Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
CAGL0M03069g8.847ON54854829040.0
SAKL0D01298g8.847ON5514664142e-43
KLTH0C03718g8.847ON5514564011e-41
TDEL0B005108.847ON5504543922e-40
ZYRO0G14322g8.847ON5505203791e-38
Kwal_27.102248.847ON5464543754e-38
Smik_13.4958.847ON5764133226e-31
Kpol_1068.38.847ON5664273155e-30
Suva_13.4718.847ON5814003066e-29
Skud_13.4548.847ON5804113068e-29
KAFR0B039708.847ON4744172683e-24
YMR282C (AEP2)8.847ON5804132703e-24
TPHA0I002908.847ON5694832677e-24
Ecym_46188.847ON5274042462e-21
NCAS0C003708.847ON4954572338e-20
NDAI0K003408.847ON6244332285e-19
TBLA0B033108.847ON6133752002e-15
KLLA0D01408g8.847ON5183891803e-13
KNAG0J002308.847ON4743541544e-10
ABL119C8.847ON5373371063e-04
Kwal_47.180987.209ON37471714.0
SAKL0H25190g8.156ON43183705.6
TPHA0A037603.330ON116648715.8
CAGL0D02838g4.23ON83457706.6
ZYRO0G19404g8.156ON42976697.6
NDAI0C024305.215ON1060127699.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0M03069g
         (548 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0M03069g Chr13 complement(347584..349230) [1647 bp, 548 aa] ...  1123   0.0  
SAKL0D01298g Chr4 (98188..99843) [1656 bp, 551 aa] {ON} weakly s...   164   2e-43
KLTH0C03718g Chr3 (321675..323330) [1656 bp, 551 aa] {ON} weakly...   159   1e-41
TDEL0B00510 Chr2 (92878..94530) [1653 bp, 550 aa] {ON} Anc_8.847...   155   2e-40
ZYRO0G14322g Chr7 complement(1146574..1148226) [1653 bp, 550 aa]...   150   1e-38
Kwal_27.10224 s27 (248037..249677) [1641 bp, 546 aa] {ON} YMR282...   149   4e-38
Smik_13.495 Chr13 complement(816375..818105) [1731 bp, 576 aa] {...   128   6e-31
Kpol_1068.3 s1068 (4295..5995) [1701 bp, 566 aa] {ON} (4295..599...   125   5e-30
Suva_13.471 Chr13 complement(816054..817799) [1746 bp, 581 aa] {...   122   6e-29
Skud_13.454 Chr13 complement(806601..808343) [1743 bp, 580 aa] {...   122   8e-29
KAFR0B03970 Chr2 complement(830202..831626) [1425 bp, 474 aa] {O...   107   3e-24
YMR282C Chr13 complement(833356..835098) [1743 bp, 580 aa] {ON} ...   108   3e-24
TPHA0I00290 Chr9 complement(55148..56857) [1710 bp, 569 aa] {ON}...   107   7e-24
Ecym_4618 Chr4 complement(1210600..1212183) [1584 bp, 527 aa] {O...    99   2e-21
NCAS0C00370 Chr3 (54433..55920) [1488 bp, 495 aa] {ON} Anc_8.847...    94   8e-20
NDAI0K00340 Chr11 complement(64928..66802) [1875 bp, 624 aa] {ON...    92   5e-19
TBLA0B03310 Chr2 complement(772555..774396) [1842 bp, 613 aa] {O...    82   2e-15
KLLA0D01408g Chr4 (120712..122268) [1557 bp, 518 aa] {ON} weakly...    74   3e-13
KNAG0J00230 Chr10 (30660..32084) [1425 bp, 474 aa] {ON} Anc_8.84...    64   4e-10
ABL119C Chr2 complement(175840..177453) [1614 bp, 537 aa] {ON} S...    45   3e-04
Kwal_47.18098 s47 (685497..686621) [1125 bp, 374 aa] {ON} YIL035...    32   4.0  
SAKL0H25190g Chr8 complement(2196842..2198137) [1296 bp, 431 aa]...    32   5.6  
TPHA0A03760 Chr1 (821355..824855) [3501 bp, 1166 aa] {ON} Anc_3....    32   5.8  
CAGL0D02838g Chr4 complement(296403..298907) [2505 bp, 834 aa] {...    32   6.6  
ZYRO0G19404g Chr7 complement(1612850..1614139) [1290 bp, 429 aa]...    31   7.6  
NDAI0C02430 Chr3 complement(556233..559415) [3183 bp, 1060 aa] {...    31   9.7  

>CAGL0M03069g Chr13 complement(347584..349230) [1647 bp, 548 aa]
           {ON} weakly similar to uniprot|P22136 Saccharomyces
           cerevisiae YMR282c AEP2 required for the expression of
           subunit-9 of atp synthase
          Length = 548

 Score = 1123 bits (2904), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 548/548 (100%), Positives = 548/548 (100%)

Query: 1   MRKQVIGINNIFHLARIRSIPVHCHCKGPLYSYPVVSKTLFHTKNVEVSKYSHVELRSLN 60
           MRKQVIGINNIFHLARIRSIPVHCHCKGPLYSYPVVSKTLFHTKNVEVSKYSHVELRSLN
Sbjct: 1   MRKQVIGINNIFHLARIRSIPVHCHCKGPLYSYPVVSKTLFHTKNVEVSKYSHVELRSLN 60

Query: 61  EQIHSQLTSLTDLNKRQLLLVETLSRNNNLEKLLDYYEIDEGSVEDAIQLLQDSNVSIQE 120
           EQIHSQLTSLTDLNKRQLLLVETLSRNNNLEKLLDYYEIDEGSVEDAIQLLQDSNVSIQE
Sbjct: 61  EQIHSQLTSLTDLNKRQLLLVETLSRNNNLEKLLDYYEIDEGSVEDAIQLLQDSNVSIQE 120

Query: 121 FSSMIQPVLNRTNLVGKYHMGYLSKLMQIYISLTRTHNGGSVDALNKDDMNKFIKRFIEG 180
           FSSMIQPVLNRTNLVGKYHMGYLSKLMQIYISLTRTHNGGSVDALNKDDMNKFIKRFIEG
Sbjct: 121 FSSMIQPVLNRTNLVGKYHMGYLSKLMQIYISLTRTHNGGSVDALNKDDMNKFIKRFIEG 180

