D    IWD  ++T + +  GH + +   ++   G  + + S D+ I
Sbjct: 151 FAPNTSSRMVTGAGDNTACIWDCDTQTRMCTLQGHHNWVLCCSWSPDGELIATGSMDNTI 210

Query: 146 IVWDLV-GESGLYKLRSHKDAITGLWCE--------DENWLISTSKDGLVKIWDLKSQQC 196
            +W+   G+     LR H   IT L  E        D+  L + SKDG +KIWD   + C
Sbjct: 211 RLWESSKGKPYGDALRGHSKWITSLSWEPIHLVKPGDKPRLATASKDGTIKIWDTTRRVC 270

Query: 197 VETHLAHTG--ECWSLGIIEDMAVTCSADSQVKLWKLDLQAENGSKLTEKGIIEKQSKQR 254
           + T   HT    C   G  +++  + S D  ++ W ++L   NG  +             
Sbjct: 271 LLTLCGHTSSVSCVKWG-GKNVLYSGSHDKTIRCWDMNL---NGKCINILKSHAHWVNHL 326

Query: 255 GVEIDFAVAPDGVKFFYIQNADKTIEIYRLRKEEEISRALKKREKRLQDKGMSEEEIKEA 314
            +  D+A     ++     +  +T        EE   +ALK  EK  + KG  E      
Sbjct: 327 SLSTDYA-----LRLGAFDHKGETPA----SPEEAQQKALKNYEKVAKRKGDFE------ 371

Query: 315 MGSPVSLMYHLFQVVRSPYKIKSAQWTVCSNSKLELVVTTSNNSIEYYSIPYSKREPTQP 374
                                             EL+VT S++   Y   P    +P   
Sbjct: 372 ----------------------------------ELMVTASDDFTMYLWNPLKSTKP--- 394

Query: 375 APLKLHTIDLHGQRTDIRSTSISDDNKLLATAS-NGSLKIWNIKTKRCIRSF-------- 425
                    + G +  +   + S D + + +AS + S+K+W+ +  + + +F        
Sbjct: 395 ------ITRMTGHQKLVNHVAFSPDGRYIVSASFDNSIKLWDGRDGKFLSTFRGHVASVY 448

Query: 426 ECGYALTCKFLPGGALVVVGTRNGELQLFDIASSTMLDNKEGAHDAAIWSLDLTSDGRKL 485
           +  ++  C+      L+V  +++  L+++D+ +  +  +  G H   ++++D + DG+++
Sbjct: 449 QVAWSSDCR------LLVSCSKDTTLKVWDVKTRKLSVDLPG-HQDEVYTVDWSVDGKRV 501

Query: 486 VTGSADKTVRFWT 498
            +G  DK VR WT
Sbjct: 502 CSGGKDKMVRIWT 514

 Score = 63.9 bits (154), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 46/146 (31%), Positives = 67/146 (45%), Gaps = 17/146 (11%)

Query: 549 DNTVKVFFLDSMKFFLSLYGHKLPVLSMDISYDSKLIVTCSADKNIKIW----GLDFGDC 604
           DNT  ++  D+     +L GH   VL    S D +LI T S D  I++W    G  +GD 
Sbjct: 165 DNTACIWDCDTQTRMCTLQGHHNWVLCCSWSPDGELIATGSMDNTIRLWESSKGKPYGD- 223

Query: 605 HKSLFAHQDSIMNVKFLP-------ESYNFFSCSKDATVKYWDGQKFECIQKLAAHQSEV 657
             +L  H   I ++ + P       +     + SKD T+K WD  +  C+  L  H S V
Sbjct: 224 --ALRGHSKWITSLSWEPIHLVKPGDKPRLATASKDGTIKIWDTTRRVCLLTLCGHTSSV 281

Query: 658 WSISVSNDGTFVISTG-HDHSIRVWE 682
               V   G  V+ +G HD +IR W+
Sbjct: 282 --SCVKWGGKNVLYSGSHDKTIRCWD 305

 Score = 57.8 bits (138), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 59/238 (24%), Positives = 100/238 (42%), Gaps = 30/238 (12%)

Query: 484 KLVTGSADKTVRFWTFEVSEVPVSDESNKTMPMLQLFHDTTLELDDDILSVVISPDDKFI 543
           ++VTG+ D T   W  +         +   M  LQ  H+        +L    SPD + I
Sbjct: 158 RMVTGAGDNTACIWDCD---------TQTRMCTLQGHHNW-------VLCCSWSPDGELI 201

Query: 544 AVSLLDNTVKVFFLDSMKFFL-SLYGHKLPVLSMDI-------SYDSKLIVTCSADKNIK 595
           A   +DNT++++     K +  +L GH   + S+           D   + T S D  IK
Sbjct: 202 ATGSMDNTIRLWESSKGKPYGDALRGHSKWITSLSWEPIHLVKPGDKPRLATASKDGTIK 261

Query: 596 IWGLDFGDCHKSLFAHQDSIMNVKFLPESYNFFSCSKDATVKYWD-GQKFECIQKLAAHQ 654
           IW      C  +L  H  S+  VK+  ++   +S S D T++ WD     +CI  L +H 
Sbjct: 262 IWDTTRRVCLLTLCGHTSSVSCVKWGGKNV-LYSGSHDKTIRCWDMNLNGKCINILKSHA 320

Query: 655 SEVWSISVSNDGTFVISTGHDH---SIRVWEETEDQVFLEEEREKEMDEQYEDTLLTS 709
             V  +S+S D    +    DH   +    EE + +     E+  +    +E+ ++T+
Sbjct: 321 HWVNHLSLSTDYALRLG-AFDHKGETPASPEEAQQKALKNYEKVAKRKGDFEELMVTA 377

 Score = 50.8 bits (120), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 69/354 (19%), Positives = 148/354 (41%), Gaps = 46/354 (12%)

Query: 360 EYYSIPYSKREPTQPAPLKLHTIDLHGQRTDIRSTSISDD--NKLLATASNGSLKIWNI- 416
           ++ ++ Y+ R   +  P+   +  + G  + I  ++ + +  ++++  A + +  IW+  
Sbjct: 115 DFLTLVYTPRAIFKVKPVTRSSSAIAGHGSTILCSAFAPNTSSRMVTGAGDNTACIWDCD 174

Query: 417 -KTKRCIRSFECGYALTCKFLPGGALVVVGTRNGELQLFDIASSTMLDNKEGAHDAAIWS 475
            +T+ C       + L C + P G L+  G+ +  ++L++ +      +    H   I S
Sbjct: 175 TQTRMCTLQGHHNWVLCCSWSPDGELIATGSMDNTIRLWESSKGKPYGDALRGHSKWITS 234

Query: 476 LDL-------TSDGRKLVTGSADKTVRFWTFEVSEVPVSDESNKTMPMLQLFHDTTLELD 528
           L           D  +L T S D T++ W           ++ + + +L L   T+    
Sbjct: 235 LSWEPIHLVKPGDKPRLATASKDGTIKIW-----------DTTRRVCLLTLCGHTS---- 279

Query: 529 DDILSVVISPDDKFIAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSMDISYDSKLIVTC 588
              +S V       +     D T++ + ++       L G  + +L     + + L  + 
Sbjct: 280 --SVSCVKWGGKNVLYSGSHDKTIRCWDMN-------LNGKCINILKSHAHWVNHL--SL 328

Query: 589 SADKNIKIWGLDF-GDCHKSL-FAHQDSIMNVKFLPESYNFF-----SCSKDATVKYWDG 641
           S D  +++   D  G+   S   A Q ++ N + + +    F     + S D T+  W+ 
Sbjct: 329 STDYALRLGAFDHKGETPASPEEAQQKALKNYEKVAKRKGDFEELMVTASDDFTMYLWNP 388

Query: 642 QK-FECIQKLAAHQSEVWSISVSNDGTFVISTGHDHSIRVWEETEDQVFLEEER 694
            K  + I ++  HQ  V  ++ S DG +++S   D+SI++W +  D  FL   R
Sbjct: 389 LKSTKPITRMTGHQKLVNHVAFSPDGRYIVSASFDNSIKLW-DGRDGKFLSTFR 441

 Score = 49.3 bits (116), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 37/145 (25%), Positives = 69/145 (47%), Gaps = 10/145 (6%)

Query: 583 KLIVTCSADKNIKIWG-LDFGDCHKSLFAHQDSIMNVKFLPESYNFFSCSKDATVKYWDG 641
           +L+VT S D  + +W  L        +  HQ  + +V F P+     S S D ++K WDG
Sbjct: 372 ELMVTASDDFTMYLWNPLKSTKPITRMTGHQKLVNHVAFSPDGRYIVSASFDNSIKLWDG 431

Query: 642 QKFECIQKLAAHQSEVWSISVSNDGTFVISTGHDHSIRVWEETEDQVFLEEEREKEMDEQ 701
           +  + +     H + V+ ++ S+D   ++S   D +++VW+    +  L  +     DE 
Sbjct: 432 RDGKFLSTFRGHVASVYQVAWSSDCRLLVSCSKDTTLKVWDVKTRK--LSVDLPGHQDEV 489

Query: 702 YEDTLLTSLEG-----GAGDEMLSV 721
           Y  T+  S++G     G  D+M+ +
Sbjct: 490 Y--TVDWSVDGKRVCSGGKDKMVRI 512

>Kwal_27.12053 s27 (1065073..1067340) [2268 bp, 755 aa] {ON} YBR198C
           (TAF5) - Probable transcription-associated factor
           protein, probable -transducin type [contig 24] FULL
          Length = 755

 Score = 85.1 bits (209), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 52/216 (24%), Positives = 97/216 (44%), Gaps = 17/216 (7%)

Query: 468 AHDAAIWSLDLTSDGRKLVTGSADKTVRFWTFEVSEVPVSDESNKTMPMLQLFHDTTLEL 527
            H   ++S   + D R L++ S DKTVR W+ +     V+ + +                
Sbjct: 480 GHSGTVYSTSFSPDNRYLLSASEDKTVRLWSTDTYTSLVNYKGH---------------- 523

Query: 528 DDDILSVVISPDDKFIAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSMDISYDSKLIVT 587
           +  I  V  SP   + A +  D T +++  D +       GH   V ++    +   + T
Sbjct: 524 NHPIWDVAFSPLGHYFATASHDQTARLWSCDHIYPLRIFAGHLNDVDTVSFHPNGTYVFT 583

Query: 588 CSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLPESYNFFSCSKDATVKYWDGQKFECI 647
            S+DK  ++W +  GD  +    H   + +    P+     + S+D  +  WD    + +
Sbjct: 584 GSSDKTCRMWDITSGDSVRLFLGHTAPVTSTAVSPDGRWLSTGSEDGVINVWDIGTGKRL 643

Query: 648 QKLAAH-QSEVWSISVSNDGTFVISTGHDHSIRVWE 682
           +++  H ++ V+S+S S +G  +IS G DHS+RVW+
Sbjct: 644 KQMRGHGKNAVYSLSYSKEGHVLISGGADHSVRVWD 679

 Score = 71.2 bits (173), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 47/181 (25%), Positives = 83/181 (45%), Gaps = 17/181 (9%)

Query: 517 LQLFHDTTLELDDDILSVVISPDDKFIAVSLLDNTVKVFFLDS--MKFFL---------- 564
           +  FH+T  E+     S+  S D +  A    D+ +K++ LD   +K  L          
Sbjct: 420 MYTFHNTNSEM----TSLEFSDDVRLAAAGFQDSIIKIWSLDGEPLKNKLPSKQGERTNN 475

Query: 565 -SLYGHKLPVLSMDISYDSKLIVTCSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLPE 623
            +L GH   V S   S D++ +++ S DK +++W  D      +   H   I +V F P 
Sbjct: 476 ETLVGHSGTVYSTSFSPDNRYLLSASEDKTVRLWSTDTYTSLVNYKGHNHPIWDVAFSPL 535

Query: 624 SYNFFSCSKDATVKYWDGQKFECIQKLAAHQSEVWSISVSNDGTFVISTGHDHSIRVWEE 683
            + F + S D T + W       ++  A H ++V ++S   +GT+V +   D + R+W+ 
Sbjct: 536 GHYFATASHDQTARLWSCDHIYPLRIFAGHLNDVDTVSFHPNGTYVFTGSSDKTCRMWDI 595

Query: 684 T 684
           T
Sbjct: 596 T 596

 Score = 62.4 bits (150), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 65/283 (22%), Positives = 114/283 (40%), Gaps = 75/283 (26%)

Query: 376 PLKLHTIDLHGQRTD----------IRSTSISDDNKLLATAS-NGSLKIWNIKTKRCIRS 424
           PLK       G+RT+          + STS S DN+ L +AS + ++++W+  T      
Sbjct: 460 PLKNKLPSKQGERTNNETLVGHSGTVYSTSFSPDNRYLLSASEDKTVRLWSTDTY----- 514

Query: 425 FECGYALTCKFLPGGALVVVGTRNGELQLFDIASSTMLDNKEGAHDAAIWSLDLTSDGRK 484
                                              T L N +G H+  IW +  +  G  
Sbjct: 515 -----------------------------------TSLVNYKG-HNHPIWDVAFSPLGHY 538

Query: 485 LVTGSADKTVRFWTFEVSEVPVSDESNKTMPMLQLFHDTTLELDDDILSVVISPDDKFIA 544
             T S D+T R W+            +   P L++F        +D+ +V   P+  ++ 
Sbjct: 539 FATASHDQTARLWS-----------CDHIYP-LRIFAGHL----NDVDTVSFHPNGTYVF 582

Query: 545 VSLLDNTVKVFFL---DSMKFFLSLYGHKLPVLSMDISYDSKLIVTCSADKNIKIWGLDF 601
               D T +++ +   DS++ FL   GH  PV S  +S D + + T S D  I +W +  
Sbjct: 583 TGSSDKTCRMWDITSGDSVRLFL---GHTAPVTSTAVSPDGRWLSTGSEDGVINVWDIGT 639

Query: 602 GDCHKSLFAH-QDSIMNVKFLPESYNFFSCSKDATVKYWDGQK 643
           G   K +  H ++++ ++ +  E +   S   D +V+ WD +K
Sbjct: 640 GKRLKQMRGHGKNAVYSLSYSKEGHVLISGGADHSVRVWDVKK 682

 Score = 61.2 bits (147), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 34/110 (30%), Positives = 58/110 (52%), Gaps = 2/110 (1%)

Query: 85  LKYHPETNLLAAGYADGVIKIWDLISKTVLISFNGHKSAITVLAFDTTGTRLISASKDSD 144
           + +HP    +  G +D   ++WD+ S   +  F GH + +T  A    G  L + S+D  
Sbjct: 572 VSFHPNGTYVFTGSSDKTCRMWDITSGDSVRLFLGHTAPVTSTAVSPDGRWLSTGSEDGV 631

Query: 145 IIVWDLVGESGLYKLRSH-KDAITGL-WCEDENWLISTSKDGLVKIWDLK 192
           I VWD+     L ++R H K+A+  L + ++ + LIS   D  V++WD+K
Sbjct: 632 INVWDIGTGKRLKQMRGHGKNAVYSLSYSKEGHVLISGGADHSVRVWDVK 681

 Score = 55.8 bits (133), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 37/151 (24%), Positives = 63/151 (41%), Gaps = 9/151 (5%)

Query: 87  YHPETNLLAAGYADGVIKIWDLISKTVLISFNGHKSAITVLAFDTTGTRLISASKDSDII 146
           + P+   L +   D  +++W   + T L+++ GH   I  +AF   G    +AS D    
Sbjct: 490 FSPDNRYLLSASEDKTVRLWSTDTYTSLVNYKGHNHPIWDVAFSPLGHYFATASHDQTAR 549

Query: 147 VWDLVGESGLYKLR---SH-KDAITGLWCEDENWLISTSKDGLVKIWDLKSQQCVETHLA 202
           +W       +Y LR    H  D  T  +  +  ++ + S D   ++WD+ S   V   L 
Sbjct: 550 LWSC---DHIYPLRIFAGHLNDVDTVSFHPNGTYVFTGSSDKTCRMWDITSGDSVRLFLG 606

Query: 203 HTGECWSLGIIEDMA--VTCSADSQVKLWKL 231
           HT    S  +  D     T S D  + +W +
Sbjct: 607 HTAPVTSTAVSPDGRWLSTGSEDGVINVWDI 637

 Score = 53.5 bits (127), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 37/159 (23%), Positives = 70/159 (44%), Gaps = 9/159 (5%)

Query: 376 PLKLHTIDLHGQRTDIRSTSISDDNKLLAT-ASNGSLKIWNIKTKRCIRSF--ECGYALT 432
           PL++      G   D+ + S   +   + T +S+ + ++W+I +   +R F        +
Sbjct: 558 PLRI----FAGHLNDVDTVSFHPNGTYVFTGSSDKTCRMWDITSGDSVRLFLGHTAPVTS 613

Query: 433 CKFLPGGALVVVGTRNGELQLFDIASSTMLDNKEGAHDAAIWSLDLTSDGRKLVTGSADK 492
               P G  +  G+ +G + ++DI +   L    G    A++SL  + +G  L++G AD 
Sbjct: 614 TAVSPDGRWLSTGSEDGVINVWDIGTGKRLKQMRGHGKNAVYSLSYSKEGHVLISGGADH 673

Query: 493 TVRFWTFEVSEVPVSDESNKTMPMLQLFHDTTLELDDDI 531
           +VR W  +V +      S    P      D T  ++ DI
Sbjct: 674 SVRVW--DVKKSTAEPGSEPEQPFTGYSGDVTSSVNQDI 710

 Score = 50.1 bits (118), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 30/101 (29%), Positives = 45/101 (44%), Gaps = 13/101 (12%)

Query: 51  VWDIKTGEQIAQLTDGLPPGASDAKLSKPAETTFLKYHPETNLLAAGYADGVIKIWDLIS 110
           +WDI +G+ +               L   A  T     P+   L+ G  DGVI +WD+ +
Sbjct: 592 MWDITSGDSVRLF------------LGHTAPVTSTAVSPDGRWLSTGSEDGVINVWDIGT 639

Query: 111 KTVLISFNGH-KSAITVLAFDTTGTRLISASKDSDIIVWDL 150
              L    GH K+A+  L++   G  LIS   D  + VWD+
Sbjct: 640 GKRLKQMRGHGKNAVYSLSYSKEGHVLISGGADHSVRVWDV 680

 Score = 42.7 bits (99), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 34/136 (25%), Positives = 58/136 (42%), Gaps = 18/136 (13%)

Query: 114 LISFNGHKSAITVLAFDTTGTRLISAS-KDSDIIVWDLVGESGLYKL------RSHKDAI 166
           + +F+   S +T L F +   RL +A  +DS I +W L GE    KL      R++ + +
Sbjct: 420 MYTFHNTNSEMTSLEF-SDDVRLAAAGFQDSIIKIWSLDGEPLKNKLPSKQGERTNNETL 478

Query: 167 TG--------LWCEDENWLISTSKDGLVKIWDLKSQQCVETHLAHTGECWSLGI--IEDM 216
            G         +  D  +L+S S+D  V++W   +   +  +  H    W +    +   
Sbjct: 479 VGHSGTVYSTSFSPDNRYLLSASEDKTVRLWSTDTYTSLVNYKGHNHPIWDVAFSPLGHY 538

Query: 217 AVTCSADSQVKLWKLD 232
             T S D   +LW  D
Sbjct: 539 FATASHDQTARLWSCD 554

>TPHA0L01690 Chr12 (355859..358357) [2499 bp, 832 aa] {ON} Anc_8.544
           YBR198C
          Length = 832

 Score = 84.7 bits (208), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 55/219 (25%), Positives = 102/219 (46%), Gaps = 19/219 (8%)

Query: 468 AHDAAIWSLDLTSDGRKLVTGSADKTVRFWTFEVSEVPVSDESNKTMPMLQLFHDTTLEL 527
            H  AI+S   + D + LV+ S DKT+R W+ +     V+ + +                
Sbjct: 551 GHSGAIYSTSFSPDNKLLVSASEDKTIRLWSMDTRTTLVTYKGH---------------- 594

Query: 528 DDDILSVVISPDDKFIAVSLLDNTVKVFFLDSMKFFLSLY-GHKLPVLSMDISYDSKLIV 586
           +  +  V  SP   + A +  D T +++  D + F L ++ GH   V  +    +   I 
Sbjct: 595 NHPVWDVQFSPVGHYFATASHDQTARLWSCDHI-FPLRIFSGHISDVDCVTFHPNGCYIF 653

Query: 587 TCSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLPESYNFFSCSKDATVKYWDGQKFEC 646
           T S+DK  ++W +  G+  +    H   I++V   P+     + S+D  +  WD    + 
Sbjct: 654 TGSSDKTCRMWDITTGESVRLFIGHTAPILSVAVAPDGLRLATGSEDGVIHIWDIGTGKS 713

Query: 647 IQKLAAH-QSEVWSISVSNDGTFVISTGHDHSIRVWEET 684
           ++KL  H +S V S+S + +   ++S G D+S+R+W+ T
Sbjct: 714 LKKLIGHGKSAVNSLSYNKESNILVSGGSDNSVRIWDLT 752

 Score = 70.5 bits (171), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 64/276 (23%), Positives = 112/276 (40%), Gaps = 65/276 (23%)

Query: 370 EPTQPAPLKLHTIDLHGQRTDIRSTSISDDNKLLATAS-NGSLKIWNIKTKRCIRSFECG 428
           E T+     + T+ L G    I STS S DNKLL +AS + ++++W++ T+  + +++  
Sbjct: 535 EKTRSQETPITTVKLVGHSGAIYSTSFSPDNKLLVSASEDKTIRLWSMDTRTTLVTYK-- 592

Query: 429 YALTCKFLPGGALVVVGTRNGELQLFDIASSTMLDNKEGAHDAAIWSLDLTSDGRKLVTG 488
                                                   H+  +W +  +  G    T 
Sbjct: 593 ---------------------------------------GHNHPVWDVQFSPVGHYFATA 613

Query: 489 SADKTVRFWTFEVSEVPVSDESNKTMPMLQLFHDTTLELDDDILSVVISPDDKFIAVSLL 548
           S D+T R W+            +   P L++F     ++D     V   P+  +I     
Sbjct: 614 SHDQTARLWS-----------CDHIFP-LRIFSGHISDVD----CVTFHPNGCYIFTGSS 657

Query: 549 DNTVKVFFL---DSMKFFLSLYGHKLPVLSMDISYDSKLIVTCSADKNIKIWGLDFGDCH 605
           D T +++ +   +S++ F+   GH  P+LS+ ++ D   + T S D  I IW +  G   
Sbjct: 658 DKTCRMWDITTGESVRLFI---GHTAPILSVAVAPDGLRLATGSEDGVIHIWDIGTGKSL 714

Query: 606 KSLFAHQDSIMN-VKFLPESYNFFSCSKDATVKYWD 640
           K L  H  S +N + +  ES    S   D +V+ WD
Sbjct: 715 KKLIGHGKSAVNSLSYNKESNILVSGGSDNSVRIWD 750

 Score = 67.4 bits (163), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 49/217 (22%), Positives = 90/217 (41%), Gaps = 39/217 (17%)

Query: 504 VPVSDESNKTMPMLQLFHDTTLELDDDILSVVISPDDKFIAVSLLDNTVKVFFLDSMKF- 562
           VP+ D     +P + +F  T L  ++++LS+  S D +  A    D+ +KV+ LD     
Sbjct: 454 VPLYDLKT-ALPSVCMF--TFLNTNNEMLSLSYSNDCRLAAAGFKDSYIKVWSLDGTTLE 510

Query: 563 -----------------------------------FLSLYGHKLPVLSMDISYDSKLIVT 587
                                               + L GH   + S   S D+KL+V+
Sbjct: 511 SKATKIQPSKSQAALRAGLDNKINEKTRSQETPITTVKLVGHSGAIYSTSFSPDNKLLVS 570

Query: 588 CSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLPESYNFFSCSKDATVKYWDGQKFECI 647
            S DK I++W +D      +   H   + +V+F P  + F + S D T + W       +
Sbjct: 571 ASEDKTIRLWSMDTRTTLVTYKGHNHPVWDVQFSPVGHYFATASHDQTARLWSCDHIFPL 630

Query: 648 QKLAAHQSEVWSISVSNDGTFVISTGHDHSIRVWEET 684
           +  + H S+V  ++   +G ++ +   D + R+W+ T
Sbjct: 631 RIFSGHISDVDCVTFHPNGCYIFTGSSDKTCRMWDIT 667

