Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
CAGL0M04235g8.321ON78378339910.0
YLR127C (APC2)8.321ON85382111041e-138
SAKL0H15598g8.321ON78778010881e-136
Suva_10.2208.321ON85482910901e-135
Skud_12.1968.321ON85483010841e-135
Smik_12.1908.321ON85082010801e-134
TDEL0F044708.321ON80979510541e-131
Kwal_56.239098.321ON7767719501e-116
KLTH0G12342g8.321ON7747629191e-111
TPHA0C008308.321ON8428389141e-110
TBLA0A039208.321ON7327078961e-108
NCAS0C032808.321ON8118048261e-97
KAFR0H022808.321ON8178427072e-80
ZYRO0F10340g8.321ON8184187062e-80
AGL193W8.321ON7096766582e-74
Ecym_42528.321ON6896756142e-68
NDAI0G026008.321ON9118865845e-63
KNAG0G024308.321ON7973615091e-53
KLLA0D16324g8.321ON6976944442e-45
Kpol_YGOB_Anc_8.3218.321ON5111322242e-18
NCAS0B080101.88ON1065117717.5
KLTH0C06864g7.384ON636103709.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0M04235g
         (783 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0M04235g Chr13 complement(464973..467324) [2352 bp, 783 aa] ...  1541   0.0  
YLR127C Chr12 complement(395758..398319) [2562 bp, 853 aa] {ON} ...   429   e-138
SAKL0H15598g Chr8 (1357656..1360019) [2364 bp, 787 aa] {ON} simi...   423   e-136
Suva_10.220 Chr10 complement(404296..406860) [2565 bp, 854 aa] {...   424   e-135
Skud_12.196 Chr12 complement(378532..381096) [2565 bp, 854 aa] {...   422   e-135
Smik_12.190 Chr12 complement(377110..379662) [2553 bp, 850 aa] {...   420   e-134
TDEL0F04470 Chr6 complement(837936..840365) [2430 bp, 809 aa] {O...   410   e-131
Kwal_56.23909 s56 complement(771248..773578) [2331 bp, 776 aa] {...   370   e-116
KLTH0G12342g Chr7 (1048457..1050781) [2325 bp, 774 aa] {ON} simi...   358   e-111
TPHA0C00830 Chr3 (163528..166056) [2529 bp, 842 aa] {ON} Anc_8.3...   356   e-110
TBLA0A03920 Chr1 complement(980348..982546) [2199 bp, 732 aa] {O...   349   e-108
NCAS0C03280 Chr3 (644169..646604) [2436 bp, 811 aa] {ON} Anc_8.3...   322   1e-97
KAFR0H02280 Chr8 (435246..437699) [2454 bp, 817 aa] {ON} Anc_8.3...   276   2e-80
ZYRO0F10340g Chr6 complement(837799..840255) [2457 bp, 818 aa] {...   276   2e-80
AGL193W Chr7 (334823..336952) [2130 bp, 709 aa] {ON} Syntenic ho...   258   2e-74
Ecym_4252 Chr4 complement(523632..525701) [2070 bp, 689 aa] {ON}...   241   2e-68
NDAI0G02600 Chr7 (595394..598129) [2736 bp, 911 aa] {ON} Anc_8.3...   229   5e-63
KNAG0G02430 Chr7 complement(553644..556037) [2394 bp, 797 aa] {O...   200   1e-53
KLLA0D16324g Chr4 complement(1373445..1375538) [2094 bp, 697 aa]...   175   2e-45
Kpol_YGOB_Anc_8.321 s1036 complement(185463..186998) [1536 bp, 5...    91   2e-18
NCAS0B08010 Chr2 complement(1517575..1520772) [3198 bp, 1065 aa]...    32   7.5  
KLTH0C06864g Chr3 (596687..598597) [1911 bp, 636 aa] {ON} weakly...    32   9.4  

>CAGL0M04235g Chr13 complement(464973..467324) [2352 bp, 783 aa]
           {ON} similar to uniprot|Q12440 Saccharomyces cerevisiae
           YLR127c APC2 component of the anaphase promoting complex
          Length = 783

 Score = 1541 bits (3991), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 754/783 (96%), Positives = 754/783 (96%)

Query: 1   MILTGDTKTFKRAVLEYGVNGNKNSNAEEWNVLLQWLDPAGKKNHQLKPPNLLVKTMIEK 60
           MILTGDTKTFKRAVLEYGVNGNKNSNAEEWNVLLQWLDPAGKKNHQLKPPNLLVKTMIEK
Sbjct: 1   MILTGDTKTFKRAVLEYGVNGNKNSNAEEWNVLLQWLDPAGKKNHQLKPPNLLVKTMIEK 60

Query: 61  LLLGSNDYQLLSNIQDYYCWQCRVYFYNEYKRIETLNELKRIERHVLFPLKYIPIFEGNN 120
           LLLGSNDYQLLSNIQDYYCWQCRVYFYNEYKRIETLNELKRIERHVLFPLKYIPIFEGNN
Sbjct: 61  LLLGSNDYQLLSNIQDYYCWQCRVYFYNEYKRIETLNELKRIERHVLFPLKYIPIFEGNN 120

Query: 121 RVENEVRLFGNYLLKTNKKVMSRAVERLRNRMLEDDFELATEIVDYFDYCQTDSTSIVLD 180
           RVENEVRLFGNYLLKTNKKVMSRAVERLRNRMLEDDFELATEIVDYFDYCQTDSTSIVLD
Sbjct: 121 RVENEVRLFGNYLLKTNKKVMSRAVERLRNRMLEDDFELATEIVDYFDYCQTDSTSIVLD 180

Query: 181 IILDKIEQFCQLHYTRKWNKRYLIMETFNQFISQYWDQLSSLLFCQEDNHTITNTLYKYF 240
           IILDKIEQFCQLHYTRKWNKRYLIMETFNQFISQYWDQLSSLLFCQEDNHTITNTLYKYF
Sbjct: 181 IILDKIEQFCQLHYTRKWNKRYLIMETFNQFISQYWDQLSSLLFCQEDNHTITNTLYKYF 240

Query: 241 EKQFISIRTNEIFDICISNPASVQPTLLELRKEISTVNDFNCVVVELLSKFNLKVINPSI 300
           EKQFISIRTNEIFDICISNPASVQPTLLELRKEISTVNDFNCVVVELLSKFNLKVINPSI
Sbjct: 241 EKQFISIRTNEIFDICISNPASVQPTLLELRKEISTVNDFNCVVVELLSKFNLKVINPSI 300

Query: 301 VTADALFLYIRTIKTFSILDPSGRYLQTISSYVKPHFRQRKDLVHLLLFSMLGLDETDQL 360
           VTADALFLYIRTIKTFSILDPSGRYLQTISSYVKPHFRQRKDLVHLLLFSMLGLDETDQL
Sbjct: 301 VTADALFLYIRTIKTFSILDPSGRYLQTISSYVKPHFRQRKDLVHLLLFSMLGLDETDQL 360

Query: 361 NTMPSQVSEEKLTALTNELKDTEICSYTEESDDVVDPMIGSFSKEEDSMVLEQVIKRYME 420
           NTMPSQVSEEKLTALTNELKDTEICSYTEESDDVVDPMIGSFSKEEDSMVLEQVIKRYME
Sbjct: 361 NTMPSQVSEEKLTALTNELKDTEICSYTEESDDVVDPMIGSFSKEEDSMVLEQVIKRYME 420

Query: 421 WIPEVPTSFGKGILSDHKXXXXXXXXXXXXSKETLVIEFKNLLTKKLLDLRGYTXXXXXX 480
           WIPEVPTSFGKGILSDHK            SKETLVIEFKNLLTKKLLDLRGYT      
Sbjct: 421 WIPEVPTSFGKGILSDHKLDLFDILLELLESKETLVIEFKNLLTKKLLDLRGYTLDKKWS 480

Query: 481 XXXXXXXXXXXNRSTETMDEEDLNNINTIDIMLRDIYKSRQIATDMQLDLHNTNVKVYPK 540
                      NRSTETMDEEDLNNINTIDIMLRDIYKSRQIATDMQLDLHNTNVKVYPK
Sbjct: 481 KFLSLLKKRFDNRSTETMDEEDLNNINTIDIMLRDIYKSRQIATDMQLDLHNTNVKVYPK 540

Query: 541 IVSALYWSNNSDTQSKAGDFEMDGELEHLLELYSRFYSQKQIGQKLELRRDNGSVSLNLS 600
           IVSALYWSNNSDTQSKAGDFEMDGELEHLLELYSRFYSQKQIGQKLELRRDNGSVSLNLS
Sbjct: 541 IVSALYWSNNSDTQSKAGDFEMDGELEHLLELYSRFYSQKQIGQKLELRRDNGSVSLNLS 600

Query: 601 FLDGRTVHCKASLRQYSVLTLFKSPKHDSNFPTEGLTISELCARSGMQSKQMADILRYWV 660
           FLDGRTVHCKASLRQYSVLTLFKSPKHDSNFPTEGLTISELCARSGMQSKQMADILRYWV
Sbjct: 601 FLDGRTVHCKASLRQYSVLTLFKSPKHDSNFPTEGLTISELCARSGMQSKQMADILRYWV 660

Query: 661 SKDVLYFSDGKYRTLEFLRWKGDSTYAAIPDVLEESVVERSSQHEDKQENHVERALPYIK 720
           SKDVLYFSDGKYRTLEFLRWKGDSTYAAIPDVLEESVVERSSQHEDKQENHVERALPYIK
Sbjct: 661 SKDVLYFSDGKYRTLEFLRWKGDSTYAAIPDVLEESVVERSSQHEDKQENHVERALPYIK 720

Query: 721 DILLNLGTLKIDKLHALLQSAMPKDSHYSTVNQKQLQDYLDTLVEEGVLSSASNDSYKLP 780
           DILLNLGTLKIDKLHALLQSAMPKDSHYSTVNQKQLQDYLDTLVEEGVLSSASNDSYKLP
Sbjct: 721 DILLNLGTLKIDKLHALLQSAMPKDSHYSTVNQKQLQDYLDTLVEEGVLSSASNDSYKLP 780

Query: 781 QIR 783
           QIR
Sbjct: 781 QIR 783

>YLR127C Chr12 complement(395758..398319) [2562 bp, 853 aa] {ON}
           APC2Subunit of the Anaphase-Promoting Complex/Cyclosome
           (APC/C), which is a ubiquitin-protein ligase required
           for degradation of anaphase inhibitors, including
           mitotic cyclins, during the metaphase/anaphase
           transition; component of the catalytic core of the
           APC/C; has similarity to cullin Cdc53p
          Length = 853

 Score =  429 bits (1104), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 271/821 (33%), Positives = 431/821 (52%), Gaps = 74/821 (9%)

Query: 27  AEEWNVLLQWLDPA-GKKNHQLKPPNLLVKTMIEKLLLGSN------------------- 66
            ++ N LL W+ P   K NHQL+PP+L +K +I K+L  +N                   
Sbjct: 31  VDDLNSLLTWMSPNDAKSNHQLRPPSLRIKNII-KVLFPNNATTSPYSMINTSQANNSIV 89

Query: 67  ---------DYQLLSNIQDYYCWQCRVYFYNEYKRIETLNELKRIERHVLFPLKYIPIFE 117
                      QL S ++++Y +Q R +F+  +  I  L +++R E +  FPL+Y+PIF+
Sbjct: 90  NEGNTNKELQLQLFSTLKEFYIFQVRYHFFLHFNNINYLKDIQRWENYYEFPLRYVPIFD 149

Query: 118 GN-NRVENEVRLFGNYLLKTNKKVMSRAVERLRNRMLEDDFELATEIVDYFDYCQT--DS 174
            N N    E+    +YLL  N K  +    RL   +++DDF+LA  ++ +         S
Sbjct: 150 VNVNDWALELNSLRHYLLNRNIKFKNNLRTRLDKLIMDDDFDLADNLIQWLKSANGSLSS 209

Query: 175 TSIVLDIILDKIEQFCQLHYTRKWNKRYLIMETFNQFISQYWDQLSSLLFCQEDNHTITN 234
           T ++++ +  KI +FC+ + +R WNKR++IMETFN+FI+QYW Q S L+ C ED+H +T 
Sbjct: 210 TELIVNALYSKINKFCEDNMSRVWNKRFMIMETFNKFINQYWSQFSKLVGCPEDDHELTT 269

Query: 235 TLYKYFEKQFISIRTNEIFDICISNPASVQPTLLELRKEISTVNDFNCVVVELLSKFNLK 294
           T++  FE  F+ IRTNEIFDIC+      + TLLELRK +    D+  +V   LS F   
Sbjct: 270 TVFNCFESNFLRIRTNEIFDICVLAYPDSKVTLLELRKIMKDFKDYTNIVTTFLSDFKKY 329

Query: 295 VINPSIVTADALFLYIRTIKTFSILDPSGRYLQTISSYVKPHFRQRKDLVHLLLFSMLGL 354
           ++NPS+ T DAL  Y++TIK F +LDP+GR L +I+++VKP+F++RK LV++LL++ML L
Sbjct: 330 ILNPSVTTVDALLRYVKTIKAFLVLDPTGRCLHSITTFVKPYFQERKHLVNVLLYAMLDL 389

Query: 355 DETDQLNTMPSQVSEEKLTALTNELKDTEI---CSYTEESDDVVDPMIGSF---SKEE-- 406
            E +    +   V  + L +L + L D++I    + T+   +   P + +     K E  
Sbjct: 390 PEEELKEKINFNVDMKALLSLVDTLHDSDINQDTNITKRDKNKKSPFLWNLKVKGKRELN 449

Query: 407 ------DSMVLEQVIKRYMEWIPEVPTSFGKGILSDH-KXXXXXXXXXXXXSKETLVIEF 459
                  +M+ E ++  Y+ W+PE        I S + K            S+E  + EF
Sbjct: 450 KDLPIRHAMLYEHILNYYIAWVPEPNDMIPGNIKSSYIKTNLFEVLLDLFESREFFISEF 509

Query: 460 KNLLTKKLLDLRGYTXXXXXXXXXXXXXXXXXN------------------RSTETMDEE 501
           +NLLT +L  L+ YT                                     +T    + 
Sbjct: 510 RNLLTDRLFTLKFYTLDEKWTRCLKLIREKIVKFTETSHSNYITNGILGLLETTAPAADA 569

Query: 502 DLNNINTIDIMLRDIYKSRQIATDMQLDLHNTNVKVYPKIVSALYWSNNSDTQ-SKAGDF 560
           D +N+N+ID+ML DI  S ++   M  ++   +  ++PK +S LYW  N DTQ S    F
Sbjct: 570 DQSNLNSIDVMLWDIKCSEELCRKMH-EVAGLDPIIFPKFISLLYWKYNCDTQGSNDLAF 628