Query: 181 SQLKRAQTALQFLLDGYKERGEDLLGPYGDKQTIAHFLMLRSGALQDLWKIDVSNGNNKK 240
           SQLKRAQTALQFLLDGYKERGEDLLGPYGDKQTIAHFLMLRSGALQDLWKIDVSNGNNKK
Sbjct: 181 SQLKRAQTALQFLLDGYKERGEDLLGPYGDKQTIAHFLMLRSGALQDLWKIDVSNGNNKK 240

Query: 241 QAFYKINGSHRNVKSTYNVLDSVKLFEIVRYILRYNDKDNHSQPVYFDEGILKNVILCLG 300
           QAFYKINGSHRNVKSTYNVLDSVKLFEIVRYILRYNDKDNHSQPVYFDEGILKNVILCLG
Sbjct: 241 QAFYKINGSHRNVKSTYNVLDSVKLFEIVRYILRYNDKDNHSQPVYFDEGILKNVILCLG 300

Query: 301 YVGQTTLIEDIINKIWELDSVSVPPKYNITVTSDLLTAIVSAYSKCGKSIQPGLVIADKF 360
           YVGQTTLIEDIINKIWELDSVSVPPKYNITVTSDLLTAIVSAYSKCGKSIQPGLVIADKF
Sbjct: 301 YVGQTTLIEDIINKIWELDSVSVPPKYNITVTSDLLTAIVSAYSKCGKSIQPGLVIADKF 360

Query: 361 FGKIPNIIVKDDFWINLQKWNIILPNKWRSTIDLSKRTWELMKSWRNSTNNGGFITANVE 420
           FGKIPNIIVKDDFWINLQKWNIILPNKWRSTIDLSKRTWELMKSWRNSTNNGGFITANVE
Sbjct: 361 FGKIPNIIVKDDFWINLQKWNIILPNKWRSTIDLSKRTWELMKSWRNSTNNGGFITANVE 420

Query: 421 FLNLVYKVLSSDYIKLKDLEWIYDIFQHSLVTLYSKNSLTVDEIKLLKKFQIFTIKKMVY 480
           FLNLVYKVLSSDYIKLKDLEWIYDIFQHSLVTLYSKNSLTVDEIKLLKKFQIFTIKKMVY
Sbjct: 421 FLNLVYKVLSSDYIKLKDLEWIYDIFQHSLVTLYSKNSLTVDEIKLLKKFQIFTIKKMVY 480

Query: 481 FGHYSKCLQFIKEWSYDAANKQQLTNLFVVLRNRYLQKRGYNQEKEMTKVQKKYDEEEQE 540
           FGHYSKCLQFIKEWSYDAANKQQLTNLFVVLRNRYLQKRGYNQEKEMTKVQKKYDEEEQE
Sbjct: 481 FGHYSKCLQFIKEWSYDAANKQQLTNLFVVLRNRYLQKRGYNQEKEMTKVQKKYDEEEQE 540

Query: 541 DMLLGGLW 548
           DMLLGGLW
Sbjct: 541 DMLLGGLW 548

>SAKL0D01298g Chr4 (98188..99843) [1656 bp, 551 aa] {ON} weakly
           similar to uniprot|P22136 Saccharomyces cerevisiae
           YMR282C AEP2 Mitochondrial protein likely involved in
           translation of the mitochondrial OLI1 mRNA exhibits
           genetic interaction with the OLI1 mRNA 5'- untranslated
           leader
          Length = 551

 Score =  164 bits (414), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 139/466 (29%), Positives = 220/466 (47%), Gaps = 47/466 (10%)

Query: 100 DEGSVEDAIQLLQDSNVSIQEFSSMIQPVLNRTNL--------VGKYHMGYLSKLMQIYI 151
           DEG    A ++  +  ++  E+S  +  +L+ TNL         G  H   L KL +IY 
Sbjct: 116 DEGF---ANRMFSEKLITKLEYSVFVNKLLSNTNLKSELTNLIPGTVHTEVLFKLYEIYR 172

Query: 152 SLTRTHNGGSVDALNKDDMNKFIKRFIEGSQLKRAQTALQFLLDGYKERGEDLLGPYGDK 211
                    ++  +   D+N+FIKRF   +QL +AQ  L F+L+ Y     D        
Sbjct: 173 D--SVVGNATLTPVQLYDLNQFIKRFTGDAQLAKAQQVLGFVLENYGSIPRD-------P 223

Query: 212 QTIAHFLMLRSGALQDLWKIDVSNGNNKKQAFYKINGSHR---NVKSTYNVLDSVKLFEI 268
           QT+ ++L L+ GA+   W I +S     +    K  GS     N+  +Y VL++  L  +
Sbjct: 224 QTLINYLELKCGAMPRNWSIPLS-----RPELGKTLGSQSFMSNLAHSYKVLETEALLPL 278

Query: 269 VRYILRYNDKDNHSQPVYFDEGILKNVILCLGYVGQTTLIEDIINKIWELD-----SVSV 323
           +  +++  D+  H +    +  +   VI  LGY+GQ  L+E  I   W +      S  V
Sbjct: 279 IDEMMK--DRAWHYKR---NCDLEAAVIYSLGYMGQFALLERYIKHTWGVSVSSNTSTEV 333

Query: 324 PPKYNITVTSDLLTAIVSAYSKCGKSIQPGLVIADKFFGKIPNIIVKDDFWINLQKWNII 383
               N+  TS+LL +IVS Y+  G ++   L I D F  K P I ++  FW  L +W+  
Sbjct: 334 EVPKNLYPTSNLLISIVSCYAMKG-NLHQALQIIDSFLSKFPQIELEPLFWRRLFQWSTR 392

Query: 384 LPN-KWRSTIDLSKRTWELMKSWRNSTNNGGFITANVEFLNLVYKVLSSDYIKLKDLEWI 442
           L N K     +LS   W++MK W N       +  ++  LN  Y VL     +  +    
Sbjct: 393 LWNQKTDPKGELSNGCWQVMKQWHNKQKRS--LPIDLGILNERYYVLK----RTNNFTEA 446

Query: 443 YDIFQHSLVTLYSKNSLTVDEIKLLKKFQIFTIKKMVYFGHYSKCLQFIKEWSYDAANKQ 502
             I   +L  LY K +L   E+ ++KKFQ   +KKM   G+Y K L++I EW  +  N+ 
Sbjct: 447 LRIHDEALAGLYMKRNLIDPEVDVIKKFQKLILKKMAGRGYYHKPLKYISEWCLNKRNEL 506

Query: 503 QLTNLFVVLRNRYLQKRGYNQEKEMTKVQKKYDEEEQEDMLLGGLW 548
           ++   F   R  Y+ +    ++K+ T  Q  +D EE++DMLLG LW
Sbjct: 507 EMREYFDRHRKAYITRIEQRKQKQET-AQVTFDAEEEDDMLLGRLW 551