 Score = 62.4 bits (150), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 35/109 (32%), Positives = 56/109 (51%), Gaps = 2/109 (1%)

Query: 85  LKYHPETNLLAAGYADGVIKIWDLISKTVLISFNGHKSAITVLAFDTTGTRLISASKDSD 144
           + +HP    +  G +D   ++WD+ +   +  F GH + I  +A    G RL + S+D  
Sbjct: 643 VTFHPNGCYIFTGSSDKTCRMWDITTGESVRLFIGHTAPILSVAVAPDGLRLATGSEDGV 702

Query: 145 IIVWDLVGESGLYKLRSH-KDAITGL-WCEDENWLISTSKDGLVKIWDL 191
           I +WD+     L KL  H K A+  L + ++ N L+S   D  V+IWDL
Sbjct: 703 IHIWDIGTGKSLKKLIGHGKSAVNSLSYNKESNILVSGGSDNSVRIWDL 751

 Score = 61.2 bits (147), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 33/151 (21%), Positives = 67/151 (44%), Gaps = 9/151 (5%)

Query: 87  YHPETNLLAAGYADGVIKIWDLISKTVLISFNGHKSAITVLAFDTTGTRLISASKDSDII 146
           + P+  LL +   D  I++W + ++T L+++ GH   +  + F   G    +AS D    
Sbjct: 561 FSPDNKLLVSASEDKTIRLWSMDTRTTLVTYKGHNHPVWDVQFSPVGHYFATASHDQTAR 620

Query: 147 VWDLVGESGLYKLRSHKDAITGLWC----EDENWLISTSKDGLVKIWDLKSQQCVETHLA 202
           +W       ++ LR     I+ + C     +  ++ + S D   ++WD+ + + V   + 
Sbjct: 621 LWSC---DHIFPLRIFSGHISDVDCVTFHPNGCYIFTGSSDKTCRMWDITTGESVRLFIG 677

Query: 203 HTGECWSLGIIED--MAVTCSADSQVKLWKL 231
           HT    S+ +  D     T S D  + +W +
Sbjct: 678 HTAPILSVAVAPDGLRLATGSEDGVIHIWDI 708

 Score = 50.8 bits (120), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 33/102 (32%), Positives = 46/102 (45%), Gaps = 13/102 (12%)

Query: 51  VWDIKTGEQIAQLTDGLPPGASDAKLSKPAETTFLKYHPETNLLAAGYADGVIKIWDLIS 110
           +WDI TGE +        P  S A              P+   LA G  DGVI IWD+ +
Sbjct: 663 MWDITTGESVRLFIGHTAPILSVA------------VAPDGLRLATGSEDGVIHIWDIGT 710

Query: 111 KTVLISFNGH-KSAITVLAFDTTGTRLISASKDSDIIVWDLV 151
              L    GH KSA+  L+++     L+S   D+ + +WDL 
Sbjct: 711 GKSLKKLIGHGKSAVNSLSYNKESNILVSGGSDNSVRIWDLT 752

 Score = 50.4 bits (119), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 31/151 (20%), Positives = 65/151 (43%), Gaps = 4/151 (2%)

Query: 85  LKYHPETNLLAAGYADGVIKIWDLISKTVLISFNGHKSAITVLAFDTTGTRLISASKDSD 144
           +++ P  +  A    D   ++W       L  F+GH S +  + F   G  + + S D  
Sbjct: 601 VQFSPVGHYFATASHDQTARLWSCDHIFPLRIFSGHISDVDCVTFHPNGCYIFTGSSDKT 660

Query: 145 IIVWDLVGESGLYKLRSHKDAITGLWCEDENWLIST-SKDGLVKIWDLKSQQCVETHLAH 203
             +WD+     +     H   I  +    +   ++T S+DG++ IWD+ + + ++  + H
Sbjct: 661 CRMWDITTGESVRLFIGHTAPILSVAVAPDGLRLATGSEDGVIHIWDIGTGKSLKKLIGH 720

Query: 204 TGEC---WSLGIIEDMAVTCSADSQVKLWKL 231
                   S     ++ V+  +D+ V++W L
Sbjct: 721 GKSAVNSLSYNKESNILVSGGSDNSVRIWDL 751

 Score = 50.4 bits (119), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 38/153 (24%), Positives = 61/153 (39%), Gaps = 13/153 (8%)

Query: 85  LKYHPETNLLAAGYADGVIKIWDLISKTV---LISFNGHKSAITVLAFDTTGTRLISASK 141
           L Y  +  L AAG+ D  IK+W L   T+          KS   + A         + S+
Sbjct: 481 LSYSNDCRLAAAGFKDSYIKVWSLDGTTLESKATKIQPSKSQAALRAGLDNKINEKTRSQ 540

Query: 142 DSDIIVWDLVGESGLYKLRSHKDAITGLWCEDENWLISTSKDGLVKIWDLKSQQCVETHL 201
           ++ I    LVG SG     S        +  D   L+S S+D  +++W + ++  + T+ 
Sbjct: 541 ETPITTVKLVGHSGAIYSTS--------FSPDNKLLVSASEDKTIRLWSMDTRTTLVTYK 592

Query: 202 AHTGECWSLGI--IEDMAVTCSADSQVKLWKLD 232
            H    W +    +     T S D   +LW  D
Sbjct: 593 GHNHPVWDVQFSPVGHYFATASHDQTARLWSCD 625

 Score = 48.9 bits (115), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 26/102 (25%), Positives = 48/102 (47%), Gaps = 2/102 (1%)

Query: 402 LLATASNGSLKIWNIKTKRCIRSF--ECGYALTCKFLPGGALVVVGTRNGELQLFDIASS 459
           +   +S+ + ++W+I T   +R F       L+    P G  +  G+ +G + ++DI + 
Sbjct: 652 IFTGSSDKTCRMWDITTGESVRLFIGHTAPILSVAVAPDGLRLATGSEDGVIHIWDIGTG 711

Query: 460 TMLDNKEGAHDAAIWSLDLTSDGRKLVTGSADKTVRFWTFEV 501
             L    G   +A+ SL    +   LV+G +D +VR W   V
Sbjct: 712 KSLKKLIGHGKSAVNSLSYNKESNILVSGGSDNSVRIWDLTV 753

 Score = 38.1 bits (87), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 25/86 (29%), Positives = 43/86 (50%), Gaps = 18/86 (20%)

Query: 23  SVWIEPEASKRKTGNLGQVIVGGLENILVWDIKTGEQIAQLTDGLPPGASDAKLSKPAET 82
           SV + P+  +  TG+   VI        +WDI TG+ + +L      G   + ++     
Sbjct: 684 SVAVAPDGLRLATGSEDGVI-------HIWDIGTGKSLKKLI-----GHGKSAVNS---- 727

Query: 83  TFLKYHPETNLLAAGYADGVIKIWDL 108
             L Y+ E+N+L +G +D  ++IWDL
Sbjct: 728 --LSYNKESNILVSGGSDNSVRIWDL 751

>AER263C Chr5 complement(1118228..1119769) [1542 bp, 513 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YCR072C
          Length = 513

 Score = 84.0 bits (206), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 98/436 (22%), Positives = 178/436 (40%), Gaps = 96/436 (22%)

Query: 87  YHPETN-LLAAGYADGVIKIWDLISKTVLISFNGHKSAITVLAFDTTGTRLISASKDSDI 145
           + P T+  +  G  D   +IWD  ++T L +  GH + +  +A+   G  + + S D+ I
Sbjct: 149 FAPHTSSRMVTGAGDNTARIWDCDTQTPLCTLKGHSNWVLCVAWSADGEVIATGSMDATI 208

Query: 146 IVWDL-VGESGLYKLRSHKDAITGLWCE--------DENWLISTSKDGLVKIWDLKSQQC 196
            +WD   G+S    LR H   IT L  E        ++  L S SKDG +KIWD   + C
Sbjct: 209 RLWDSEKGQSLGDALRGHTKWITSLSWEPIHLVKPGEKPRLASASKDGTIKIWDTTRRVC 268

Query: 197 VETHLAHTG--ECWSLGIIEDMAVTCSADSQVKLWKLDLQAENGSKLTEKGIIEKQS--- 251
           + T   HT    C   G   ++  + S D  V+ W  D+ A  G K     I++  +   
Sbjct: 269 IYTLSGHTSSVSCIKWG-GRNVLYSASHDRTVRCW--DMAA--GGKCIN--ILKSHAHWV 321

Query: 252 KQRGVEIDFAVAPDGVKFFYIQNADKTIEIYRLRKEEEISRALKKREKRLQDKGMSEEEI 311
               +  D+A+          + A           E+  +RAL+  EK  +  G  E   
Sbjct: 322 NHLSLSTDYALRMGPFDHTGTKPAS---------PEDAQARALRNYEKVAKKNGTME--- 369

Query: 312 KEAMGSPVSLMYHLFQVVRSPYKIKSAQWTVCSNSKLELVVTTSNNSIEYYSIPYSKREP 371
                                                EL+VT S++   Y   P    +P
Sbjct: 370 -------------------------------------ELMVTGSDDFTMYLWNPLKGSKP 392

Query: 372 TQPAPLKLHTIDLHGQRTDIRSTSISDDNKLLATAS-NGSLKIWNIKTKRCIRSF----- 425
                     + + G +  +   + S D + + +AS + S+K+W+ +  + I +F     
Sbjct: 393 ---------ILRMTGHQKLVNHVAFSPDGRYIVSASFDNSIKLWDGRDGKFIATFRGHVA 443

Query: 426 ---ECGYALTCKFLPGGALVVVGTRNGELQLFDIASSTMLDNKEGAHDAAIWSLDLTSDG 482
              +  ++  C+ L      V  +++  L+++D+ +  +  +  G H+  ++++D + DG
Sbjct: 444 SVYQVAWSSDCRLL------VSCSKDTTLKVWDVKTRKLTVDLPG-HNDEVYTVDWSVDG 496

Query: 483 RKLVTGSADKTVRFWT 498
           +++ +G  DK VR WT
Sbjct: 497 KRVCSGGKDKMVRLWT 512

 Score = 75.5 bits (184), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 69/283 (24%), Positives = 126/283 (44%), Gaps = 21/283 (7%)

Query: 401 KLLATASNGSLKIWNIKTKRCIRSFECGY--ALTCKFLPGGALVVVGTRNGELQLFDIAS 458
           +L + + +G++KIW+   + CI +   G+  +++C    G  ++   + +  ++ +D+A+
Sbjct: 248 RLASASKDGTIKIWDTTRRVCIYTLS-GHTSSVSCIKWGGRNVLYSASHDRTVRCWDMAA 306

Query: 459 STMLDNKEGAHDAAIWSLDLTSDGRKLVTGSADKTVRFWTFEVSEVPVSDESNKTMPMLQ 518
                N   +H   +  L L++D   L  G  D T           P S E  +   +  
Sbjct: 307 GGKCINILKSHAHWVNHLSLSTD-YALRMGPFDHT--------GTKPASPEDAQARALRN 357

Query: 519 LFHDTTLELDDDILSVVISPDDKFIAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSMDI 578
             ++   + +  +  ++++  D F     L N +K       K  L + GH+  V  +  
Sbjct: 358 --YEKVAKKNGTMEELMVTGSDDFTM--YLWNPLK-----GSKPILRMTGHQKLVNHVAF 408

Query: 579 SYDSKLIVTCSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLPESYNFFSCSKDATVKY 638
           S D + IV+ S D +IK+W    G    +   H  S+  V +  +     SCSKD T+K 
Sbjct: 409 SPDGRYIVSASFDNSIKLWDGRDGKFIATFRGHVASVYQVAWSSDCRLLVSCSKDTTLKV 468

Query: 639 WDGQKFECIQKLAAHQSEVWSISVSNDGTFVISTGHDHSIRVW 681
           WD +  +    L  H  EV+++  S DG  V S G D  +R+W
Sbjct: 469 WDVKTRKLTVDLPGHNDEVYTVDWSVDGKRVCSGGKDKMVRLW 511

 Score = 67.8 bits (164), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 45/145 (31%), Positives = 66/145 (45%), Gaps = 15/145 (10%)

Query: 549 DNTVKVFFLDSMKFFLSLYGHKLPVLSMDISYDSKLIVTCSADKNIKIW----GLDFGDC 604
           DNT +++  D+     +L GH   VL +  S D ++I T S D  I++W    G   GD 
Sbjct: 163 DNTARIWDCDTQTPLCTLKGHSNWVLCVAWSADGEVIATGSMDATIRLWDSEKGQSLGD- 221

Query: 605 HKSLFAHQDSIMNVKFLP-------ESYNFFSCSKDATVKYWDGQKFECIQKLAAHQSEV 657
             +L  H   I ++ + P       E     S SKD T+K WD  +  CI  L+ H S V
Sbjct: 222 --ALRGHTKWITSLSWEPIHLVKPGEKPRLASASKDGTIKIWDTTRRVCIYTLSGHTSSV 279

Query: 658 WSISVSNDGTFVISTGHDHSIRVWE 682
             I        + S  HD ++R W+
Sbjct: 280 SCIKWGGR-NVLYSASHDRTVRCWD 303

 Score = 51.2 bits (121), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 28/106 (26%), Positives = 52/106 (49%), Gaps = 1/106 (0%)

Query: 85  LKYHPETNLLAAGYADGVIKIWDLISKTVLISFNGHKSAITVLAFDTTGTRLISASKDSD 144
           + + P+   + +   D  IK+WD      + +F GH +++  +A+ +    L+S SKD+ 
Sbjct: 406 VAFSPDGRYIVSASFDNSIKLWDGRDGKFIATFRGHVASVYQVAWSSDCRLLVSCSKDTT 465

Query: 145 IIVWDLVGESGLYKLRSHKDAITGL-WCEDENWLISTSKDGLVKIW 189
           + VWD+        L  H D +  + W  D   + S  KD +V++W
Sbjct: 466 LKVWDVKTRKLTVDLPGHNDEVYTVDWSVDGKRVCSGGKDKMVRLW 511

 Score = 51.2 bits (121), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 50/193 (25%), Positives = 81/193 (41%), Gaps = 30/193 (15%)

Query: 484 KLVTGSADKTVRFWTFEVSEVPVSDESNKTMPMLQLFHDTTLELDDDILSVVISPDDKFI 543
           ++VTG+ D T R W           + +   P+  L   +       +L V  S D + I
Sbjct: 156 RMVTGAGDNTARIW-----------DCDTQTPLCTLKGHSNW-----VLCVAWSADGEVI 199

Query: 544 AVSLLDNTVKVFFLDSMK---FFLSLYGHKLPVLSMDI-------SYDSKLIVTCSADKN 593
           A   +D T++++  DS K      +L GH   + S+           +   + + S D  
Sbjct: 200 ATGSMDATIRLW--DSEKGQSLGDALRGHTKWITSLSWEPIHLVKPGEKPRLASASKDGT 257

Query: 594 IKIWGLDFGDCHKSLFAHQDSIMNVKFLPESYNFFSCSKDATVKYWD-GQKFECIQKLAA 652
           IKIW      C  +L  H  S+  +K+   +   +S S D TV+ WD     +CI  L +
Sbjct: 258 IKIWDTTRRVCIYTLSGHTSSVSCIKWGGRNV-LYSASHDRTVRCWDMAAGGKCINILKS 316

Query: 653 HQSEVWSISVSND 665
           H   V  +S+S D
Sbjct: 317 HAHWVNHLSLSTD 329

 Score = 49.3 bits (116), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 28/101 (27%), Positives = 51/101 (50%), Gaps = 1/101 (0%)

Query: 583 KLIVTCSADKNIKIWG-LDFGDCHKSLFAHQDSIMNVKFLPESYNFFSCSKDATVKYWDG 641
           +L+VT S D  + +W  L        +  HQ  + +V F P+     S S D ++K WDG
Sbjct: 370 ELMVTGSDDFTMYLWNPLKGSKPILRMTGHQKLVNHVAFSPDGRYIVSASFDNSIKLWDG 429

Query: 642 QKFECIQKLAAHQSEVWSISVSNDGTFVISTGHDHSIRVWE 682
           +  + I     H + V+ ++ S+D   ++S   D +++VW+
Sbjct: 430 RDGKFIATFRGHVASVYQVAWSSDCRLLVSCSKDTTLKVWD 470

 Score = 41.6 bits (96), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 57/294 (19%), Positives = 111/294 (37%), Gaps = 52/294 (17%)

Query: 442 VVVGTRNGELQLFDIASSTMLDNKEGAHDAAIWSLDLTSDGRKLVTGSADKTVRFWTFEV 501
           +V G  +   +++D  + T L   +G H   +  +  ++DG  + TGS D T+R W    
Sbjct: 157 MVTGAGDNTARIWDCDTQTPLCTLKG-HSNWVLCVAWSADGEVIATGSMDATIRLWD--- 212

Query: 502 SEVPVSDESNKTMPMLQLFHDTTLELDDDILSVVISPDDKFIAVSLLDNTVKVFFLDSMK 561
                S++       L+        L  + + +V   +   +A +  D T+K++      
Sbjct: 213 -----SEKGQSLGDALRGHTKWITSLSWEPIHLVKPGEKPRLASASKDGTIKIWDTTRRV 267

Query: 562 FFLSLYGHKLPVLSMDISYDSKLIVTCSADKNIKIWGLDFGD-CHKSLFAHQDSIMNVKF 620
              +L GH   V  +       ++ + S D+ ++ W +  G  C   L +H   + ++  
Sbjct: 268 CIYTLSGHTSSVSCIKWG-GRNVLYSASHDRTVRCWDMAAGGKCINILKSHAHWVNHLSL 326

Query: 621 -------------------LPESYN--------------------FFSCSKDATVKYWDG 641
                               PE                         + S D T+  W+ 
Sbjct: 327 STDYALRMGPFDHTGTKPASPEDAQARALRNYEKVAKKNGTMEELMVTGSDDFTMYLWNP 386

Query: 642 QKF-ECIQKLAAHQSEVWSISVSNDGTFVISTGHDHSIRVWEETEDQVFLEEER 694
            K  + I ++  HQ  V  ++ S DG +++S   D+SI++W+   D  F+   R
Sbjct: 387 LKGSKPILRMTGHQKLVNHVAFSPDGRYIVSASFDNSIKLWDG-RDGKFIATFR 439

 Score = 41.2 bits (95), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 47/215 (21%), Positives = 93/215 (43%), Gaps = 31/215 (14%)

Query: 486 VTGSADKTVRFWTFEVSEVPVSDESNKTMPML-QLFHD---TTLELDDDILSVVISPDDK 541
           V+G+ D+ V + +F   EV   D   +T+ ++  L+H      L+  +D +++V +P   
Sbjct: 67  VSGTGDEPVPY-SFSC-EVQGKDGKGQTVDIIDNLYHSLLGPGLKGTEDFITLVYTPKAV 124

Query: 542 FIAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVL-SMDISYDSKLIVTCSADKNIKIWGLD 600
           F    +  ++             ++ GH   +L S    + S  +VT + D   +IW  D
Sbjct: 125 FKVRPVTRSSS------------AIAGHGATILCSAFAPHTSSRMVTGAGDNTARIWDCD 172

Query: 601 FGDCHKSLFAHQDSIMNVKFLPESYNFFSCSKDATVKYWDGQKFECI-QKLAAHQSEVWS 659
                 +L  H + ++ V +  +     + S DAT++ WD +K + +   L  H    W 
Sbjct: 173 TQTPLCTLKGHSNWVLCVAWSADGEVIATGSMDATIRLWDSEKGQSLGDALRGHTK--WI 230

Query: 660 ISVSNDGTFVISTGH---------DHSIRVWEETE 685
            S+S +   ++  G          D +I++W+ T 
Sbjct: 231 TSLSWEPIHLVKPGEKPRLASASKDGTIKIWDTTR 265

 Score = 37.0 bits (84), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 21/89 (23%), Positives = 39/89 (43%), Gaps = 1/89 (1%)

Query: 607 SLFAHQDSIMNVKFLPE-SYNFFSCSKDATVKYWDGQKFECIQKLAAHQSEVWSISVSND 665
           ++  H  +I+   F P  S    + + D T + WD      +  L  H + V  ++ S D
Sbjct: 136 AIAGHGATILCSAFAPHTSSRMVTGAGDNTARIWDCDTQTPLCTLKGHSNWVLCVAWSAD 195

Query: 666 GTFVISTGHDHSIRVWEETEDQVFLEEER 694
           G  + +   D +IR+W+  + Q   +  R
Sbjct: 196 GEVIATGSMDATIRLWDSEKGQSLGDALR 224

>TPHA0I03240 Chr9 (714446..715879) [1434 bp, 477 aa] {ON} Anc_7.534
           YPR178W
          Length = 477

 Score = 83.6 bits (205), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 71/295 (24%), Positives = 136/295 (46%), Gaps = 25/295 (8%)

Query: 396 ISDDNKLLATAS-NGSLKI---WNIKTKRCIRSFECGYALTCKFLPGGALVVVGTRNGEL 451
           ++  +KLLA+ S +G++ I    N++ K   ++   G     ++    A +  G  +  +
Sbjct: 196 LAPQSKLLASGSWDGAISIVDNMNLERKTHFQAAHVGKIGGIEWSNDEAYLFTGGEDCLV 255

Query: 452 QLFDIASS--TMLDNKEGAHDAAIWSLDLTSDGRKLVTGSADKTVRFWTFEVSEVPVSDE 509
           ++F    +  T +D  +G H   +  + L   G+ L + S D T R W  E         
Sbjct: 256 KVFGYEKNDLTSIDTLKG-HQGRVSDVKLHPLGKYLGSSSFDNTWRLWDIE--------- 305

Query: 510 SNKTMPMLQLFHDTTLELDDDILSVVISPDDKFIAVSLLDNTVKVFFLDSMKFFLSLYGH 569
             K   +LQ  H        +I S+    D    A +  D+   ++ L S K  ++L GH
Sbjct: 306 -KKKEILLQEGHSK------EIFSLAFHTDGSLTATAGFDSIGMIWDLRSGKNIMNLIGH 358

Query: 570 KLPVLSMDISYDSKLIVTCSADKNIKIWGLDFGDCH-KSLFAHQDSIMNVKFLPESYNF- 627
             P+ S+D + +   + T S D  IKIW L   + +  S+FAH++ + +V++   +  F 
Sbjct: 359 AKPIYSLDWAPNGYQLATGSGDGTIKIWDLRNKESNCASIFAHKNLVTSVQYEKNNGGFV 418

Query: 628 FSCSKDATVKYWDGQKFECIQKLAAHQSEVWSISVSNDGTFVISTGHDHSIRVWE 682
           FS   D  +K  D + +E +  L  H  ++ ++  S     ++S+G D ++++W+
Sbjct: 419 FSAGYDKLIKIHDSKTYESVATLEGHTEKILTLDTSPISNLIVSSGWDRTVKIWD 473

 Score = 77.8 bits (190), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 63/250 (25%), Positives = 108/250 (43%), Gaps = 16/250 (6%)

Query: 433 CKFLPGGALVVVGTRNGELQLFDIASSTMLDNKEGAHDAAIWSLDLTSDGRKLVTGSADK 492
            K  P   L+  G+ +G + + D  +     + + AH   I  ++ ++D   L TG  D 
Sbjct: 194 VKLAPQSKLLASGSWDGAISIVDNMNLERKTHFQAAHVGKIGGIEWSNDEAYLFTGGEDC 253

Query: 493 TVRFWTFEVSEVPVSDESNKTMPMLQLFHDTTLELDDDILSVVISPDDKFIAVSLLDNTV 552
            V+ + +E +++   D    T+   Q            +  V + P  K++  S  DNT 
Sbjct: 254 LVKVFGYEKNDLTSID----TLKGHQ----------GRVSDVKLHPLGKYLGSSSFDNTW 299

Query: 553 KVFFLDSMKFFLSLYGHKLPVLSMDISYDSKLIVTCSADKNIKIWGLDFGDCHKSLFAHQ 612
           +++ ++  K  L   GH   + S+    D  L  T   D    IW L  G    +L  H 
Sbjct: 300 RLWDIEKKKEILLQEGHSKEIFSLAFHTDGSLTATAGFDSIGMIWDLRSGKNIMNLIGHA 359

Query: 613 DSIMNVKFLPESYNFFSCSKDATVKYWDGQKFEC-IQKLAAHQSEVWSISV-SNDGTFVI 670
             I ++ + P  Y   + S D T+K WD +  E     + AH++ V S+    N+G FV 
Sbjct: 360 KPIYSLDWAPNGYQLATGSGDGTIKIWDLRNKESNCASIFAHKNLVTSVQYEKNNGGFVF 419