Query: 561 EMDGELEHLLELYSRFYSQKQIGQKLELRRDNGSVSLNLSFLDGRTVHCKASLRQYSVLT 620
            +  +LE  L+ YS  YSQ + G+KL+L +D G V + L+F DGR +    SL Q SV+ 
Sbjct: 629 HLPIDLERELQKYSDIYSQLKPGRKLQLCKDKGKVEIQLAFKDGRKLVLDVSLEQCSVIN 688

Query: 621 LFKSPKHDSNFPTEGLTISELCARSGMQSKQMADILRYWVSKDVLYFSDGKYRTLEFLRW 680
            F SP  +   P   L++ +L     +   ++  +L +W+ K VL   +G Y  +E    
Sbjct: 689 QFDSPNDE---PI-CLSLEQLSESLNIAPPRLTHLLDFWIQKGVLLKENGTYSVIEHSEM 744

Query: 681 KGDSTYAAIPDVLEESVVE--RSSQHEDKQENHVERALPYIKDILLNLGTLKIDKLHALL 738
             D      P  +E S  E    S+ E K E  ++R+LP+I+ +L NLG +K+ K+H+ L
Sbjct: 745 DFDQAQKTAPMEIENSNYELHNDSEIERKYELTLQRSLPFIEGMLTNLGAMKLHKIHSFL 804

Query: 739 QSAMPKDSHYSTVNQKQLQDYLDTLVEEGVLSSASNDSYKL 779
           +  +PKD  Y+ +  +QL+ YL+TL +EG L   +N SY++
Sbjct: 805 KITVPKDWGYNRITLQQLEGYLNTLADEGRLKYIANGSYEI 845

>SAKL0H15598g Chr8 (1357656..1360019) [2364 bp, 787 aa] {ON} similar
           to uniprot|Q7LGV7 Saccharomyces cerevisiae YLR127C
          Length = 787

 Score =  423 bits (1088), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 259/780 (33%), Positives = 439/780 (56%), Gaps = 40/780 (5%)

Query: 24  NSNAE-EWNVLLQWLDP-AGKKNHQLKPPNLLVKTMIEKLLLGSNDYQ--LLSNIQDYYC 79
           N N E E + +L WL+P     NHQL+PP+L +K  I KL++ + D     +  ++ +  
Sbjct: 22  NPNLEDELDGVLTWLNPNEPNSNHQLRPPSLRLKNGI-KLVVNNEDVPPGFVHLLRQFVL 80

Query: 80  WQCRVYFYNEYKRIETLNELKRIERHVLFPLKYIPIFEGNNRVENEVRLFGNYLLKTNKK 139
            Q R++F++ +  I +  +++R+E++  FPLKYI IF  +     E+  F +YL+  N+ 
Sbjct: 81  LQTRIHFFSNFNSITSFKDIQRLEKYYEFPLKYINIFTPDEWF-IEMNGFRHYLMSKNRI 139

Query: 140 VMSRAVERLRNRMLEDDFELATEIVDYFDYCQTDS-TSIVLDIILDKIEQFCQLHYTRKW 198
                  R+R  ++EDDF++A +I  +          S++L+I++DKI  F + +   KW
Sbjct: 140 FGDNIKHRVRQLIMEDDFDMAWKIYTWLTETMGHQLVSLLLEILMDKIADFSKQNMMGKW 199

Query: 199 NKRYLIMETFNQFISQYWDQLSSLLFCQEDNHTITNTLYKYFEKQFISIRTNEIFDICIS 258
            +R+L+METFN FI++YW   +  L C ED+H IT  ++  FEK+F+ IRT+EI++IC+ 
Sbjct: 200 TQRFLVMETFNTFITKYWSTFAQALRCPEDDHEITTEIFHCFEKEFVKIRTSEIYEICVL 259

Query: 259 NPASVQPTLLELRKEISTVNDFNCVVVELLSKFNLKVINPSIVTADALFLYIRTIKTFSI 318
                +P LLELR  + T  D++ +++E LSKF  K++NPS+ T + L  YIRTIK+F  
Sbjct: 260 EYPHSKPALLELRNVMKTSADYSKLMIEFLSKFESKLMNPSVTTTEILLSYIRTIKSFLT 319

Query: 319 LDPSGRYLQTISSYVKPHFRQRKDLVHLLLFSMLGLDETDQLNTMPSQVSEEKLTALTNE 378
           +DP+GRYLQ++++Y+KP+ R+R+D V  LL++ML LDE+ +++     ++   LT L+ E
Sbjct: 320 VDPAGRYLQSVTAYIKPYLRERRDTVVHLLYAMLELDES-EIDDANVSLNMPILTELSKE 378

Query: 379 LKDTEICSYTEESDDVVDPMIGSFSK---EEDSMVLEQVIKRYMEWIPEVPTSFGKGILS 435
           LKD +      +S    + ++ + S    + +  + EQV+  +++W PE P+       +
Sbjct: 379 LKDPDFGIEDADSKSRKNKLMVTDSSPVFKVEKPLCEQVLNYFLQWTPE-PSDVAHRKPN 437

Query: 436 DH--KXXXXXXXXXXXXSKETLVIEFKNLLTKKLLDLRGYTXXXXXXXXXXXXXXXXXNR 493
           +                SK+  + EF +L TKKLL L+ Y                  + 
Sbjct: 438 NTFVNKSLLDILLDIFDSKDVFISEFLSLFTKKLLGLKYYKLETKWIKILRLLKKKFGHT 497

Query: 494 STETMDEEDLNNINTIDIMLRDIYKSRQIATDMQLDLHNTNVKVYPKIVSALYWSNNSDT 553
           S      +D +NIN IDIMLRD+  S ++ + M  ++   + +V+PK +S L+W  NS  
Sbjct: 498 SFPQHQFQDTSNINNIDIMLRDVKTSYELISKMH-EVAGLDDRVFPKFISYLFW--NSAL 554

Query: 554 QSKAGDFEMDGELEHLLELYSRFYSQKQIGQKLELRRDNGSVSLNLSFLDGRTVHCKASL 613
           +++  DF++ G LE  +E YS  YSQ + G++L L +D G+V L+L F DGR + C+  L
Sbjct: 555 EAETSDFQLPGWLETEIEKYSEVYSQLKPGRRLHLYKDQGTVELDLEFKDGRKISCEVPL 614

Query: 614 RQYSVLTLFKSPKHDSNFPTEGLTISELCARSGMQSKQMADILRYWVSKDVLYFSD--GK 671
            + +V++ F     D +   +GL + ++     M+   +  IL++W  K+ +Y+ D    
Sbjct: 615 NKAAVISCF-----DQDTALKGLAVEQIVDNVKMEKALVTSILQFWCKKNAIYYDDRYNT 669

Query: 672 YRTLEFLRWKGDSTYAAIPDVLEESVVERSSQHEDKQEN-----------HVERALPYIK 720
           YR LE+  ++ +S  +A   +  +          D Q+N            + +  P+I+
Sbjct: 670 YRVLEY--YEPNSALSASTVISSKGNTNGGINPMDDQDNAGDKQQQEFIQSMSKIWPFIQ 727

Query: 721 DILLNLGTLKIDKLHALLQSAMPKDSHY-STVNQKQLQDYLDTLVEEGVLSSASNDSYKL 779
            +L NLG++K +K+H+ L+ A+PKD  Y +TVN  QL+ YL+ LV+E  L++  N SYKL
Sbjct: 728 GMLTNLGSMKPEKIHSFLKMAVPKDIGYTATVN--QLESYLNVLVDEDKLAAVPNGSYKL 785

>Suva_10.220 Chr10 complement(404296..406860) [2565 bp, 854 aa] {ON}
           YLR127C (REAL)
          Length = 854

 Score =  424 bits (1090), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 270/829 (32%), Positives = 432/829 (52%), Gaps = 89/829 (10%)

Query: 27  AEEWNVLLQWLDPAG-KKNHQLKPPNLLVKTMIEKLLLGSN------------------- 66
            ++ N LL W+ P   K NHQL+PP+L +K +I+ L   +                    
Sbjct: 31  TDDLNSLLIWMSPDDPKSNHQLRPPSLRIKNIIKNLFPNNACTSSYGAMNTAQANNSIVN 90

Query: 67  --------DYQLLSNIQDYYCWQCRVYFYNEYKRIETLNELKRIERHVLFPLKYIPIFEG 118
                     Q +S  ++YY +Q R +F+  +  I  L +++R E +  FPL+Y+ IF+ 
Sbjct: 91  EGNTNKELQLQFISTFKEYYIFQVRYHFFLHFSSINYLKDIQRWENYYEFPLRYVSIFDL 150

Query: 119 N-NRVENEVRLFGNYLLKTNKKVMSRAVERLRNRMLEDDFELATEIVDYFDYCQTD--ST 175
           N N    E+    +YLL  N K  +    RL   +++DDF+LA+ ++ + +       S 
Sbjct: 151 NVNGWTLELNSLRHYLLNRNTKFKNNLRTRLNKLIIDDDFDLASNLIRWLNSANGSLSSM 210

Query: 176 SIVLDIILDKIEQFCQLHYTRKWNKRYLIMETFNQFISQYWDQLSSLLFCQEDNHTITNT 235
            ++++ + DKI  FC+++ +  WNKR++IMETFN+FI+QYW Q S L+ C ED+H +T T
Sbjct: 211 DLIVNALFDKISMFCEINMSGVWNKRFMIMETFNKFINQYWSQFSELIGCPEDDHELTTT 270

Query: 236 LYKYFEKQFISIRTNEIFDICISNPASVQPTLLELRKEISTVNDFNCVVVELLSKFNLKV 295
           ++  FE  F+ IRT EIFDIC+      + TLLEL+K +    D+  +V   LS F   +
Sbjct: 271 VFNCFESNFLRIRTKEIFDICVLAYPGSKITLLELKKIMKDFKDYTNIVTTFLSDFKKHI 330

Query: 296 INPSIVTADALFLYIRTIKTFSILDPSGRYLQTISSYVKPHFRQRKDLVHLLLFSMLGLD 355
           +NPSI T DAL  Y++TIK F +LDP+GR L +I+++VKP+F++RK LV++LL+++L L 
Sbjct: 331 LNPSITTVDALLSYVKTIKAFLVLDPTGRCLHSITTFVKPYFQERKHLVNVLLYAILDLP 390

Query: 356 ETDQLNTMPSQVSEEKLTALTNELKDTEICSYTEESDDVVDPMIGSFS--------KEED 407
           E +    +  +V  + L  L   L D++I   T           GSF         KE++
Sbjct: 391 EEELKEKISFKVDMKALLLLVETLHDSDIDQITNTPKSKDKNKGGSFPWNLHVKGKKEKN 450

Query: 408 -------SMVLEQVIKRYMEWIPEVPTSFGKGIL--SDHKXXXXXXXXXXXXSKETLVIE 458
                  SM+ E ++  Y+ W+PE P     G +  S  K            S+E  + E
Sbjct: 451 GSSSITQSMLYEHILNYYLTWVPE-PNDMIPGNIKSSSIKTNLFEVLLDLFESREFFISE 509

Query: 459 FKNLLTKKLLDLRGYTXXXXXXXXXXXXXXXXXNRSTET-------------------MD 499
           F+NLLT +L  L+ Y                   +STET                     
Sbjct: 510 FRNLLTDRLFTLKFYKLDNKWSRCLKLIREKIV-KSTETNQTNYIANGIIGLPQTTAPAA 568

Query: 500 EEDLNNINTIDIMLRDIYKSRQIATDMQLDLHNTNVKVYPKIVSALYWSNNSDT-QSKAG 558
           + DL+NIN+ID+ML DI  S ++   M  ++   +  +YPK +S LYW +N DT  +   
Sbjct: 569 DADLSNINSIDVMLWDIKCSEELCLKMH-EVAGLDPAIYPKFISLLYWKHNGDTNNANEL 627

Query: 559 DFEMDGELEHLLELYSRFYSQKQIGQKLELRRDNGSVSLNLSFLDGRTVHCKASLRQYSV 618
            F + G LE+ L+ YS  YSQ + G+KL+L +D G + + L F DGR +    SL Q SV
Sbjct: 628 TFHLPGNLENELQKYSDIYSQLKPGRKLQLCKDQGKIEMELDFNDGRKLVLDVSLEQCSV 687

Query: 619 LTLFKSPKHDSNFPTEGLTISELCARSGMQSKQMADILRYWVSKDVLYFSDGKYRTLEFL 678
           +  F S   +  +    L++ +L     +   ++ D+L +W+ + VL   +G Y  +E+ 
Sbjct: 688 INQFNSTDGEPIY----LSLEQLSEPLNIAPARLLDLLNFWIQRGVLSEENGVYSVIEYS 743

Query: 679 RWKGDSTYAAIP--------DVLEESVVERSSQHEDKQENHVERALPYIKDILLNLGTLK 730
           R   + T    P        ++ +E+ VER      K E  +ER+LP+I+ +L NLG +K
Sbjct: 744 RTDFNQTQIEFPMKNENNNNELRDETEVER------KCELILERSLPFIEGMLANLGAMK 797

Query: 731 IDKLHALLQSAMPKDSHYSTVNQKQLQDYLDTLVEEGVLSSASNDSYKL 779
           ++K+H+ L+  +PK+  Y+ +   QL+ YL+ L +EG L   +N SY+L
Sbjct: 798 LNKIHSFLKITVPKNWGYNRITLLQLEKYLNVLADEGKLKYITNGSYEL 846

>Skud_12.196 Chr12 complement(378532..381096) [2565 bp, 854 aa] {ON}
           YLR127C (REAL)
          Length = 854

 Score =  422 bits (1084), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 268/830 (32%), Positives = 440/830 (53%), Gaps = 87/830 (10%)

Query: 27  AEEWNVLLQWLDPAG-KKNHQLKPPNLLVKTMIEKLL---LGSNDY-------------- 68
           A++ N LL W+ P   K NHQL+PP+L +K +I+ L    + ++ Y              
Sbjct: 31  ADDLNSLLIWMSPNDPKSNHQLRPPSLRIKNIIKVLFPNNVSTSSYGVINSGQTINAVAG 90

Query: 69  ----------QLLSNIQDYYCWQCRVYFYNEYKRIETLNELKRIERHVLFPLKYIPIFE- 117
                     QLLS +++YY +Q R +F+  +  I  L +++R E +  FPL+Y+PIF+ 
Sbjct: 91  EGNTNKELQLQLLSTLKEYYVFQVRYHFFLRFNDIIYLKDIQRWENYYEFPLRYVPIFDL 150