>KLTH0C03718g Chr3 (321675..323330) [1656 bp, 551 aa] {ON} weakly
           similar to uniprot|P22136 Saccharomyces cerevisiae
           YMR282C AEP2 Mitochondrial protein likely involved in
           translation of the mitochondrial OLI1 mRNA exhibits
           genetic interaction with the OLI1 mRNA 5'- untranslated
           leader
          Length = 551

 Score =  159 bits (401), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 127/456 (27%), Positives = 219/456 (48%), Gaps = 42/456 (9%)

Query: 109 QLLQDSNVSIQEFSSMIQPVLNRTNLVGKYHMG--------YLSKLMQIYISLTRTHNGG 160
           ++ Q++++SI EFS+ I+ +L+  NL+ K             +  L Q+Y+   +T   G
Sbjct: 122 KMFQNNDLSIAEFSAFIEGLLSVNNLLHKLSATLPNVSGTEMVFSLYQLYL---KTVTPG 178

Query: 161 SVDALNKDDMNKFIKRFIEGSQLKRAQTALQFLLDGYKERGEDLLGPYGDKQTIAHFLML 220
            +  L   D NKFI+ FI  +QL++AQT L  +L   K     L     D  T  H+L L
Sbjct: 179 PLSPLQLHDFNKFIRFFIRSAQLRKAQTVLDCIL---KSNNNQLPC---DSATATHYLQL 232

Query: 221 RSGALQDLWKI-DVSNGNNKKQAFYKINGSHRNVKSTYNVLDSVKLFEIVRYILRYNDKD 279
           R GAL   WK+ D + G + +    K    ++ V  +Y  LD        + +L +    
Sbjct: 233 RCGALPRNWKVLDENLGRSTRLGARK--NRYQLVSHSYKALDH-------KSVLTFMSLL 283

Query: 280 NHSQPVYF---DEGILKNVILCLGYVGQTTLIEDIINKIWEL---DSVSVPPKYNITVTS 333
           +  + V+F      +   V+  LG++GQ  L+E+ + + W +   +   V      + +S
Sbjct: 284 SDPKSVWFHRKSAALESAVVYSLGFMGQLKLLEEHVWRNWGISLQEHNQVTDASFTSPSS 343

Query: 334 DLLTAIVSAYSKCGKSIQPGLVIADKFFGKIPNIIVKDDFWINLQKWNI-ILPNKWRSTI 392
           ++L A++++Y+   K+I   L + D F  K P + +   FW  L +W+  +   K     
Sbjct: 344 EVLVAVLTSYAS-NKNISSALHLIDGFMAKYPTLELDHVFWRRLFQWSTRVWSEKTDPRG 402

Query: 393 DLSKRTWELMKSWRNSTNNGGFITANVEFLNLVYKVLSSDYIKLKDLEWIYDIFQHSLVT 452
           +LS+  W +M+ W  + N    + A+   LN  + VLS    +  +     ++ +    +
Sbjct: 403 ELSRGCWRVMREWHAARNRQ--LPADAVLLNERFVVLS----RTNNYRDAIEVVEQCYSS 456

Query: 453 LYSKNSLTVDEIKLLKKFQIFTIKKMVYFGHYSKCLQFIKEWSYDAANKQQLTNLFVVLR 512
            + K +L+  E  L +KF    +K M + G+Y K L+FIKEWS +   +  L   F   R
Sbjct: 457 FFQKANLSRHEAVLFQKFAKLILKNMAHLGYYHKPLKFIKEWSPNKLLEHTLRAYFEKHR 516

Query: 513 NRYLQKRGYNQEKEMTKVQKKYDEEEQEDMLLGGLW 548
           N Y   R   + +   K QK++D+EE++ MLLG LW
Sbjct: 517 NAY-SARKQRRTEAAQKAQKRFDDEEEDSMLLGRLW 551

>TDEL0B00510 Chr2 (92878..94530) [1653 bp, 550 aa] {ON} Anc_8.847
           YMR282C
          Length = 550

 Score =  155 bits (392), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 134/454 (29%), Positives = 209/454 (46%), Gaps = 38/454 (8%)

Query: 110 LLQDSNVSIQEFSSMIQ-------PVLNRTNLV-GKYHMGYLSKLMQIYISLTRTHNGGS 161
           L +   +S  EFS+ I          L  +N++    H   +  L QIY +     +   
Sbjct: 120 LFETKELSTSEFSTFINRLLLEKDLDLKLSNIIPDTVHTEIIFNLYQIYCTYVIKDSQNG 179

Query: 162 VDALNKDDMNKFIKRFIEGSQLKRAQTALQFLLDGYKERGEDLLGPYGDKQTIAHFLMLR 221
           +  L   D+N+FIKRFI+ +QLK+AQ  LQFL+D   ++G   +   GD +TI  FL LR
Sbjct: 180 LTPLQVHDINRFIKRFIDEAQLKKAQECLQFLID---KQGLHNILQSGDVETITQFLQLR 236

Query: 222 SGALQDLWKIDVSNGNNKKQAFYKINGSHRNVKSTYNVLDSVKLFEIVRYILRYNDKDNH 281
            GALQ  W++D    +N  +   + +  H     +YN+L      EIV ++L+       
Sbjct: 237 CGALQKFWRVD----SNSTKVLGE-DSKHFKSPKSYNLLKEQPFLEIVNFLLKDKSWRLR 291

Query: 282 SQPVYFDEGILKNVILCLGYVGQTTLIEDIINKIWEL-DSVSVPPKYNITVTSDLLTAIV 340
           S P+     I   ++  L  +GQT LI+  I   W + +   V  K       ++L  IV
Sbjct: 292 SSPI-----IDSAIVYSLSNLGQTKLIDQYIQLKWGISEDGHVAVKNEAVPGHEVLINIV 346

Query: 341 SAYSKCGKSIQPGLVIADKFFGKIPNIIVKDDFWINLQKWNIILPNKWRSTID----LSK 396
           SAY         GL I D+F  K P   ++  FW  L + +    + W    D    +  
Sbjct: 347 SAYCLKNGDTGKGLRILDQFMKKYPQTELEKLFWRRLLQLSF---HNWDKQKDKKALVCH 403

Query: 397 RTWELMKSWRNSTNNGGFITANVEFLNLVYKVLSSDYIKLKDLEWIYDIFQHSLVTLYSK 456
             W +MK W      G  IT +   L L+Y++        ++     ++ +    ++Y+K
Sbjct: 404 GCWNIMKQWHE--QKGVSITYDSGTLRLLYQLFKFT----RNGRGAAEVVRTCFSSVYAK 457