Query: 671 STGHDHSIRV 680
           S G+D  I++
Sbjct: 420 SAGYDKLIKI 429

 Score = 67.4 bits (163), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 48/153 (31%), Positives = 75/153 (49%), Gaps = 5/153 (3%)

Query: 85  LKYHPETNLLAAGYADGVIKIWDLISKTVLISFNGHKSAITVLAFDTTGTRLISASKDSD 144
           L +H + +L A    D +  IWDL S   +++  GH   I  L +   G +L + S D  
Sbjct: 323 LAFHTDGSLTATAGFDSIGMIWDLRSGKNIMNLIGHAKPIYSLDWAPNGYQLATGSGDGT 382

Query: 145 IIVWDLVG-ESGLYKLRSHKDAITGLWCEDEN--WLISTSKDGLVKIWDLKSQQCVETHL 201
           I +WDL   ES    + +HK+ +T +  E  N  ++ S   D L+KI D K+ + V T  
Sbjct: 383 IKIWDLRNKESNCASIFAHKNLVTSVQYEKNNGGFVFSAGYDKLIKIHDSKTYESVATLE 442

Query: 202 AHTGECWSLGI--IEDMAVTCSADSQVKLWKLD 232
            HT +  +L    I ++ V+   D  VK+W  D
Sbjct: 443 GHTEKILTLDTSPISNLIVSSGWDRTVKIWDND 475

 Score = 61.6 bits (148), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 36/113 (31%), Positives = 55/113 (48%), Gaps = 1/113 (0%)

Query: 85  LKYHPETNLLAAGYADGVIKIWDLISKTVLISFNGHKSAITVLAFDTTGTRLISASKDSD 144
           +K HP    L +   D   ++WD+  K  ++   GH   I  LAF T G+   +A  DS 
Sbjct: 281 VKLHPLGKYLGSSSFDNTWRLWDIEKKKEILLQEGHSKEIFSLAFHTDGSLTATAGFDSI 340

Query: 145 IIVWDLVGESGLYKLRSHKDAITGL-WCEDENWLISTSKDGLVKIWDLKSQQC 196
            ++WDL     +  L  H   I  L W  +   L + S DG +KIWDL++++ 
Sbjct: 341 GMIWDLRSGKNIMNLIGHAKPIYSLDWAPNGYQLATGSGDGTIKIWDLRNKES 393

 Score = 58.5 bits (140), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 61/240 (25%), Positives = 108/240 (45%), Gaps = 29/240 (12%)

Query: 366 YSKREPTQPAPLKLHTIDLHGQRTDIRSTSISDDNKLLATAS-NGSLKIWNIKTKRCIRS 424
           Y K + T    LK H     G+ +D++   +    K L ++S + + ++W+I+ K+ I  
Sbjct: 260 YEKNDLTSIDTLKGH----QGRVSDVKLHPLG---KYLGSSSFDNTWRLWDIEKKKEIL- 311

Query: 425 FECGYA---LTCKFLPGGALVVVGTRNGELQLFDIASSTMLDNKEGAHDAAIWSLDLTSD 481
            + G++    +  F   G+L      +    ++D+ S   + N  G H   I+SLD   +
Sbjct: 312 LQEGHSKEIFSLAFHTDGSLTATAGFDSIGMIWDLRSGKNIMNLIG-HAKPIYSLDWAPN 370

Query: 482 GRKLVTGSADKTVRFWTFEVSEVPVSDESNKTMPMLQLFHDTTLELDDDILSVVISPDDK 541
           G +L TGS D T++ W          D  NK      +F    L     + SV    ++ 
Sbjct: 371 GYQLATGSGDGTIKIW----------DLRNKESNCASIFAHKNL-----VTSVQYEKNNG 415

Query: 542 -FIAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSMDISYDSKLIVTCSADKNIKIWGLD 600
            F+  +  D  +K+    + +   +L GH   +L++D S  S LIV+   D+ +KIW  D
Sbjct: 416 GFVFSAGYDKLIKIHDSKTYESVATLEGHTEKILTLDTSPISNLIVSSGWDRTVKIWDND 475

 Score = 39.7 bits (91), Expect = 0.039,   Method: Compositional matrix adjust.
 Identities = 58/246 (23%), Positives = 110/246 (44%), Gaps = 33/246 (13%)

Query: 53  DIKTGEQIAQLTDGLPPGASDAKLSKPAETTFLKYHPETNLLAAGYADGVIKIWDLISKT 112
           ++KTG +  +LT       S     +P   + +K  P++ LLA+G  DG I I D ++  
Sbjct: 170 NLKTGLKRYELT------GSQVIAERPV--SVVKLAPQSKLLASGSWDGAISIVDNMNLE 221

Query: 113 VLISFN-GHKSAITVLAFDTTGTRLISASKDSDIIVW-----DLVGESGLYKLRSHKDAI 166
               F   H   I  + +      L +  +D  + V+     DL   + +  L+ H+  +
Sbjct: 222 RKTHFQAAHVGKIGGIEWSNDEAYLFTGGEDCLVKVFGYEKNDL---TSIDTLKGHQGRV 278

Query: 167 TGLWCED-ENWLISTSKDGLVKIWDLKSQQCVETHLAHTGECWSLGIIEDMAVTCSA--D 223
           + +       +L S+S D   ++WD++ ++ +     H+ E +SL    D ++T +A  D
Sbjct: 279 SDVKLHPLGKYLGSSSFDNTWRLWDIEKKKEILLQEGHSKEIFSLAFHTDGSLTATAGFD 338

Query: 224 SQVKLWKLDLQAENGSKLTEKGIIEKQSKQRGV-EIDFAVAPDGVKFFYIQNADKTIEIY 282
           S   +W L          + K I+      + +  +D+  AP+G +     + D TI+I+
Sbjct: 339 SIGMIWDLR---------SGKNIMNLIGHAKPIYSLDW--APNGYQ-LATGSGDGTIKIW 386

Query: 283 RLRKEE 288
            LR +E
Sbjct: 387 DLRNKE 392

 Score = 39.3 bits (90), Expect = 0.042,   Method: Compositional matrix adjust.
 Identities = 31/129 (24%), Positives = 56/129 (43%), Gaps = 3/129 (2%)

Query: 112 TVLISFNGHKSAITVLAFDTTGTRLISASKDSDIIVWDLVGESGLYKLRSHKDAITGLWC 171
           T + +  GH+  ++ +     G  L S+S D+   +WD+  +  +     H   I  L  
Sbjct: 266 TSIDTLKGHQGRVSDVKLHPLGKYLGSSSFDNTWRLWDIEKKKEILLQEGHSKEIFSLAF 325

Query: 172 EDENWLISTSK-DGLVKIWDLKSQQCVETHLAHTGECWSLGIIED--MAVTCSADSQVKL 228
             +  L +T+  D +  IWDL+S + +   + H    +SL    +     T S D  +K+
Sbjct: 326 HTDGSLTATAGFDSIGMIWDLRSGKNIMNLIGHAKPIYSLDWAPNGYQLATGSGDGTIKI 385

Query: 229 WKLDLQAEN 237
           W L  +  N
Sbjct: 386 WDLRNKESN 394

>NCAS0A15170 Chr1 (2984221..2985645) [1425 bp, 474 aa] {ON}
           Anc_7.534
          Length = 474

 Score = 83.2 bits (204), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 75/307 (24%), Positives = 128/307 (41%), Gaps = 36/307 (11%)

Query: 391 IRSTSISDDNKLLATAS-NGSLKIWNIKTKRCIRSFECGY---------ALTCKFLPGGA 440
           I    +  DN L AT S  G +KI + KT   I   E G+           T   L  GA
Sbjct: 189 ISKVCLMSDNALCATGSWAGDIKILDTKTLDVISGIENGHDGKIGGLAWNSTNTHLVSGA 248

Query: 441 ---LVVVGTRNGELQLFDIASSTMLDNKEGAHDAAIWSLDLTSDGRKLVTGSADKTVRFW 497
              LV + + + ++++  I   T L      H   + ++D    GR + + S D T R W
Sbjct: 249 DDCLVKIHSFDPDVKI--IKELTALQ----GHTGRVVNVDFHPSGRFVASASFDMTWRLW 302

Query: 498 TFEVSEVPVSDESNKTMPMLQLFHDTTLELDDDILSVVISPDDKFIAVSLLDNTVKVFFL 557
             E          ++T    Q  H        ++ S+    D   +    LDN   V+ +
Sbjct: 303 DIE----------SETELQFQEGHGK------EVYSLSFQNDGALLCSGGLDNAAIVWDV 346

Query: 558 DSMKFFLSLYGHKLPVLSMDISYDSKLIVTCSADKNIKIWGLDFGDCHKSLFAHQDSIMN 617
            + K  ++L GH  P+ S+D S D   I T   D  I IW +        L AH + +  
Sbjct: 347 RTGKSIMNLQGHAKPIYSVDWSPDGYHIATGGGDGVINIWDIRKTTETTRLLAHNNIVTG 406

Query: 618 VKFLPES-YNFFSCSKDATVKYWDGQKFECIQKLAAHQSEVWSISVSNDGTFVISTGHDH 676
           V+F   + +   SC  D  ++ +    +  ++ L  H  ++  + +S D   ++S+G D 
Sbjct: 407 VRFQKSTGHCLVSCGYDKQIRIYSSDNWIQVKTLEGHTDKILDVDISEDAQLIVSSGWDR 466

Query: 677 SIRVWEE 683
           S+++W++
Sbjct: 467 SLKLWKQ 473

 Score = 66.2 bits (160), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 42/161 (26%), Positives = 68/161 (42%), Gaps = 22/161 (13%)

Query: 85  LKYHPETNLLAAGYADGVIKIWDLISKTVLISFNGHKSAITVLAFDTTGTRLISASKDSD 144
           + +HP    +A+   D   ++WD+ S+T L    GH   +  L+F   G  L S   D+ 
Sbjct: 281 VDFHPSGRFVASASFDMTWRLWDIESETELQFQEGHGKEVYSLSFQNDGALLCSGGLDNA 340

Query: 145 IIVWDLVGESGLYKLRSHKDAITGL-WCEDENWLISTSKDGLVKIWDLKSQQCVETHLAH 203
            IVWD+     +  L+ H   I  + W  D   + +   DG++ IWD++        LAH
Sbjct: 341 AIVWDVRTGKSIMNLQGHAKPIYSVDWSPDGYHIATGGGDGVINIWDIRKTTETTRLLAH 400

Query: 204 ------------TGECWSLGIIEDMAVTCSADSQVKLWKLD 232
                       TG C          V+C  D Q++++  D
Sbjct: 401 NNIVTGVRFQKSTGHC---------LVSCGYDKQIRIYSSD 432

 Score = 53.5 bits (127), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 37/154 (24%), Positives = 71/154 (46%), Gaps = 4/154 (2%)

Query: 81  ETTFLKYHPETNLLAAGYADGVIKIWDLISKTVLISFNGHKSAITVLAFDTTGTRLISAS 140
           E   L +  +  LL +G  D    +WD+ +   +++  GH   I  + +   G  + +  
Sbjct: 319 EVYSLSFQNDGALLCSGGLDNAAIVWDVRTGKSIMNLQGHAKPIYSVDWSPDGYHIATGG 378

Query: 141 KDSDIIVWDLVGESGLYKLRSHKDAITGLWCEDE--NWLISTSKDGLVKIWDLKSQQCVE 198
            D  I +WD+   +   +L +H + +TG+  +    + L+S   D  ++I+   +   V+
Sbjct: 379 GDGVINIWDIRKTTETTRLLAHNNIVTGVRFQKSTGHCLVSCGYDKQIRIYSSDNWIQVK 438

Query: 199 THLAHTGECWSLGIIEDMAVTCSA--DSQVKLWK 230
           T   HT +   + I ED  +  S+  D  +KLWK
Sbjct: 439 TLEGHTDKILDVDISEDAQLIVSSGWDRSLKLWK 472

 Score = 38.5 bits (88), Expect = 0.070,   Method: Compositional matrix adjust.
 Identities = 45/207 (21%), Positives = 84/207 (40%), Gaps = 18/207 (8%)

Query: 48  NILVWDIKTGEQIAQLTDGLPPGASDAKLSKPAETTFLKYHPETNLLAAGYADGVIKI-- 105
           +I + D KT + I+ + +G      D K+        L ++     L +G  D ++KI  
Sbjct: 209 DIKILDTKTLDVISGIENG-----HDGKIGG------LAWNSTNTHLVSGADDCLVKIHS 257

Query: 106 WDLISKTV--LISFNGHKSAITVLAFDTTGTRLISASKDSDIIVWDLVGESGLYKLRSHK 163
           +D   K +  L +  GH   +  + F  +G  + SAS D    +WD+  E+ L     H 
Sbjct: 258 FDPDVKIIKELTALQGHTGRVVNVDFHPSGRFVASASFDMTWRLWDIESETELQFQEGHG 317

Query: 164 DAITGLWCEDENWLI-STSKDGLVKIWDLKSQQCVETHLAHTGECWSLGIIED--MAVTC 220
             +  L  +++  L+ S   D    +WD+++ + +     H    +S+    D     T 
Sbjct: 318 KEVYSLSFQNDGALLCSGGLDNAAIVWDVRTGKSIMNLQGHAKPIYSVDWSPDGYHIATG 377

Query: 221 SADSQVKLWKLDLQAENGSKLTEKGII 247
             D  + +W +    E    L    I+
Sbjct: 378 GGDGVINIWDIRKTTETTRLLAHNNIV 404

>KLTH0E12606g Chr5 (1120419..1122686) [2268 bp, 755 aa] {ON} similar
           to uniprot|P38129 Saccharomyces cerevisiae YBR198C TAF5
           Subunit (90 kDa) of TFIID and SAGA complexes involved in
           RNA polymerase II transcription initiation and in
           chromatin modification
          Length = 755

 Score = 84.0 bits (206), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 52/216 (24%), Positives = 96/216 (44%), Gaps = 17/216 (7%)

Query: 468 AHDAAIWSLDLTSDGRKLVTGSADKTVRFWTFEVSEVPVSDESNKTMPMLQLFHDTTLEL 527
            H   ++S   + D R L++ S DKTVR W+ +     VS + +                
Sbjct: 480 GHSGTVYSTAFSPDNRYLLSASEDKTVRLWSTDTYTSLVSYKGH---------------- 523

Query: 528 DDDILSVVISPDDKFIAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSMDISYDSKLIVT 587
           +  I  V  SP   + A +  D T +++  D +       GH   V ++    +   + T
Sbjct: 524 NHPIWDVAFSPLGHYFATASHDQTARLWSCDHIYPLRIFAGHLNDVDTVSFHPNGTYVFT 583

Query: 588 CSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLPESYNFFSCSKDATVKYWDGQKFECI 647
            S+DK  ++W +  GD  +    H   +      P+     + S+D  +  WD    + +
Sbjct: 584 GSSDKTCRMWDMSTGDSVRLFLGHTAPVTATAVSPDGRWLSTGSEDGIINVWDIGTGKRL 643

Query: 648 QKLAAH-QSEVWSISVSNDGTFVISTGHDHSIRVWE 682
           +++  H ++ V+S+S S +G  ++S G DHS+RVW+
Sbjct: 644 KQMRGHGKNAVYSLSYSKEGHVLVSGGADHSLRVWD 679

 Score = 76.6 bits (187), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 51/217 (23%), Positives = 96/217 (44%), Gaps = 11/217 (5%)

Query: 470 DAAIWSLDLTSDGRKLVTGSADKTVRFWTFE----VSEVPVSDESNKTMPMLQLFHDTTL 525
           ++ + SL+ + D R    G  D  V+ W+ +     S++P S +  ++     + H  T 
Sbjct: 427 NSEMTSLEFSDDVRLASAGFQDSIVKIWSLDGEPLSSKLP-SKQDERSNNATLVGHSGT- 484

Query: 526 ELDDDILSVVISPDDKFIAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSMDISYDSKLI 585
                + S   SPD++++  +  D TV+++  D+    +S  GH  P+  +  S      
Sbjct: 485 -----VYSTAFSPDNRYLLSASEDKTVRLWSTDTYTSLVSYKGHNHPIWDVAFSPLGHYF 539

Query: 586 VTCSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLPESYNFFSCSKDATVKYWDGQKFE 645
            T S D+  ++W  D     +    H + +  V F P     F+ S D T + WD    +
Sbjct: 540 ATASHDQTARLWSCDHIYPLRIFAGHLNDVDTVSFHPNGTYVFTGSSDKTCRMWDMSTGD 599

Query: 646 CIQKLAAHQSEVWSISVSNDGTFVISTGHDHSIRVWE 682
            ++    H + V + +VS DG ++ +   D  I VW+
Sbjct: 600 SVRLFLGHTAPVTATAVSPDGRWLSTGSEDGIINVWD 636

 Score = 71.6 bits (174), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 49/188 (26%), Positives = 83/188 (44%), Gaps = 18/188 (9%)

Query: 517 LQLFHDTTLELDDDILSVVISPDDKFIAVSLLDNTVKVFFLDSMKFF------------- 563
           +  FH+T  E+     S+  S D +  +    D+ VK++ LD                  
Sbjct: 420 MYTFHNTNSEM----TSLEFSDDVRLASAGFQDSIVKIWSLDGEPLSSKLPSKQDERSNN 475

Query: 564 LSLYGHKLPVLSMDISYDSKLIVTCSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLPE 623
            +L GH   V S   S D++ +++ S DK +++W  D      S   H   I +V F P 
Sbjct: 476 ATLVGHSGTVYSTAFSPDNRYLLSASEDKTVRLWSTDTYTSLVSYKGHNHPIWDVAFSPL 535

Query: 624 SYNFFSCSKDATVKYWDGQKFECIQKLAAHQSEVWSISVSNDGTFVISTGHDHSIRVWE- 682
            + F + S D T + W       ++  A H ++V ++S   +GT+V +   D + R+W+ 
Sbjct: 536 GHYFATASHDQTARLWSCDHIYPLRIFAGHLNDVDTVSFHPNGTYVFTGSSDKTCRMWDM 595

Query: 683 ETEDQVFL 690
            T D V L
Sbjct: 596 STGDSVRL 603

 Score = 58.5 bits (140), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 31/110 (28%), Positives = 58/110 (52%), Gaps = 2/110 (1%)

Query: 85  LKYHPETNLLAAGYADGVIKIWDLISKTVLISFNGHKSAITVLAFDTTGTRLISASKDSD 144
           + +HP    +  G +D   ++WD+ +   +  F GH + +T  A    G  L + S+D  
Sbjct: 572 VSFHPNGTYVFTGSSDKTCRMWDMSTGDSVRLFLGHTAPVTATAVSPDGRWLSTGSEDGI 631

Query: 145 IIVWDLVGESGLYKLRSH-KDAITGL-WCEDENWLISTSKDGLVKIWDLK 192
           I VWD+     L ++R H K+A+  L + ++ + L+S   D  +++WD+K
Sbjct: 632 INVWDIGTGKRLKQMRGHGKNAVYSLSYSKEGHVLVSGGADHSLRVWDVK 681

 Score = 55.5 bits (132), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 36/151 (23%), Positives = 63/151 (41%), Gaps = 9/151 (5%)

Query: 87  YHPETNLLAAGYADGVIKIWDLISKTVLISFNGHKSAITVLAFDTTGTRLISASKDSDII 146
           + P+   L +   D  +++W   + T L+S+ GH   I  +AF   G    +AS D    
Sbjct: 490 FSPDNRYLLSASEDKTVRLWSTDTYTSLVSYKGHNHPIWDVAFSPLGHYFATASHDQTAR 549

Query: 147 VWDLVGESGLYKLR---SH-KDAITGLWCEDENWLISTSKDGLVKIWDLKSQQCVETHLA 202
           +W       +Y LR    H  D  T  +  +  ++ + S D   ++WD+ +   V   L 
Sbjct: 550 LWSC---DHIYPLRIFAGHLNDVDTVSFHPNGTYVFTGSSDKTCRMWDMSTGDSVRLFLG 606

Query: 203 HTGECWSLGIIEDMA--VTCSADSQVKLWKL 231
           HT    +  +  D     T S D  + +W +
Sbjct: 607 HTAPVTATAVSPDGRWLSTGSEDGIINVWDI 637

 Score = 53.5 bits (127), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 37/159 (23%), Positives = 69/159 (43%), Gaps = 9/159 (5%)

Query: 376 PLKLHTIDLHGQRTDIRSTSISDDNKLLAT-ASNGSLKIWNIKTKRCIRSF--ECGYALT 432
           PL++      G   D+ + S   +   + T +S+ + ++W++ T   +R F         
Sbjct: 558 PLRI----FAGHLNDVDTVSFHPNGTYVFTGSSDKTCRMWDMSTGDSVRLFLGHTAPVTA 613

Query: 433 CKFLPGGALVVVGTRNGELQLFDIASSTMLDNKEGAHDAAIWSLDLTSDGRKLVTGSADK 492
               P G  +  G+ +G + ++DI +   L    G    A++SL  + +G  LV+G AD 
Sbjct: 614 TAVSPDGRWLSTGSEDGIINVWDIGTGKRLKQMRGHGKNAVYSLSYSKEGHVLVSGGADH 673

Query: 493 TVRFWTFEVSEVPVSDESNKTMPMLQLFHDTTLELDDDI 531
           ++R W  +V +      S    P      D T  ++ DI
Sbjct: 674 SLRVW--DVKKSTAEPGSEPEQPFTSFSGDVTTSVNQDI 710

 Score = 48.9 bits (115), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 28/101 (27%), Positives = 45/101 (44%), Gaps = 13/101 (12%)

Query: 51  VWDIKTGEQIAQLTDGLPPGASDAKLSKPAETTFLKYHPETNLLAAGYADGVIKIWDLIS 110
           +WD+ TG+ +               L   A  T     P+   L+ G  DG+I +WD+ +
Sbjct: 592 MWDMSTGDSVRLF------------LGHTAPVTATAVSPDGRWLSTGSEDGIINVWDIGT 639

Query: 111 KTVLISFNGH-KSAITVLAFDTTGTRLISASKDSDIIVWDL 150
              L    GH K+A+  L++   G  L+S   D  + VWD+
Sbjct: 640 GKRLKQMRGHGKNAVYSLSYSKEGHVLVSGGADHSLRVWDV 680

 Score = 45.1 bits (105), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 34/136 (25%), Positives = 57/136 (41%), Gaps = 18/136 (13%)

Query: 114 LISFNGHKSAITVLAFDTTGTRLISAS-KDSDIIVWDLVGESGLYKLRSHKD-------- 164
           + +F+   S +T L F +   RL SA  +DS + +W L GE    KL S +D        
Sbjct: 420 MYTFHNTNSEMTSLEF-SDDVRLASAGFQDSIVKIWSLDGEPLSSKLPSKQDERSNNATL 478

Query: 165 ------AITGLWCEDENWLISTSKDGLVKIWDLKSQQCVETHLAHTGECWSLGI--IEDM 216
                   +  +  D  +L+S S+D  V++W   +   + ++  H    W +    +   
Sbjct: 479 VGHSGTVYSTAFSPDNRYLLSASEDKTVRLWSTDTYTSLVSYKGHNHPIWDVAFSPLGHY 538

Query: 217 AVTCSADSQVKLWKLD 232
             T S D   +LW  D
Sbjct: 539 FATASHDQTARLWSCD 554

>ZYRO0E04620g Chr5 (348647..349558) [912 bp, 303 aa] {ON} highly
           similar to uniprot|P41318 Saccharomyces cerevisiae
           YNL006W LST8 Protein required for the transport of amino
           acid permease Gap1p from the Golgi to the cell surface
           component of the TOR signaling pathway associates with
           both Tor1p and Tor2p contains a WD-repeat
          Length = 303

 Score = 80.9 bits (198), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 60/254 (23%), Positives = 116/254 (45%), Gaps = 22/254 (8%)

Query: 349 ELVVTTSNNSIEYYSIPYSKREPTQPAPLKLHTIDLHGQRTDIRSTSISDDNKLLATAS- 407
           +L+    + ++  Y I       T P P+        G R ++ S S   DNK +AT+S 
Sbjct: 45  KLLAAAGHQNVRLYDI-----RTTNPNPVA----SFEGHRGNVTSVSFQQDNKWMATSSE 95