Query: 118 GNNRVENEVRLFGNYLLKTNKKVMSRAVERLRNRMLEDDFELATEIVDYFDYCQT--DST 175
             N    E+    +Y+L  N K  +    RL   +++DDF+LA  ++ + ++      S 
Sbjct: 151 SVNDWSLELNSLRHYMLNRNIKFKNNLRVRLNKLIMDDDFDLAGNLIRWLNFANGSLSSM 210

Query: 176 SIVLDIILDKIEQFCQLHYTRKWNKRYLIMETFNQFISQYWDQLSSLLFCQEDNHTITNT 235
            ++++ + +KIE+FC+ + +  WNKR++IMETFN+FI+QYW Q   L+ C ED+H +T T
Sbjct: 211 ELIVNALFNKIEKFCEANMSGVWNKRFMIMETFNKFINQYWSQFCELICCPEDDHELTTT 270

Query: 236 LYKYFEKQFISIRTNEIFDICISNPASVQPTLLELRKEISTVNDFNCVVVELLSKFNLKV 295
           ++  FE  F+ IRT EIFDIC+      +  LLEL+K +    D+  +V + LS F   +
Sbjct: 271 VFNCFESNFLRIRTREIFDICVLAYPDSKVALLELKKIMKDFKDYTNIVTKFLSDFKKYI 330

Query: 296 INPSIVTADALFLYIRTIKTFSILDPSGRYLQTISSYVKPHFRQRKDLVHLLLFSMLGLD 355
           +NPSI T DAL  Y++TIK F +LDP+GR L +I ++VKP+F++RK LV++LL++ML L 
Sbjct: 331 LNPSITTVDALLRYVKTIKAFLVLDPTGRCLHSIITFVKPYFQERKHLVNVLLYAMLDLP 390

Query: 356 ETDQLNTMPSQVSEEKLTALTNELKDTEICSYTE----ESDDVVDPMI------GSFSKE 405
           E +    +  +V  + L +L + L D +I   T+    +  +   P +      G     
Sbjct: 391 EEELKEKITFKVDMKALLSLVDILHDYDIGQNTDAHKSKDKNKRSPFLWNLKVKGKKETN 450

Query: 406 ED-----SMVLEQVIKRYMEWIPE----VPTSFGKGILSDHKXXXXXXXXXXXXSKETLV 456
           ED     +M+ E V+  Y+ W+PE    +P S     +   K            S+E  +
Sbjct: 451 EDPLARQTMLYEHVLNHYLTWVPEPNDIIPGSVKSSYI---KTNLFEILLDLFESREFFI 507

Query: 457 IEFKNLLTKKLLDLRGYTX------------------XXXXXXXXXXXXXXXXNRSTETM 498
            EF+NLLT +L  L+ Y                                      +T   
Sbjct: 508 SEFRNLLTDRLSSLKFYKLDDKWSQCLKLIRERIVKFTETNHANYITNGILGLPETTAPA 567

Query: 499 DEEDLNNINTIDIMLRDIYKSRQIATDMQLDLHNTNVKVYPKIVSALYWSNNSDTQS-KA 557
            + D +N+N+ID+ML DI  S ++   M  ++   +  V+PK +S LYW +N DTQ+ K 
Sbjct: 568 ADADQSNLNSIDVMLWDIKCSEELCRKMH-EVAGLDPTVFPKFISLLYWKHNGDTQNPKD 626

Query: 558 GDFEMDGELEHLLELYSRFYSQKQIGQKLELRRDNGSVSLNLSFLDGRTVHCKASLRQYS 617
             F +  +LE  L+ YS  YSQ + G++L+L +D G V + LSF DGR +    SL QYS
Sbjct: 627 SKFRIPADLERELQKYSDIYSQMKPGRRLQLCKDQGKVEMELSFRDGRKLVLDVSLEQYS 686

Query: 618 VLTLFKSPKHDSNFPTEGLTISELCARSGMQSKQMADILRYWVSKDVLYFSDGKYRTLEF 677
           V+  F S    +N     L++ +L     + + ++  +L +W+ K VL      Y  +E+
Sbjct: 687 VMNQFNS----TNDEPINLSLKQLSESLNITTSKLLQLLNFWIQKGVLSEEGEVYSVIEY 742

Query: 678 LRWKGDSTYAAI-PDVLEESV-----VERSSQHEDKQENHVERALPYIKDILLNLGTLKI 731
                D+ ++    DVL ++V     +   S+ E K E  ++R+LP+I+ +L NLG +K+
Sbjct: 743 ----SDTGFSQTQKDVLMKNVNNNNELRDESEVEKKCELTLQRSLPFIEGMLANLGAMKL 798

Query: 732 DKLHALLQSAMPKDSHYSTVNQKQLQDYLDTLVEEGVLSSASNDSYKLPQ 781
           +K+H+ L+  +PKD  Y+ +   QL+ YL+TL +EG L   +N SY++ +
Sbjct: 799 NKIHSFLKITVPKDWGYNRITLLQLEKYLNTLTDEGKLKYIANGSYEIAK 848

>Smik_12.190 Chr12 complement(377110..379662) [2553 bp, 850 aa] {ON}
           YLR127C (REAL)
          Length = 850

 Score =  420 bits (1080), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 263/820 (32%), Positives = 429/820 (52%), Gaps = 75/820 (9%)

Query: 27  AEEWNVLLQWLDPAG-KKNHQLKPPNLLVKTMIEKLLLGSND------------------ 67
           A++ N LL W  P   K NHQL+PP+L +K +I+ L   S                    
Sbjct: 31  ADDLNSLLIWTSPNDPKSNHQLRPPSLRIKNIIKVLFPNSASTSPYSVVNTGQTSNSIVN 90

Query: 68  ---------YQLLSNIQDYYCWQCRVYFYNEYKRIETLNELKRIERHVLFPLKYIPIFEG 118
                     QLLS +++YY +Q R +F++ ++ I  L +++R E +  FPL+Y+PIF+ 
Sbjct: 91  EGNTNKELQLQLLSTLKEYYIFQVRYHFFSHFENINYLKDIQRWENYYEFPLRYVPIFDL 150

Query: 119 N-NRVENEVRLFGNYLLKTNKKVMSRAVERLRNRMLEDDFELATEIVDYFDYC--QTDST 175
           + N    E+    +YLL  N K  +    RL   +++DDF+LA  ++ + +       S 
Sbjct: 151 DINGWSLELNSLRHYLLNRNMKFKNNLRTRLDKLIMDDDFDLADNLIQWLNSADGSLSSM 210

Query: 176 SIVLDIILDKIEQFCQLHYTRKWNKRYLIMETFNQFISQYWDQLSSLLFCQEDNHTITNT 235
            ++++ + +KI +FC+   +  WNKR++IMETFN+FI+QYW Q S L+ C ED+H +T T
Sbjct: 211 ELIVNALFNKINKFCEDTMSGVWNKRFMIMETFNKFINQYWSQFSKLIGCPEDDHELTTT 270

Query: 236 LYKYFEKQFISIRTNEIFDICISNPASVQPTLLELRKEISTVNDFNCVVVELLSKFNLKV 295
           ++  FE  F+ IRT EIFDIC+    + + TLLEL+K +    D+  +V   LS F   +
Sbjct: 271 VFNCFESNFLRIRTKEIFDICVLAYPNSKVTLLELKKIMKDFKDYANIVTTFLSDFKKYI 330

Query: 296 INPSIVTADALFLYIRTIKTFSILDPSGRYLQTISSYVKPHFRQRKDLVHLLLFSMLGLD 355
           +NPSI T DAL  Y++TIK F +LDP+GR L +I+++VKP+F++RK LV LLL++ML L 
Sbjct: 331 LNPSITTVDALLRYVKTIKAFLVLDPTGRCLHSITTFVKPYFQERKHLVDLLLYAMLDLP 390

Query: 356 ETDQLNTMPSQVSEEKLTALTNELKDTEICSYT---EESDDVVDPMIGSF--------SK 404
           E +    +  +V  + L +L + L D++I  +T   + + +   P + +         S 
Sbjct: 391 EEELKEKITFKVDIKALISLVDTLHDSDISQFTNVMKRNKNKKGPFLWNLKVKGKNGPSP 450

Query: 405 EEDSMVLEQVIKRYMEWIPE----VPTSFGKGILSDHKXXXXXXXXXXXXSKETLVIEFK 460
              +M+ + ++  Y+ W+PE    +P S     +   K            S+E  + EF+
Sbjct: 451 TSQTMIYQHILNYYLTWVPEPNDMIPGSVKSSCI---KTNLFEVLLDLFESREFFISEFR 507

Query: 461 NLLTKKLLDLRGYTXXXXXXXXXXXXXXXXXN------------------RSTETMDEED 502
           NLLT +L  L+ Y                                      +T    + D
Sbjct: 508 NLLTDRLFTLKFYKLDDKWTQCLKLIREKVVKFRETSHVNYITNGILGLPETTAPSADAD 567

Query: 503 LNNINTIDIMLRDIYKSRQIATDMQLDLHNTNVKVYPKIVSALYWSNNSDTQSKAG-DFE 561
            +N+N+ID+ML DI  S ++   M  ++   +  ++PK +S LYW  N D QS     F 
Sbjct: 568 QSNLNSIDVMLWDIKCSEELCRKMH-EVAGLDPAIFPKFISLLYWKYNCDMQSSNELTFH 626

Query: 562 MDGELEHLLELYSRFYSQKQIGQKLELRRDNGSVSLNLSFLDGRTVHCKASLRQYSVLTL 621
           +   L+  L+ YS  YSQ + G+KL+L +D G V + L+F DGR +    SL Q SV+  
Sbjct: 627 LPIHLKKELQKYSDVYSQLKPGRKLQLCKDQGKVEIELNFKDGRKLVLDVSLEQCSVINQ 686

Query: 622 FKSPKHDSNFPTEGLTISELCARSGMQSKQMADILRYWVSKDVLYFSDGKYRTLEFLRWK 681
           F S  + S      LT+ +L     +   ++  +L +W+ K V+   +G Y  +E     
Sbjct: 687 FDSTDNKS----ISLTLEQLSDSLNITPPRLVHLLDFWIQKGVISKENGVYSVIENCETD 742

Query: 682 GDSTYAAIPDVLEES--VVERSSQHEDKQENHVERALPYIKDILLNLGTLKIDKLHALLQ 739
            D  +  IP   E +   +   S+ E K E  ++R+LP+I+ +L NLG +K++K+H+ L+
Sbjct: 743 FDKVHKDIPMETENNNRGLRNESEAERKCELTLQRSLPFIEGMLANLGAMKLNKIHSFLK 802

Query: 740 SAMPKDSHYSTVNQKQLQDYLDTLVEEGVLSSASNDSYKL 779
             +PKD  Y+ V+ +QL+ YL  L +EG L   +N SY++
Sbjct: 803 ITVPKDWGYNRVSLQQLEQYLSALADEGRLKYIANGSYEI 842

>TDEL0F04470 Chr6 complement(837936..840365) [2430 bp, 809 aa] {ON}
           Anc_8.321 YLR127C
          Length = 809

 Score =  410 bits (1054), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 262/795 (32%), Positives = 424/795 (53%), Gaps = 62/795 (7%)

Query: 32  VLLQWLDP-AGKKNHQLKPPNLLVKTMIEKLLL----------GSN-------DYQLLSN 73
            LL WL+P   + NH ++PP L +K  I KL +          GS+       +++L + 
Sbjct: 33  ALLTWLNPNESESNHHMRPPPLRLKDAI-KLFVNQYYNSGYISGSDGEINKGPEFELGNQ 91

Query: 74  IQDYYCWQCRVYFYNEYKRIETLNELKRIERHVLFPLKYIPIFEGNNR---VENEVRLFG 130
           ++ +Y +Q R++F+  +  I+T  +++R+E++ + PL YI +FE +     +E +     
Sbjct: 92  LRQFYIYQVRIHFFTSFNLIQTFKDIQRLEKYYVSPLAYIHLFESSGYEWIIERDG--LR 149

Query: 131 NYLLKTNKKVMSRAVERLRNRMLEDDFELATEIVDYFDYCQTDSTS--IVLDIILDKIEQ 188
           +YLL  N +  +   +R+ +  ++DDFE   E++D+ +   T  +S  I+LD+I+ K++Q
Sbjct: 150 HYLLNRNMEFHNNMKQRMESLFMQDDFEYVAEMLDWVEKAHTSLSSKDILLDLIIAKVKQ 209

Query: 189 FCQLHYTRKWNKRYLIMETFNQFISQYWDQLSSLLFCQEDNHTITNTLYKYFEKQFISIR 248
           FC  H    + K YL+M+TFN+FI +YW   + LL C +D+H +TN +Y  FEKQFI IR
Sbjct: 210 FCDDHMMGVYGKTYLVMKTFNKFIIKYWSNFAQLLGCPQDDHGLTNVVYTCFEKQFIRIR 269

Query: 249 TNEIFDICISNPASVQPTLLELRKEISTVNDFNCVVVELLSKFNLKVINPSIVTADALFL 308
           T E+FDI ++   + +PT++E+RK I+   DF  +V+  LS F  KV+NPS+ T DAL  
Sbjct: 270 TQEVFDIFVNEFPNSKPTIIEMRKLITHSTDFKTIVIAFLSTFEKKVLNPSVTTTDALLA 329

Query: 309 YIRTIKTFSILDPSGRYLQTISSYVKPHFRQRKDLVHLLLFSMLGLDETDQLNTMPSQVS 368
           Y++++K F  LDPSGRYLQ++ S+VK  F++R DLV +LL+++L L + D L     QV 
Sbjct: 330 YVKSVKAFLTLDPSGRYLQSVISFVKQTFQERSDLVVILLYAILDL-QLDGLVGSHIQVD 388

Query: 369 EEKLTALTNELKDTEICSYTE-ESDDVVDPMIGSFSK--EEDSMVLEQVIKRYMEWIPE- 424
              L AL +EL+D E+    +   DD +  +    +K   E  +  E+V++R++ W P+ 
Sbjct: 389 PVCLKALASELRDPELGIENDIYPDDNLANVATGMAKLNYEGCLPYEEVMQRFLSWNPDP 448

Query: 425 ---VPTSFGKGILSDHKXXXXXXXXXXXXSKETLVIEFKNLLTKKLLDLRGYT------- 474
               P +  K   S               SK+  V EF  LLTK+LL L+ Y        
Sbjct: 449 RDMAPRAISKQ--SPSHMSLLDILMELFESKDFFVSEFLKLLTKRLLSLKFYNLDRNWSK 506