Query: 457 NS--LTVDEIKLLKKFQIFTIKKMVYFGHYSKCLQFIKEWSYDAANKQQLTNLFVVLRNR 514
               ++ DE+ LL  FQ   +K M   G Y++ LQ IKEW+ D  N+  L + F+  R +
Sbjct: 458 QPYQISKDEMDLLLMFQKLALKTMALKGRYNEPLQLIKEWNVDKINQHYLLDYFMRHRRK 517

Query: 515 YLQKRGYNQEKEMTKVQKKYDEEEQEDMLLGGLW 548
           Y   R      +  + Q +YD  E+EDMLLG LW
Sbjct: 518 YDLTRD-KARAKQQQQQAQYDNMEEEDMLLGRLW 550

>ZYRO0G14322g Chr7 complement(1146574..1148226) [1653 bp, 550 aa]
           {ON} weakly similar to uniprot|P22136 Saccharomyces
           cerevisiae YMR282C AEP2 Mitochondrial protein likely
           involved in translation of the mitochondrial OLI1 mRNA
           exhibits genetic interaction with the OLI1 mRNA 5'-
           untranslated leader
          Length = 550

 Score =  150 bits (379), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 141/520 (27%), Positives = 236/520 (45%), Gaps = 44/520 (8%)

Query: 52  SHVELRSLNEQIHSQ-------LTSLTDLNKRQL---LLVETLSRNNNLEKLLDYYEIDE 101
           S + LR+LN+++H+        LT+  + +  +      +    +N    KLL    +D 
Sbjct: 52  SELPLRTLNDELHNAERKYIKPLTNAPEWSSTRTGPNSKIREYLKNGQYTKLLIRLSVDN 111

Query: 102 GSVEDAIQ-LLQDSNVSIQEFSSMIQPVLNRTNLVGKY--------HMGYLSKLMQIYIS 152
               + I  L     ++  E+S  I  +L+   L  K         H   + KL + Y  
Sbjct: 112 HLNNEYISGLFTTGGLTKSEYSLFINKLLSEEELDVKLSNVIPDTPHTELIYKLYEFYCD 171

Query: 153 -LTRTHNGGSVDALNKDDMNKFIKRFIEGSQLKRAQTALQFLLDGYKERGEDLLGPYGDK 211
            +   HN   +  L   D+N F+K FI  +QL +A   L F+L   +    DLL    D 
Sbjct: 172 HIVDQHN---LTPLQLYDLNLFLKTFIAEAQLSKAHNVLDFIL--LRRPLNDLLA-NTDV 225

Query: 212 QTIAHFLMLRSGALQDLWKIDVSNGNNKKQAFYKINGSHRNVKSTYNVLDSVKLFEIVRY 271
           + +  FL L+ GAL   WKI  ++  N          S  ++  +Y   +   L +I+  
Sbjct: 226 EILIQFLRLKCGALSKFWKIQPASQRNSTAITLGEKASDCHLAKSYKFQNEKVLLQIINS 285

Query: 272 ILRYNDKDNHSQPVYFDEGILKNVILCLGYVGQTTLIEDIINKIWELDSVSVPPKYNITV 331
           +L  ++  N   P   D  I    I  LGY+GQT LIE  +N+ W   S S         
Sbjct: 286 VLGEHNWKNRRSPK-LDAAI----IYSLGYLGQTDLIEKYVNRTW---SPSKDEGVKTNP 337

Query: 332 TSDLLTAIVSAYSKCGKSIQPGLVIADKFFGKIPNIIVKDDFWINLQKWNIILPNKWRS- 390
            SDLL A++++Y     +++ GL + D+F    P + +   FW  L + + +L +K R  
Sbjct: 338 NSDLLVAVLTSYCVKEGNMRKGLEVLDRFIRDYPEVELDPLFWRRLLQLSSLLWDKKRDR 397

Query: 391 TIDLSKRTWELMKSWRNSTNNGGFITANVEFLNLVYKVLSSDYIKLKDLEWIYDIFQHSL 450
              LS   W +MK W             + +   + K L   +++ K+     ++   S 
Sbjct: 398 KATLSHGCWTIMKQWHAQRQR------KIPYDYGIMKELYPIFVRTKNKNGALEVITKSF 451

Query: 451 VTLYSKNSLTV--DEIKLLKKFQIFTIKKMVYFGHYSKCLQFIKEWSYDAANKQQLTNLF 508
              + +   T+  +E+ LL K+Q F +K +   G+Y K  +F +EWS+ + NK +L + F
Sbjct: 452 FGAFIQPEFTIRPNELSLLCKYQRFILKMIALKGNYHKGFEFCQEWSFSSTNKFELQSYF 511

Query: 509 VVLRNRYLQKRGYNQEKEMTKVQKKYDEEEQEDMLLGGLW 548
           +  R  + Q+R  +Q K+   +Q+KYDE E++DMLLG LW
Sbjct: 512 MKWRGIHEQRRT-SQSKQKAALQEKYDEMEEDDMLLGRLW 550

>Kwal_27.10224 s27 (248037..249677) [1641 bp, 546 aa] {ON} YMR282C
           (AEP2) - basic, hydrophilic 67.5 kDa protein [contig 39]
           FULL
          Length = 546

 Score =  149 bits (375), Expect = 4e-38,   Method: Compositional matrix adjust.
 Identities = 129/454 (28%), Positives = 210/454 (46%), Gaps = 38/454 (8%)

Query: 109 QLLQDSNVSIQEFSSMIQPVLNRTNLVGKYHMGYLS-----KLMQIYISLTRTHNGGSVD 163
           ++ +D+ ++  EFS+++  +L   NL  K      S      +  +Y +   T   GS++
Sbjct: 117 KIFEDNLLTPNEFSTLLNGLLTERNLSTKLETVLPSVQSTEMIFGLYQTYLMTIPAGSLN 176

Query: 164 ALNKDDMNKFIKRFIEGSQLKRAQTALQFLLDGYKERGEDLLGPYGDKQTIAHFLMLRSG 223
            L   D+N F++ FIE +QL +AQ  L  +L        D L    D  T  H+L LR G
Sbjct: 177 PLQLHDLNSFVQYFIETAQLGKAQIVLDRILAS----NNDQLP--CDTTTGIHYLQLRCG 230