Query: 408 NGSLKIWNIKTKRCIRSFECGYALTCKFL-PGGALVVVGTRNGELQLFDIASSTMLDNKE 466
           +G++K+W+++     R+++    +    + P    ++   R+G ++++D+  +       
Sbjct: 96  DGTIKVWDVRAPSIPRNYKLNAPVNEVVIHPNQGELISCDRDGHIRIWDLGENQCTHQLT 155

Query: 467 GAHDAAIWSLDLTSDGRKLVTGSADKTVRFWTFEVSEVPVSDESNKTMPMLQLFHDTTLE 526
              D  + SL L SDG  LV  +       W     E+P   +++   P+ +     T  
Sbjct: 156 PEDDTPLQSLSLASDGSMLVAANNKGNCYVW-----EMPNRTDASNLKPVTKFRSHNTY- 209

Query: 527 LDDDILSVVISPDDKFIAVSLLDNTVKVFFLD-SMKFFLSLYGHKLPVLSMDISYDSKLI 585
               I  +++S D K +A    D+T +V+ +D + K   +L GH+  V     S DS  +
Sbjct: 210 ----ITRILLSSDVKHLATCSADHTARVWSVDDNFKLETTLDGHQRWVWDCAFSADSAYL 265

Query: 586 VTCSADKNIKIWGL 599
           +T S+D  +++W L
Sbjct: 266 MTASSDHYVRLWDL 279

 Score = 59.3 bits (142), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 54/270 (20%), Positives = 114/270 (42%), Gaps = 28/270 (10%)

Query: 396 ISDDNKLLATASNGSLKIWNIKT--KRCIRSFEC--GYALTCKFLPGGALVVVGTRNGEL 451
           I++D KLLA A + ++++++I+T     + SFE   G   +  F      +   + +G +
Sbjct: 40  ITNDKKLLAAAGHQNVRLYDIRTTNPNPVASFEGHRGNVTSVSFQQDNKWMATSSEDGTI 99

Query: 452 QLFDIASSTMLDNKEGAHDAAIWSLDLTSDGRKLVTGSADKTVRFWTFEVSEVPVSDESN 511
           +++D+ + ++  N +   +A +  + +  +  +L++   D  +R W    +         
Sbjct: 100 KVWDVRAPSIPRNYKL--NAPVNEVVIHPNQGELISCDRDGHIRIWDLGEN--------- 148

Query: 512 KTMPMLQLFHDTTLELDDDILSVVISPDDKFIAVSLLDNTVKVFFL------DSMKFFLS 565
                 Q  H  T E D  + S+ ++ D   +  +       V+ +       ++K    
Sbjct: 149 ------QCTHQLTPEDDTPLQSLSLASDGSMLVAANNKGNCYVWEMPNRTDASNLKPVTK 202

Query: 566 LYGHKLPVLSMDISYDSKLIVTCSADKNIKIWGLDFG-DCHKSLFAHQDSIMNVKFLPES 624
              H   +  + +S D K + TCSAD   ++W +D       +L  HQ  + +  F  +S
Sbjct: 203 FRSHNTYITRILLSSDVKHLATCSADHTARVWSVDDNFKLETTLDGHQRWVWDCAFSADS 262

Query: 625 YNFFSCSKDATVKYWDGQKFECIQKLAAHQ 654
               + S D  V+ WD    E +++   H 
Sbjct: 263 AYLMTASSDHYVRLWDLSTREIVRQYGGHH 292

 Score = 57.8 bits (138), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 53/292 (18%), Positives = 116/292 (39%), Gaps = 29/292 (9%)

Query: 402 LLATASNGSLKIWNIKTKRCIRSFECGYALTCKF-LPGGALVVVGTRNGELQLFDIASST 460
           L++   + +++ W   T  C R+ +   +   +  +     ++    +  ++L+DI ++ 
Sbjct: 5   LVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLAAAGHQNVRLYDIRTTN 64

Query: 461 M--LDNKEGAHDAAIWSLDLTSDGRKLVTGSADKTVRFWTFEVSEVPVSDESNKTMPMLQ 518
              + + EG H   + S+    D + + T S D T++ W      +P             
Sbjct: 65  PNPVASFEG-HRGNVTSVSFQQDNKWMATSSEDGTIKVWDVRAPSIP------------- 110

Query: 519 LFHDTTLELDDDILSVVISPDDKFIAVSLLDNTVKVFFLDSMKFFLSLYGHK-LPVLSMD 577
                  +L+  +  VVI P+   +     D  ++++ L   +    L      P+ S+ 
Sbjct: 111 ----RNYKLNAPVNEVVIHPNQGELISCDRDGHIRIWDLGENQCTHQLTPEDDTPLQSLS 166

Query: 578 ISYDSKLIVTCSADKNIKIWGLDFGDCHKSL------FAHQDSIMNVKFLPESYNFFSCS 631
           ++ D  ++V  +   N  +W +       +L       +H   I  +    +  +  +CS
Sbjct: 167 LASDGSMLVAANNKGNCYVWEMPNRTDASNLKPVTKFRSHNTYITRILLSSDVKHLATCS 226

Query: 632 KDATVKYWD-GQKFECIQKLAAHQSEVWSISVSNDGTFVISTGHDHSIRVWE 682
            D T + W     F+    L  HQ  VW  + S D  ++++   DH +R+W+
Sbjct: 227 ADHTARVWSVDDNFKLETTLDGHQRWVWDCAFSADSAYLMTASSDHYVRLWD 278

 Score = 50.4 bits (119), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 33/110 (30%), Positives = 58/110 (52%), Gaps = 8/110 (7%)

Query: 93  LLAAGYADGVIKIWDL--ISKTVLISFNGHKSAITVLAFDTTGTRLISASKDSDIIVWDL 150
           L AAG+ +  ++++D+   +   + SF GH+  +T ++F      + ++S+D  I VWD+
Sbjct: 47  LAAAGHQN--VRLYDIRTTNPNPVASFEGHRGNVTSVSFQQDNKWMATSSEDGTIKVWDV 104

Query: 151 VGES--GLYKLRSHKDAITGLWCEDENWLISTSKDGLVKIWDLKSQQCVE 198
              S    YKL +  + +     + E  LIS  +DG ++IWDL   QC  
Sbjct: 105 RAPSIPRNYKLNAPVNEVVIHPNQGE--LISCDRDGHIRIWDLGENQCTH 152

 Score = 43.9 bits (102), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 41/200 (20%), Positives = 82/200 (41%), Gaps = 21/200 (10%)

Query: 43  VGGLENILVWDIKTGEQIAQLTDGLPPGASDAKLSKPAETTFLKYHPETNLLAAGYADGV 102
             G +N+ ++DI+T            P    +        T + +  +   +A    DG 
Sbjct: 49  AAGHQNVRLYDIRTTN----------PNPVASFEGHRGNVTSVSFQQDNKWMATSSEDGT 98

Query: 103 IKIWDLISKTVLISFNGHKSAITVLAFDTTGTRLISASKDSDIIVWDLVGESGLYKLRSH 162
           IK+WD+ + ++  ++  +     V+     G  LIS  +D  I +WDL      ++L   
Sbjct: 99  IKVWDVRAPSIPRNYKLNAPVNEVVIHPNQG-ELISCDRDGHIRIWDLGENQCTHQLTPE 157

Query: 163 KDA-ITGL-WCEDENWLISTSKDGLVKIWDLKSQ------QCVETHLAHTGECWSLGIIE 214
            D  +  L    D + L++ +  G   +W++ ++      + V    +H      + +  
Sbjct: 158 DDTPLQSLSLASDGSMLVAANNKGNCYVWEMPNRTDASNLKPVTKFRSHNTYITRILLSS 217

Query: 215 DMA--VTCSADSQVKLWKLD 232
           D+    TCSAD   ++W +D
Sbjct: 218 DVKHLATCSADHTARVWSVD 237

 Score = 42.4 bits (98), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 29/144 (20%), Positives = 70/144 (48%), Gaps = 8/144 (5%)

Query: 93  LLAAGYADGVIKIWDLISKTVLISFNGHKSAITVLAFDTTGTRLISASKDSDIIVWDL-- 150
           L++AGY D  I+ W+ ++     +     S +  L   T   +L++A+   ++ ++D+  
Sbjct: 5   LVSAGY-DHTIRFWEALTGVCSRTIQHSDSQVNRLEI-TNDKKLLAAAGHQNVRLYDIRT 62

Query: 151 VGESGLYKLRSHKDAITGL-WCEDENWLISTSKDGLVKIWDLKSQQCVETHL--AHTGEC 207
              + +     H+  +T + + +D  W+ ++S+DG +K+WD+++      +   A   E 
Sbjct: 63  TNPNPVASFEGHRGNVTSVSFQQDNKWMATSSEDGTIKVWDVRAPSIPRNYKLNAPVNEV 122

Query: 208 WSLGIIEDMAVTCSADSQVKLWKL 231
             +   +   ++C  D  +++W L
Sbjct: 123 -VIHPNQGELISCDRDGHIRIWDL 145

 Score = 41.2 bits (95), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 47/212 (22%), Positives = 75/212 (35%), Gaps = 60/212 (28%)

Query: 49  ILVWDIKTGEQIAQLTDGLPPGASDAKLSKPAETTFLKYHPETNLLAAGYADGVIKIWDL 108
           I VWD++            P    + KL+ P     +  HP    L +   DG I+IWDL
Sbjct: 99  IKVWDVRA-----------PSIPRNYKLNAPVNEVVI--HPNQGELISCDRDGHIRIWDL 145

Query: 109 ISKTVLISFNGHK-SAITVLAFDTTGTRLISASKDSDIIVWDLVGESG------LYKLRS 161
                         + +  L+  + G+ L++A+   +  VW++   +       + K RS
Sbjct: 146 GENQCTHQLTPEDDTPLQSLSLASDGSMLVAANNKGNCYVWEMPNRTDASNLKPVTKFRS 205

Query: 162 HKDAITGL--------------------WCEDENWLISTSKDGLVKIWDLKSQQCVETHL 201
           H   IT +                    W  D+N+ + T+ DG                 
Sbjct: 206 HNTYITRILLSSDVKHLATCSADHTARVWSVDDNFKLETTLDG----------------- 248

Query: 202 AHTGECWSLGIIEDMA--VTCSADSQVKLWKL 231
            H    W      D A  +T S+D  V+LW L
Sbjct: 249 -HQRWVWDCAFSADSAYLMTASSDHYVRLWDL 279

 Score = 35.4 bits (80), Expect = 0.63,   Method: Compositional matrix adjust.
 Identities = 39/151 (25%), Positives = 71/151 (47%), Gaps = 15/151 (9%)

Query: 573 VLSMDISYDSKLIVTCSADKNIKIWGLDFGDCHK--SLFAHQDSIMNVKFLPESYNFFSC 630
           V  ++I+ D KL+   +  +N++++ +   + +   S   H+ ++ +V F  ++    + 
Sbjct: 35  VNRLEITNDKKLLAA-AGHQNVRLYDIRTTNPNPVASFEGHRGNVTSVSFQQDNKWMATS 93

Query: 631 SKDATVKYWDGQKFECIQ--KLAAHQSEVWSISVSNDGTFVISTGHDHSIRVWEETEDQV 688
           S+D T+K WD +     +  KL A  +EV  +   N G   IS   D  IR+W+  E+Q 
Sbjct: 94  SEDGTIKVWDVRAPSIPRNYKLNAPVNEV--VIHPNQGEL-ISCDRDGHIRIWDLGENQC 150

Query: 689 FLEEEREKEMDEQYEDTLLTSLEGGAGDEML 719
             +   E       +DT L SL   +   ML
Sbjct: 151 THQLTPE-------DDTPLQSLSLASDGSML 174

 Score = 34.3 bits (77), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 24/125 (19%), Positives = 53/125 (42%), Gaps = 9/125 (7%)

Query: 389 TDIRSTSISDDNKLLATASN-GSLKIWNIKTK------RCIRSFECGYALTCKFLPGGAL 441
           T ++S S++ D  +L  A+N G+  +W +  +      + +  F        + L    +
Sbjct: 160 TPLQSLSLASDGSMLVAANNKGNCYVWEMPNRTDASNLKPVTKFRSHNTYITRILLSSDV 219

Query: 442 VVVGTRNGE--LQLFDIASSTMLDNKEGAHDAAIWSLDLTSDGRKLVTGSADKTVRFWTF 499
             + T + +   +++ +  +  L+     H   +W    ++D   L+T S+D  VR W  
Sbjct: 220 KHLATCSADHTARVWSVDDNFKLETTLDGHQRWVWDCAFSADSAYLMTASSDHYVRLWDL 279

Query: 500 EVSEV 504
              E+
Sbjct: 280 STREI 284

>Suva_14.342 Chr14 (600032..600943) [912 bp, 303 aa] {ON} YNL006W
           (REAL)
          Length = 303

 Score = 80.9 bits (198), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 58/254 (22%), Positives = 117/254 (46%), Gaps = 22/254 (8%)

Query: 349 ELVVTTSNNSIEYYSIPYSKREPTQPAPLKLHTIDLHGQRTDIRSTSISDDNKLLATAS- 407
           +L+ T  + ++  Y I       T P P+        G R ++ S S   DN+ + T+S 
Sbjct: 45  KLLATAGHQNVRLYDI-----RTTNPNPVA----SFEGHRGNVTSVSFQQDNRWMVTSSE 95

Query: 408 NGSLKIWNIKTKRCIRSFECGYALT-CKFLPGGALVVVGTRNGELQLFDIASSTMLDNKE 466
           +G++K+W++++    R+++    +      P    ++   R+G ++++D+  +       
Sbjct: 96  DGTIKVWDVRSPSIPRNYKHNAPVNEVVIHPNQGELISCDRDGNIRIWDLGENQCTHQLT 155

Query: 467 GAHDAAIWSLDLTSDGRKLVTGSADKTVRFWTFEVSEVPVSDESNKTMPMLQLFHDTTLE 526
              D ++ SL + SDG  L   ++      W     E+P   +++   P+ +    +T  
Sbjct: 156 PEDDTSLQSLSMASDGSMLAAANSKGNCYVW-----EMPNHTDASHLKPVTKFRAHSTY- 209

Query: 527 LDDDILSVVISPDDKFIAVSLLDNTVKVFFL-DSMKFFLSLYGHKLPVLSMDISYDSKLI 585
               I  +++S D K +A    D+T +V+ + D  K   +L GH+  V     S DS  +
Sbjct: 210 ----ITRILLSSDVKHLATCSADHTARVWSIEDDFKLETTLDGHQRWVWDCAFSADSAYL 265

Query: 586 VTCSADKNIKIWGL 599
           VT S+D  +++W L
Sbjct: 266 VTASSDHYVRLWDL 279

 Score = 69.7 bits (169), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 60/271 (22%), Positives = 119/271 (43%), Gaps = 30/271 (11%)

Query: 396 ISDDNKLLATASNGSLKIWNIKT--KRCIRSFEC--GYALTCKFLPGGALVVVGTRNGEL 451
           I++D KLLATA + ++++++I+T     + SFE   G   +  F      +V  + +G +
Sbjct: 40  ITNDKKLLATAGHQNVRLYDIRTTNPNPVASFEGHRGNVTSVSFQQDNRWMVTSSEDGTI 99

Query: 452 QLFDIASSTMLDNKEGAHDAAIWSLDLTSDGRKLVTGSADKTVRFWTFEVSEVPVSDESN 511
           +++D+ S ++  N +  H+A +  + +  +  +L++   D  +R W    +         
Sbjct: 100 KVWDVRSPSIPRNYK--HNAPVNEVVIHPNQGELISCDRDGNIRIWDLGEN--------- 148

Query: 512 KTMPMLQLFHDTTLELDDDILSVVISPDDKFIAVSLLDNTVKVFFLDS------MKFFLS 565
                 Q  H  T E D  + S+ ++ D   +A +       V+ + +      +K    
Sbjct: 149 ------QCTHQLTPEDDTSLQSLSMASDGSMLAAANSKGNCYVWEMPNHTDASHLKPVTK 202

Query: 566 LYGHKLPVLSMDISYDSKLIVTCSADKNIKIWGL--DFGDCHKSLFAHQDSIMNVKFLPE 623
              H   +  + +S D K + TCSAD   ++W +  DF     +L  HQ  + +  F  +
Sbjct: 203 FRAHSTYITRILLSSDVKHLATCSADHTARVWSIEDDF-KLETTLDGHQRWVWDCAFSAD 261

Query: 624 SYNFFSCSKDATVKYWDGQKFECIQKLAAHQ 654
           S    + S D  V+ WD    E +++   H 
Sbjct: 262 SAYLVTASSDHYVRLWDLSTREIVRQYGGHH 292

 Score = 56.6 bits (135), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 55/292 (18%), Positives = 117/292 (40%), Gaps = 29/292 (9%)

Query: 402 LLATASNGSLKIWNIKTKRCIRSFECGYALTCKF-LPGGALVVVGTRNGELQLFDIASST 460
           L++   + +++ W   T  C R+ +   +   +  +     ++    +  ++L+DI ++ 
Sbjct: 5   LVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLATAGHQNVRLYDIRTTN 64

Query: 461 M--LDNKEGAHDAAIWSLDLTSDGRKLVTGSADKTVRFWTFEVSEVPVSDESNKTMPMLQ 518
              + + EG H   + S+    D R +VT S D T++ W      +P + + N       
Sbjct: 65  PNPVASFEG-HRGNVTSVSFQQDNRWMVTSSEDGTIKVWDVRSPSIPRNYKHNAP----- 118

Query: 519 LFHDTTLELDDDILSVVISPDDKFIAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVL-SMD 577
                       +  VVI P+   +     D  ++++ L   +    L       L S+ 
Sbjct: 119 ------------VNEVVIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPEDDTSLQSLS 166

Query: 578 ISYDSKLIVTCSADKNIKIWGL-DFGDCHK-----SLFAHQDSIMNVKFLPESYNFFSCS 631
           ++ D  ++   ++  N  +W + +  D           AH   I  +    +  +  +CS
Sbjct: 167 MASDGSMLAAANSKGNCYVWEMPNHTDASHLKPVTKFRAHSTYITRILLSSDVKHLATCS 226

Query: 632 KDATVKYWDGQK-FECIQKLAAHQSEVWSISVSNDGTFVISTGHDHSIRVWE 682
            D T + W  +  F+    L  HQ  VW  + S D  ++++   DH +R+W+
Sbjct: 227 ADHTARVWSIEDDFKLETTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWD 278

 Score = 54.7 bits (130), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 42/169 (24%), Positives = 73/169 (43%), Gaps = 9/169 (5%)

Query: 530 DILSVVISPDDKFIAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSMDISYDSKLIVTCS 589
           ++ SV    D++++  S  D T+KV+ + S     + Y H  PV  + I  +   +++C 
Sbjct: 77  NVTSVSFQQDNRWMVTSSEDGTIKVWDVRSPSIPRN-YKHNAPVNEVVIHPNQGELISCD 135

Query: 590 ADKNIKIWGLDFGDCHKSLFAHQD-SIMNVKFLPESYNFFSCSKDATVKYW------DGQ 642
            D NI+IW L    C   L    D S+ ++    +     + +       W      D  
Sbjct: 136 RDGNIRIWDLGENQCTHQLTPEDDTSLQSLSMASDGSMLAAANSKGNCYVWEMPNHTDAS 195

Query: 643 KFECIQKLAAHQSEVWSISVSNDGTFVISTGHDHSIRVWEETEDQVFLE 691
             + + K  AH + +  I +S+D   + +   DH+ RVW   ED   LE
Sbjct: 196 HLKPVTKFRAHSTYITRILLSSDVKHLATCSADHTARVW-SIEDDFKLE 243

 Score = 50.1 bits (118), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 49/194 (25%), Positives = 79/194 (40%), Gaps = 24/194 (12%)

Query: 49  ILVWDIKTGEQIAQLTDGLPPGASDAKLSKPAETTFLKYHPETNLLAAGYADGVIKIWDL 108
           I VWD+++           P    + K + P     +  HP    L +   DG I+IWDL
Sbjct: 99  IKVWDVRS-----------PSIPRNYKHNAPVNEVVI--HPNQGELISCDRDGNIRIWDL 145

Query: 109 ISKTVLISFNGHK-SAITVLAFDTTGTRLISASKDSDIIVWDLVGESG------LYKLRS 161
                         +++  L+  + G+ L +A+   +  VW++   +       + K R+
Sbjct: 146 GENQCTHQLTPEDDTSLQSLSMASDGSMLAAANSKGNCYVWEMPNHTDASHLKPVTKFRA 205

Query: 162 HKDAITG-LWCEDENWLISTSKDGLVKIWDLKSQQCVETHL-AHTGECWSLGIIEDMA-- 217
           H   IT  L   D   L + S D   ++W ++    +ET L  H    W      D A  
Sbjct: 206 HSTYITRILLSSDVKHLATCSADHTARVWSIEDDFKLETTLDGHQRWVWDCAFSADSAYL 265

Query: 218 VTCSADSQVKLWKL 231
           VT S+D  V+LW L
Sbjct: 266 VTASSDHYVRLWDL 279

 Score = 48.9 bits (115), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 28/108 (25%), Positives = 55/108 (50%), Gaps = 4/108 (3%)

Query: 93  LLAAGYADGVIKIWDL--ISKTVLISFNGHKSAITVLAFDTTGTRLISASKDSDIIVWDL 150
           L  AG+ +  ++++D+   +   + SF GH+  +T ++F      ++++S+D  I VWD+
Sbjct: 47  LATAGHQN--VRLYDIRTTNPNPVASFEGHRGNVTSVSFQQDNRWMVTSSEDGTIKVWDV 104

Query: 151 VGESGLYKLRSHKDAITGLWCEDENWLISTSKDGLVKIWDLKSQQCVE 198
              S     + +      +   ++  LIS  +DG ++IWDL   QC  
Sbjct: 105 RSPSIPRNYKHNAPVNEVVIHPNQGELISCDRDGNIRIWDLGENQCTH 152

 Score = 46.6 bits (109), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 29/144 (20%), Positives = 71/144 (49%), Gaps = 8/144 (5%)

Query: 93  LLAAGYADGVIKIWDLISKTVLISFNGHKSAITVLAFDTTGTRLISASKDSDIIVWDL-- 150
           L++AGY D  I+ W+ ++     +     S +  L   T   +L++ +   ++ ++D+  
Sbjct: 5   LVSAGY-DHTIRFWEALTGVCSRTIQHSDSQVNRLEI-TNDKKLLATAGHQNVRLYDIRT 62

Query: 151 VGESGLYKLRSHKDAITGL-WCEDENWLISTSKDGLVKIWDLKSQQCVETHLAHTGECWS 209
              + +     H+  +T + + +D  W++++S+DG +K+WD++S   +  +  H      
Sbjct: 63  TNPNPVASFEGHRGNVTSVSFQQDNRWMVTSSEDGTIKVWDVRSPS-IPRNYKHNAPVNE 121

Query: 210 LGIIEDMA--VTCSADSQVKLWKL 231
           + I  +    ++C  D  +++W L
Sbjct: 122 VVIHPNQGELISCDRDGNIRIWDL 145

 Score = 45.4 bits (106), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 40/199 (20%), Positives = 82/199 (41%), Gaps = 21/199 (10%)

Query: 44  GGLENILVWDIKTGEQIAQLTDGLPPGASDAKLSKPAETTFLKYHPETNLLAAGYADGVI 103
            G +N+ ++DI+T            P    +        T + +  +   +     DG I
Sbjct: 50  AGHQNVRLYDIRTTN----------PNPVASFEGHRGNVTSVSFQQDNRWMVTSSEDGTI 99

Query: 104 KIWDLISKTVLISFNGHKSAITVLAFDTTGTRLISASKDSDIIVWDLVGESGLYKLRSHK 163
           K+WD+ S ++  ++  H + +  +        LIS  +D +I +WDL      ++L    
Sbjct: 100 KVWDVRSPSIPRNYK-HNAPVNEVVIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPED 158

Query: 164 D-AITGL-WCEDENWLISTSKDGLVKIWDLKSQ------QCVETHLAHTGECWSLGIIED 215
           D ++  L    D + L + +  G   +W++ +       + V    AH+     + +  D
Sbjct: 159 DTSLQSLSMASDGSMLAAANSKGNCYVWEMPNHTDASHLKPVTKFRAHSTYITRILLSSD 218