Query: 475 ----XXXXXXXXXXXXXXXXXNRSTETMDEEDLNNINTIDIMLRDIYKSRQIATDMQLDL 530
                                 +   +   +D +NIN+ D+ML D+  S ++   M   +
Sbjct: 507 CLQLLKKKLARGAPNISLAPTGQQNNSERGDDYSNINSNDVMLWDVKLSYELCKQMH-QV 565

Query: 531 HNTNVKVYPKIVSALYWSNNSDTQSKAGDFEMDGELEHLLELYSRFYSQKQIGQKLELRR 590
              + ++YPK +S LYW  N   +SK  DFE+   L    E YSR YS+ + G+ L+L +
Sbjct: 566 SGLDQRIYPKFISYLYW--NCQLESK-NDFEIPEPLNSEFEKYSRVYSEVKAGRALKLLK 622

Query: 591 DNGSVSLNLSFLDGRTVHCKASLRQYSVLTLFKSPKHDSNFPTEGLTISELCARSGMQSK 650
           D G + L+L F DGR + C  +L QY+V+  F    + +    E +++        M+  
Sbjct: 623 DQGVIELDLEFKDGRVLQCDVTLEQYAVIQQFDEDSYANRLMAETISL-----YLNMEIS 677

Query: 651 QMADILRYWVSKDVLYFSDGKYRTLEFLRWKGDSTYAAIPDVLEESVVERSS---QHEDK 707
           ++   L++WV K VLY  D  Y T E    + DS           S  E++    + E  
Sbjct: 678 RVKSALQFWVEKGVLYQVDAFYATQES---RQDSNIKTAKSDSVGSFFEKNETIIEEETT 734

Query: 708 QENHVERALPYIKDILLNLGTLKIDKLHALLQSAMPKDSHYSTVNQKQLQDYLDTLVEEG 767
               +    P+++ +L NLG+LK  K+H+ L+  +PK+  Y  V Q QL+ YL++LVEE 
Sbjct: 735 LSKTLNAIWPFVQGMLTNLGSLKAAKIHSFLKVTVPKEVGYIVVTQSQLESYLNSLVEEE 794

Query: 768 VLSSASNDSYKLPQI 782
            L+  ++ SYKLP I
Sbjct: 795 RLACTTSGSYKLPSI 809

>Kwal_56.23909 s56 complement(771248..773578) [2331 bp, 776 aa] {ON}
           YLR127C (APC2) - subunit of the anaphase promoting
           complex (APC) [contig 171] FULL
          Length = 776

 Score =  370 bits (950), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 239/771 (30%), Positives = 404/771 (52%), Gaps = 55/771 (7%)

Query: 33  LLQWLDP-AGKKNHQLKPPNLLVKTMIEKLLLGSNDYQLLSNI-QDYYCWQCRVYFYNEY 90
           +L W++P     NHQL+PP+L +K+ I+ L+  + +   L++I + Y  +Q R +F+  Y
Sbjct: 32  VLTWINPNEPTSNHQLRPPSLRLKSAIKILINENGNGPALTDILRQYLIFQTRKHFFAHY 91

Query: 91  KRIETLNELKRIERHVLFPLKYIPIFEGNNRVENEVRLFGNYLLKTNKKVMSRAVERLRN 150
             +    +++++ER+  FPL+++ +F      E E+    NYL+  N      A  RLR 
Sbjct: 92  YSLCHFKDVQKLERYYEFPLRFVRLFNREEWAE-EINGLRNYLISKNLVFNRNARLRLRQ 150

Query: 151 RMLEDDFELATEIVDYFDYCQTDS---TSIVLDIILDKIEQFCQLHYTRKWNKRYLIMET 207
            +LEDDFE+A ++ ++   C+ +    T +++D +L K++ F   H    W+KR++ +E 
Sbjct: 151 LVLEDDFEMACKLYEWL--CRAEGRLLTHLLVDAVLSKVKAFALKHMEEAWSKRFVTVEL 208

Query: 208 FNQFISQYWDQLSSLLFCQEDNHTITNTLYKYFEKQFISIRTNEIFDICISNPASVQPTL 267
           +N FIS+YW  LS +L C ED+H +TN +Y+ FE++FI IRT + F I ++     +PTL
Sbjct: 209 YNLFISKYWSTLSQMLQCPEDDHDVTNEIYRCFEEEFIRIRTQQAFKIFVTGYPESEPTL 268

Query: 268 LELRKEISTVNDFNCVVVELLSKFNLKVINPSIVTADALFLYIRTIKTFSILDPSGRYLQ 327
           LELR  + T   +  +V ELLS+F  +++NPSI TA+ L  Y++ IK+   +D S RY Q
Sbjct: 269 LELRSVLKTPAKYTQLVTELLSQFEARMLNPSITTAEILLSYVKAIKSILTIDVSFRYFQ 328

Query: 328 TISSYVKPHFRQRKDLVHLLLFSMLGLDETDQLNTMPSQVSEEKLTALTNELKDTEICSY 387
            ++ +V+P   +R+D V   L++MLGLD ++     P+       + L+ ELKD+    +
Sbjct: 329 LLTDFVRPFLMERRDTVVTFLYAMLGLDASETRGPKPTGAHASIASQLSAELKDSHQPIF 388

Query: 388 TEESD----DVVDPMIGSFSKEEDSMVLEQVIKRYMEWIPEVPTS---------FGKGIL 434
               D      VD M     KE    V +QVI  Y+ W PE   S           KG+ 
Sbjct: 389 RSALDKSAQSPVDDMASVNPKEP---VYQQVINFYLHWTPEPSDSIQANNSDTLMNKGLF 445

Query: 435 SDHKXXXXXXXXXXXXSKETLVIEFKNLLTKKLLDLRGYTXXXXXXXXXXXXXXXXXNRS 494
                           SK+ ++ EF  L T KLLDL+GY                   ++
Sbjct: 446 D--------IIVELFDSKDIIIGEFLTLFTDKLLDLKGYRLEQNWVKSLKILKNRFDFKN 497

Query: 495 TETMDEEDLNNINTIDIMLRDIYKSRQIATDMQLDLHNTNVKVYPKIVSALYWSNNSDTQ 554
               + + ++NIN ID+MLRD+  S ++   M   +   + +V P  +S L+W+  S   
Sbjct: 498 YS--NAQGVSNINNIDVMLRDVKHSEELCAQMH-SVPEISREVIPMFISYLFWNAGSKFS 554

Query: 555 SKAGDFEMDGELEHLLELYSRFYSQKQIGQKLELRRDNGSVSLNLSFLDGRTVHCKASLR 614
           +   D  +  +LE  +  Y   Y+Q + G+KL L ++  +V L L F D R +  + S+ 
Sbjct: 555 TLPKDCRLPSQLESEIRKYKDMYAQIKPGRKLRLHQEQSTVVLQLHFADKRVMDFEVSMD 614

Query: 615 QYSVLTLFKSPKHDSNFPTEGLTISELCARSGMQSKQMADILRYWVSKDVLYFSDGK--- 671
           + SVL             T G++  ++   +G++  Q+   LR+W+   VL F D K   
Sbjct: 615 KSSVLACVAE--------TTGISRDKIVEATGLEKAQVDQNLRFWLDASVLRF-DSKTSL 665

Query: 672 YRTLEFLRWKGDSTYAAIPDVLEESVVERSSQHEDKQENHV---ERALPYIKDILLNLGT 728
           Y +LE    + D+  A+  +    +  +  S  + +Q+  V   E+  P+I+ +L NLGT
Sbjct: 666 YSSLE----RQDTDNASEREAQMRAEDQARSAFDSQQQQFVESMEKVWPFIRGMLTNLGT 721

Query: 729 LKIDKLHALLQSAMPKDSHYSTVNQKQLQDYLDTLVEEGVLSSASNDSYKL 779
           LK++K+H+ L+ A+PK+  ++     QL+ YL  LV+E  L  ++N+++KL
Sbjct: 722 LKVEKIHSFLKVAVPKEIGFNATT-AQLEAYLRLLVDENKLVCSANNAFKL 771

>KLTH0G12342g Chr7 (1048457..1050781) [2325 bp, 774 aa] {ON} similar
           to uniprot|Q7LGV7 Saccharomyces cerevisiae YLR127C
          Length = 774

 Score =  358 bits (919), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 234/762 (30%), Positives = 394/762 (51%), Gaps = 32/762 (4%)

Query: 33  LLQWLDP-AGKKNHQLKPPNLLVKTMIEKLLLGS-NDYQLLSNIQDYYCWQCRVYFYNEY 90
           +L W++P     NHQ++PP+L VK+ I+ LL G       +  +  Y  +Q R +F+  Y
Sbjct: 32  ILTWVNPNEPGSNHQMRPPSLRVKSAIKSLLNGVVTSESFIDLLGKYMIFQTRKHFFLNY 91

Query: 91  KRIETLNELKRIERHVLFPLKYIPIFEGNNRVENEVRLFGNYLLKTNKKVMSRAVERLRN 150
           + +    +++++ER+  FP +Y+ IF      + E+    NYL++ N  + +    RL  
Sbjct: 92  QSLLYFKDVQKLERYYEFPTRYVNIFSSEEWCD-EMSGLRNYLIRQNSGLKNNIQLRLEQ 150

Query: 151 RMLEDDFELATEIVDYFDYCQTDS---TSIVLDIILDKIEQFCQLHYTRKWNKRYLIMET 207
            + EDDF++A +I ++   CQ +      I++D++L K++ F   +    W +R+ IME 
Sbjct: 151 LVHEDDFDMACKIYEWL--CQAEGRLLPEILVDVLLSKVKLFASKNMNSAWTQRFTIMEA 208

Query: 208 FNQFISQYWDQLSSLLFCQEDNHTITNTLYKYFEKQFISIRTNEIFDICISNPASVQPTL 267
           +N F++ YW     +L C ED+H ITN +Y+ FE++FI IRT+++FDI ++   + +PTL
Sbjct: 209 YNLFVTNYWSVFCRMLQCMEDDHEITNEIYRCFEEEFIRIRTSQVFDIFVTGFPTTKPTL 268

Query: 268 LELRKEISTVNDFNCVVVELLSKFNLKVINPSIVTADALFLYIRTIKTFSILDPSGRYLQ 327
           LELR  + T   +  ++ E L +F  K++NPSI TA+ L  Y+R IK+  I+D S RY Q
Sbjct: 269 LELRSVLKTSVKYTELITEFLYQFESKMLNPSITTAEILLSYVRAIKSILIVDVSFRYFQ 328

Query: 328 TISSYVKPHFRQRKDLVHLLLFSMLGLDETDQLNTMPSQVSEEKLTALTNELKDTE--IC 385
            ++++V+P+  +R D V   L++MLGLD +D  +   +       + L+ EL+ +   I 
Sbjct: 329 LLTNFVRPYLMERHDTVATFLYAMLGLDASDLSSKNSTSTHMSIASQLSAELRGSHQPIS 388

Query: 386 SYTEESDDVVDPMIGSFSKEEDSMVLEQVIKRYMEWIPEVPTSF----GKGILSDHKXXX 441
           S T E  ++      + S        +Q+I  Y+ W PE   S      + ++S      
Sbjct: 389 SSTAERGNLPHGK-HALSMNPYEPAYQQIIDYYLHWNPEPADSIQANNDQALISKE---L 444

Query: 442 XXXXXXXXXSKETLVIEFKNLLTKKLLDLRGYTXXXXXXXXXXXXXXXXXNRSTETMDEE 501
                    SK+ +V EF  L T+KLL LRGY                   ++  +  E 
Sbjct: 445 FDIIVELFDSKDVIVREFLGLFTRKLLGLRGYKLESNWVQSLKVVKKKLDFKTYSSAQE- 503

Query: 502 DLNNINTIDIMLRDIYKSRQIATDMQLDLHNTNVKVYPKIVSALYWSNNSDTQSKAGDFE 561
             +NIN ID+MLRD+  S ++ + M   L  ++ ++ PK VS L+W+ +SD  +   D  
Sbjct: 504 -FSNINNIDVMLRDVKHSEELCSLMHEKLGLSD-RIIPKFVSYLFWNAHSDFSALPKDHP 561

Query: 562 MDGELEHLLELYSRFYSQKQIGQKLELRRDNGSVSLNLSFLDGRTVHCKASLRQYSVLTL 621
           +  ELE  +  Y + Y+  + G+KL L  +   V L L   DGR ++ + +L +  VL+ 
Sbjct: 562 LPKELEADINNYKKAYTNVKKGRKLRLHPEQSIVELQLRLADGRDLNYEVTLDEALVLSY 621

Query: 622 FKSPKHDSNFPTEGLTISELCARSGMQSKQMADILRYWVSKDVLYFSDGKYRTLEFLRWK 681
             S            T+ E+  ++ +   Q+   L++WV   +L +S    R     R  
Sbjct: 622 LSSNGDG--------TVEEIVKQTNLDISQVEKSLKFWVKSSILRYSTETSRYSVEERQN 673

Query: 682 GDSTYAAIPDVLEESVVERSSQHEDKQE--NHVERALPYIKDILLNLGTLKIDKLHALLQ 739
            D  +A       E V    S    +Q+  + +++ LP+IK +L NLG+LK DK+H+ L+
Sbjct: 674 VDVKHAVERQSSSEIVNATDSVDLQQQQFIDSMQKVLPFIKGMLTNLGSLKADKIHSFLK 733

Query: 740 SAMPKDSHYSTVNQKQLQDYLDTLVEEGVLSSASNDSYKLPQ 781
            A+PK+  YS     QLQ YL+ LVEE  L    N +++L +
Sbjct: 734 MAVPKEIGYSAT-PSQLQLYLNALVEESKLVKTPNGAFRLAK 774

>TPHA0C00830 Chr3 (163528..166056) [2529 bp, 842 aa] {ON} Anc_8.321
           YLR127C
          Length = 842

 Score =  356 bits (914), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 251/838 (29%), Positives = 426/838 (50%), Gaps = 87/838 (10%)

Query: 19  VNGNKNSNAEEWNVLLQWLDPAG-KKNHQLKPPNLLVKTMIEKLLLGSN---DYQ----L 70
           V+     ++++ + LL WL+P   K NHQLKPP + +K +I+K+LL  N   DY     L
Sbjct: 17  VDSKSCGSSDDIDSLLDWLNPNDPKSNHQLKPPTIRLKKVIKKILLDVNTLGDYDSIETL 76