Query: 224 ALQDLWKI-DVSNGNNKKQAFYKINGSHRN----VKSTYNVLDSVKLFEIVRYILRYNDK 278
           AL   WK+ D   G++ +       GSHRN    V  TY  LD   + E V  +   N +
Sbjct: 231 ALPRNWKVFDSRVGHSCRL------GSHRNKSQPVSHTYKALDQSSVLEFVNVLNDENSE 284

Query: 279 DNHSQPVYFDEGILKNVILCLGYVGQTTLIEDIINKIW---ELDSVSVPPKYNITVTSDL 335
             H +    +      VI  LG++GQ TL+++ I   W   EL +        +  + ++
Sbjct: 285 WFHKKSPTLEAA----VIYSLGFMGQLTLLKEHIAVRWGITELGASLATEVNEVPPSPEV 340

Query: 336 LTAIVSAYSKCGKSIQPGLVIADKFFGKIPNIIVKDDFWINLQKW-NIILPNKWRSTIDL 394
           L AI ++++   + +  GL + D F  K   I +   FW  L +W N++   K     DL
Sbjct: 341 LIAIFTSFA-SHQEVTLGLRLMDAFITKYSEINLDIVFWRRLFQWTNLVWDVKTDPRGDL 399

Query: 395 SKRTWELMKSWRNSTNNGGFITANVEFLNLVYKVLSSDYIKLKDLEWIYDIFQHSLVTLY 454
           S+  W +M  W    +    +  +   LN  Y VL+    +  + +    +   S   LY
Sbjct: 400 SRGCWRVMTEWHEKGSKK--LQPDTTLLNERYFVLA----QTNNYKEALTVISQSFPQLY 453

Query: 455 SKNSLTVDEIKLLKKFQIFTIKKMVYFGHYSKCLQFIKEWSYDAANKQQLTNLFVVLRNR 514
            K +L+  E+ +++K+    +K M   G+Y K L FI EWS + A +  L   F   R+ 
Sbjct: 454 EKPTLSSKEMAIVQKYSKLVLKSMAELGYYHKPLTFITEWSPNKAVEDSLRVYFKKHRDG 513

Query: 515 YLQKRGYNQEKEMTKVQKKYDEEEQEDMLLGGLW 548
           +  KR     +E  + Q  YD+EE+++MLLG LW
Sbjct: 514 F-TKRKERLREESRRKQNTYDDEEEDNMLLGRLW 546

>Smik_13.495 Chr13 complement(816375..818105) [1731 bp, 576 aa] {ON}
           YMR282C (REAL)
          Length = 576

 Score =  128 bits (322), Expect = 6e-31,   Method: Compositional matrix adjust.
 Identities = 119/413 (28%), Positives = 190/413 (46%), Gaps = 51/413 (12%)

Query: 161 SVDALNKDDMNKFIKRFIEGSQLKRAQTALQFLLDGYKERGED-LLGPY-GDKQTIAHFL 218
           ++DA    D+N  I+ FIE  QL +AQ  L F++D    R  D LL P   D  T+ HFL
Sbjct: 190 TLDACEIFDINLLIRNFIELGQLGKAQKILTFIID----RNPDILLSPNNADIGTMVHFL 245

Query: 219 MLRSGALQDLWKIDVSNGNNKKQAFYKINGSHRN----VKSTYNVLDSVKLFEIVRYILR 274
            LR GAL   WKI  ++G ++KQ    +    +N    + STY V+D   L +I   +L 
Sbjct: 246 KLRCGALAAYWKIPDNSGQDQKQLRKIVRLGAKNTSIRLSSTYKVMDHQTLLKIADLVL- 304

Query: 275 YNDKDNHSQPVYFDEGILKNVILCLGYVGQTTLIEDIINKIWELDSVSVPPKYNIT---- 330
                 H +     E +L  +I   G++GQT ++E  I  IW + +   P    I     
Sbjct: 305 ------HEKRFLNSEDLLSTLIQSFGHLGQTQILERCIEHIWHITTQEFPSHVAIKPRGC 358

Query: 331 -VTSDLLTAIVSAYSKCGKSIQPGLVIADKFFGKIPNIIVKDDFWINLQK-----WNIIL 384
             +S +L +I+ ++      +  GL I D F    P + +   FW  L +     W    
Sbjct: 359 YPSSKILISILVSFHYNDNDLHRGLSILDSFIKHYPEVKLDALFWRRLFQLSNFAWTPAK 418

Query: 385 PNKWRSTIDLSKRTWELMKSWRNSTNNGGFITANVEFLNLVYKVLSSDYIKLKDLEWIYD 444
             K  S I    R W LMK W  S   G  ++ + E L  +Y ++     K  +     D
Sbjct: 419 DKKATSVI----RCWHLMKQWHVS--KGLSLSVDYETLRQLYDIMK----KTGNFPLGID 468

Query: 445 I---FQHSLVTLYSKNSLTVDEIKLLKKFQIFTIKKMVYFGHYSKCLQFIKEWSYDAANK 501
           +   F+  +  L   NS  ++ +  L K+Q + IK++V  G  S   +FI ++ +D    
Sbjct: 469 VLKSFKSGIERLRETNSDKLNIV--LIKYQKYIIKQLVDRGRISAVREFINDFGFDRTIT 526

Query: 502 QQLTNLFVVLRNRYLQKRGYNQ-----EKEMTKVQKK-YDEEEQEDMLLGGLW 548
           + L N+F    NR L +   N+     +KE  K++   +D++E + M++G LW
Sbjct: 527 KNL-NIFCT--NRLLLRSKKNKSKIENKKERNKLEPSGFDDDEDDGMIIGSLW 576

>Kpol_1068.3 s1068 (4295..5995) [1701 bp, 566 aa] {ON} (4295..5995)
           [1701 nt, 567 aa]
          Length = 566

 Score =  125 bits (315), Expect = 5e-30,   Method: Compositional matrix adjust.
 Identities = 115/427 (26%), Positives = 197/427 (46%), Gaps = 41/427 (9%)

Query: 145 KLMQIYISLTRTHNGG-SVDALNKDDMNKFIKRFIEGSQLKRAQTALQFLLDGYKERGED 203
           ++ ++Y S     +G   ++AL+  D+N FI  FI+ +QL +AQ  LQ+++D      E 
Sbjct: 158 EIFELYTSTIPKESGIIKLNALHLKDLNLFITIFIKEAQLSKAQNVLQYIIDA-----EG 212

Query: 204 LLGPYGDKQTIAHFLMLRSGALQDLWKIDVSN----GNNKKQAFYKINGSHRNVKSTY-N 258
            +    D  T+ +FL LR G L   W +  ++       KK +    N  +    S+Y +
Sbjct: 213 SIEKITDHDTMVNFLRLRCGGLPKFWLVPQASYAVTKQTKKNSRLSSNSPNTRFPSSYKS 272