Query: 216 MA--VTCSADSQVKLWKLD 232
           +    TCSAD   ++W ++
Sbjct: 219 VKHLATCSADHTARVWSIE 237

 Score = 42.0 bits (97), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 42/180 (23%), Positives = 83/180 (46%), Gaps = 16/180 (8%)

Query: 573 VLSMDISYDSKLIVTCSADKNIKIWGLDFGDCHK--SLFAHQDSIMNVKFLPESYNFFSC 630
           V  ++I+ D KL+ T +  +N++++ +   + +   S   H+ ++ +V F  ++    + 
Sbjct: 35  VNRLEITNDKKLLAT-AGHQNVRLYDIRTTNPNPVASFEGHRGNVTSVSFQQDNRWMVTS 93

Query: 631 SKDATVKYWDGQKFECIQKLAAHQSEVWSISVSNDGTFVISTGHDHSIRVWEETEDQVFL 690
           S+D T+K WD  +   I +   H + V  + +  +   +IS   D +IR+W+  E+Q   
Sbjct: 94  SEDGTIKVWD-VRSPSIPRNYKHNAPVNEVVIHPNQGELISCDRDGNIRIWDLGENQCTH 152

Query: 691 EEEREKEMDEQYEDTLLTSLEGGAGDEMLSV--KKGDN---EESEEVEGVHKQTVESLKA 745
           +   E       +DT L SL   +   ML+    KG+    E     +  H + V   +A
Sbjct: 153 QLTPE-------DDTSLQSLSMASDGSMLAAANSKGNCYVWEMPNHTDASHLKPVTKFRA 205

 Score = 35.8 bits (81), Expect = 0.47,   Method: Compositional matrix adjust.
 Identities = 27/125 (21%), Positives = 51/125 (40%), Gaps = 9/125 (7%)

Query: 389 TDIRSTSISDDNKLLATA-SNGSLKIWNIKTK------RCIRSFECGYALTCKFLPGGAL 441
           T ++S S++ D  +LA A S G+  +W +         + +  F        + L    +
Sbjct: 160 TSLQSLSMASDGSMLAAANSKGNCYVWEMPNHTDASHLKPVTKFRAHSTYITRILLSSDV 219

Query: 442 VVVGTRNGE--LQLFDIASSTMLDNKEGAHDAAIWSLDLTSDGRKLVTGSADKTVRFWTF 499
             + T + +   +++ I     L+     H   +W    ++D   LVT S+D  VR W  
Sbjct: 220 KHLATCSADHTARVWSIEDDFKLETTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDL 279

Query: 500 EVSEV 504
              E+
Sbjct: 280 STREI 284

>AFR199C Chr6 complement(799873..800295,800490..801071) [1005 bp,
           334 aa] {ON} Syntenic homolog of Saccharomyces
           cerevisiae YMR116C (ASC1); 1-intron
          Length = 334

 Score = 81.3 bits (199), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 58/219 (26%), Positives = 95/219 (43%), Gaps = 17/219 (7%)

Query: 485 LVTGSADKTVRFWTFEVSEVPVSDESNKTMPMLQLFHDTTLELDDDILSVVISPDDKFIA 544
           L++GS DKT+  W          ++    +P+      + +  D       ++ D K+  
Sbjct: 49  LLSGSRDKTLITWKL------TGEDQQYGVPVRSFKGHSHIVQD-----CTVTHDGKYAL 97

Query: 545 VSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSMDISYDSKLIVTCSADKNIKIWGLDFGDC 604
            +  D T++++ L S K      GHK  V+S+ I   +  IV+ S DK +K+W    GDC
Sbjct: 98  SASWDKTLRLWDLQSGKCIKRFVGHKSDVMSVSIDPRATQIVSASRDKTVKVWNT-VGDC 156

Query: 605 HKSLFAHQDSIMNVKFLP-----ESYNFFSCSKDATVKYWDGQKFECIQKLAAHQSEVWS 659
             +L  H D + NV+  P     ++    S   D  VK WD Q F        H + V +
Sbjct: 157 VVTLLGHNDWVSNVRIAPSEKSDDAVTVISAGMDKVVKVWDLQSFTIEADFIGHNNYVTT 216

Query: 660 ISVSNDGTFVISTGHDHSIRVWEETEDQVFLEEEREKEM 698
           ++ S DG+   S G D  I +W   E       + + E+
Sbjct: 217 VTPSPDGSIFASAGKDGQIILWNLNEKTALYTLDAKDEV 255

 Score = 64.7 bits (156), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 45/153 (29%), Positives = 77/153 (50%), Gaps = 10/153 (6%)

Query: 88  HPETNLLAAGYADGVIKIWDLISKTVLISFNGHKSAITVLAFDTTGTRLISASKDSDIIV 147
           H     L+A + D  +++WDL S   +  F GHKS +  ++ D   T+++SAS+D  + V
Sbjct: 91  HDGKYALSASW-DKTLRLWDLQSGKCIKRFVGHKSDVMSVSIDPRATQIVSASRDKTVKV 149

Query: 148 WDLVGESGLYKLRSHKDAITGLW------CEDENWLISTSKDGLVKIWDLKSQQCVETHL 201
           W+ VG+  +  L  H D ++ +        +D   +IS   D +VK+WDL+S       +
Sbjct: 150 WNTVGDC-VVTLLGHNDWVSNVRIAPSEKSDDAVTVISAGMDKVVKVWDLQSFTIEADFI 208

Query: 202 AHTGECWSLGIIEDMAVTCSA--DSQVKLWKLD 232
            H     ++    D ++  SA  D Q+ LW L+
Sbjct: 209 GHNNYVTTVTPSPDGSIFASAGKDGQIILWNLN 241

 Score = 58.5 bits (140), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 75/322 (23%), Positives = 134/322 (41%), Gaps = 40/322 (12%)

Query: 381 TIDLHGQRTDIRSTSISDDNKLLATASNGSLKIWNIKTKR-----CIRSFECGYALT--C 433
           T++ H       STS +  N LL+ + + +L  W +  +       +RSF+    +   C
Sbjct: 28  TLEGHNGWVTSLSTSPAQPNMLLSGSRDKTLITWKLTGEDQQYGVPVRSFKGHSHIVQDC 87

Query: 434 KFLPGGALVVVGTRNGELQLFDIASSTMLDNKEGAHDAAIWSLDLTSDGRKLVTGSADKT 493
                G   +  + +  L+L+D+ S   +    G H + + S+ +     ++V+ S DKT
Sbjct: 88  TVTHDGKYALSASWDKTLRLWDLQSGKCIKRFVG-HKSDVMSVSIDPRATQIVSASRDKT 146

Query: 494 VRFWTFEVSEVPVSDESNKTMPMLQLFHDTTLELDDDILSVVISP----DDKFIAVSL-L 548
           V+ W   V +  V                T L  +D + +V I+P    DD    +S  +
Sbjct: 147 VKVWN-TVGDCVV----------------TLLGHNDWVSNVRIAPSEKSDDAVTVISAGM 189

Query: 549 DNTVKVFFLDSMKFFLSLYGHKLPVLSMDISYDSKLIVTCSADKNIKIWGLDFGDCHKSL 608
           D  VKV+ L S        GH   V ++  S D  +  +   D  I +W L+      +L
Sbjct: 190 DKVVKVWDLQSFTIEADFIGHNNYVTTVTPSPDGSIFASAGKDGQIILWNLNEKTALYTL 249

Query: 609 FAHQDSIMNVKFLPESYNFFSCSKDATVKYWDGQKFECIQKLA--------AHQSEVWSI 660
            A +D +  V F P  Y + + +  + +K +D ++   +  L         A      S+
Sbjct: 250 DA-KDEVFAVAFSPNRY-WLTAATASGIKIFDLEERTIVDDLKPEFAGYNKAQDPHAVSL 307

Query: 661 SVSNDGTFVISTGHDHSIRVWE 682
           + S DG  + +   D+ IRVW+
Sbjct: 308 AWSADGQTLFAGYTDNIIRVWQ 329

 Score = 58.2 bits (139), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 34/106 (32%), Positives = 59/106 (55%), Gaps = 2/106 (1%)

Query: 93  LLAAGYADGVIKIWDLISKTVLISFNGHKSAITVLAFDTTGTRLISASKDSDIIVWDLVG 152
           +++AG  D V+K+WDL S T+   F GH + +T +     G+   SA KD  II+W+L  
Sbjct: 184 VISAGM-DKVVKVWDLQSFTIEADFIGHNNYVTTVTPSPDGSIFASAGKDGQIILWNLNE 242

Query: 153 ESGLYKLRSHKDAITGLWCEDENWLISTSKDGLVKIWDLKSQQCVE 198
           ++ LY L +  +     +  +  WL + +  G +KI+DL+ +  V+
Sbjct: 243 KTALYTLDAKDEVFAVAFSPNRYWLTAATASG-IKIFDLEERTIVD 287

 Score = 56.6 bits (135), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 35/130 (26%), Positives = 61/130 (46%), Gaps = 6/130 (4%)

Query: 565 SLYGHKLPVLSMDIS-YDSKLIVTCSADKNIKIWGL-----DFGDCHKSLFAHQDSIMNV 618
           +L GH   V S+  S     ++++ S DK +  W L      +G   +S   H   + + 
Sbjct: 28  TLEGHNGWVTSLSTSPAQPNMLLSGSRDKTLITWKLTGEDQQYGVPVRSFKGHSHIVQDC 87

Query: 619 KFLPESYNFFSCSKDATVKYWDGQKFECIQKLAAHQSEVWSISVSNDGTFVISTGHDHSI 678
               +     S S D T++ WD Q  +CI++   H+S+V S+S+    T ++S   D ++
Sbjct: 88  TVTHDGKYALSASWDKTLRLWDLQSGKCIKRFVGHKSDVMSVSIDPRATQIVSASRDKTV 147

Query: 679 RVWEETEDQV 688
           +VW    D V
Sbjct: 148 KVWNTVGDCV 157

 Score = 46.6 bits (109), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 34/125 (27%), Positives = 56/125 (44%), Gaps = 13/125 (10%)

Query: 116 SFNGHKSAITVLAFDTT-GTRLISASKDSDIIVWDLVGESGLY-----KLRSHKDAITGL 169
           +  GH   +T L+        L+S S+D  +I W L GE   Y       + H   +   
Sbjct: 28  TLEGHNGWVTSLSTSPAQPNMLLSGSRDKTLITWKLTGEDQQYGVPVRSFKGHSHIVQD- 86

Query: 170 WC---EDENWLISTSKDGLVKIWDLKSQQCVETHLAHTGECWSLGIIEDMA--VTCSADS 224
            C    D  + +S S D  +++WDL+S +C++  + H  +  S+ I       V+ S D 
Sbjct: 87  -CTVTHDGKYALSASWDKTLRLWDLQSGKCIKRFVGHKSDVMSVSIDPRATQIVSASRDK 145

Query: 225 QVKLW 229
            VK+W
Sbjct: 146 TVKVW 150

 Score = 34.3 bits (77), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 37/171 (21%), Positives = 69/171 (40%), Gaps = 22/171 (12%)

Query: 30  ASKRKTGNLGQVIVGGLENIL-VWDIKTGEQIAQLTDGLPPGASDAKLSKPAETTFLKYH 88
           A   K+ +   VI  G++ ++ VWD+++    A              +      T +   
Sbjct: 173 APSEKSDDAVTVISAGMDKVVKVWDLQSFTIEADF------------IGHNNYVTTVTPS 220

Query: 89  PETNLLAAGYADGVIKIWDLISKTVLISFNGHKSAITVLAFDTTGTRLISASK------- 141
           P+ ++ A+   DG I +W+L  KT L + +  K  +  +AF      L +A+        
Sbjct: 221 PDGSIFASAGKDGQIILWNLNEKTALYTLDA-KDEVFAVAFSPNRYWLTAATASGIKIFD 279

Query: 142 -DSDIIVWDLVGESGLYKLRSHKDAITGLWCEDENWLISTSKDGLVKIWDL 191
            +   IV DL  E   Y       A++  W  D   L +   D ++++W +
Sbjct: 280 LEERTIVDDLKPEFAGYNKAQDPHAVSLAWSADGQTLFAGYTDNIIRVWQV 330

>Kwal_23.6324 s23 complement(1531252..1532796) [1545 bp, 514 aa]
           {ON} YCR072C - Protein required for cell viability
           [contig 17] FULL
          Length = 514

 Score = 82.4 bits (202), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 71/286 (24%), Positives = 129/286 (45%), Gaps = 21/286 (7%)

Query: 398 DDNKLLATASNGSLKIWNIKTKRCIRSFECGY--ALTCKFLPGGALVVVGTRNGELQLFD 455
           D  +L + + +G++KIW+   + C+ +   G+  +++C    G  ++  G+ +  ++ +D
Sbjct: 246 DQPRLASASKDGTIKIWDTTRRVCVLTLS-GHTNSVSCVKWGGRGILYSGSHDKTIRAWD 304

Query: 456 IASSTMLDNKEGAHDAAIWSLDLTSDGRKLVTGSADKTVRFWTFEVSEVPVSDESNKTMP 515
           +A+     N   +H   I  L L +D   L  G+ D T         E P S E  +   
Sbjct: 305 MAAGGKCINILKSHAHWINHLSLNTD-YALRVGAFDHT--------GEKPSSPEEARAKA 355

Query: 516 MLQLFHDTTLELDDDILSVVISPDDKFIAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLS 575
           +    ++   + +  +  ++++  D F  + L D       L + K    + GH+  V  
Sbjct: 356 LKN--YEKIAKKNGQLEELMVTASDDF-TMYLWDP------LKASKPITRMTGHQKLVNH 406

Query: 576 MDISYDSKLIVTCSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLPESYNFFSCSKDAT 635
           +  S D + IV+ S D +IK+W    G    +   H  S+  V +  +     SCSKD T
Sbjct: 407 VAFSPDGRYIVSASFDNSIKLWDGRNGTFIATFRGHVASVYQVAWSSDCRLLVSCSKDTT 466

Query: 636 VKYWDGQKFECIQKLAAHQSEVWSISVSNDGTFVISTGHDHSIRVW 681
           +K WD +  +    L  H  EV+++  S DG  V S G D  +R+W
Sbjct: 467 LKVWDVRTKKLSVDLPGHNDEVYTVDWSVDGKRVCSAGKDKMVRIW 512

 Score = 79.3 bits (194), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 101/436 (23%), Positives = 174/436 (39%), Gaps = 96/436 (22%)

Query: 87  YHPETN-LLAAGYADGVIKIWDLISKTVLISFNGHKSAITVLAFDTTGTRLISASKDSDI 145
           + P T+  +  G  D   +IWD  + T + +  GH + +  +A+   G  + + S D+ I
Sbjct: 150 FAPHTSGRMVTGSGDNTARIWDCNTNTPMYTLKGHFNWVLCVAWCPDGELIATGSMDNTI 209

Query: 146 IVWDL-VGESGLYKLRSHKDAITGLWCE--------DENWLISTSKDGLVKIWDLKSQQC 196
            +WD   GES    LR H   IT L  E        D+  L S SKDG +KIWD   + C
Sbjct: 210 RLWDSNKGESYGEALRGHAKWITSLTWEPMHLVKAGDQPRLASASKDGTIKIWDTTRRVC 269

Query: 197 VETHLAHTGE--CWSLGIIEDMAVTCSADSQVKLWKLDLQAENGSKLTEKGIIEKQS--- 251
           V T   HT    C   G    +  + S D  ++ W  D+ A  G K     I++  +   
Sbjct: 270 VLTLSGHTNSVSCVKWGG-RGILYSGSHDKTIRAW--DMAA--GGKCIN--ILKSHAHWI 322

Query: 252 KQRGVEIDFAVAPDGVKFFYIQNADKTIEIYRLRKEEEISRALKKREKRLQDKGMSEEEI 311
               +  D+A          +   D T E      EE  ++ALK  EK  +  G  EE  
Sbjct: 323 NHLSLNTDYA--------LRVGAFDHTGE-KPSSPEEARAKALKNYEKIAKKNGQLEE-- 371

Query: 312 KEAMGSPVSLMYHLFQVVRSPYKIKSAQWTVCSNSKLELVVTTSNNSIEYYSIPYSKREP 371
                                                 L+VT S++   Y   P    +P
Sbjct: 372 --------------------------------------LMVTASDDFTMYLWDPLKASKP 393

Query: 372 TQPAPLKLHTIDLHGQRTDIRSTSISDDNKLLATAS-NGSLKIWNIKTKRCIRSF----- 425
                       + G +  +   + S D + + +AS + S+K+W+ +    I +F     
Sbjct: 394 I---------TRMTGHQKLVNHVAFSPDGRYIVSASFDNSIKLWDGRNGTFIATFRGHVA 444

Query: 426 ---ECGYALTCKFLPGGALVVVGTRNGELQLFDIASSTMLDNKEGAHDAAIWSLDLTSDG 482
              +  ++  C+ L      V  +++  L+++D+ +  +  +  G H+  ++++D + DG
Sbjct: 445 SVYQVAWSSDCRLL------VSCSKDTTLKVWDVRTKKLSVDLPG-HNDEVYTVDWSVDG 497

Query: 483 RKLVTGSADKTVRFWT 498
           +++ +   DK VR WT
Sbjct: 498 KRVCSAGKDKMVRIWT 513

 Score = 62.0 bits (149), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 40/142 (28%), Positives = 68/142 (47%), Gaps = 9/142 (6%)

Query: 549 DNTVKVFFLDSMKFFLSLYGHKLPVLSMDISYDSKLIVTCSADKNIKIWGLDFGDCH-KS 607
           DNT +++  ++     +L GH   VL +    D +LI T S D  I++W  + G+ + ++
Sbjct: 164 DNTARIWDCNTNTPMYTLKGHFNWVLCVAWCPDGELIATGSMDNTIRLWDSNKGESYGEA 223

Query: 608 LFAHQDSIMNVKFLP-------ESYNFFSCSKDATVKYWDGQKFECIQKLAAHQSEVWSI 660
           L  H   I ++ + P       +     S SKD T+K WD  +  C+  L+ H + V  +
Sbjct: 224 LRGHAKWITSLTWEPMHLVKAGDQPRLASASKDGTIKIWDTTRRVCVLTLSGHTNSVSCV 283

Query: 661 SVSNDGTFVISTGHDHSIRVWE 682
                G  + S  HD +IR W+
Sbjct: 284 KWGGRG-ILYSGSHDKTIRAWD 304

 Score = 62.0 bits (149), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 62/241 (25%), Positives = 101/241 (41%), Gaps = 36/241 (14%)

Query: 484 KLVTGSADKTVRFWTFEVSEVPVSDESNKTMPMLQLFHDTTLELDDDILSVVISPDDKFI 543
           ++VTGS D T R W           + N   PM  L           +L V   PD + I
Sbjct: 157 RMVTGSGDNTARIW-----------DCNTNTPMYTLKGHFNW-----VLCVAWCPDGELI 200

Query: 544 AVSLLDNTVKVFFLDSMK---FFLSLYGHKLPVLSMDI-------SYDSKLIVTCSADKN 593
           A   +DNT++++  DS K   +  +L GH   + S+         + D   + + S D  
Sbjct: 201 ATGSMDNTIRLW--DSNKGESYGEALRGHAKWITSLTWEPMHLVKAGDQPRLASASKDGT 258

Query: 594 IKIWGLDFGDCHKSLFAHQDSIMNVKFLPESYNFFSCSKDATVKYWD-GQKFECIQKLAA 652
           IKIW      C  +L  H +S+  VK+       +S S D T++ WD     +CI  L +
Sbjct: 259 IKIWDTTRRVCVLTLSGHTNSVSCVKWGGRGI-LYSGSHDKTIRAWDMAAGGKCINILKS 317

Query: 653 HQSEVWSISVSNDGTFVIS----TGHDHSIRVWEETEDQVFLEEEREKEMDEQYEDTLLT 708
           H   +  +S++ D    +     TG   S    EE   +     E+  + + Q E+ ++T
Sbjct: 318 HAHWINHLSLNTDYALRVGAFDHTGEKPSSP--EEARAKALKNYEKIAKKNGQLEELMVT 375

Query: 709 S 709
           +
Sbjct: 376 A 376

 Score = 56.6 bits (135), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 41/161 (25%), Positives = 78/161 (48%), Gaps = 16/161 (9%)

Query: 33  RKTGNLGQVIVGGLEN--ILVWD-IKTGEQIAQLTDGLPPGASDAKLSKPAETTFLKYHP 89
           +K G L +++V   ++  + +WD +K  + I ++T          KL        + + P
Sbjct: 364 KKNGQLEELMVTASDDFTMYLWDPLKASKPITRMT-------GHQKL-----VNHVAFSP 411

Query: 90  ETNLLAAGYADGVIKIWDLISKTVLISFNGHKSAITVLAFDTTGTRLISASKDSDIIVWD 149
           +   + +   D  IK+WD  + T + +F GH +++  +A+ +    L+S SKD+ + VWD
Sbjct: 412 DGRYIVSASFDNSIKLWDGRNGTFIATFRGHVASVYQVAWSSDCRLLVSCSKDTTLKVWD 471

Query: 150 LVGESGLYKLRSHKDAITGL-WCEDENWLISTSKDGLVKIW 189
           +  +     L  H D +  + W  D   + S  KD +V+IW
Sbjct: 472 VRTKKLSVDLPGHNDEVYTVDWSVDGKRVCSAGKDKMVRIW 512

 Score = 50.1 bits (118), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 28/101 (27%), Positives = 50/101 (49%), Gaps = 1/101 (0%)

Query: 583 KLIVTCSADKNIKIW-GLDFGDCHKSLFAHQDSIMNVKFLPESYNFFSCSKDATVKYWDG 641
           +L+VT S D  + +W  L        +  HQ  + +V F P+     S S D ++K WDG
Sbjct: 371 ELMVTASDDFTMYLWDPLKASKPITRMTGHQKLVNHVAFSPDGRYIVSASFDNSIKLWDG 430

Query: 642 QKFECIQKLAAHQSEVWSISVSNDGTFVISTGHDHSIRVWE 682
           +    I     H + V+ ++ S+D   ++S   D +++VW+
Sbjct: 431 RNGTFIATFRGHVASVYQVAWSSDCRLLVSCSKDTTLKVWD 471

 Score = 38.1 bits (87), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 21/89 (23%), Positives = 40/89 (44%), Gaps = 1/89 (1%)

Query: 607 SLFAHQDSIMNVKFLPE-SYNFFSCSKDATVKYWDGQKFECIQKLAAHQSEVWSISVSND 665
           ++  H  +I+   F P  S    + S D T + WD      +  L  H + V  ++   D
Sbjct: 137 AIAGHGSTILCSAFAPHTSGRMVTGSGDNTARIWDCNTNTPMYTLKGHFNWVLCVAWCPD 196

Query: 666 GTFVISTGHDHSIRVWEETEDQVFLEEER 694
           G  + +   D++IR+W+  + + + E  R
Sbjct: 197 GELIATGSMDNTIRLWDSNKGESYGEALR 225

>NCAS0B02200 Chr2 complement(359080..361548) [2469 bp, 822 aa] {ON}
           Anc_8.544
          Length = 822

 Score = 83.2 bits (204), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 54/229 (23%), Positives = 101/229 (44%), Gaps = 22/229 (9%)

Query: 455 DIASSTMLDNKEGAHDAAIWSLDLTSDGRKLVTGSADKTVRFWTFEVSEVPVSDESNKTM 514
           D  S+T++      H  A++S   + D R L++GS DKTVR W+ +     VS + +   
Sbjct: 539 DNTSTTLI-----GHSGAVYSTSFSPDNRYLLSGSEDKTVRLWSTDTYTSLVSYKGH--- 590

Query: 515 PMLQLFHDTTLELDDDILSVVISPDDKFIAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVL 574
                        +  +  V  SP   + A +  D T +++  D +       GH   V 
Sbjct: 591 -------------NHPVWDVQFSPLGHYFATASHDQTARLWSCDHIYPLRIFAGHLSDVD 637

Query: 575 SMDISYDSKLIVTCSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLPESYNFFSCSKDA 634
            +    +   + T S+DK  ++W +  GD  +    H   ++     P+     + S+D 
Sbjct: 638 CVSFHPNGCYVFTGSSDKTCRMWDISTGDSVRLFLGHTAPVLCTAVSPDGRWLATGSEDG 697

Query: 635 TVKYWDGQKFECIQKLAAH-QSEVWSISVSNDGTFVISTGHDHSIRVWE 682
            +  WD    + ++ +  H ++ + S+S   +G  ++S G DHS+RVW+
Sbjct: 698 IINLWDIGTAKRLKVMRGHGKNAIHSLSYCKEGNVLVSGGADHSVRVWD 746