Query: 71  LSNIQDYYCWQCRVYFYNEYKRIETLNELKRIERHVLFPLKYIPIFEGNNRV-ENEVRLF 129
            S ++ YY +Q R+ F++  + I    ++ ++E++  FP+ ++PIF  NN + E E+   
Sbjct: 77  NSLLRYYYIFQVRLNFFSNLQSITYFKDIIKLEKYYEFPILHVPIFLNNNYIWETELNKI 136

Query: 130 GNYLLKTNKKVMSRAVERLRNRMLEDDFELATEIVDY---FDYCQTDSTSIVLDIILDKI 186
            +YLL+TN    S  + RL+  + EDDF+LA EI+ +    ++    S  I+L+ +LDKI
Sbjct: 137 RHYLLRTNLTFRSNLINRLKKLVKEDDFDLAQEIIKWSNEANFSLLSSKQIILNALLDKI 196

Query: 187 EQFCQLHYTRKWNKRYLIMETFNQFISQYWDQLSSLLFCQEDNHTITNTLYKYFEKQFIS 246
             +    +T  W++R++IMET+N+FI++YW   + LL C ED+H IT  LYKYFEKQF+ 
Sbjct: 197 TMYADKQFTNAWSQRFIIMETYNKFINKYWSNFAVLLNCAEDDHEITKVLYKYFEKQFLR 256

Query: 247 IRTNEIFDICISNPASVQPTLLELRKEISTVNDFNCVVVELLSKFNLKVINPSIVTADAL 306
           IR+ EIFDIC+ +    +PT++ELR  ++       +++ LLS+F LKV+N SI T   L
Sbjct: 257 IRSEEIFDICVISYPDSKPTIMELRGLLTQSKISTNILIRLLSEFQLKVLNLSIPTCTIL 316

Query: 307 FLYIRTIKTFSILDPSGRYLQTISSYVKPHFRQRKDLVHLLLFSMLGLDETDQLNTMP-S 365
             YI+T+K+  ILDP+ RYLQ+ +S+  P+ +Q+ D++++LLF++L L  TD + T P  
Sbjct: 317 IAYIKTVKSLLILDPTSRYLQSFTSFTNPYLQQKSDIIYILLFAILDL-RTDDIKTNPIV 375

Query: 366 QVSEEKLTALTNELKDTEICSYTEESD-DVVD-----------PMIGSFSKEEDSMVLEQ 413
           +V +  L  L+ EL+++        SD D+ D             +    +E   ++  Q
Sbjct: 376 KVDQNLLKLLSEELRESHFGINLNFSDVDISDNLENGNNNKNISQLDYAGQESSQLLYSQ 435

Query: 414 VIKRYMEWIPEVP-TSFGKGILSDHKXXXXXXXXXXXXSKETLVIEFKNLLTKKLLDLRG 472
           ++ R + W+PE    S  K I    K              E  +  F  LL +KL  ++G
Sbjct: 436 ILNRALTWLPESKLVSPNKSIKMMRKKNLLDILFAIFDDHELFLKRFVELLKQKLFVIKG 495

Query: 473 YTX-----------XXXXXXXXXXXXXXXXNRSTETMDEEDLNNINTIDIMLRDIYKSRQ 521
           Y                             N  T T + + +   N ID+ML D+  S++
Sbjct: 496 YNLEESWVQCLRLFKTKFSPNSLDDAPTSTNLETLTGNNDSMYMTN-IDVMLWDMRGSKK 554

Query: 522 IATDMQLDLHNTNVKVYPKIVSALYWSNNSDTQSKAGDF----EMDGELEHLLELYSRFY 577
           +   M L +   + ++  KI+S+LYW  +   + +   +    +MD  L + L+ YS+ Y
Sbjct: 555 LTEQMHL-IDELDNRINLKIISSLYWQYDMKNEKRKTYYGLLNKMDQTLFNQLDKYSKLY 613

Query: 578 SQKQIGQKLELRRDNGSVSLNLSFLDGRTVHCKASLRQYSVLTLFKSPKHDSNFPTEGLT 637
           S+ + G+ L L  D  ++ ++ +F D RTV C+ +   Y  +  F   +  S++  E L+
Sbjct: 614 SRLKPGRVLNLLTDQSTIEIDFNFEDNRTVTCECTFENYMSICPFLENEGTSSYTLEELS 673

Query: 638 ISELCARSGMQSKQMADILRYWVSKDVLYFSDGKYRTLEFLR------------------ 679
           I       G++  +++  L++W+ + +LYF    YR LE+L                   
Sbjct: 674 I---ITSFGLEDLKIS--LKFWLDQKILYFDGKTYRPLEYLDRSEIIIESPESNNVNSVM 728

Query: 680 -------------WKGDSTYAAIPDVLEESVVERSSQHE---DKQENHVERALPYIKDIL 723
                         KG+ T   I    +E++ + +  H+   +     V +   Y+  IL
Sbjct: 729 SITNNPLNGFAILGKGNDT---IDRPSQENITKCTPDHDKTFNATSQEVSKIKEYVLSIL 785

Query: 724 LNLGTLKIDKLHALLQSAMPKDSHYSTVNQKQLQDYLDTLVEEGVLSSASNDSYKLPQ 781
            NLG   I+KL+ +LQ+    D+    V+   L++ +  LVE G +    N  Y+LP+
Sbjct: 786 TNLGEQNIEKLYNVLQTT-SHDTAIKKVSSVTLENIVTELVENGQILCLPNGLYQLPE 842

>TBLA0A03920 Chr1 complement(980348..982546) [2199 bp, 732 aa] {ON}
           Anc_8.321 YLR127C
          Length = 732

 Score =  349 bits (896), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 228/707 (32%), Positives = 375/707 (53%), Gaps = 61/707 (8%)

Query: 27  AEEWNVLLQWLDPA-GKKNHQLKPPNLLVKTMIEKLLLGSNDYQ-----LLSNIQD---- 76
           ++E   LL WLDP     NH L PP L +KT+I+++   S+ Y+     + +NIQ+    
Sbjct: 30  SDELETLLIWLDPNDPNSNHHLHPPTLQLKTIIKQITPSSDIYKDPSNSIKNNIQNWLKL 89

Query: 77  YYCWQCRVYFYNEYKRIETLNELKRIERHVLFPLKYIPIFEGNNRVENEVRLFGNYLLKT 136
           +Y +Q R YF+ +   I    ++ ++E++  FPL++IP+F        E+    +Y+L  
Sbjct: 90  FYVYQVRTYFFKKIDNIRQYKDMIKLEKYYQFPLQFIPLFTFQEWCF-ELLSLRHYILHQ 148

Query: 137 NKKVMSRAVERLRNRMLEDDFELATEIVDYFDYCQTD--STSIVLDIILDKIEQFCQLHY 194
           NK+   + +  LR  + E+DFE + +IV +     ++  S + +LDI+L+KI  +C+   
Sbjct: 149 NKEFTQKIILELRQLIKEEDFETSLDIVTWIREVDSNLLSENFILDILLEKITLYCEQTM 208

Query: 195 TRKWNKRYLIMETFNQFISQYWDQLSSLLFCQEDNHTITNTLYKYFEKQFISIRTNEIFD 254
              W +RYL+MET+N F+  YW   + LL C+EDNH ITN L+KYFEKQFI IR  EIF 
Sbjct: 209 KGNWTRRYLVMETYNTFMMNYWLNFTQLLNCKEDNHKITNILFKYFEKQFIKIRIQEIFK 268

Query: 255 ICISNPASVQPTLLELRKEISTVNDFNCVVVELLSKFNLKVINPSIVTADALFLYIRTIK 314
           ICI +    +PTLLELR  + T N F  +VV  LS F   V+ P+I T D L  YIRT+K
Sbjct: 269 ICILSYPDTKPTLLELRNLLVTYNFFQKLVVNFLSAFERIVLTPTINTIDCLLAYIRTVK 328

Query: 315 TFSILDPSGRYLQTISSYVKPHFRQRKDLVHLLLFSMLGLDETDQLNTM-PSQVSEEKLT 373
           +F ILDPSGRYL +I++Y+ PHFR+RK L  +LL ++L L + D  N + P +VS   L 
Sbjct: 329 SFQILDPSGRYLYSITNYINPHFRERKMLAPILLHAILALPKIDLENAIYPIKVSSISLK 388

Query: 374 ALTNELKDTEIC--------SYTEESDDVVDP--------------MIGSFSKEE--DSM 409
            + NEL+D E+         +  ++ ++++ P              ++ + S E+   ++
Sbjct: 389 LIINELEDPELGIENTSTKKNSIKKFNEILSPKRFNNHNSSEYLPDLLQNTSSEDSNSTL 448

Query: 410 VLEQVIKRYMEWIP---EVPTSFGKGILSDHKXXXXXXXXXXXXSKETLVIEFKNLLTKK 466
           ++++V+K+++ W+P   ++ T+  K + S               SKE L+ EF  LL+K+
Sbjct: 449 LVQKVVKQFLTWVPIPNDIATNDTKKLYSS--TNLLDILLNIFESKEFLLTEFSKLLSKR 506

Query: 467 LLDLRGYTXXXXXXXXXXXXXXXXXNRS-----TETMDEEDLNN-----INTIDIMLRDI 516
           LL  + Y                  + S     T   D ++L N     I  +++ML D+
Sbjct: 507 LLITKNYKLEGKWGACLQLLRKRFSSGSDNYTNTNLADTDNLVNGENLKITNMNVMLSDL 566

Query: 517 YKSRQIATDMQLDLHNTNVKVYPKIVSALYWSNNSDTQSKAGD------FEMDGELEHLL 570
             S ++        +  N +VYPK +S+ YW +  D     G       F++   L    
Sbjct: 567 NYSSELCKIFH-HANGVNTRVYPKFISSHYWVDLDDENVSNGPNEETNHFQIPPSLLGYF 625

Query: 571 ELYSRFYSQKQIGQKLELRRDNGSVSLNLSFLDGRTVHCKASLRQYSVLTLFKSPKHDSN 630
           E Y++ Y     G+K+++  + G + + LSF DGR +   A+L QY++L   +  K+   
Sbjct: 626 EEYAKLYEDLNEGRKVDIWPNEGVIEIKLSFEDGRVLEIDATLPQYALLQYIQE-KNAIM 684

Query: 631 FPTEGLTISELCARSGMQSKQMADILRYWVSKDVLYFSDGKYRTLEF 677
              +G T++EL     +  + + +++ +W+ K+VL   D KY  LE+
Sbjct: 685 QNNQGFTVNELSVPLNLSLQNVTELVDFWLKKNVLKKVDDKYSILEY 731

>NCAS0C03280 Chr3 (644169..646604) [2436 bp, 811 aa] {ON} Anc_8.321
           YLR127C
          Length = 811

 Score =  322 bits (826), Expect = 1e-97,   Method: Compositional matrix adjust.
 Identities = 240/804 (29%), Positives = 395/804 (49%), Gaps = 81/804 (10%)

Query: 33  LLQWLDP-AGKKNHQLKPPNLLVKTMIEKLLLG-SNDYQLLSNIQDYYCWQCRVYFYNEY 90
           LL WLDP + K   Q KPP L +K  I  L  G S D +    +++YY +  + +F    
Sbjct: 29  LLLWLDPNSSKGTRQNKPPTLELKDCINLLRAGYSQDEKFKMWLREYYLYVVKFHFMKNV 88

Query: 91  KRIETLNELKRIERHVLFPLKYIPIFEGNNRVENEVRLFGNYLLKTNKKVMSRAVERLRN 150
             I  L + K +E   ++PL+++ + +  + + N V+ F +YL+  N       + + ++
Sbjct: 89  DEISVLKDFKLLEMIYIYPLQFMDLVDSTD-ISNLVKSFKHYLIDKNVTFRKNLITKFKD 147

Query: 151 RML-----EDDFELATEIVDYFDYCQ-----TDSTSIVLDIILDKIEQFCQLHYTRKWNK 200
             L     E ++E A  IV+   + Q       +T ++LD  L KIE F +     K N+
Sbjct: 148 CFLVGNQFEFEYEFAN-IVEIIHWIQDSEGVLSATDLILDASLTKIEIFAREQMIGKLNQ 206

Query: 201 RYLIMETFNQFISQYWDQLSSLLFCQEDNHTITNTLYKYFEKQFISIRTNEIFDICISNP 260
           ++++METFN+FI  YW  L+ L+   ED+H +TN +Y++FE+QFI IR  EI  I + + 
Sbjct: 207 KFIVMETFNKFIDIYWKNLTQLIGNIEDDHDLTNLIYQFFERQFIKIRIEEILTIMVQDY 266

Query: 261 ASVQPTLLELRKEISTVNDFNC---------------VVVELLSKFNLKVINPSIVTADA 305
              +PT+LEL+  +S  N                   ++ + L  F  + +NP I T D 
Sbjct: 267 PQTKPTILELKSILSKQNSSTAGARKRGRRKDEWSKKLLKQFLVTFKREFLNPCIPTIDV 326

Query: 306 LFLYIRTIKTFSILDPSGRYLQTISSYVKPHFRQRK-DLVHLLLFSMLGLDETD--QLNT 362
           L  Y++  K+F +LDPSG  L +I  +VKP+ R  + ++V +LL+++L L   D  +LN 
Sbjct: 327 LNAYVKATKSFLLLDPSGSLLNSIVIFVKPYLRSNEVEMVDILLYALLNLKSKDLIELNC 386

Query: 363 MPSQVSEEKLTALTNELKDTEICSYTEESDDV----VDPMIGSFSKEEDSMVLEQVIKRY 418
             +      +  L+ EL +     +++ + DV      P  G+   E  ++  EQV   +
Sbjct: 387 EKTTYDMRSIELLSKELSN----DHSKHAGDVDYKKFSPE-GTNEFENSTLPYEQVYTDF 441

Query: 419 MEWIPEVP-----------TSFGKGILSDHKXXXXXXXXXXXXSKETLVIEFKNLLTKKL 467
           + W P +             S GK I                 SK+ L+ EF  LLT KL
Sbjct: 442 LNWKPSITPISESSNDDEFASLGKNI------TPIDYVFNALESKDKLISEFLKLLTIKL 495

Query: 468 LDLRGYTXXXXXXXXXXXXXXXXXNRSTETMDEEDLNNINTIDIMLRDIYKSRQIATDMQ 527
           L ++GY                  +      DE   ++INTI IML DI  S++ + +  
Sbjct: 496 LHMKGYEVEDRWQKCLKILQDKVTSDKNIVNDESITSDINTILIMLHDISISKESSNEKI 555