Query: 259 VLDSVKLFEIVRYILRYND-KDNHSQPVYFDEGILKNVIL-CLGYVGQTTLIEDIINKIW 316
            + +  LFE++  IL     K  HS       GIL + I+  L +  Q  +++  I + W
Sbjct: 273 TVPNTVLFEVINMILNKKVWKSKHS-------GILDSTIVYSLAHTFQKQMMDGFIKEHW 325

Query: 317 ELDSVSVP-------PKYNITVTSDLLTAIVSAYSKCGKSIQPGLVIADKFFGKIPNIIV 369
            + S   P        K     ++++L AI+S+Y    ++I   + I DKF    P+I +
Sbjct: 326 GISSHGDPLDLFIKKKKVASAPSNEILIAIMSSYIYKDRNIDGAMKILDKFIRMYPDISL 385

Query: 370 KDDFWINLQKWNIILPNKWRSTID----LSKRTWELMKSWRNSTNNGGFITANVEFLNLV 425
            + FW  L +W   L   W   ID         W +MK+W N    G  +    +F   +
Sbjct: 386 DNMFWRRLIQWCNRL---WDPKIDRQGTFGYGCWNMMKNW-NGAGTGKDVVLPYDFQ--I 439

Query: 426 YKVLSSDYIKLKDLEWIYDIFQHSLVTLYSKNSLTVD--EIKLLKKFQIFTIKKMVYFGH 483
           Y+     + +  + +   +I  + L+   S+ ++ V   E+ LL K+Q   +  ++    
Sbjct: 440 YEEFYRLFKRTNNGKIAAEIVSNVLIPHLSEKNVAVKKAELNLLNKYQTLAMNWLIERRQ 499

Query: 484 YSKCLQFIKEWSYDAANKQQLTNLFVVLRNRYLQKRGYNQEKEMT--KVQKKYDEEEQED 541
           + K   FI+EWS D  N+ QL   F   +   L+K     +K  +  K Q +YDE E+ED
Sbjct: 500 FKKAAFFIEEWSIDRNNRIQLREAFKKRKQLMLRKLSTRDKKSQSQKKRQDRYDEMEEED 559

Query: 542 MLLGGLW 548
           M++G LW
Sbjct: 560 MIIGRLW 566

>Suva_13.471 Chr13 complement(816054..817799) [1746 bp, 581 aa] {ON}
           YMR282C (REAL)
          Length = 581

 Score =  122 bits (306), Expect = 6e-29,   Method: Compositional matrix adjust.
 Identities = 108/400 (27%), Positives = 188/400 (47%), Gaps = 41/400 (10%)

Query: 169 DMNKFIKRFIEGSQLKRAQTALQFLLDGYKERGED-LLGPY-GDKQTIAHFLMLRSGALQ 226
           DMN  IK FIE  QL +AQ  L F+LD    R  D LL P   D  TI HFL LR GAL 
Sbjct: 203 DMNLIIKNFIELGQLGKAQKVLSFILD----RNSDILLSPKNADIGTIIHFLQLRCGALA 258

Query: 227 DLWKIDVSNGNNKKQAFYKINGSHRNVK--STYNVLDSVKLFEIVRYILRYNDKDNHSQP 284
             WK+  ++     +   ++   + +++  S+Y  +D   L +I   +L+        + 
Sbjct: 259 AYWKMPDNSEQKYSRKMVRLGAKNTSIRITSSYKAMDHQTLLKIADLVLQ-------KER 311

Query: 285 VYFDEGILKNVILCLGYVGQTTLIEDIINKIWELDSVSVPPKYNI-------TVTSDLLT 337
           +   E +L  +I   G++GQT ++E  I  IW++     P    I         +S +L 
Sbjct: 312 LLNSEDLLSTLIQSFGHLGQTQILERCIEHIWQISLQEFPSHATIKPKTRGCCPSSKILI 371

Query: 338 AIVSAYSKCGKSIQPGLVIADKFFGKIPNIIVKDDFWINLQKWNIILPNKWRSTIDLSK- 396
           +I+ ++      +  GL I D F    P + V + FW  L + +      W  T D    
Sbjct: 372 SILVSFHLNDNDLHRGLSILDSFIKHYPEVKVDELFWRRLFQLSHF---AWTPTHDKRAT 428

Query: 397 ---RTWELMKSWRNSTNNGGFITANVEFLNLVYKVLSSDYIKLKDLEWIYDIFQHSLVTL 453
              R W LMK W  S   G  ++ + E L  +Y +      K  +     D+ Q+    +
Sbjct: 429 SIVRCWHLMKQWHES--KGFSLSVDYETLRQLYDLTK----KTGNYSLGIDVLQNFKPGI 482

Query: 454 YSKNSLTVDEIK-LLKKFQIFTIKKMVYFGHYSKCLQFIKEWSYDAANKQQLTNLF---- 508
              +++  ++I  ++ K Q + IK++V  G  S   +FI ++S+D    ++L N+F    
Sbjct: 483 TRTSAMKTEKINGIVIKHQKYIIKQLVNRGKTSAAREFINDFSFDIGAVKEL-NVFCTNR 541

Query: 509 VVLRNRYLQKRGYNQEKEMTKVQKKYDEEEQEDMLLGGLW 548
           ++LR++ L+ +  N+++     Q  +D+++ + M++G LW
Sbjct: 542 ILLRSKKLKNKTENRKERNRSGQGNFDDDDDDGMVIGSLW 581

>Skud_13.454 Chr13 complement(806601..808343) [1743 bp, 580 aa] {ON}
           YMR282C (REAL)
          Length = 580

 Score =  122 bits (306), Expect = 8e-29,   Method: Compositional matrix adjust.
 Identities = 112/411 (27%), Positives = 186/411 (45%), Gaps = 47/411 (11%)

Query: 161 SVDALNKDDMNKFIKRFIEGSQLKRAQTALQFLLDGYKERGED-LLGPY-GDKQTIAHFL 218
           ++D+    D+N  IK FIE  QL +AQ  L F+LD    R  D LL P   D  TI HFL
Sbjct: 194 ALDSCEIFDLNLLIKNFIELGQLSKAQKILSFILD----RNPDILLSPRNADIGTIVHFL 249

Query: 219 MLRSGALQDLWKIDVSNGNNKKQAFYKINGSHRN----VKSTYNVLDSVKLFEIVRYILR 274
            LR GAL   WKI  ++G  + Q    +    +N    + STY  +D   L +I   +L+
Sbjct: 250 QLRCGALTAYWKIPDNSGRKQNQLRRMVRLGAKNTSIRLSSTYKAMDHQTLLKIADLVLQ 309