 Score = 69.3 bits (168), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 49/195 (25%), Positives = 86/195 (44%), Gaps = 25/195 (12%)

Query: 517 LQLFHDTTLELDDDILSVVISPDDKFIAVSLLDNTVKVFFLD--SMKFF----------- 563
           +  FH+T    +  + S+  S D + +A    D+ +K++ LD  S+K             
Sbjct: 480 MYTFHNT----NGGMTSLQFSEDSRLVAAGFQDSYIKLWSLDGSSLKQIQEKSADSINTG 535

Query: 564 -------LSLYGHKLPVLSMDISYDSKLIVTCSADKNIKIWGLDFGDCHKSLFAHQDSIM 616
                   +L GH   V S   S D++ +++ S DK +++W  D      S   H   + 
Sbjct: 536 DMNDNTSTTLIGHSGAVYSTSFSPDNRYLLSGSEDKTVRLWSTDTYTSLVSYKGHNHPVW 595

Query: 617 NVKFLPESYNFFSCSKDATVKYWDGQKFECIQKLAAHQSEVWSISVSNDGTFVISTGHDH 676
           +V+F P  + F + S D T + W       ++  A H S+V  +S   +G +V +   D 
Sbjct: 596 DVQFSPLGHYFATASHDQTARLWSCDHIYPLRIFAGHLSDVDCVSFHPNGCYVFTGSSDK 655

Query: 677 SIRVWE-ETEDQVFL 690
           + R+W+  T D V L
Sbjct: 656 TCRMWDISTGDSVRL 670

 Score = 61.6 bits (148), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 34/110 (30%), Positives = 57/110 (51%), Gaps = 2/110 (1%)

Query: 85  LKYHPETNLLAAGYADGVIKIWDLISKTVLISFNGHKSAITVLAFDTTGTRLISASKDSD 144
           + +HP    +  G +D   ++WD+ +   +  F GH + +   A    G  L + S+D  
Sbjct: 639 VSFHPNGCYVFTGSSDKTCRMWDISTGDSVRLFLGHTAPVLCTAVSPDGRWLATGSEDGI 698

Query: 145 IIVWDLVGESGLYKLRSH-KDAITGL-WCEDENWLISTSKDGLVKIWDLK 192
           I +WD+     L  +R H K+AI  L +C++ N L+S   D  V++WDLK
Sbjct: 699 INLWDIGTAKRLKVMRGHGKNAIHSLSYCKEGNVLVSGGADHSVRVWDLK 748

 Score = 55.8 bits (133), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 34/151 (22%), Positives = 62/151 (41%), Gaps = 9/151 (5%)

Query: 87  YHPETNLLAAGYADGVIKIWDLISKTVLISFNGHKSAITVLAFDTTGTRLISASKDSDII 146
           + P+   L +G  D  +++W   + T L+S+ GH   +  + F   G    +AS D    
Sbjct: 557 FSPDNRYLLSGSEDKTVRLWSTDTYTSLVSYKGHNHPVWDVQFSPLGHYFATASHDQTAR 616

Query: 147 VWDLVGESGLYKLRSHKDAITGLWC----EDENWLISTSKDGLVKIWDLKSQQCVETHLA 202
           +W       +Y LR     ++ + C     +  ++ + S D   ++WD+ +   V   L 
Sbjct: 617 LWSC---DHIYPLRIFAGHLSDVDCVSFHPNGCYVFTGSSDKTCRMWDISTGDSVRLFLG 673

Query: 203 HTGECWSLGIIEDMA--VTCSADSQVKLWKL 231
           HT       +  D     T S D  + LW +
Sbjct: 674 HTAPVLCTAVSPDGRWLATGSEDGIINLWDI 704

 Score = 53.1 bits (126), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 35/151 (23%), Positives = 66/151 (43%), Gaps = 4/151 (2%)

Query: 85  LKYHPETNLLAAGYADGVIKIWDLISKTVLISFNGHKSAITVLAFDTTGTRLISASKDSD 144
           +++ P  +  A    D   ++W       L  F GH S +  ++F   G  + + S D  
Sbjct: 597 VQFSPLGHYFATASHDQTARLWSCDHIYPLRIFAGHLSDVDCVSFHPNGCYVFTGSSDKT 656

Query: 145 IIVWDL-VGESGLYKLRSHKDAITGLWCEDENWLISTSKDGLVKIWDLKSQQCVETHLAH 203
             +WD+  G+S    L      +      D  WL + S+DG++ +WD+ + + ++    H
Sbjct: 657 CRMWDISTGDSVRLFLGHTAPVLCTAVSPDGRWLATGSEDGIINLWDIGTAKRLKVMRGH 716

Query: 204 TGEC-WSLGIIE--DMAVTCSADSQVKLWKL 231
                 SL   +  ++ V+  AD  V++W L
Sbjct: 717 GKNAIHSLSYCKEGNVLVSGGADHSVRVWDL 747

 Score = 52.0 bits (123), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 36/130 (27%), Positives = 60/130 (46%), Gaps = 7/130 (5%)

Query: 376 PLKLHTIDLHGQRTDIRSTSISDDNKLLAT-ASNGSLKIWNIKTKRCIRSF--ECGYALT 432
           PL++      G  +D+   S   +   + T +S+ + ++W+I T   +R F       L 
Sbjct: 625 PLRI----FAGHLSDVDCVSFHPNGCYVFTGSSDKTCRMWDISTGDSVRLFLGHTAPVLC 680

Query: 433 CKFLPGGALVVVGTRNGELQLFDIASSTMLDNKEGAHDAAIWSLDLTSDGRKLVTGSADK 492
               P G  +  G+ +G + L+DI ++  L    G    AI SL    +G  LV+G AD 
Sbjct: 681 TAVSPDGRWLATGSEDGIINLWDIGTAKRLKVMRGHGKNAIHSLSYCKEGNVLVSGGADH 740

Query: 493 TVRFWTFEVS 502
           +VR W  + S
Sbjct: 741 SVRVWDLKKS 750

 Score = 42.4 bits (98), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 38/153 (24%), Positives = 60/153 (39%), Gaps = 25/153 (16%)

Query: 83  TFLKYHPETNLLAAGYADGVIKIWDLISKTV-LISFNGHKSAITVLAFDTTGTRLISASK 141
           T L++  ++ L+AAG+ D  IK+W L   ++  I      S  T    D T T LI    
Sbjct: 491 TSLQFSEDSRLVAAGFQDSYIKLWSLDGSSLKQIQEKSADSINTGDMNDNTSTTLI---- 546

Query: 142 DSDIIVWDLVGESGLYKLRSHKDAITGLWCEDENWLISTSKDGLVKIWDLKSQQCVETHL 201
                     G SG     S        +  D  +L+S S+D  V++W   +   + ++ 
Sbjct: 547 ----------GHSGAVYSTS--------FSPDNRYLLSGSEDKTVRLWSTDTYTSLVSYK 588

Query: 202 AHTGECWSLGI--IEDMAVTCSADSQVKLWKLD 232
            H    W +    +     T S D   +LW  D
Sbjct: 589 GHNHPVWDVQFSPLGHYFATASHDQTARLWSCD 621

>Kpol_487.7 s487 complement(37021..37932) [912 bp, 303 aa] {ON}
           complement(37021..37932) [912 nt, 304 aa]
          Length = 303

 Score = 80.1 bits (196), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 59/260 (22%), Positives = 122/260 (46%), Gaps = 25/260 (9%)

Query: 344 SNSKLELVVTTSNNSIEYYSIPYSKREPTQPAPLKLHTIDLHGQRTDIRSTSISDDNKLL 403
           +N K +L+    + +++ Y I       T P P+        G R ++ S S  +DN+ +
Sbjct: 41  TNDK-KLLAAAGHQNVKLYDI-----NTTNPNPVA----SFEGHRGNVTSLSFQNDNRWM 90

Query: 404 ATAS-NGSLKIWNIKTKRCIRSFECGYALT-CKFLPGGALVVVGTRNGELQLFDIASSTM 461
            T+S +G++K+W++++    R+++    +      P    ++   R+G ++++D+  +  
Sbjct: 91  VTSSEDGTIKVWDVRSPSVPRTYKHNAPVNEVAIHPNQGELISCDRDGNIRIWDLGENQC 150

Query: 462 LDNKEGAHDAAIWSLDLTSDGRKLVTGSADKTVRFWTFEVSEVPVSDESNKTMPMLQL-F 520
                   D  + SL L +DG  LV  ++      W     E+P   +++   P+ +   
Sbjct: 151 THQLTPEDDTPVQSLSLATDGSMLVAANSKGNCYVW-----EMPNRTDASNLKPVTKFRA 205

Query: 521 HDTTLELDDDILSVVISPDDKFIAVSLLDNTVKVFFLD-SMKFFLSLYGHKLPVLSMDIS 579
           HD        I  +++S D KF+A    D+T +++ +D +     +L GH+  V     S
Sbjct: 206 HDAY------ITRILLSSDVKFLATCSADHTARIWSIDDNFNLHTTLDGHQRWVWDCAFS 259

Query: 580 YDSKLIVTCSADKNIKIWGL 599
            DS  ++T S+D  +++W L
Sbjct: 260 ADSAYLITASSDHYVRLWDL 279

 Score = 65.1 bits (157), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 61/298 (20%), Positives = 116/298 (38%), Gaps = 29/298 (9%)

Query: 402 LLATASNGSLKIWNIKTKRCIRSFECGYALTCKFL---PGGALVVVGTRNGELQLFDIAS 458
           L++   + +++ W   T  C R+ +   +   +         L   G +N +L   +  +
Sbjct: 5   LVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLTITNDKKLLAAAGHQNVKLYDINTTN 64

Query: 459 STMLDNKEGAHDAAIWSLDLTSDGRKLVTGSADKTVRFWTFEVSEVPVSDESNKTMPMLQ 518
              + + EG H   + SL   +D R +VT S D T++ W      VP + + N       
Sbjct: 65  PNPVASFEG-HRGNVTSLSFQNDNRWMVTSSEDGTIKVWDVRSPSVPRTYKHNAP----- 118

Query: 519 LFHDTTLELDDDILSVVISPDDKFIAVSLLDNTVKVFFLDSMKFFLSLYGHK-LPVLSMD 577
                       +  V I P+   +     D  ++++ L   +    L      PV S+ 
Sbjct: 119 ------------VNEVAIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPEDDTPVQSLS 166

Query: 578 ISYDSKLIVTCSADKNIKIWGLDFGDCHKSL-----FAHQDSIMNVKFLPESYNFF-SCS 631
           ++ D  ++V  ++  N  +W +       +L     F   D+ +    L     F  +CS
Sbjct: 167 LATDGSMLVAANSKGNCYVWEMPNRTDASNLKPVTKFRAHDAYITRILLSSDVKFLATCS 226

Query: 632 KDATVKYWD-GQKFECIQKLAAHQSEVWSISVSNDGTFVISTGHDHSIRVWEETEDQV 688
            D T + W     F     L  HQ  VW  + S D  ++I+   DH +R+W+ +  ++
Sbjct: 227 ADHTARIWSIDDNFNLHTTLDGHQRWVWDCAFSADSAYLITASSDHYVRLWDLSTREI 284

 Score = 53.5 bits (127), Expect = 9e-07,   Method: Composition-based stats.
 Identities = 51/225 (22%), Positives = 97/225 (43%), Gaps = 18/225 (8%)

Query: 93  LLAAGYADGVIKIWDL--ISKTVLISFNGHKSAITVLAFDTTGTRLISASKDSDIIVWDL 150
           L AAG+ +  +K++D+   +   + SF GH+  +T L+F      ++++S+D  I VWD+
Sbjct: 47  LAAAGHQN--VKLYDINTTNPNPVASFEGHRGNVTSLSFQNDNRWMVTSSEDGTIKVWDV 104

Query: 151 VGESGLYKLRSHKDAITGLWCE-DENWLISTSKDGLVKIWDLKSQQCVETHLAHTG---E 206
              S + +   H   +  +    ++  LIS  +DG ++IWDL   QC            +
Sbjct: 105 RSPS-VPRTYKHNAPVNEVAIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPEDDTPVQ 163

Query: 207 CWSLGIIEDMAVTCSADSQVKLWKLDLQAENGSKLTEKGIIEKQSKQRGVE--IDFAVAP 264
             SL     M V  ++     +W++          T+   ++  +K R  +  I   +  
Sbjct: 164 SLSLATDGSMLVAANSKGNCYVWEM-------PNRTDASNLKPVTKFRAHDAYITRILLS 216

Query: 265 DGVKFFYIQNADKTIEIYRLRKEEEISRALKKREKRLQDKGMSEE 309
             VKF    +AD T  I+ +     +   L   ++ + D   S +
Sbjct: 217 SDVKFLATCSADHTARIWSIDDNFNLHTTLDGHQRWVWDCAFSAD 261

 Score = 52.8 bits (125), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 44/199 (22%), Positives = 82/199 (41%), Gaps = 21/199 (10%)

Query: 44  GGLENILVWDIKTGEQIAQLTDGLPPGASDAKLSKPAETTFLKYHPETNLLAAGYADGVI 103
            G +N+ ++DI T            P    +        T L +  +   +     DG I
Sbjct: 50  AGHQNVKLYDINTTN----------PNPVASFEGHRGNVTSLSFQNDNRWMVTSSEDGTI 99

Query: 104 KIWDLISKTVLISFNGHKSAITVLAFDTTGTRLISASKDSDIIVWDLVGESGLYKLRSHK 163
           K+WD+ S +V  ++  H + +  +A       LIS  +D +I +WDL      ++L    
Sbjct: 100 KVWDVRSPSVPRTYK-HNAPVNEVAIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPED 158

Query: 164 DA-ITGL-WCEDENWLISTSKDGLVKIWDLKSQ------QCVETHLAHTGECWSLGIIED 215
           D  +  L    D + L++ +  G   +W++ ++      + V    AH      + +  D
Sbjct: 159 DTPVQSLSLATDGSMLVAANSKGNCYVWEMPNRTDASNLKPVTKFRAHDAYITRILLSSD 218

Query: 216 MA--VTCSADSQVKLWKLD 232
           +    TCSAD   ++W +D
Sbjct: 219 VKFLATCSADHTARIWSID 237

 Score = 52.4 bits (124), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 49/194 (25%), Positives = 77/194 (39%), Gaps = 24/194 (12%)

Query: 49  ILVWDIKTGEQIAQLTDGLPPGASDAKLSKPAETTFLKYHPETNLLAAGYADGVIKIWDL 108
           I VWD+++           P      K + P     +  HP    L +   DG I+IWDL
Sbjct: 99  IKVWDVRS-----------PSVPRTYKHNAPVNEVAI--HPNQGELISCDRDGNIRIWDL 145

Query: 109 ISKTVLISFNGHK-SAITVLAFDTTGTRLISASKDSDIIVWDLVGESG------LYKLRS 161
                         + +  L+  T G+ L++A+   +  VW++   +       + K R+
Sbjct: 146 GENQCTHQLTPEDDTPVQSLSLATDGSMLVAANSKGNCYVWEMPNRTDASNLKPVTKFRA 205

Query: 162 HKDAITG-LWCEDENWLISTSKDGLVKIWDLKSQQCVETHL-AHTGECWSLGIIEDMA-- 217
           H   IT  L   D  +L + S D   +IW +     + T L  H    W      D A  
Sbjct: 206 HDAYITRILLSSDVKFLATCSADHTARIWSIDDNFNLHTTLDGHQRWVWDCAFSADSAYL 265

Query: 218 VTCSADSQVKLWKL 231
           +T S+D  V+LW L
Sbjct: 266 ITASSDHYVRLWDL 279

 Score = 37.0 bits (84), Expect = 0.21,   Method: Composition-based stats.
 Identities = 26/125 (20%), Positives = 52/125 (41%), Gaps = 9/125 (7%)

Query: 389 TDIRSTSISDDNKLLATA-SNGSLKIWNIKTK------RCIRSFECGYALTCKFLPGGAL 441
           T ++S S++ D  +L  A S G+  +W +  +      + +  F    A   + L    +
Sbjct: 160 TPVQSLSLATDGSMLVAANSKGNCYVWEMPNRTDASNLKPVTKFRAHDAYITRILLSSDV 219

Query: 442 VVVGTRNGE--LQLFDIASSTMLDNKEGAHDAAIWSLDLTSDGRKLVTGSADKTVRFWTF 499
             + T + +   +++ I  +  L      H   +W    ++D   L+T S+D  VR W  
Sbjct: 220 KFLATCSADHTARIWSIDDNFNLHTTLDGHQRWVWDCAFSADSAYLITASSDHYVRLWDL 279

Query: 500 EVSEV 504
              E+
Sbjct: 280 STREI 284

 Score = 34.7 bits (78), Expect = 1.1,   Method: Composition-based stats.
 Identities = 27/104 (25%), Positives = 46/104 (44%), Gaps = 7/104 (6%)

Query: 48  NILVWDIKTGEQIAQLTDGLPPGASDAKLSKPAETTFLKYHPETNLLAAGYADGVIKIWD 107
           N  VW++      + L       A DA +++   ++ +K+      LA   AD   +IW 
Sbjct: 182 NCYVWEMPNRTDASNLKPVTKFRAHDAYITRILLSSDVKF------LATCSADHTARIWS 235

Query: 108 LISKTVL-ISFNGHKSAITVLAFDTTGTRLISASKDSDIIVWDL 150
           +     L  + +GH+  +   AF      LI+AS D  + +WDL
Sbjct: 236 IDDNFNLHTTLDGHQRWVWDCAFSADSAYLITASSDHYVRLWDL 279

>NCAS0A04270 Chr1 (862892..863425,863734..864156) [957 bp, 318 aa]
           {ON} Anc_2.431 YMR116C
          Length = 318

 Score = 80.1 bits (196), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 59/238 (24%), Positives = 105/238 (44%), Gaps = 20/238 (8%)

Query: 468 AHDAAIWSLDLTSDGRK--LVTGSADKTVRFWTFEVSEVPVSDESNKTMPMLQLFHDTTL 525
            H+  + SL  TS G+   L++GS DKT+  W          D+    +P+      + +
Sbjct: 15  GHNGWVTSL-ATSAGQPNLLLSGSRDKTLISWKL------TGDDQKFGVPVRSFKGHSHI 67

Query: 526 ELDDDILSVVISPDDKFIAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSMDISYDSKLI 585
             D       ++ D  +   +  D T++++ + + + +    GHK  V+S+ I   + +I
Sbjct: 68  VQD-----CTLTQDGAYALSASWDKTLRLWDVATGETYQRFVGHKSDVMSVAIDRKASMI 122

Query: 586 VTCSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLP-----ESYNFFSCSKDATVKYWD 640
           ++ S DK IK+W +  G C  +L  H D +  V+  P     +S    S   D  VK W+
Sbjct: 123 ISGSRDKTIKVWTIK-GQCLATLLGHNDWVSQVRIAPTDQNDDSVTVISAGNDKMVKAWN 181

Query: 641 GQKFECIQKLAAHQSEVWSISVSNDGTFVISTGHDHSIRVWEETEDQVFLEEEREKEM 698
             +F+       H   V +++ S DGT + S G D  I +W   E +       + E+
Sbjct: 182 LNQFQIEADFVGHNGNVNTVTASPDGTLIASAGKDGEIMLWNLAEKKAMYTLSAQDEV 239

 Score = 57.4 bits (137), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 40/140 (28%), Positives = 65/140 (46%), Gaps = 9/140 (6%)

Query: 100 DGVIKIWDLISKTVLISFNGHKSAITVLAFDTTGTRLISASKDSDIIVWDLVGESGLYKL 159
           D  +++WD+ +      F GHKS +  +A D   + +IS S+D  I VW + G+  L  L
Sbjct: 86  DKTLRLWDVATGETYQRFVGHKSDVMSVAIDRKASMIISGSRDKTIKVWTIKGQC-LATL 144

Query: 160 RSHKDAITGLWC------EDENWLISTSKDGLVKIWDLKSQQCVETHLAHTGECWSLGII 213
             H D ++ +        +D   +IS   D +VK W+L   Q     + H G   ++   
Sbjct: 145 LGHNDWVSQVRIAPTDQNDDSVTVISAGNDKMVKAWNLNQFQIEADFVGHNGNVNTVTAS 204

Query: 214 EDMAVTCSA--DSQVKLWKL 231
            D  +  SA  D ++ LW L
Sbjct: 205 PDGTLIASAGKDGEIMLWNL 224

 Score = 51.6 bits (122), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 34/123 (27%), Positives = 56/123 (45%), Gaps = 6/123 (4%)

Query: 565 SLYGHKLPVLSMDISY-DSKLIVTCSADKNIKIWGLD-----FGDCHKSLFAHQDSIMNV 618
           +L GH   V S+  S     L+++ S DK +  W L      FG   +S   H   + + 
Sbjct: 12  TLEGHNGWVTSLATSAGQPNLLLSGSRDKTLISWKLTGDDQKFGVPVRSFKGHSHIVQDC 71

Query: 619 KFLPESYNFFSCSKDATVKYWDGQKFECIQKLAAHQSEVWSISVSNDGTFVISTGHDHSI 678
               +     S S D T++ WD    E  Q+   H+S+V S+++    + +IS   D +I
Sbjct: 72  TLTQDGAYALSASWDKTLRLWDVATGETYQRFVGHKSDVMSVAIDRKASMIISGSRDKTI 131

Query: 679 RVW 681
           +VW
Sbjct: 132 KVW 134

 Score = 47.0 bits (110), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 28/106 (26%), Positives = 53/106 (50%), Gaps = 2/106 (1%)

Query: 93  LLAAGYADGVIKIWDLISKTVLISFNGHKSAITVLAFDTTGTRLISASKDSDIIVWDLVG 152
           +++AG  D ++K W+L    +   F GH   +  +     GT + SA KD +I++W+L  
Sbjct: 168 VISAGN-DKMVKAWNLNQFQIEADFVGHNGNVNTVTASPDGTLIASAGKDGEIMLWNLAE 226

Query: 153 ESGLYKLRSHKDAITGLWCEDENWLISTSKDGLVKIWDLKSQQCVE 198
           +  +Y L +  +     +  +  WL + +  G +KI+ L  Q  V+
Sbjct: 227 KKAMYTLSAQDEVFALAFSPNRYWLAAATASG-IKIFCLDPQSLVD 271

 Score = 43.9 bits (102), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 42/164 (25%), Positives = 67/164 (40%), Gaps = 14/164 (8%)

Query: 82  TTFLKYHPETNLLAAGYADGVIKIWDLISK-----TVLISFNGHKSAITVLAFDTTGTRL 136
           T+      + NLL +G  D  +  W L          + SF GH   +        G   
Sbjct: 21  TSLATSAGQPNLLLSGSRDKTLISWKLTGDDQKFGVPVRSFKGHSHIVQDCTLTQDGAYA 80

Query: 137 ISASKDSDIIVWDLVGESGLYKLRSHKDAITGLWCEDE-NWLISTSKDGLVKIWDLKSQQ 195
           +SAS D  + +WD+       +   HK  +  +  + + + +IS S+D  +K+W +K  Q
Sbjct: 81  LSASWDKTLRLWDVATGETYQRFVGHKSDVMSVAIDRKASMIISGSRDKTIKVWTIKG-Q 139

Query: 196 CVETHLAHTGECWSLGII-----EDMAVTCSA--DSQVKLWKLD 232
           C+ T L H      + I      +D     SA  D  VK W L+
Sbjct: 140 CLATLLGHNDWVSQVRIAPTDQNDDSVTVISAGNDKMVKAWNLN 183

 Score = 38.5 bits (88), Expect = 0.071,   Method: Compositional matrix adjust.
 Identities = 28/125 (22%), Positives = 57/125 (45%), Gaps = 12/125 (9%)

Query: 383 DLHGQRTDIRSTSISDDNKLLATAS-NGSLKIWNIKTKRCIRSFEC-GYALTCKFLPGGA 440
           D  G   ++ + + S D  L+A+A  +G + +WN+  K+ + +           F P   
Sbjct: 190 DFVGHNGNVNTVTASPDGTLIASAGKDGEIMLWNLAEKKAMYTLSAQDEVFALAFSPNRY 249