Query: 528 LDLHNTN-VKVYPKIVSALYWSNNSDTQSKAGDFEMDGELEHLLELYSRFYSQKQIGQKL 586
            +  N++ ++++PK +S LYW     ++ +   F +D +L   L  Y + Y     G KL
Sbjct: 556 SEFQNSSEMQLFPKFISKLYWKFKRQSEYQ---FPLDSKLRKKLSKYMKSYHHSHPGMKL 612

Query: 587 ELRRDNGSVSLNLSFLDGRTVHCKASLRQYSVLTLFKSPKHDSNFPTEGLTISELCARSG 646
           +L    G  SLNL+F DGR +   A+  QY+VL+ F + K DS   ++ L+I++L     
Sbjct: 613 KLVNGTGICSLNLTFKDGRKLSVDATFEQYTVLSAFHNDKDDS---SQVLSINQLSTMLK 669

Query: 647 MQSKQMADILRYWVSKDVLYFSDGKYRTLEFLRWKGDSTYAAIPDVLEESVVERSSQH-- 704
           M  +++   L++W++K VL   +  Y   E+L    +   ++ P V+  S++  S +   
Sbjct: 670 MDPERVRAHLQFWINKKVLCHQNDYYTIQEYL---NNQELSSGPTVITSSILPLSQERMP 726

Query: 705 ----------EDKQENHVERALPYIKDILLNLGTLKIDKLHALLQSAMPKDSHYSTVNQK 754
                      D +E  + R  PYI D+  NLG+LK+DK+H+ L  ++P+  HYS V   
Sbjct: 727 FKRSVPTNVLNDPKE-ILHRVYPYINDMFTNLGSLKVDKIHSFLNMSVPRGLHYSKVTVT 785

Query: 755 QLQDYLDTLVEEGVLSSASNDSYK 778
           QL+ YLD LVEE  L    + S+K
Sbjct: 786 QLEAYLDQLVEEEQLIVLPDGSFK 809

>KAFR0H02280 Chr8 (435246..437699) [2454 bp, 817 aa] {ON} Anc_8.321
           YLR127C
          Length = 817

 Score =  276 bits (707), Expect = 2e-80,   Method: Compositional matrix adjust.
 Identities = 241/842 (28%), Positives = 390/842 (46%), Gaps = 134/842 (15%)

Query: 27  AEEWNVLLQWLDPAGKKNHQLKPPNLLVKTMIEKLLLGSNDYQLLSNIQDYYCWQCRVYF 86
           AE+ + LL WL PA    HQ KPP+L +K  I+++      +QL S+  +     C V  
Sbjct: 17  AEDLDRLLLWLSPA---EHQCKPPSLRIKKSIQRI---RECFQLSSDFTN-----CLVKL 65

Query: 87  YNEYKRIETL------------NELKRIERHVLFPLKYIPIFEGNNRVENEVRLFGNYLL 134
           Y +  R E +            N++ ++E  +  P  +IP  E        + +  +YLL
Sbjct: 66  YIDLIRFEFISYMKENANCLKFNDVLKLENRIEHPRLFIPELEF--EYFKNLHMLRHYLL 123

Query: 135 KTNKKVMSRAVERLRNRMLEDDFELATEIVDYFDYCQTDSTS---IVLDIILDKIEQFCQ 191
            ++K   +     + N ++EDDF  AT I+D+ D   +   S   +VLD+++ KI   C 
Sbjct: 124 DSDKSFKTALCTSIENLIMEDDFYSATIILDWIDSAYSIDLSPKDLVLDMLVKKIAGICS 183

Query: 192 LHYTRKWNKRYLIMETFNQFISQYWDQLSSLLFCQEDNHTITNTLYKYFEKQFISIRTNE 251
                 W +R++++ETFN FI  YW   + LL C E++H +T T++K FE++FI+IR NE
Sbjct: 184 GSIRGSWTRRFIVIETFNDFIEVYWSHFAQLLKCPENDHELTKTVFKCFEREFINIRINE 243

Query: 252 IFDICISNPASVQPTLLELRKEISTVNDFNCVVVELLSKFNLKVINPSIVTADALFLYIR 311
           IF+I  S     +PT+LELRK +    D   +    L  F  +++NP + T DAL  Y++
Sbjct: 244 IFEIFTSAYPESKPTILELRKVMKAPKDLQRLTYTFLDTFKDEMLNPCVTTIDALTSYLK 303

Query: 312 TIKTFSILDPSGRYLQTISSYVKPHFRQRKDLVHLLLFSMLGLDETDQLNTMPSQVSEEK 371
            IK F +LDP+GRYL  ++++VKP+F+ + DL+++LL+++L L   D  +   S +    
Sbjct: 304 AIKGFLLLDPAGRYLNLVTTFVKPYFQDKSDLINILLYAILDLKPKDFEDLNISYIP--G 361

Query: 372 LTALTNELK-DTEICSYTEESDD-----VVDPM--IGSFS-KEEDSMVLEQVIKRYMEWI 422
           L  L+ +++ D E      E +D      V  +  IG+ S  ++ +++ + ++K++M W+
Sbjct: 362 LNKLSLDMREDPEFSIENVEPNDNNYKRTVPNLESIGANSLHDKGTLIQDHIMKQFMMWV 421

Query: 423 PEVPTS-------FGKGILSDHKXXXXXXXXXXXX-----------SKETLVIEFKNLLT 464
           PE   +        G     D+                        SKE  + +F NLLT
Sbjct: 422 PEPNMNNLENDHDNGNDFEEDNNDVTAVNSIFYNVNLLDILLDLFESKEIFIGKFVNLLT 481

Query: 465 KKLLDLRGYTXXXXXXXXXXXXXXXXXNRSTETMD---EEDLN----------------- 504
            K   L+ Y                  N S  +MD   EED+                  
Sbjct: 482 IKFFKLQNY-RVDPNWQKCLELINSKFNSSNISMDEKMEEDVAIGTVNPTNENYVDEKRK 540

Query: 505 ------------NINTIDIMLRDIYKSR----QIATDM-QLDLHNTNVKVYPKIVSALYW 547
                       ++N I++ML DI  S     QI++++ +  L + NV + PK +S LYW
Sbjct: 541 TNASNDMEEIQISLNKIEVMLNDIRHSEKFSFQISSELNRYGLRSNNVGIKPKFISPLYW 600

Query: 548 SNNSDTQSKAGDF----EMDGELEHLLELYSRFYSQKQIGQKLELRRDNGSVSLNLSFLD 603
            +  D +    +F      D E    +  Y+  Y     G  L   +    + + +SF D
Sbjct: 601 -DYEDNELGVNNFLKENVFDEECTKAILQYASEYCSINKGFALHYCKGKEMIEVEISFND 659

Query: 604 GRTVHCKASLRQYSVLTLFKSPKHDSNFPTEGLTI-SELCARSGMQSK-QMADILRYWVS 661
           G       +  QY VLTLF +         E LTI S L A    +SK ++ D L++WV 
Sbjct: 660 GAIKGFLVNASQYYVLTLFDT-------GNEKLTIESILTAGEAKRSKNEIIDALKFWVE 712

Query: 662 KDVLYFSDGKY--RTLEFLRWKGDSTYAAIPDVLEESVVERSSQHEDKQENHVERALPYI 719
           K+VL +  G Y  R L  +     +T     D+L                  V+ ALPYI
Sbjct: 713 KNVLVYEGGYYYSRDLHSIENSKGNTTTRTDDLL------------------VKEALPYI 754

Query: 720 KDILLNLGTLKIDKLHALLQSAMP--KDSHYSTVNQKQLQDYLDTLVEEGVLSSASNDSY 777
           K +L + G L   ++   L++ +P  +DS +   +   +   LDTLV +G+L   S+ SY
Sbjct: 755 KTMLESFGNLSASRIQNFLKATLPAAQDSDHIITD---IHSVLDTLVSDGILFKNSSGSY 811

Query: 778 KL 779
           KL
Sbjct: 812 KL 813

>ZYRO0F10340g Chr6 complement(837799..840255) [2457 bp, 818 aa] {ON}
           similar to uniprot|Q7LGV7 Saccharomyces cerevisiae
           YLR127C
          Length = 818

 Score =  276 bits (706), Expect = 2e-80,   Method: Compositional matrix adjust.
 Identities = 153/418 (36%), Positives = 240/418 (57%), Gaps = 30/418 (7%)

Query: 33  LLQWLDP-AGKKNHQLKPPNLLVKTMIEKLLLGS------------NDYQLLSNIQDYYC 79
           LL W++P   + NHQ KPP L +K  I K+L+                Y  +  ++ +Y 
Sbjct: 36  LLTWINPNEPQSNHQCKPPTLRLKNSI-KMLVNQYYNMELREDERDTGYLFIQLVRQFYV 94

Query: 80  WQCRVYFYNEYKRIETLNELKRIERHVLFPLKYIPIFEG-NNRVENEVRLFGNYLLKTNK 138
           +Q R++F+     + T  +++R+ ++  FPLKY+ IFE        E     +YLL  +K
Sbjct: 95  YQVRLHFFASLSNLHTFKDVQRLVKYYEFPLKYVYIFENCPEEWIGERDGLMHYLLNRHK 154

Query: 139 KVMSRAVERLRNRMLEDDFELATEIVDYFDYCQTDSTS--IVLDIILDKIEQFCQLHYTR 196
           K+    V RL++ ++EDDF+LA ++V + +   ++ +S  ++LD+I++KI +FCQ   T 
Sbjct: 155 KLRINVVSRLKDLVMEDDFDLAMDVVKWLNESNSNVSSMDLMLDLIVEKISRFCQDQMTG 214

Query: 197 KWNKRYLIMETFNQFISQYWDQLSSLLFCQEDNHTITNTLYKYFEKQFISIRTNEIFDIC 256
            WN R+LIMETFN+FI+ YW Q   LL C EDNH +T  +Y  FE+QF+ +RT EIFDI 
Sbjct: 215 TWNNRFLIMETFNRFITSYWSQFCLLLACPEDNHELTTVVYHLFERQFVKLRTKEIFDIV 274

Query: 257 ISNPASVQPTLLELRKEISTVNDFNCVVVELLSKFNLKVINPSIVTADALFLYIRTIKTF 316
           +      +PTLLELR+ +    DF  +VVE LS F  +++NPSI T +AL  Y++T+K F
Sbjct: 275 VGVYPDSKPTLLELRRVLVKSKDFTQIVVEFLSNFERQILNPSISTVNALLAYVKTVKAF 334

Query: 317 SILDPSGRYLQTISSYVKPHFRQRKDLVHLLLFSMLGLDETDQLNTMPSQVSEEKLTALT 376
             LDP+GR L ++S++VKP+F++R DLV +LL+++L L   +      + +    L  L+
Sbjct: 335 LTLDPTGRCLNSVSAFVKPYFQERNDLVTVLLYAILELQSEEFEGPARAYLDTNSLNQLS 394

Query: 377 NELKDTEICSYTEESDDVVDPMIGSFSKEEDS----------MVLEQVIKRYMEWIPE 424
            ELKD E   +  ES     P     S+   +          +  + VIK +++W PE
Sbjct: 395 QELKDPE---FGIESSFETIPQADLLSRPASTATTAAMLDPRLPYKSVIKNFLQWTPE 449

 Score =  172 bits (437), Expect = 5e-44,   Method: Compositional matrix adjust.
 Identities = 102/281 (36%), Positives = 152/281 (54%), Gaps = 8/281 (2%)

Query: 502 DLNNINTIDIMLRDIYKSRQIATDMQLDLHNTNVKVYPKIVSALYWSNNSDTQSKAGDFE 561
           D +NIN ID+MLRD+  S ++   M   +   + ++YPK +S LYW  N D  S    F+
Sbjct: 545 DPSNINNIDVMLRDVRGSSELCKRMH-QVAGLDQRIYPKFISPLYW--NRDNSSNGWTFQ 601

Query: 562 MDGELEHLLELYSRFYSQKQIGQKLELRRDNGSVSLNLSFLDGRTVHCKASLRQYSVLTL 621
           +D ++   L+ Y + YS+ + G+ L L +D G V L LSF DGR   C+A+L Q SV+  
Sbjct: 602 LDPQMALELDKYCQVYSEIKPGRALHLYKDQGIVVLTLSFQDGRKKRCEATLEQCSVIQQ 661

Query: 622 FKSPKHDSNFPTEGLTISELCARSGMQSKQMADILRYWVSKDVLYFSDGKYRTLEFLRWK 681
           F +    S   T GLT   + AR  M   +    L++WV + VLY+    Y+T E+L  +
Sbjct: 662 FDA----STATTTGLTEQMIGARLQMDPARARAALQHWVQEGVLYYDGNAYKTREYLDDQ 717

Query: 682 GDSTYAAIPDVLEESVVERSSQHEDKQENHV-ERALPYIKDILLNLGTLKIDKLHALLQS 740
                 A  D    S     S   D +   + E+  P+I+ +L NLG LK+ K+H+ L+ 
Sbjct: 718 PAENLPASKDSSASSQARTMSPDRDSRLTSILEQTWPFIQGMLTNLGALKVKKIHSFLKV 777

Query: 741 AMPKDSHYSTVNQKQLQDYLDTLVEEGVLSSASNDSYKLPQ 781
             PK+  +S V   QL+ YL +LVEE  L   +ND+YKLP+
Sbjct: 778 TTPKELGFSMVTPSQLESYLHSLVEEERLICTTNDTYKLPK 818

>AGL193W Chr7 (334823..336952) [2130 bp, 709 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YLR127C (APC2)
          Length = 709

 Score =  258 bits (658), Expect = 2e-74,   Method: Compositional matrix adjust.
 Identities = 190/676 (28%), Positives = 334/676 (49%), Gaps = 47/676 (6%)

Query: 28  EEWNVLLQWLDPAG-KKNHQLKPPNLLVKTMIEKLLLGSN-DYQLLSNIQDYYCWQCRVY 85
           +E   +L+W+DP     NHQ++PP+L +K  I  L LG       +  ++     Q R +
Sbjct: 27  DEIEAVLEWMDPNDDHNNHQMRPPSLRIKNSIRLLRLGEQAPGTTVGLLRQCAVSQMRQH 86

Query: 86  FYNEYKRIETLNELKRIERHVLFPLKYIPIFEGNNRVENEVRLFGNYLLKTNKKVMSRAV 145
           F+  ++R+E   ++ ++ER+  FPL+Y+ +F   + V  E+     YLL  N    +   
Sbjct: 87  FFRHWERLEQYTDMVKLERYYEFPLRYVAVF-TEDEVAAELVGLRKYLLNGNPGFRANME 145