Query: 275 YNDKDNHSQPVYFDEGILKNVILCLGYVGQTTLIEDIINKIWELDSVSVPPKYNIT---- 330
                   +     E +L  +I   G++GQT ++E  I  IW++ S   P    I     
Sbjct: 310 -------DKRFLNSEDLLSTLIQSFGHLGQTQILERCIEHIWQISSQEFPSHVAIKPRGC 362

Query: 331 -VTSDLLTAIVSAYSKCGKSIQPGLVIADKFFGKIPNIIVKDDFWINLQK-----WNIIL 384
             +S +L +I+ ++    K +  GL I D F    P + +   FW  L +     W  + 
Sbjct: 363 YPSSKILISILVSFHLNDKDLHRGLSILDSFIKHYPEVKLDALFWRRLLQLSHFAWTPVN 422

Query: 385 PNKWRSTIDLSKRTWELMKSWRNSTNNGGFITANVEFLNLVYKVLSSDYIKLKDLEWIYD 444
             +  S +    + W LMK W  S       + + E L  +Y+V+     K  +     D
Sbjct: 423 DKRAASIV----KCWHLMKHWYESKELSP--SVDYETLRQLYEVMK----KTGNFSLGID 472

Query: 445 I---FQHSLVTLYSKNSLTVDEIKLLKKFQIFTIKKMVYFGHYSKCLQFIKEWSYDAANK 501
           +   F+  +  + + N   ++ I  L K+Q   IK++V  G  S   +FI ++ ++    
Sbjct: 473 VLKSFKSGIEKMRTANPEKLEAI--LIKYQKCIIKQLVNRGKISAARKFIGDFGFNRRAA 530

Query: 502 QQLTNLF----VVLRNRYLQKRGYNQEKEMTKVQKKYDEEEQEDMLLGGLW 548
           + L N+F    +  R++ ++    N++K        YD++E + M++G LW
Sbjct: 531 KDL-NIFCSNRIFSRSKKIKNDIENKKKRDGLAPGNYDDDEDDGMIIGSLW 580

>KAFR0B03970 Chr2 complement(830202..831626) [1425 bp, 474 aa] {ON}
           Anc_8.847 YMR282C
          Length = 474

 Score =  107 bits (268), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 112/417 (26%), Positives = 191/417 (45%), Gaps = 73/417 (17%)

Query: 145 KLMQIYISLTRTHNGGSVDALNKDDMNKFIKRFIEGSQLKRAQTALQFLLDGYKERGEDL 204
           +L + Y+ L  +H   ++  L  +DMNKFI  F+E  QLK+AQ  +++L+     +   +
Sbjct: 118 QLFETYVKLISSHEELTI--LQVEDMNKFINYFVEFKQLKKAQLVMKYLI----LKSPRV 171

Query: 205 LGPYGDKQTIAHFLMLRSGALQDLWKIDVSNGNNKKQAFYKINGSHRNVKSTYNVLDSVK 264
           L  Y D  T  ++L L  GA  +LW  +           YKI              ++  
Sbjct: 172 LEKY-DVSTTRNYLKLNCGACHELWYTN-----------YKIFD-----------FNNTT 208

Query: 265 LFEIVRYILRYNDKDNHSQPVYFDEGILKNVILCLGYVGQTTLIEDIINKIWELDSVSVP 324
           L ++V+Y L     DN  +  Y+D  I+ +    LGY G+   +ED I K W    +S+ 
Sbjct: 209 LDKLVKYSL-----DN--KIGYWDVEIIHS----LGYSGRIRSLEDYILKKW---GISLC 254

Query: 325 PKYNITVT-----SDLLTAIVSAYSKCGKSIQPGLVIADKFFGKIPNIIVKDDFWINLQK 379
            +  +  T     S++L AI++ +    K +   + I ++F    P++ +K  FW     
Sbjct: 255 DRAQVNTTNEAPESEVLEAIINGFFYRDKRMFRAIKILNEFVNVYPDLNLKITFWKTFMN 314

Query: 380 WNIILPNKWRSTID----LSKRTWELMKSWRNSTNNGGFITANVEFLNLVYKVLSSDYIK 435
            N I   +W   +D    +    WE MK W    N    I  N+ FL    KV+ + + K
Sbjct: 315 -NCI--KEWDEKVDQKGVVIVEYWETMKRWYTVHNRR--IPFNINFL----KVMRTCFKK 365

Query: 436 LKDLEWIYDIFQHSLVTLY-SKNSLTVDEIKLLKKFQIFTIKKMVYFGHYSKCLQFIKEW 494
             +L    DIFQ+     Y     +   E+ ++K++Q F + +++    +S  L FI + 
Sbjct: 366 NNNLVLATDIFQNCFHNFYFCATRMNDSELNVIKEYQNFILSRLIEKKGFSNALTFINDH 425

Query: 495 SYDAANKQQLTNLFVVLRNRYLQKRGYNQEKEMTK---VQKKYDEEEQEDMLLGGLW 548
            +   NK+QL N        Y   R  ++ K+MT+   ++K YD+  +ED ++G LW
Sbjct: 426 CFSLENKRQLMN--------YYHGRKEHKLKKMTRNENLEKTYDDMVEEDFIIGKLW 474

>YMR282C Chr13 complement(833356..835098) [1743 bp, 580 aa] {ON}
           AEP2Mitochondrial protein, likely involved in
           translation of the mitochondrial OLI1 mRNA; exhibits
           genetic interaction with the OLI1 mRNA 5'-untranslated
           leader
          Length = 580

 Score =  108 bits (270), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 116/413 (28%), Positives = 189/413 (45%), Gaps = 53/413 (12%)

Query: 162 VDALNKDDMNKFIKRFIEGSQLKRAQTALQFLLDGYKERGED-LLGPY-GDKQTIAHFLM 219
           +DA    D N  IK FIE  QL +AQ  L F+LD    R  D LL P   D  TI HFL 
Sbjct: 195 LDACEIFDANLMIKNFIELGQLGKAQKILSFILD----RNPDILLSPKNADISTIVHFLQ 250

Query: 220 LRSGALQDLWKIDVSNGNNKKQAF----YKINGSHRNVK--STYNVLDSVKLFEIVRYIL 273
           LR GAL   WKI   + + +KQ F     ++   + +++  STY  +D   L +I    L
Sbjct: 251 LRCGALAPYWKI--PDNSEQKQGFLRKMVRLGAKNTSIRLSSTYKAMDHQTLLKIADLAL 308