Query: 441 LVVVGTRNGELQLFDIASSTMLDN--------KEGAHDAAIWSLDLTSDGRKLVTGSADK 492
            +   T +G +++F +   +++D+         + A   A+ SL  ++DG+ L  G  D 
Sbjct: 250 WLAAATASG-IKIFCLDPQSLVDDLRPEFAGYNKSAEPHAV-SLAWSADGQTLFAGYTDS 307

Query: 493 TVRFW 497
            +R W
Sbjct: 308 VIRVW 312

>TPHA0G02380 Chr7 (484477..485010,485373..485795) [957 bp, 318 aa]
           {ON} Anc_2.431 YMR116C
          Length = 318

 Score = 79.7 bits (195), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 58/222 (26%), Positives = 100/222 (45%), Gaps = 21/222 (9%)

Query: 468 AHDAAIWSLDLTSDGRK--LVTGSADKTVRFWTFEVSEVPVSDESNKTMPMLQLFHDTTL 525
            H+  + SL  TS G+   LV+ S DKT+  W          D+    +P+        +
Sbjct: 14  GHNGWVTSL-ATSAGQPNLLVSASRDKTLISWKL------TGDDQQYGVPVRSFKGHNHI 66

Query: 526 ELDDDILSVVISPDDKFIAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSMDISYDSKLI 585
             D       ++ D  +   +  D T++++ + + + +    GHK  V+S+ I   + +I
Sbjct: 67  VQD-----CALTADGAYALSASWDKTLRLWNVATGETYQRFTGHKSDVMSVAIDRKASMI 121

Query: 586 VTCSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLP------ESYNFFSCSKDATVKYW 639
           ++ S DK IK+W +  GDC  +L  H D +  V+  P      ++    S   D  VK W
Sbjct: 122 ISGSRDKTIKVWSIK-GDCLATLLGHNDWVSQVRVAPNEKQEDDNVTLISAGSDKMVKAW 180

Query: 640 DGQKFECIQKLAAHQSEVWSISVSNDGTFVISTGHDHSIRVW 681
           +  +F+       H + + SI+ S DG+ V S G D  I +W
Sbjct: 181 NINQFQIEADFVGHNNYINSITASPDGSLVASAGKDGDIMLW 222

 Score = 56.6 bits (135), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 52/197 (26%), Positives = 85/197 (43%), Gaps = 23/197 (11%)

Query: 100 DGVIKIWDLISKTVLISFNGHKSAITVLAFDTTGTRLISASKDSDIIVWDLVGESGLYKL 159
           D  +++W++ +      F GHKS +  +A D   + +IS S+D  I VW + G+  L  L
Sbjct: 85  DKTLRLWNVATGETYQRFTGHKSDVMSVAIDRKASMIISGSRDKTIKVWSIKGDC-LATL 143

Query: 160 RSHKDAITGLWC------EDEN-WLISTSKDGLVKIWDLKSQQCVETHLAHTGECWSLGI 212
             H D ++ +        ED+N  LIS   D +VK W++   Q     + H     S+  
Sbjct: 144 LGHNDWVSQVRVAPNEKQEDDNVTLISAGSDKMVKAWNINQFQIEADFVGHNNYINSITA 203

Query: 213 IEDMAVTCSA--DSQVKLWKLDLQAENGSKLTEKGIIEKQSKQRGVEIDFAVAPDGVKFF 270
             D ++  SA  D  + LW L           +K  +   S Q  V   FA+A    +++
Sbjct: 204 SPDGSLVASAGKDGDIMLWNLK----------QKTPLYTLSAQDEV---FALAFSPNRYW 250

Query: 271 YIQNADKTIEIYRLRKE 287
                   I++Y L  E
Sbjct: 251 LTAATATGIKVYSLEDE 267

 Score = 53.1 bits (126), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 65/317 (20%), Positives = 132/317 (41%), Gaps = 29/317 (9%)

Query: 381 TIDLHGQRTDIRSTSISDDNKLLATASNGSLKIWNI-----KTKRCIRSFECGYALT--C 433
           T++ H       +TS    N L++ + + +L  W +     +    +RSF+    +   C
Sbjct: 11  TLEGHNGWVTSLATSAGQPNLLVSASRDKTLISWKLTGDDQQYGVPVRSFKGHNHIVQDC 70

Query: 434 KFLPGGALVVVGTRNGELQLFDIASSTMLDNKEGAHDAAIWSLDLTSDGRKLVTGSADKT 493
                GA  +  + +  L+L+++A+        G H + + S+ +      +++GS DKT
Sbjct: 71  ALTADGAYALSASWDKTLRLWNVATGETYQRFTG-HKSDVMSVAIDRKASMIISGSRDKT 129

Query: 494 VRFWTFEVSEVPVSDESNKTMPMLQLFHDTTLELDDDILSVVISPDDKFIAVSLLDNTVK 553
           ++ W+ +   +      N  +  +++  +   E  DD ++++ +  DK          VK
Sbjct: 130 IKVWSIKGDCLATLLGHNDWVSQVRVAPNEKQE--DDNVTLISAGSDKM---------VK 178

Query: 554 VFFLDSMKFFLSLYGHKLPVLSMDISYDSKLIVTCSADKNIKIWGLDFGDCHKSLFAHQD 613
            + ++  +      GH   + S+  S D  L+ +   D +I +W L       +L A QD
Sbjct: 179 AWNINQFQIEADFVGHNNYINSITASPDGSLVASAGKDGDIMLWNLKQKTPLYTLSA-QD 237

Query: 614 SIMNVKFLPESYNFFSCSKDATVKYW--------DGQKFECIQKLAAHQSEVWSISVSND 665
            +  + F P  Y + + +    +K +        D  K E      A +    S++ S D
Sbjct: 238 EVFALAFSPNRY-WLTAATATGIKVYSLEDEVLIDELKPEFTGYNKAAEPHAVSLTWSAD 296

Query: 666 GTFVISTGHDHSIRVWE 682
           G  + +   D  IRVW+
Sbjct: 297 GQTLFAGYTDSIIRVWQ 313

 Score = 47.8 bits (112), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 27/106 (25%), Positives = 57/106 (53%), Gaps = 2/106 (1%)

Query: 93  LLAAGYADGVIKIWDLISKTVLISFNGHKSAITVLAFDTTGTRLISASKDSDIIVWDLVG 152
           L++AG +D ++K W++    +   F GH + I  +     G+ + SA KD DI++W+L  
Sbjct: 168 LISAG-SDKMVKAWNINQFQIEADFVGHNNYINSITASPDGSLVASAGKDGDIMLWNLKQ 226

Query: 153 ESGLYKLRSHKDAITGLWCEDENWLISTSKDGLVKIWDLKSQQCVE 198
           ++ LY L +  +     +  +  WL + +  G +K++ L+ +  ++
Sbjct: 227 KTPLYTLSAQDEVFALAFSPNRYWLTAATATG-IKVYSLEDEVLID 271

 Score = 40.8 bits (94), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 38/157 (24%), Positives = 65/157 (41%), Gaps = 15/157 (9%)

Query: 90  ETNLLAAGYADGVIKIWDLISK-----TVLISFNGHKSAITVLAFDTTGTRLISASKDSD 144
           + NLL +   D  +  W L          + SF GH   +   A    G   +SAS D  
Sbjct: 28  QPNLLVSASRDKTLISWKLTGDDQQYGVPVRSFKGHNHIVQDCALTADGAYALSASWDKT 87

Query: 145 IIVWDLVGESGLYKLRSHKDAITGLWCEDE-NWLISTSKDGLVKIWDLKSQQCVETHLAH 203
           + +W++       +   HK  +  +  + + + +IS S+D  +K+W +K   C+ T L H
Sbjct: 88  LRLWNVATGETYQRFTGHKSDVMSVAIDRKASMIISGSRDKTIKVWSIKG-DCLATLLGH 146

Query: 204 TGECWSLGII-----EDMAVT---CSADSQVKLWKLD 232
                 + +      ED  VT     +D  VK W ++
Sbjct: 147 NDWVSQVRVAPNEKQEDDNVTLISAGSDKMVKAWNIN 183

>NCAS0F01850 Chr6 complement(371372..371794,372104..372637) [957 bp,
           318 aa] {ON} Anc_2.431 YMR116C
          Length = 318

 Score = 79.7 bits (195), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 59/238 (24%), Positives = 104/238 (43%), Gaps = 20/238 (8%)

Query: 468 AHDAAIWSLDLTSDGRK--LVTGSADKTVRFWTFEVSEVPVSDESNKTMPMLQLFHDTTL 525
            H+  + SL  TS G+   L++GS DKT+  W          D+    +P+      + +
Sbjct: 15  GHNGWVTSL-ATSAGQPNLLLSGSRDKTLISWKL------TGDDQKFGVPVRSFKGHSHI 67

Query: 526 ELDDDILSVVISPDDKFIAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSMDISYDSKLI 585
             D       ++ D  +   +  D T++++ + + + +    GHK  V+S+ I   + +I
Sbjct: 68  VQD-----CTLTQDGAYALSASWDKTLRLWDVATGETYQRFVGHKSDVMSVAIDRKASMI 122

Query: 586 VTCSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLPESYN-----FFSCSKDATVKYWD 640
           ++ S DK IK+W +  G C  +L  H D +  V+  P   N       S   D  VK W+
Sbjct: 123 ISGSRDKTIKVWTIK-GQCLATLLGHNDWVSQVRIAPTDQNDDAVTVISAGNDKMVKAWN 181

Query: 641 GQKFECIQKLAAHQSEVWSISVSNDGTFVISTGHDHSIRVWEETEDQVFLEEEREKEM 698
             +F+       H   V +++ S DGT + S G D  I +W   E +       + E+
Sbjct: 182 LNQFQIEADFVGHNGNVNAVTASPDGTLIASAGKDGEIMLWNLAEKKAMYTLSAQDEV 239

 Score = 57.4 bits (137), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 40/140 (28%), Positives = 65/140 (46%), Gaps = 9/140 (6%)

Query: 100 DGVIKIWDLISKTVLISFNGHKSAITVLAFDTTGTRLISASKDSDIIVWDLVGESGLYKL 159
           D  +++WD+ +      F GHKS +  +A D   + +IS S+D  I VW + G+  L  L
Sbjct: 86  DKTLRLWDVATGETYQRFVGHKSDVMSVAIDRKASMIISGSRDKTIKVWTIKGQC-LATL 144

Query: 160 RSHKDAITGLWC------EDENWLISTSKDGLVKIWDLKSQQCVETHLAHTGECWSLGII 213
             H D ++ +        +D   +IS   D +VK W+L   Q     + H G   ++   
Sbjct: 145 LGHNDWVSQVRIAPTDQNDDAVTVISAGNDKMVKAWNLNQFQIEADFVGHNGNVNAVTAS 204

Query: 214 EDMAVTCSA--DSQVKLWKL 231
            D  +  SA  D ++ LW L
Sbjct: 205 PDGTLIASAGKDGEIMLWNL 224

 Score = 51.6 bits (122), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 34/123 (27%), Positives = 56/123 (45%), Gaps = 6/123 (4%)

Query: 565 SLYGHKLPVLSMDISY-DSKLIVTCSADKNIKIWGLD-----FGDCHKSLFAHQDSIMNV 618
           +L GH   V S+  S     L+++ S DK +  W L      FG   +S   H   + + 
Sbjct: 12  TLEGHNGWVTSLATSAGQPNLLLSGSRDKTLISWKLTGDDQKFGVPVRSFKGHSHIVQDC 71

Query: 619 KFLPESYNFFSCSKDATVKYWDGQKFECIQKLAAHQSEVWSISVSNDGTFVISTGHDHSI 678
               +     S S D T++ WD    E  Q+   H+S+V S+++    + +IS   D +I
Sbjct: 72  TLTQDGAYALSASWDKTLRLWDVATGETYQRFVGHKSDVMSVAIDRKASMIISGSRDKTI 131

Query: 679 RVW 681
           +VW
Sbjct: 132 KVW 134

 Score = 47.0 bits (110), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 25/99 (25%), Positives = 49/99 (49%), Gaps = 1/99 (1%)

Query: 100 DGVIKIWDLISKTVLISFNGHKSAITVLAFDTTGTRLISASKDSDIIVWDLVGESGLYKL 159
           D ++K W+L    +   F GH   +  +     GT + SA KD +I++W+L  +  +Y L
Sbjct: 174 DKMVKAWNLNQFQIEADFVGHNGNVNAVTASPDGTLIASAGKDGEIMLWNLAEKKAMYTL 233

Query: 160 RSHKDAITGLWCEDENWLISTSKDGLVKIWDLKSQQCVE 198
            +  +  +  +  +  WL + +  G +KI+ L  Q  ++
Sbjct: 234 SAQDEVFSLAFSPNRYWLAAATASG-IKIFCLDPQSLID 271

 Score = 44.7 bits (104), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 43/164 (26%), Positives = 67/164 (40%), Gaps = 14/164 (8%)

Query: 82  TTFLKYHPETNLLAAGYADGVIKIWDLISK-----TVLISFNGHKSAITVLAFDTTGTRL 136
           T+      + NLL +G  D  +  W L          + SF GH   +        G   
Sbjct: 21  TSLATSAGQPNLLLSGSRDKTLISWKLTGDDQKFGVPVRSFKGHSHIVQDCTLTQDGAYA 80

Query: 137 ISASKDSDIIVWDLVGESGLYKLRSHKDAITGLWCEDE-NWLISTSKDGLVKIWDLKSQQ 195
           +SAS D  + +WD+       +   HK  +  +  + + + +IS S+D  +K+W +K  Q
Sbjct: 81  LSASWDKTLRLWDVATGETYQRFVGHKSDVMSVAIDRKASMIISGSRDKTIKVWTIKG-Q 139

Query: 196 CVETHLAHTGECWSLGII----EDMAVT---CSADSQVKLWKLD 232
           C+ T L H      + I      D AVT      D  VK W L+
Sbjct: 140 CLATLLGHNDWVSQVRIAPTDQNDDAVTVISAGNDKMVKAWNLN 183

 Score = 39.3 bits (90), Expect = 0.041,   Method: Compositional matrix adjust.
 Identities = 28/125 (22%), Positives = 58/125 (46%), Gaps = 12/125 (9%)

Query: 383 DLHGQRTDIRSTSISDDNKLLATAS-NGSLKIWNIKTKRCIRSFEC-GYALTCKFLPGGA 440
           D  G   ++ + + S D  L+A+A  +G + +WN+  K+ + +        +  F P   
Sbjct: 190 DFVGHNGNVNAVTASPDGTLIASAGKDGEIMLWNLAEKKAMYTLSAQDEVFSLAFSPNRY 249

Query: 441 LVVVGTRNGELQLFDIASSTMLDN--------KEGAHDAAIWSLDLTSDGRKLVTGSADK 492
            +   T +G +++F +   +++D+         + A   A+ SL  ++DG+ L  G  D 
Sbjct: 250 WLAAATASG-IKIFCLDPQSLIDDLRPEFAGYNKSAEPHAV-SLAWSADGQTLFAGYTDS 307

Query: 493 TVRFW 497
            +R W
Sbjct: 308 VIRVW 312

 Score = 32.3 bits (72), Expect = 5.7,   Method: Compositional matrix adjust.
 Identities = 50/275 (18%), Positives = 108/275 (39%), Gaps = 46/275 (16%)

Query: 386 GQRTDIRSTSISDDNKLLATAS-NGSLKIWNIKTKRCIRSFECGY---ALTCKFLPGGAL 441
           G    ++  +++ D     +AS + +L++W++ T    + F  G+    ++       ++
Sbjct: 63  GHSHIVQDCTLTQDGAYALSASWDKTLRLWDVATGETYQRF-VGHKSDVMSVAIDRKASM 121

Query: 442 VVVGTRNGELQLFDIAS---STMLDNKEGAHDAAIWSLDLTSDGRKLVTGSADKTVRFWT 498
           ++ G+R+  ++++ I     +T+L + +      I   D   D   +++   DK V+ W 
Sbjct: 122 IISGSRDKTIKVWTIKGQCLATLLGHNDWVSQVRIAPTDQNDDAVTVISAGNDKMVKAWN 181

Query: 499 ---FEVSEVPVSDESNKTMPMLQLFHDTTLELDDDILSVVISPDDKFIAVSLLDNTVKVF 555
              F++    V    N                   + +V  SPD   IA +  D  + ++
Sbjct: 182 LNQFQIEADFVGHNGN-------------------VNAVTASPDGTLIASAGKDGEIMLW 222

Query: 556 FLDSMKFFLSLYGHKLPVLSMDISYDSKLIVTCSADKNIKIWGLD-----------FGDC 604
            L   K   +L      V S+  S +   +   +A   IKI+ LD           F   
Sbjct: 223 NLAEKKAMYTLSAQD-EVFSLAFSPNRYWLAAATA-SGIKIFCLDPQSLIDDLRPEFAGY 280

Query: 605 HKSLFAHQDSIMNVKFLPESYNFFSCSKDATVKYW 639
           +KS   H    +++ +  +    F+   D+ ++ W
Sbjct: 281 NKSAEPHA---VSLAWSADGQTLFAGYTDSVIRVW 312

>ZYRO0D08206g Chr4 (711937..713484) [1548 bp, 515 aa] {ON} highly
           similar to uniprot|P25382 Saccharomyces cerevisiae
           YCR072C Protein required for cell viability
          Length = 515

 Score = 81.3 bits (199), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 69/289 (23%), Positives = 127/289 (43%), Gaps = 21/289 (7%)

Query: 395 SISDDNKLLATASNGSLKIWNIKTKRCIRSFECGY--ALTCKFLPGGALVVVGTRNGELQ 452
           +  D  +L + + +G++KIW+   + C+ +   G+  +++C    G  L+  G+ +  ++
Sbjct: 244 AAGDKPRLASASKDGTIKIWDASRRTCLYTLS-GHTNSVSCVKWGGQGLLYTGSHDKTIR 302

Query: 453 LFDIASSTMLDNKEGAHDAAIWSLDLTSDGRKLVTGSADKTVRFWTFEVSEVPVSDESNK 512
           ++DI +     N   +H   +  L L          S D  +R   F   +   S    +
Sbjct: 303 VWDIKAGGKCINILKSHAHWVNHLSL----------STDYAIRVGPFG-PDGKASPSPQE 351

Query: 513 TMPMLQLFHDTTLELDDDILSVVISPDDKFIAVSLLDNTVKVFFLDSMKFFLSLYGHKLP 572
              + +  ++  +     +  ++++  D F     L N +K     S K    + GH+  
Sbjct: 352 ARDIAKKNYEKVVRKSGQVEELMVTASDDFTM--FLWNPLK-----SAKPLARMTGHQKL 404

Query: 573 VLSMDISYDSKLIVTCSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLPESYNFFSCSK 632
           V  +  S D + IV+ S D +IK+W    G    +   H  S+  V +  +     SCSK
Sbjct: 405 VNHVAFSPDGRYIVSASFDNSIKLWDGRDGKFIATFRGHVASVYQVAWSSDCRLLVSCSK 464

Query: 633 DATVKYWDGQKFECIQKLAAHQSEVWSISVSNDGTFVISTGHDHSIRVW 681
           D T+K WD +  +    L  HQ EV+++  S DG  V S G D  +R+W
Sbjct: 465 DTTLKVWDVKTRKLSVDLPGHQDEVYTVDWSVDGQRVCSGGKDKMVRLW 513

 Score = 76.3 bits (186), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 96/441 (21%), Positives = 179/441 (40%), Gaps = 106/441 (24%)

Query: 87  YHPETN-LLAAGYADGVIKIWDLISKTVLISFNGHKSAITVLAFDTTGTRLISASKDSDI 145
           + P+T+  +  G  D   +IWD  ++T L    GH + +  +A+   G  + + S D+ I
Sbjct: 151 FAPDTSSRMVTGAGDNTARIWDCATQTPLSVLKGHSNWVLCVAWSPDGELIATGSMDNTI 210

Query: 146 IVWDL-VGESGLYKLRSHKDAITGLWCE--------DENWLISTSKDGLVKIWDLKSQQC 196
            +W+   G+     ++ H   IT L  E        D+  L S SKDG +KIWD   + C
Sbjct: 211 RLWESKAGKPWGDAMKGHSKWITSLTWEPLHLVAAGDKPRLASASKDGTIKIWDASRRTC 270

Query: 197 VETHLAHTG--ECWSLGIIEDMAVTCSADSQVKLWKLDLQAENGSKLTEKGIIEKQS--- 251
           + T   HT    C   G  + +  T S D  +++W  D++A  G K     I++  +   
Sbjct: 271 LYTLSGHTNSVSCVKWG-GQGLLYTGSHDKTIRVW--DIKA--GGKCIN--ILKSHAHWV 323

Query: 252 KQRGVEIDFAV-----APDGVKFFYIQNADKTIEIYRLRKEEEISRALKKREKRLQDKGM 306
               +  D+A+      PDG      Q A             +I++  K  EK ++  G 
Sbjct: 324 NHLSLSTDYAIRVGPFGPDGKASPSPQEA------------RDIAK--KNYEKVVRKSGQ 369

Query: 307 SEEEIKEAMGSPVSLMYHLFQVVRSPYKIKSAQWTVCSNSKLELVVTTSNNSIEYYSIPY 366
            EE                                        L+VT S++   +   P 
Sbjct: 370 VEE----------------------------------------LMVTASDDFTMFLWNPL 389

Query: 367 SKREPTQPAPLKLHTIDLHGQRTDIRSTSISDDNKLLATAS-NGSLKIWNIKTKRCIRSF 425
              +P            + G +  +   + S D + + +AS + S+K+W+ +  + I +F
Sbjct: 390 KSAKPLA---------RMTGHQKLVNHVAFSPDGRYIVSASFDNSIKLWDGRDGKFIATF 440

Query: 426 --------ECGYALTCKFLPGGALVVVGTRNGELQLFDIASSTMLDNKEGAHDAAIWSLD 477
                   +  ++  C+ L      V  +++  L+++D+ +  +  +  G H   ++++D
Sbjct: 441 RGHVASVYQVAWSSDCRLL------VSCSKDTTLKVWDVKTRKLSVDLPG-HQDEVYTVD 493

Query: 478 LTSDGRKLVTGSADKTVRFWT 498
            + DG+++ +G  DK VR WT
Sbjct: 494 WSVDGQRVCSGGKDKMVRLWT 514

 Score = 65.9 bits (159), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 47/164 (28%), Positives = 72/164 (43%), Gaps = 16/164 (9%)

Query: 531 ILSVVISPD-DKFIAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSMDISYDSKLIVTCS 589
           IL    +PD    +     DNT +++   +      L GH   VL +  S D +LI T S
Sbjct: 146 ILCSAFAPDTSSRMVTGAGDNTARIWDCATQTPLSVLKGHSNWVLCVAWSPDGELIATGS 205

Query: 590 ADKNIKIW----GLDFGDCHKSLFAHQDSIMNVKFLP-------ESYNFFSCSKDATVKY 638
            D  I++W    G  +GD  K    H   I ++ + P       +     S SKD T+K 
Sbjct: 206 MDNTIRLWESKAGKPWGDAMK---GHSKWITSLTWEPLHLVAAGDKPRLASASKDGTIKI 262

Query: 639 WDGQKFECIQKLAAHQSEVWSISVSNDGTFVISTGHDHSIRVWE 682
           WD  +  C+  L+ H + V  +     G  + +  HD +IRVW+
Sbjct: 263 WDASRRTCLYTLSGHTNSVSCVKWGGQG-LLYTGSHDKTIRVWD 305

 Score = 59.3 bits (142), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 54/202 (26%), Positives = 93/202 (46%), Gaps = 34/202 (16%)

Query: 484 KLVTGSADKTVRFWTFEVSEVPVSDESNKTMPMLQLFHDTTLELDDDILSVVISPDDKFI 543
           ++VTG+ D T R W    ++ P+S        +L+   +        +L V  SPD + I
Sbjct: 158 RMVTGAGDNTARIWDC-ATQTPLS--------VLKGHSNW-------VLCVAWSPDGELI 201

Query: 544 AVSLLDNTVKVF-------FLDSM----KFFLSLYGHKLPVLSMDISYDSKLIVTCSADK 592
           A   +DNT++++       + D+M    K+  SL    L +++   + D   + + S D 
Sbjct: 202 ATGSMDNTIRLWESKAGKPWGDAMKGHSKWITSLTWEPLHLVA---AGDKPRLASASKDG 258