Query: 146 ERLRNRMLEDD-FELATEIVDYF-DYCQTDSTSIVLDIILDKIEQFCQLHYTRKWNKRYL 203
            R+R  +L+DD FE A  +  +            V++++  KI  FC+       ++RYL
Sbjct: 146 ARIRALILQDDDFETAARLYKWIVQGLGHPMVKFVIEVLTQKIALFCRNRMDGNVDQRYL 205

Query: 204 IMETFNQFISQYWDQLSSLL-FCQEDNHTITNTLYKYFEKQFISIRTNEIFDICISNPAS 262
           IME FN FI++ W Q   LL F   D+  + N +Y+ FEK+FI ++T E+F   I     
Sbjct: 206 IMEVFNSFIARCWAQFIQLLQFPTADDPELNNLIYRCFEKKFIELKTQELFHQIIPKFPM 265

Query: 263 VQPTLLELRKEI-STVNDFNCVVVELLSKFNLKVINPSIVTADALFLYIRTIKTFSILDP 321
            +P LLE++  I     + + +V ++ + F+ +++ PS+ T + L  Y++TIK   ++DP
Sbjct: 266 SKPALLEMKSVIKGDTAELDRLVAQIYNDFHKELLVPSVTTVEILLYYVKTIKCLMVVDP 325

Query: 322 SGRYLQTISSYVKPHFRQRKDLVHLLLFSMLGLDETDQLNTMPSQVS----EEKLTALTN 377
           +GR +   +S +KP  ++R DL+  +L ++L LD +D+++ + S+ +     + L+ L+ 
Sbjct: 326 TGRSMNRFTSKLKPKIKERSDLIISVLCAILELD-SDEIHEVISKNTLTENPQLLSQLSK 384

Query: 378 ELKDTEICSYTEESDDVVDPMIGSFSKEEDSMVLEQVIKRYMEWIPEVPTSF----GKGI 433
           ELK++   ++   S       I S + E      +Q++K+++EW PE P  F     K +
Sbjct: 385 ELKNSTALTFHSMSTSKGKAAIYSVAFERQ----DQLVKQFLEWTPE-PGPFTADDAKAL 439

Query: 434 LSDHKXXXX--------XXXXXXXXSKETLVIEFKNLLTKKLLDLRGYTXXXXXXXXXXX 485
            SD                      S E L+ EF  L+T  +L + GY            
Sbjct: 440 NSDDDGAETLELPKDVLEVVFQVFDSPEVLINEFIQLVTNHMLQMDGYVLNAKWSQLLKT 499

Query: 486 XXXXXXNRSTE---TMDEEDLNNINTIDIMLRDIYKSRQIAT-DMQLDLHNTNVKVYPKI 541
                   + +   +M EE  +N+  + +M  D+ KS    T   +L L   N  VYPKI
Sbjct: 500 VMKKYFKNNKQVLKSMCEE--SNLVNVFVMWSDLEKSATFQTWSTKLQLVPPN--VYPKI 555

Query: 542 VSALYWSNNSDTQSKAGDFEMDGELEHLLELYSRFYSQKQIGQKLELRRDNGSVSLNLSF 601
           +S LYW      +S  GD+ +   L  + +   + +  +  G+KL  ++D GSV L L F
Sbjct: 556 ISYLYWKIGR--RSPYGDYAVAPGLAAIFDQMEKAFETRSPGRKLRFQKDQGSVDLQLVF 613

Query: 602 LDGRTVHCKASLRQYSVLTLFKSPKHDSNFPTEGLTISELCARSGMQSKQMADILRYWVS 661
            DGR    + SL +Y+V+ LF+            L+++++ A + M  + + DI+++W  
Sbjct: 614 EDGRHWSSRVSLPKYTVIDLFQRQAC-------PLSVTDIAAHTNMSPRLVEDIIQFWCH 666

Query: 662 KDVLYFSDGK-YRTLE 676
           + VL+ +    Y  LE
Sbjct: 667 EHVLHLNKNDLYEILE 682

>Ecym_4252 Chr4 complement(523632..525701) [2070 bp, 689 aa] {ON}
           similar to Ashbya gossypii AGL193W
          Length = 689

 Score =  241 bits (614), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 188/675 (27%), Positives = 335/675 (49%), Gaps = 54/675 (8%)

Query: 33  LLQWLDPAG-KKNHQLKPPNLLVKTMIEKLLLG-SNDYQLLSNIQDYYCWQCRVYFYNEY 90
           LL W++P     NHQ++ P+L +K  I+ L L  +    LL  ++ +   Q R +F++ +
Sbjct: 32  LLTWINPNDDHNNHQMRLPSLRIKNSIKLLKLDDAEQVFLLQLLRQWTLSQLRYHFFHNW 91

Query: 91  KRIETLNELKRIERHVLFPLKYIPIFEGNNRVENEVRLFGNYLLKTNKKVMSRAVERLRN 150
           + +    ++ R+ER+  FPLKY+ +F     + NE+     YLL  N    +    R+R 
Sbjct: 92  ESLMQYKDMLRLERYYEFPLKYVGLFTAE-ELSNELIGLRKYLLNRNSTFRNNMESRIRV 150

Query: 151 RMLE-DDFELATEIVDYF-DYCQTDSTSIVLDIILDKIEQFCQLHYTRKWNKRYLIMETF 208
            +LE DDFE+++++  +            V+D++ +KIE FC+       +++++I E F
Sbjct: 151 LILEEDDFEMSSKLYKWMVQGLGHPMVKFVIDLLTNKIELFCKSRMEGNVDQKHVIEEVF 210

Query: 209 NQFISQYWDQLSSLL-FCQEDNHTITNTLYKYFEKQFISIRTNEIFDICISNPASVQPTL 267
           N FI + W+Q   LL F  ED+  + N +Y+ FE +FI ++T E+FD  I      +P+L
Sbjct: 211 NAFIDKCWNQFIQLLQFPNEDDQELNNLIYRCFENKFIEMKTKELFDEIIPKFPLSKPSL 270

Query: 268 LELRKEI-STVNDFNCVVVELLSKFNLKVINPSIVTADALFLYIRTIKTFSILDPSGRYL 326
           LE++  I     + + +V ++ + F+ +++ PS+ T + L  Y++ IK   ++DP+GR +
Sbjct: 271 LEMKSVIKGATEELDRLVAQICNDFHSELLIPSVTTIEILLYYVKAIKCLMVVDPTGRSM 330

Query: 327 QTISSYVKPHFRQRKDLVHLLLFSMLGL--DETDQL---NTMPSQVSEEKLTALTNELKD 381
              +  +KP  ++R DL+  +L ++L L  DE  ++   NT+    + + L  L+ ELK+
Sbjct: 331 NRFTFKLKPKIKERSDLITTVLCAILELTKDEIHEVISKNTLTE--NPQLLDQLSKELKN 388

Query: 382 TEICSYTEESDDVVDPMIGSFSKEEDSMVLEQVIKRYMEWIPEVPTSFGKGI--LSDHKX 439
           +   ++   +       I S ++E  +     ++K+++EW PE P  F + I  L ++  
Sbjct: 389 STALNFHSVTTIKSKAAIYSVAQERQN----PLVKQFLEWTPE-PGPFNEDISKLGNNDT 443

Query: 440 XXXXXXXXXXX-----------SKETLVIEFKNLLTKKLLDLRGYTXXXXXXXXXXXXXX 488
                                 S E L+ EF  L+T  +L + GY               
Sbjct: 444 DDTTETLELPKDVLEVVFQVFDSPEILINEFIKLITNHMLQMEGYILSAKWSQLLKTLMK 503

Query: 489 XXXNRSTETMDE--EDLNNINTIDIMLRDIYKSRQI---ATDMQLDLHNTNVKVYPKIVS 543
                + + +    E+ N +N   +M  D+ KS      +T +QL   N    VYPKI+S
Sbjct: 504 KYFKNNKQVLKSICEESNLVNVF-VMWSDLEKSASFQNWSTKLQLIPSN----VYPKIIS 558

Query: 544 ALYWSNNSDTQSKAGDFEMDGELEHLLELYSRFYSQKQIGQKLELRRDNGSVSLNLSFLD 603
            LYW  +   +S  GD+ +   L  + +   + +  K  G+KL  + D G+V + L+F D
Sbjct: 559 YLYWKISR--KSLYGDYRISSALAIIFQQMEKAFEMKSPGRKLRFQNDQGTVEIALTFDD 616

Query: 604 GRTVHCKASLRQYSVLTLF-KSPKHDSNFPTEGLTISELCARSGMQSKQMADILRYWVSK 662
           GR    K SL +Y+V+ LF K P+        GL  +++  ++ M    +  I++YW  +
Sbjct: 617 GRHWSNKVSLPKYTVIELFQKVPR--------GLRTADIVQQTDMAQHHVEAIVQYWCQE 668

Query: 663 DVLYFS-DGKYRTLE 676
            VLY + D  YR LE
Sbjct: 669 HVLYSTGDDCYRILE 683

>NDAI0G02600 Chr7 (595394..598129) [2736 bp, 911 aa] {ON} Anc_8.321
           YLR127C
          Length = 911

 Score =  229 bits (584), Expect = 5e-63,   Method: Compositional matrix adjust.
 Identities = 233/886 (26%), Positives = 394/886 (44%), Gaps = 144/886 (16%)

Query: 33  LLQWLDPAGKKNHQLKPPNLLVKTMIEKLL--LGSNDYQLLSNIQDYYCWQCRVYFY--N 88
           +L WL+P            + +K  I  ++   G +D Q+    + YY +  +++F   N
Sbjct: 33  MLLWLNPNETTTQSATTMTIDLKNCINIIVSTYGKDD-QIRLLFKKYYSFVIKLHFMKDN 91

Query: 89  EYKRIETLNELKRIERHVLFPLKYIPIFEGNNRVENEVRLFGNYLLKTNKKVMSRAVERL 148
             K + ++ E  ++E   L PL++       N +++ + +F  YL+  N       +  +
Sbjct: 92  RPKNMTSIREFHKLENLYLTPLRFTYDLIDTNEMQSLINIFKRYLINNNFTFRKNVLHSM 151

Query: 149 RNRML-EDDFELA------TEIVDYFDYCQTDSTSIVLDIILD--KIEQFCQLHYTRKWN 199
               L ED FE         EIV + +    + + I L + L   KIE+FCQ      WN
Sbjct: 152 ETLFLTEDQFEFQYNMNSLNEIVIWLNDANGNVSPIDLLLDLLLRKIEKFCQREMAGLWN 211

Query: 200 KRYLIMETFNQFISQYWDQLSSLLFCQ-------EDNHTITNTLYKYFEKQFISIRTNEI 252
            R++IME FN FI+QYW  +S L   Q       E++H +TN +Y +F +QFI IR NE 
Sbjct: 212 GRFIIMEKFNLFINQYWKLISKLFHHQQFDYGDVENDHALTNLIYYFFTQQFIKIRINES 271

Query: 253 FDICISNPASVQPTLLELRKEIST---------------VNDFNC-------VVVELLSK 290
             I +SN     PT++EL+  + T                 D N         V + L  
Sbjct: 272 LKIMVSNFPISTPTIIELKNVLITSSMPRENVSTTATTTFRDTNLSEEYLKLFVKKFLKD 331

Query: 291 FNLKVINPSIVTADALFLYIRTIKTFSILDPSGRYLQTISSYVKPHFRQRK-DLVHLLLF 349
           F  K +NP I T   +   ++   +F ILDP G+ L TI   +KP  ++R  D+V++LL+
Sbjct: 332 FQRKFLNPCIPTIPLIRALVKMTNSFLILDPRGQLLTTIILTLKPLIQRRTTDIVNILLY 391

Query: 350 SMLGLDE-------------TDQLNTMPSQVSEEKLTALTNELKDTEICSYTEE------ 390
           +ML L+E              +  N + S++    + ++     +  +  YT        
Sbjct: 392 AMLNLNEMELHKLGCNIDFDIESFNILVSELYPTIIKSMNQNQNNPSVVPYTTAGTGTTC 451

Query: 391 ------SDDV----VDPMIGSFSKE------EDSMVLEQVIKRYMEWIP---EVPTSFGK 431
                 +DD+    V  M  + + E       ++     + K+Y+EW+P   ++  S  K
Sbjct: 452 SNERITNDDIPYQNVKDMANANTMEYLARRKPETKPFFDLFKQYLEWVPPMNKIYDSTSK 511

Query: 432 GILSDHKXXXXXXXXXXXX-------SKETLVIEFKNLLTKKLLDLRGYTXXXXXXXXXX 484
             + D +                   S + L+ E+  LLT+K +  + Y           
Sbjct: 512 NTVVDDEETSRIRSRHAIDYLFRFFDSIDLLLSEYLKLLTEKFIHSKNYYTLDNNWLWCL 571

Query: 485 XXXXXXXNRSTETMDEEDLNNINTIDIMLRDIYKSRQIATDMQLDLHNT----NVKVYPK 540
                  N S+   DE   + INTIDIML D+ +S     D +    N     ++  YPK
Sbjct: 572 NLLKEKSN-SSNVPDENVKSTINTIDIMLNDMKRSASYGKDKKHTKENNMVQGDIGFYPK 630

Query: 541 IVSALYWSNNSDTQSKAGDFEMDGELEHLLELYS--------------RFYSQ-KQIGQK 585
            VS LYW  NS   +K     M G+  HLL+ YS              RF+++  + G+K
Sbjct: 631 EVSKLYWKINSTNIAKWR-MNMKGDFFHLLK-YSKTAEPNHTMDIKLNRFFNELGRKGKK 688

Query: 586 LELRRDNGSVSLNLSFLDGRTVHC-KASLRQYSVLTLFKSPKHDSNFPTEGLTISELCAR 644
           +EL +D   + + +SF DGR +     ++ QY VL+LF   K  + F  E         +
Sbjct: 689 MELYKDKSLMEMKISFDDGRELFFDNITIEQYDVLSLFTVEK-GAAFTLEKAYDFFSGLK 747

Query: 645 SGMQSKQMADILRYWVSKDVLYFSD--GKYRTLEFLRW----------------KGDSTY 686
            G Q  ++ + +++WV K VLY  D  G Y+ LE L +                K D+  
Sbjct: 748 RGKQ--KLEECIQFWVDKKVLYLDDDDGCYKVLERLTFLDEIKQRKKMQEETVIKSDARM 805

Query: 687 AAIPDVLEESVVERS-----------SQHEDKQENHVERALPYIKDILLNLGTLKIDKLH 735
               D ++E+  +             S+  D+ +N ++R  P+I  +L NLG++K++K+H
Sbjct: 806 GIDHDYVQEAAEDDDIAGFETHKDVISRANDEIKNILDRIFPFINGMLENLGSMKLEKIH 865

Query: 736 ALLQSAMPKDSHYSTVNQKQLQDYLDTLVEEGVLSSASNDSYKLPQ 781
           + L+  +P+D  Y+ +   QL++YL+ LVE+  L + ++ ++K P+
Sbjct: 866 SFLKMTVPRDFEYNRIAIHQLENYLNGLVEDEKLETTTDGAFKKPK 911

>KNAG0G02430 Chr7 complement(553644..556037) [2394 bp, 797 aa] {ON}
           Anc_8.321 YLR127C possible pseudogene; NNN added to
           avoid internal stop codon
          Length = 797

 Score =  200 bits (509), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 116/361 (32%), Positives = 195/361 (54%), Gaps = 27/361 (7%)

Query: 33  LLQWLDPAGKKNHQLKPPNLLVKTMIEKLLLGSNDYQLLSNI-------QDYYCWQCRVY 85
           ++ W+ P     H   PP+L +K  I  +L  +++      I       Q+Y C Q +  
Sbjct: 28  VMGWIHPQA---HACHPPSLRMKKAIRSVLGKASELDRQFKIYYIDVIKQEYLCDQVK-- 82

Query: 86  FYNEYKRIETLNELKRIERHVLFPLKYIPIFEGNNR--VENEVRLFGNYLLKTNKKVMSR 143
              E+K I+ L      E  +++P+ Y+P    +++  +E  +    +YL+  +  + + 
Sbjct: 83  --REFKHIQVL------ESKLVYPVTYLPFLSISDQLAIEQTICSLRHYLVDNDDNLRNS 134

Query: 144 AVERLRNRMLEDDFELATEIVDYFDYCQTD---STSIVLDIILDKIEQFCQLHYTRKWNK 200
            V      M +DDFE   +I+++            ++ LD I+ KI   C     R W  
Sbjct: 135 LVAEFETLMQDDDFESGYQIIEWLYTANAKLLRPWNLALDTIVSKISTLCDNEMRRNWEA 194

Query: 201 RYLIMETFNQFISQYWDQLSSLLFCQEDNHTITNTLYKYFEKQFISIRTNEIFDICISNP 260
           ++L+M TFN+FI+ YW  L+  L   EDNH  T  LYK FEK+F+ IRT EIF+I + + 
Sbjct: 195 KFLVMNTFNKFINLYWSHLAKFLHLSEDNHDFTKVLYKCFEKEFVRIRTEEIFEIVVESY 254

Query: 261 ASVQPTLLELRKEISTVNDFNCVVVELLSKFNLKVINPSIVTADALFLYIRTIKTFSILD 320
            + + T+LELR  +S     + +V + L +F +KV+NPS+ T +AL  +IR++K F ILD
Sbjct: 255 QAAKTTILELRTFMSGYERLSKLVNQFLKQFKIKVLNPSVNTVEALVAFIRSVKCFVILD 314

Query: 321 PSGRYLQTISSYVKPHFRQRKDLVHLLLFSMLGLDETDQLNTMPSQVSEEKLTALTNELK 380
           P  R++ TI+++VKP F QR D V ++L+++L L + D      S V  + L+ L++EL+
Sbjct: 315 PRARHMHTITNFVKPFFHQRGDAVQIILYAILDLRDVDFEKMGVSPV--KGLSELSHELR 372

Query: 381 D 381
           +
Sbjct: 373 E 373

 Score = 89.4 bits (220), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 81/291 (27%), Positives = 132/291 (45%), Gaps = 34/291 (11%)

Query: 499 DEEDLNNINTIDIMLRDIYKSRQIATDMQLDLHNT---NVKVYPKIVSALYWSNNSDTQS 555
           +E+ L ++N ID+ML D+ ++ +I       LH T   N  V+PK +S+ YWS   DT +
Sbjct: 530 NEQVLLSLNKIDVMLHDLRENAKITRR----LHRTSMLNGNVFPKFISSQYWSYRDDTFT 585

Query: 556 KAGD---FEMDGELEHLLELYSRFYSQKQIGQKLELRRDNGSVSLNLSFLDGRTVHC-KA 611
           KAG+    ++D  LE  +  Y   + + + G+ + L ++     + L+  DG      K 
Sbjct: 586 KAGNRDQIKIDPVLETDILQYGGRFCELKYGRMVRLCKEKTIFEIELTVNDGEVPQVFKV 645

Query: 612 SLRQYSVLTLFKSPKHDSNFPTEGLTISELCARSGMQSKQMADILRYWVSKDVLYFSDGK 671
              +YSV+      K+ +  P  G T +ELC   GM    +   L YWV+  +L  S   
Sbjct: 646 DAMKYSVIE-----KYATGGPRAGYTPTELCELCGMDIADVQTSLTYWVNAGLLRLSSSG 700

Query: 672 YRTLEFLRWKGDSTYAAIPDVLEESVVERSSQHEDKQENHVERAL-PYIKDILLNLGTLK 730
           Y       ++  S     P+        R +  E      ++  +  +I+ +L +LGTL 
Sbjct: 701 Y-------YESTSETGPPPN--------RGTPLEASTREFLDGVVWTFIRGMLESLGTLS 745

Query: 731 IDKLHALLQSAMPKDSHYS-TVNQKQLQDYLDTLVEEG-VLSSASNDSYKL 779
             ++H  L + +P    Y  TV   QLQ YLD  V+   +L       YKL
Sbjct: 746 CAEIHEYLAATVPATIRYQETVTMLQLQGYLDYNVQSTHLLQQTPEGEYKL 796

>KLLA0D16324g Chr4 complement(1373445..1375538) [2094 bp, 697 aa]
           {ON} weakly similar to uniprot|Q7LGV7 Saccharomyces
           cerevisiae YLR127C
          Length = 697

 Score =  175 bits (444), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 172/694 (24%), Positives = 324/694 (46%), Gaps = 68/694 (9%)

Query: 28  EEWNVLLQWLDPAGKKNHQLKPPNLLVKTMIEKLLLGSNDYQLLSNIQDYYCWQCRVYFY 87
           EE +++L WL+P      Q + P L +K  + K++L  +D +    I+ YY    R +F+
Sbjct: 25  EEVDMVLAWLNPT----FQPQIPTLRIKQCL-KVVLEQSDERTRFLIEQYYLTLIRTHFF 79

Query: 88  NEYKRIETLNELKRIERHVLFPLKYIPIFEGNNRVENEVRLFGNYLLKTNKKVMSRAVER 147
            ++  I    ++ ++E+  +  ++++        ++ E+  F   L+K N +   +   +
Sbjct: 80  LQFDDIVNWKDMIKLEKLYISKVEFM-FGTSVYWIKEEMISFKRLLMKKNNEFRKQLHAK 138

Query: 148 LRNRMLEDDF----ELATEIVDYFDYCQTDSTSIVLDIILDKIEQFCQLHYTRKWNKRYL 203
           L + +L++D     ++   +   FD  + +    ++++   K++Q  Q     K + RYL
Sbjct: 139 LESHILDNDLVRFDQMYQWLAPAFDGQEIEFNVRIINL---KVDQMSQKLMKNKIDDRYL 195

Query: 204 IMETFNQFISQYWDQLSSLLFCQEDNHTITNTLYKYFEKQFISIRTNEIF-DICISNPAS 262
           +M T+N FI  +W + S LL   ED+H +T  +Y+ FEK +I  + +E + DI    PAS
Sbjct: 196 VMNTYNHFIKDFWSKFSKLLII-EDDHELTAIIYQSFEKNYIKYKCDEFYTDIVPKFPAS 254

Query: 263 VQPTLLELR----KEISTVNDFNCVVVELLSKFNLKVINPSIVTADALFLYIRTIKTFSI 318
            +  LLELR    K+I TV     V+  L   F  + +  S++T + L+ YI+T+K   I
Sbjct: 255 -RKCLLELRSILNKDIKTVG--TKVLETLYHGFVSRFLTSSLLTCEILYYYIKTVKCLKI 311

Query: 319 LDPSGRYLQTISSYVKPHFRQRKDLVHLLLFSMLGLDETDQL----NTMPSQVSEEKLTA 374
           +DP G  L+++S  V+ +   R D++  LL  +      ++     +T  S V  EKL  
Sbjct: 312 IDPMGICLRSLSKAVRVYLNPRPDIIKTLLLGIFPFQNNERFKIASSTDGSSVHLEKLEQ 371

Query: 375 LTNELKDTEICSYTEESDDVVD-PMIGSFSKEEDSMVLEQVIKRYMEWIPEVPT------ 427
            + E+ D  +      +    + P +   + + D    +Q++K+Y+ W+PE P       
Sbjct: 372 FSREVGDFSMGPELPTALPWFNQPHLPRCTYDGD----DQLLKQYLNWVPEPPRIKLDVE 427

Query: 428 ----SFGKGILSDHKXXXXXXXXXXXXSKETLVIEFKNLLTKKLLDLRGYTXXX--XXXX 481
               + GK +                 SK TLV +   +++ K ++   Y+         
Sbjct: 428 DFADNDGKYV---PPVDLIHVLLDVLESKRTLVDDLLGVVSGKFIESEEYSLDPEWQRIM 484

Query: 482 XXXXXXXXXXNRSTETMDEEDLNNINTIDIMLRDIYKSRQIATDMQLDLHNTNVKVYP-- 539
                      + T T +E DL ++N +DIML D+  S Q    +    +N++ + +P  
Sbjct: 485 DIILNHLEGTRKGTVTSEEADLTHLNDVDIMLEDLRLSSQFRNQVAHK-NNSHFENFPHI 543

Query: 540 KIVSALYWSN--NSDTQSKAGDFEMDGELEHLLELYSRFYSQKQIGQKLELRRDNGS--- 594
           KI+S LYW +  N + +     ++ D E+E L++  ++ Y +   G+ L+   D GS   
Sbjct: 544 KILSKLYWRHYQNLNGRLVTTKYKWDSEMEPLIQKLTKVYERLNTGRTLKF--DTGSSSR 601

Query: 595 VSLNLSFLDGRTVHCKASLRQYSVLTLFKSPKHDSN-----------FPTEGLTISELCA 643
           VS+N+    G     K ++ QY V++ F++  +  N            P    T+ +L  
Sbjct: 602 VSINIVTKSGERRFFKVTMEQYLVISHFQNETNGRNAPGMMADCNYVIPERRYTLKDLHK 661

Query: 644 RSGMQSKQMADILRYWVSKDVLY-FSDGKYRTLE 676
            + M  +++ DIL +W  K+++   SD  Y   E
Sbjct: 662 MTSMPRQKILDILSFWQQKEIVTKHSDDSYSVQE 695

>Kpol_YGOB_Anc_8.321 s1036 complement(185463..186998) [1536 bp, 511
           aa] {ON} ANNOTATED BY YGOB -
          Length = 511

 Score = 90.9 bits (224), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 48/132 (36%), Positives = 82/132 (62%), Gaps = 3/132 (2%)

Query: 296 INPSIVTADALFLYIRTIKTFSILDPSGRYLQTISSYVKPHFRQRKDLVHLLLFSMLGLD 355
           +NPSI T DAL  Y++T+K+F  LDPSG+YL +IS++V P+ ++R DLV +LL+++L L 
Sbjct: 1   MNPSITTVDALIAYVKTVKSFLTLDPSGKYLHSISTFVNPYLQERNDLVSVLLYAILDLQ 60

Query: 356 ETDQLNTMPSQVSEEKLTALTNELKDTEICSYTEESDDV-VDPMIGSFSKE--EDSMVLE 412
             +      + +  + L  L++EL+D E     E + D+  + + G  S +  + S++  
Sbjct: 61  SENFQEEAQNILDADSLVILSDELRDPEFGIEGELNIDLDKNELTGQPSNKSGDSSLLYR 120

Query: 413 QVIKRYMEWIPE 424
           QVI + + W+PE
Sbjct: 121 QVITQMLNWVPE 132

>NCAS0B08010 Chr2 complement(1517575..1520772) [3198 bp, 1065 aa]
           {ON} Anc_1.88 YGR047C
          Length = 1065

 Score = 32.0 bits (71), Expect = 7.5,   Method: Compositional matrix adjust.
 Identities = 28/117 (23%), Positives = 57/117 (48%), Gaps = 10/117 (8%)

Query: 567 EHLLELYSRFYSQKQIGQKLELRRDNGSVSLNLSFLDGRTVHCKASLRQYSVLTLFKSPK 626
           EHL  L ++F   +++ Q      ++G +SLN+      TV  K  LRQ   L  + S +
Sbjct: 837 EHLRGLLNQFQFNRKVLQLFMFCLNHGKISLNIL---SSTVQQKFFLRQ---LKAYDSIR 890

Query: 627 HDSNFPTEGLTISELCARSGMQSKQMADILRYWVSKDVLYFSDGKYRTLEFLRWKGD 683
           +D++   +    + +  +  + +++ +    Y++   +LY S G   +L++L W  D
Sbjct: 891 YDTHVNGQ----ASITNKEVINTEKKSSPYLYYIYATLLYSSKGFLSSLQYLSWLED 943

>KLTH0C06864g Chr3 (596687..598597) [1911 bp, 636 aa] {ON} weakly
           similar to uniprot|P34225 Saccharomyces cerevisiae
           YBL060W Hypothetical ORF
          Length = 636

 Score = 31.6 bits (70), Expect = 9.4,   Method: Compositional matrix adjust.
 Identities = 26/103 (25%), Positives = 49/103 (47%), Gaps = 12/103 (11%)

Query: 303 ADALFLYIRTIKTFSILDPSGRYLQTISSYVKPHFRQRKDLVHLLLFSMLGLDETDQLNT 362
           + +L+         +IL+   R  Q +S + K H++    L H+++F++L L+ T     
Sbjct: 106 SSSLYFIAEAANLDTILEALSR--QWLSEHNKAHYQDNYKLCHIVMFALLMLNST----- 158

Query: 363 MPSQVSEEKLTALTNELKDTEICSYTEESDDVVDPMIGSFSKE 405
                SE  L+    E ++  I +  +ES D+  P   SF++E
Sbjct: 159 --LHNSEADLSFTIEEFRENTINALQKESPDIDVP---SFNRE 196

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.134    0.387 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 84,350,273
Number of extensions: 3838489
Number of successful extensions: 13453
Number of sequences better than 10.0: 55
Number of HSP's gapped: 13735
Number of HSP's successfully gapped: 66
Length of query: 783
Length of database: 53,481,399
Length adjustment: 118
Effective length of query: 665
Effective length of database: 39,950,811
Effective search space: 26567289315
Effective search space used: 26567289315
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 70 (31.6 bits)