Query: 593 NIKIWGLDFGDCHKSLFAHQDSIMNVKFLPESYNFFSCSKDATVKYWD-GQKFECIQKLA 651
            IKIW      C  +L  H +S+  VK+  +    ++ S D T++ WD     +CI  L 
Sbjct: 259 TIKIWDASRRTCLYTLSGHTNSVSCVKWGGQGL-LYTGSHDKTIRVWDIKAGGKCINILK 317

Query: 652 AHQSEVWSISVSNDGTFVISTG 673
           +H   V  +S+S D  + I  G
Sbjct: 318 SHAHWVNHLSLSTD--YAIRVG 337

 Score = 56.6 bits (135), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 69/359 (19%), Positives = 140/359 (38%), Gaps = 69/359 (19%)

Query: 376 PLKLHTIDLHGQRTDIRSTSISDD--NKLLATASNGSLKIWNIKTKRCIRSFE--CGYAL 431
           P+   +  + G  + I  ++ + D  ++++  A + + +IW+  T+  +   +    + L
Sbjct: 131 PITRSSAAIAGHGSTILCSAFAPDTSSRMVTGAGDNTARIWDCATQTPLSVLKGHSNWVL 190

Query: 432 TCKFLPGGALVVVGTRNGELQLFDIASSTMLDNKEGAHDAAIWSLD-------LTSDGRK 484
              + P G L+  G+ +  ++L++  +     +    H   I SL           D  +
Sbjct: 191 CVAWSPDGELIATGSMDNTIRLWESKAGKPWGDAMKGHSKWITSLTWEPLHLVAAGDKPR 250

Query: 485 LVTGSADKTVRFWTFEVSEVPVSDESNKTMPMLQLFHDTTLELDDDILSVVISPDDKFIA 544
           L + S D T++ W          D S +T     L+   TL    + +S V       + 
Sbjct: 251 LASASKDGTIKIW----------DASRRTC----LY---TLSGHTNSVSCVKWGGQGLLY 293

Query: 545 VSLLDNTVKVFFLDSMKFFLSL---YGHKLPVLSMDISY---------DSK--------- 583
               D T++V+ + +    +++   + H +  LS+   Y         D K         
Sbjct: 294 TGSHDKTIRVWDIKAGGKCINILKSHAHWVNHLSLSTDYAIRVGPFGPDGKASPSPQEAR 353

Query: 584 -------------------LIVTCSADKNIKIWG-LDFGDCHKSLFAHQDSIMNVKFLPE 623
                              L+VT S D  + +W  L        +  HQ  + +V F P+
Sbjct: 354 DIAKKNYEKVVRKSGQVEELMVTASDDFTMFLWNPLKSAKPLARMTGHQKLVNHVAFSPD 413

Query: 624 SYNFFSCSKDATVKYWDGQKFECIQKLAAHQSEVWSISVSNDGTFVISTGHDHSIRVWE 682
                S S D ++K WDG+  + I     H + V+ ++ S+D   ++S   D +++VW+
Sbjct: 414 GRYIVSASFDNSIKLWDGRDGKFIATFRGHVASVYQVAWSSDCRLLVSCSKDTTLKVWD 472

 Score = 52.8 bits (125), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 38/161 (23%), Positives = 79/161 (49%), Gaps = 16/161 (9%)

Query: 33  RKTGNLGQVIVGGLEN--ILVWD-IKTGEQIAQLTDGLPPGASDAKLSKPAETTFLKYHP 89
           RK+G + +++V   ++  + +W+ +K+ + +A++T          KL        + + P
Sbjct: 365 RKSGQVEELMVTASDDFTMFLWNPLKSAKPLARMT-------GHQKL-----VNHVAFSP 412

Query: 90  ETNLLAAGYADGVIKIWDLISKTVLISFNGHKSAITVLAFDTTGTRLISASKDSDIIVWD 149
           +   + +   D  IK+WD      + +F GH +++  +A+ +    L+S SKD+ + VWD
Sbjct: 413 DGRYIVSASFDNSIKLWDGRDGKFIATFRGHVASVYQVAWSSDCRLLVSCSKDTTLKVWD 472

Query: 150 LVGESGLYKLRSHKDAITGL-WCEDENWLISTSKDGLVKIW 189
           +        L  H+D +  + W  D   + S  KD +V++W
Sbjct: 473 VKTRKLSVDLPGHQDEVYTVDWSVDGQRVCSGGKDKMVRLW 513

>TDEL0A07550 Chr1 complement(1314676..1316223) [1548 bp, 515 aa]
           {ON} Anc_6.340 YCR072C
          Length = 515

 Score = 81.3 bits (199), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 94/439 (21%), Positives = 177/439 (40%), Gaps = 100/439 (22%)

Query: 86  KYHPETN-LLAAGYADGVIKIWDLISKTVLISFNGHKSAITVLAFDTTGTRLISASKDSD 144
           ++ P T+  +  G  D   ++WD  ++T + + +GH++ +  +A+   G  + + S D  
Sbjct: 150 QFAPHTSSRMVTGAGDNTARVWDCDTQTPMATLSGHQNWVLCVAWSPDGETIATGSMDCT 209

Query: 145 IIVWDL-VGESGLYKLRSHKDAITGLWCE--------DENWLISTSKDGLVKIWDLKSQQ 195
           + +WD   G+     L+ H+  IT L  E        D+  L S SKDG +KIWD   + 
Sbjct: 210 VRLWDSKAGQPLGDALKGHQKWITSLVWEPLHLVKPGDKPRLASASKDGTIKIWDTSRRV 269

Query: 196 CVETHLAHTG--ECWSLGIIEDMAVTCSADSQVKLWKLDLQAENGSKLTEKGIIEKQSK- 252
           C+ T   HT    C   G  + +  + S D  V++W +++    G K     I++  +  
Sbjct: 270 CIYTLSGHTNSVSCVKWG-GQGLLYSGSHDKTVRVWDMNV----GGKCIN--ILKSHAHW 322

Query: 253 ----QRGVEIDFAVAPDGVKFFYIQNADKTIEIYRLRKEEEISRALKKREKRLQDKGMSE 308
                   E    V P      +   A K       RK     +AL+  EK  +  G +E
Sbjct: 323 VNHLSLSTEYALRVGP------FDHTATKFTSAEEARK-----KALENYEKIAKRNGKAE 371

Query: 309 EEIKEAMGSPVSLMYHLFQVVRSPYKIKSAQWTVCSNSKLELVVTTSNNSIEYYSIPYSK 368
           E                                        L+VT S++   +   P   
Sbjct: 372 E----------------------------------------LIVTASDDFTMFLWDPTKS 391

Query: 369 REPTQPAPLKLHTIDLHGQRTDIRSTSISDDNKLLATAS-NGSLKIWNIKTKRCIRSF-- 425
            +P            L G +  +   + S D + + +AS + S+K+W+ +    I +F  
Sbjct: 392 GKPLA---------RLTGHQKLVNHVAFSPDGRFIVSASFDNSIKLWDGRNGTFISTFRG 442

Query: 426 ------ECGYALTCKFLPGGALVVVGTRNGELQLFDIASSTMLDNKEGAHDAAIWSLDLT 479
                 +  ++  C+ L      V  +++  L+++D+ +  +  +  G H   ++++D +
Sbjct: 443 HVASVYQVAWSSDCRLL------VSCSKDTTLKVWDVRTRKLSVDLPG-HKDEVYTVDWS 495

Query: 480 SDGRKLVTGSADKTVRFWT 498
            DG+++ +G  DK VR WT
Sbjct: 496 VDGKRVCSGGKDKMVRLWT 514

 Score = 76.3 bits (186), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 72/286 (25%), Positives = 131/286 (45%), Gaps = 21/286 (7%)

Query: 398 DDNKLLATASNGSLKIWNIKTKRCIRSFECGY--ALTCKFLPGGALVVVGTRNGELQLFD 455
           D  +L + + +G++KIW+   + CI +   G+  +++C    G  L+  G+ +  ++++D
Sbjct: 247 DKPRLASASKDGTIKIWDTSRRVCIYTLS-GHTNSVSCVKWGGQGLLYSGSHDKTVRVWD 305

Query: 456 IASSTMLDNKEGAHDAAIWSLDLTSDGRKLVTGSADKTVRFWTFEVSEVPVSDESNKTMP 515
           +       N   +H   +  L L+++   L  G  D T   +T        ++E+ K   
Sbjct: 306 MNVGGKCINILKSHAHWVNHLSLSTE-YALRVGPFDHTATKFT-------SAEEARKKA- 356

Query: 516 MLQLFHDTTLELDDDILSVVISPDDKFIAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLS 575
            L+ + +   + +     ++++  D F  + L D T       S K    L GH+  V  
Sbjct: 357 -LENY-EKIAKRNGKAEELIVTASDDF-TMFLWDPT------KSGKPLARLTGHQKLVNH 407

Query: 576 MDISYDSKLIVTCSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLPESYNFFSCSKDAT 635
           +  S D + IV+ S D +IK+W    G    +   H  S+  V +  +     SCSKD T
Sbjct: 408 VAFSPDGRFIVSASFDNSIKLWDGRNGTFISTFRGHVASVYQVAWSSDCRLLVSCSKDTT 467

Query: 636 VKYWDGQKFECIQKLAAHQSEVWSISVSNDGTFVISTGHDHSIRVW 681
           +K WD +  +    L  H+ EV+++  S DG  V S G D  +R+W
Sbjct: 468 LKVWDVRTRKLSVDLPGHKDEVYTVDWSVDGKRVCSGGKDKMVRLW 513

 Score = 58.9 bits (141), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 42/161 (26%), Positives = 79/161 (49%), Gaps = 16/161 (9%)

Query: 33  RKTGNLGQVIVGGLEN--ILVWD-IKTGEQIAQLTDGLPPGASDAKLSKPAETTFLKYHP 89
           ++ G   ++IV   ++  + +WD  K+G+ +A+LT          KL        + + P
Sbjct: 365 KRNGKAEELIVTASDDFTMFLWDPTKSGKPLARLT-------GHQKL-----VNHVAFSP 412

Query: 90  ETNLLAAGYADGVIKIWDLISKTVLISFNGHKSAITVLAFDTTGTRLISASKDSDIIVWD 149
           +   + +   D  IK+WD  + T + +F GH +++  +A+ +    L+S SKD+ + VWD
Sbjct: 413 DGRFIVSASFDNSIKLWDGRNGTFISTFRGHVASVYQVAWSSDCRLLVSCSKDTTLKVWD 472

Query: 150 LVGESGLYKLRSHKDAITGL-WCEDENWLISTSKDGLVKIW 189
           +        L  HKD +  + W  D   + S  KD +V++W
Sbjct: 473 VRTRKLSVDLPGHKDEVYTVDWSVDGKRVCSGGKDKMVRLW 513

 Score = 56.6 bits (135), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 62/233 (26%), Positives = 98/233 (42%), Gaps = 42/233 (18%)

Query: 484 KLVTGSADKTVRFWTFEVSEVPVSDESNKTMPMLQLFHDTTLELDDDILSVVISPDDKFI 543
           ++VTG+ D T R W           + +   PM  L           +L V  SPD + I
Sbjct: 158 RMVTGAGDNTARVW-----------DCDTQTPMATLSGHQNW-----VLCVAWSPDGETI 201

Query: 544 AVSLLDNTVKVFFLDS---MKFFLSLYGHKLPVLSMDI-------SYDSKLIVTCSADKN 593
           A   +D TV+++  DS        +L GH+  + S+           D   + + S D  
Sbjct: 202 ATGSMDCTVRLW--DSKAGQPLGDALKGHQKWITSLVWEPLHLVKPGDKPRLASASKDGT 259

Query: 594 IKIWGLDFGDCHKSLFAHQDSIMNVKFLPESYNFFSCSKDATVKYWD-GQKFECIQKLAA 652
           IKIW      C  +L  H +S+  VK+  +    +S S D TV+ WD     +CI  L +
Sbjct: 260 IKIWDTSRRVCIYTLSGHTNSVSCVKWGGQGL-LYSGSHDKTVRVWDMNVGGKCINILKS 318

Query: 653 HQSEVWSISVSNDGTFVISTGHDHSIRV--WEETEDQVFLEEEREKEMDEQYE 703
           H   V  +S+S           ++++RV  ++ T  +    EE  K+  E YE
Sbjct: 319 HAHWVNHLSLST----------EYALRVGPFDHTATKFTSAEEARKKALENYE 361

 Score = 54.7 bits (130), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 67/298 (22%), Positives = 119/298 (39%), Gaps = 53/298 (17%)

Query: 428 GYALTC-KFLP-GGALVVVGTRNGELQLFDIASSTMLDNKEGAHDAAIWSLDLTSDGRKL 485
           G  + C +F P   + +V G  +   +++D  + T +    G H   +  +  + DG  +
Sbjct: 143 GATILCSQFAPHTSSRMVTGAGDNTARVWDCDTQTPMATLSG-HQNWVLCVAWSPDGETI 201

Query: 486 VTGSADKTVRFWTFEVSEVPVSDESNKTMPMLQLFHDTTLELDDDILSVVISPDDKFIAV 545
            TGS D TVR W  +  + P+ D        L+        L  + L +V   D   +A 
Sbjct: 202 ATGSMDCTVRLWDSKAGQ-PLGD-------ALKGHQKWITSLVWEPLHLVKPGDKPRLAS 253

Query: 546 SLLDNTVKVFFLDSMKFFLSLYGHKLPVLSMDISYDSKLIVTCSADKNIKIWGLDFGD-C 604
           +  D T+K++         +L GH   V  +       L+ + S DK +++W ++ G  C
Sbjct: 254 ASKDGTIKIWDTSRRVCIYTLSGHTNSVSCVKWG-GQGLLYSGSHDKTVRVWDMNVGGKC 312

Query: 605 HKSLFAHQDSIMNV------------------KFLP---------ESYN----------- 626
              L +H   + ++                  KF           E+Y            
Sbjct: 313 INILKSHAHWVNHLSLSTEYALRVGPFDHTATKFTSAEEARKKALENYEKIAKRNGKAEE 372

Query: 627 -FFSCSKDATVKYWDGQKF-ECIQKLAAHQSEVWSISVSNDGTFVISTGHDHSIRVWE 682
              + S D T+  WD  K  + + +L  HQ  V  ++ S DG F++S   D+SI++W+
Sbjct: 373 LIVTASDDFTMFLWDPTKSGKPLARLTGHQKLVNHVAFSPDGRFIVSASFDNSIKLWD 430

 Score = 52.4 bits (124), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 40/143 (27%), Positives = 69/143 (48%), Gaps = 10/143 (6%)

Query: 583 KLIVTCSADKNIKIW-GLDFGDCHKSLFAHQDSIMNVKFLPESYNFFSCSKDATVKYWDG 641
           +LIVT S D  + +W     G     L  HQ  + +V F P+     S S D ++K WDG
Sbjct: 372 ELIVTASDDFTMFLWDPTKSGKPLARLTGHQKLVNHVAFSPDGRFIVSASFDNSIKLWDG 431

Query: 642 QKFECIQKLAAHQSEVWSISVSNDGTFVISTGHDHSIRVWEETEDQVFLEEEREKEMDEQ 701
           +    I     H + V+ ++ S+D   ++S   D +++VW+    ++ ++    K  DE 
Sbjct: 432 RNGTFISTFRGHVASVYQVAWSSDCRLLVSCSKDTTLKVWDVRTRKLSVDLPGHK--DEV 489

Query: 702 YEDTLLTSLEG-----GAGDEML 719
           Y  T+  S++G     G  D+M+
Sbjct: 490 Y--TVDWSVDGKRVCSGGKDKMV 510

 Score = 50.4 bits (119), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 49/212 (23%), Positives = 95/212 (44%), Gaps = 23/212 (10%)

Query: 486 VTGSADKTVRFWTFEVSEVPVSDESNKTMPMLQLFHDTTLELDDDILSVVISPDDKFI-- 543
           + GSAD+ V + TF  S VP   +++            T+++ D++ S ++ P  K    
Sbjct: 67  LNGSADEPVPY-TFSCS-VPGKRKNDPQQ---------TIDITDNLYSSLLKPGLKTTED 115

Query: 544 AVSLLDNTVKVFFLDSM-KFFLSLYGHKLPVLSMDIS-YDSKLIVTCSADKNIKIWGLDF 601
            ++L+     VF +  + +   ++ GH   +L    + + S  +VT + D   ++W  D 
Sbjct: 116 QITLIYTPRAVFKVKPITRSSSAIAGHGATILCSQFAPHTSSRMVTGAGDNTARVWDCDT 175

Query: 602 GDCHKSLFAHQDSIMNVKFLPESYNFFSCSKDATVKYWDGQKFECI-QKLAAHQ----SE 656
                +L  HQ+ ++ V + P+     + S D TV+ WD +  + +   L  HQ    S 
Sbjct: 176 QTPMATLSGHQNWVLCVAWSPDGETIATGSMDCTVRLWDSKAGQPLGDALKGHQKWITSL 235

Query: 657 VWS---ISVSNDGTFVISTGHDHSIRVWEETE 685
           VW    +    D   + S   D +I++W+ + 
Sbjct: 236 VWEPLHLVKPGDKPRLASASKDGTIKIWDTSR 267

 Score = 39.3 bits (90), Expect = 0.053,   Method: Compositional matrix adjust.
 Identities = 20/82 (24%), Positives = 39/82 (47%), Gaps = 1/82 (1%)

Query: 607 SLFAHQDSIMNVKFLPE-SYNFFSCSKDATVKYWDGQKFECIQKLAAHQSEVWSISVSND 665
           ++  H  +I+  +F P  S    + + D T + WD      +  L+ HQ+ V  ++ S D
Sbjct: 138 AIAGHGATILCSQFAPHTSSRMVTGAGDNTARVWDCDTQTPMATLSGHQNWVLCVAWSPD 197

Query: 666 GTFVISTGHDHSIRVWEETEDQ 687
           G  + +   D ++R+W+    Q
Sbjct: 198 GETIATGSMDCTVRLWDSKAGQ 219

>Suva_13.295 Chr13 complement(480518..480940,481217..481753) [960
           bp, 319 aa] {ON} YMR116C (REAL)
          Length = 319

 Score = 79.3 bits (194), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 42/153 (27%), Positives = 76/153 (49%), Gaps = 7/153 (4%)

Query: 536 ISPDDKFIAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSMDISYDSKLIVTCSADKNIK 595
           ++ D  +   +  D T++++ + + + +    GHK  V+S+DI   + +I++ S DK IK
Sbjct: 73  LTADGAYALSASWDKTLRLWDVATGETYQRFVGHKSDVMSVDIDKKASMIISGSRDKTIK 132

Query: 596 IWGLDFGDCHKSLFAHQDSIMNVKFLP------ESYNFFSCSKDATVKYWDGQKFECIQK 649
           +W +  G C  +L  H D +  V+ +P      +S    S   D  VK W+  +F+    
Sbjct: 133 VWTIK-GQCLATLLGHNDWVSQVRVVPNEKADDDSVTIISAGNDKMVKAWNLNQFQIEAD 191

Query: 650 LAAHQSEVWSISVSNDGTFVISTGHDHSIRVWE 682
              H S + +++ S DGT + S G D  I +W 
Sbjct: 192 FIGHNSNINTLTASPDGTLIASAGKDGEIMLWN 224

 Score = 67.4 bits (163), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 70/317 (22%), Positives = 136/317 (42%), Gaps = 29/317 (9%)

Query: 381 TIDLHGQRTDIRSTSISDDNKLLATASNGSLKIWNI-----KTKRCIRSFECGYALT--C 433
           T++ H       +TS    N LL+ + + +L  W +     K    +RSF+    +   C
Sbjct: 12  TLEGHNGWVTSLATSAGQPNLLLSASRDKTLISWKLTGDDQKFGVPVRSFKGHSHIVQDC 71

Query: 434 KFLPGGALVVVGTRNGELQLFDIASSTMLDNKEGAHDAAIWSLDLTSDGRKLVTGSADKT 493
                GA  +  + +  L+L+D+A+        G H + + S+D+      +++GS DKT
Sbjct: 72  TLTADGAYALSASWDKTLRLWDVATGETYQRFVG-HKSDVMSVDIDKKASMIISGSRDKT 130

Query: 494 VRFWTFEVSEVPVSDESNKTMPMLQLFHDTTLELDDDILSVVISPDDKFIAVSLLDNTVK 553
           ++ WT +   +      N  +  +++  +   + DDD ++++ + +DK          VK
Sbjct: 131 IKVWTIKGQCLATLLGHNDWVSQVRVVPNE--KADDDSVTIISAGNDKM---------VK 179

Query: 554 VFFLDSMKFFLSLYGHKLPVLSMDISYDSKLIVTCSADKNIKIWGLDFGDCHKSLFAHQD 613
            + L+  +      GH   + ++  S D  LI +   D  I +W L       +L A QD
Sbjct: 180 AWNLNQFQIEADFIGHNSNINTLTASPDGTLIASAGKDGEIMLWNLAAKKAMYTLSA-QD 238

Query: 614 SIMNVKFLPESYNFFSCSKDATVKYW--------DGQKFECIQKLAAHQSEVWSISVSND 665
            + ++ F P  Y + + +    +K +        D  + E      A +    S++ S D
Sbjct: 239 EVFSLAFSPNRY-WLAAATATGIKVFSLDPQYLVDDLRPEFAGYSKAAEPHAVSLAWSAD 297

Query: 666 GTFVISTGHDHSIRVWE 682
           G  + +   D+ IRVW+
Sbjct: 298 GQTLFAGYTDNVIRVWQ 314

 Score = 56.2 bits (134), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 42/174 (24%), Positives = 74/174 (42%), Gaps = 13/174 (7%)

Query: 558 DSMKFFL---SLYGHKLPVLSMDISYDSKLIVTCSADKNIKIWGLDFGDCHKSLFAHQDS 614
           D  KF +   S  GH   V    ++ D    ++ S DK +++W +  G+ ++    H+  
Sbjct: 50  DDQKFGVPVRSFKGHSHIVQDCTLTADGAYALSASWDKTLRLWDVATGETYQRFVGHKSD 109

Query: 615 IMNVKFLPESYNFFSCSKDATVKYWDGQKFECIQKLAAHQSEVWSISV------SNDGTF 668
           +M+V    ++    S S+D T+K W   K +C+  L  H   V  + V       +D   
Sbjct: 110 VMSVDIDKKASMIISGSRDKTIKVWT-IKGQCLATLLGHNDWVSQVRVVPNEKADDDSVT 168

Query: 669 VISTGHDHSIRVWEETEDQV---FLEEEREKEMDEQYEDTLLTSLEGGAGDEML 719
           +IS G+D  ++ W   + Q+   F+             D  L +  G  G+ ML
Sbjct: 169 IISAGNDKMVKAWNLNQFQIEADFIGHNSNINTLTASPDGTLIASAGKDGEIML 222

 Score = 53.9 bits (128), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 39/141 (27%), Positives = 63/141 (44%), Gaps = 10/141 (7%)

Query: 100 DGVIKIWDLISKTVLISFNGHKSAITVLAFDTTGTRLISASKDSDIIVWDLVGESGLYKL 159
           D  +++WD+ +      F GHKS +  +  D   + +IS S+D  I VW + G+  L  L
Sbjct: 86  DKTLRLWDVATGETYQRFVGHKSDVMSVDIDKKASMIISGSRDKTIKVWTIKGQC-LATL 144

Query: 160 RSHKDAITGLWC-------EDENWLISTSKDGLVKIWDLKSQQCVETHLAHTGECWSLGI 212
             H D ++ +         +D   +IS   D +VK W+L   Q     + H     +L  
Sbjct: 145 LGHNDWVSQVRVVPNEKADDDSVTIISAGNDKMVKAWNLNQFQIEADFIGHNSNINTLTA 204

Query: 213 IEDMAVTCSA--DSQVKLWKL 231
             D  +  SA  D ++ LW L
Sbjct: 205 SPDGTLIASAGKDGEIMLWNL 225

 Score = 52.4 bits (124), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 30/106 (28%), Positives = 55/106 (51%), Gaps = 2/106 (1%)

Query: 93  LLAAGYADGVIKIWDLISKTVLISFNGHKSAITVLAFDTTGTRLISASKDSDIIVWDLVG 152
           +++AG  D ++K W+L    +   F GH S I  L     GT + SA KD +I++W+L  
Sbjct: 169 IISAGN-DKMVKAWNLNQFQIEADFIGHNSNINTLTASPDGTLIASAGKDGEIMLWNLAA 227

Query: 153 ESGLYKLRSHKDAITGLWCEDENWLISTSKDGLVKIWDLKSQQCVE 198