Query: 274 RYNDKDNHSQPVYFDEGILKNVILCLGYVGQTTLIEDIINKIWELDSVSVPPKYNIT--- 330
           +        + +   E +L  +I   G++GQT ++E  I  IW++     P    I    
Sbjct: 309 Q-------EKKLLNSEDLLSTLIQSFGHLGQTQILERCIEHIWQISPQEFPSHVVIKHRG 361

Query: 331 --VTSDLLTAIVSAYSKCGKSIQPGLVIADKFFGKIPNIIVKDDFWINLQK-----WNII 383
              +S +L +I+ ++      +  GL I D F    P++ +   FW  L +     W   
Sbjct: 362 CYPSSKILVSILVSFYFNDHDLHRGLSILDSFIKHYPDVKLDALFWRRLFQLSHFAWTPA 421

Query: 384 LPNKWRSTIDLSKRTWELMKSWRNSTNNGGFITANVEFLNLVYKVLSSDYIKLKDLEWIY 443
              K  S +    R W LMK W  S       + + E L  +Y ++     K  +     
Sbjct: 422 NDKKATSVV----RCWHLMKQWYASKRLRP--SVDYETLRQLYDIMK----KTGNFPLGI 471

Query: 444 DI---FQHSLVTLYSKNSLTVDEIKLLKKFQIFTIKKMVYFGHYSKCLQFIKEWSYDAAN 500
           D+   F+  +    ++N+  V+ I  + K+Q   IK++V  G +S   +FI  + +D   
Sbjct: 472 DVLRSFKPGIERTRAENAGKVNNI--IIKYQKCIIKELVNRGRFSAVREFIDSYGFDRKM 529

Query: 501 KQQLTNLFVV----LRNRYLQKRGYNQEKEMTKVQ-KKYDEEEQEDMLLGGLW 548
            + L N+F      LR++ ++ +  N+ KE  KV+   +D++E + M++G LW
Sbjct: 530 TKDL-NIFCANRMFLRSKKMKNKIENK-KEREKVRLDSFDDDEDDGMIIGSLW 580

>TPHA0I00290 Chr9 complement(55148..56857) [1710 bp, 569 aa] {ON}
           Anc_8.847 YMR282C
          Length = 569

 Score =  107 bits (267), Expect = 7e-24,   Method: Compositional matrix adjust.
 Identities = 126/483 (26%), Positives = 206/483 (42%), Gaps = 72/483 (14%)

Query: 109 QLLQDSNVSIQEFSSMIQPVLNRTNLV-----------GKYHMGYLSKLMQIYISLTRTH 157
           +LL+   ++  EFS  +  +++R   +           GK H   + KL Q+Y       
Sbjct: 116 ELLESKQLTFNEFSIFLNRLIDRKGFIYDSIVLKEFPNGK-HSEMVFKLFQLY---GNAI 171

Query: 158 NGGSVDALNKDDMNKFIKRFIEGSQLKRAQTALQFLLDGYKERGEDLLGPYGDKQTIAHF 217
               +  L+  DMN FI+ FI    L RA+  L F+L+    +   +L  Y D  T+ H+
Sbjct: 172 GSDKLSLLSLRDMNLFIEFFINEGHLGRAEIVLTFVLN----KTRSILDLY-DVDTVTHY 226

Query: 218 LMLRSGALQDLW-------KIDVSNGNNKKQAFYKINGSHRN--VKST--YNVLDSVKLF 266
           L LR GAL   W       ++   +    + + YK     +N  VK T  Y +LD + + 
Sbjct: 227 LQLRCGALPRYWMFQNKSAELAYKDKFGNRLSKYKTRLGRKNFAVKLTNRYKILDPLGVL 286

Query: 267 EIVRYILRYND-KDNHSQPVYFDEGILKNVILCLGYVGQTTLIEDIINKIWELD------ 319
           +I   I+  +  K NHS        +   V+  L Y GQ + I   IN  W +D      
Sbjct: 287 KIANKIITDDKWKSNHSAK------LDATVVYSLCYSGQLSNIPSYINSRWNVDISMSDG 340

Query: 320 ----SVSVPPKYNITVTSDLLTAIVSAYSKCGKSIQPGLVIADKFFGKIPNIIVKDDFWI 375
                  +  + +  + S+++ AI+S+YS   KSI+  + I DK     PN+ +   FW 
Sbjct: 341 NSDVGTQISNEASKPLPSEVMEAILSSYSYDDKSIERAINIIDKIMNSYPNLELNQQFWR 400

Query: 376 NLQKWNIILPNKWRSTIDL----------SKRTWELMKSWRNSTNNGGFITANVEFLNLV 425
            L +W+++    W   +D           + + +  M+S R + + G       E   LV
Sbjct: 401 RLMQWSVLC---WDHKLDRKGSLVYGCFKTLKKYHEMRSIRINFDEGLL----QELYTLV 453

Query: 426 YKVLSSDYIKLKDLEWIYDIFQHSLVTLYSKNSLTVDEIKLLKKFQIFTIKKMVYFGHYS 485
           Y   +S        E++   F          + +T  E KLL  FQ  +I  M+    Y 
Sbjct: 454 YYTKNSRIAAEVVSEFMPQFFYK------RSDEITFGERKLLFYFQKRSIDGMLGKKDYF 507

Query: 486 KCLQFIKEWSYDAANKQQLTNLFVVLRNRYLQKRGYNQEKEMTKVQKKYDEEEQEDMLLG 545
               FI++WS D  NK++L   +     + LQK   N  ++  K +K  D  +++D LLG
Sbjct: 508 TASNFIEKWSMDNQNKEELFKYYKDSIAKKLQKVRRNSLQQKIK-EKLEDHSDEDDTLLG 566

Query: 546 GLW 548
            LW
Sbjct: 567 RLW 569

>Ecym_4618 Chr4 complement(1210600..1212183) [1584 bp, 527 aa] {ON}
           similar to Ashbya gossypii ABL119C
          Length = 527

 Score = 99.4 bits (246), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 100/404 (24%), Positives = 179/404 (44%), Gaps = 45/404 (11%)

Query: 145 KLMQIYISLTRTHNGGSVDALNKDDMNKFIKRFIEGSQLKRAQTALQFLLDGYKERGEDL 204
           KL Q Y+++           +   D+NKF   F+  ++LK A+  LQ +L   ++ G + 
Sbjct: 134 KLYQFYMAILEREKKTRFTPMELHDLNKFSNWFLNENKLKLARKVLQQIL---RQTGSEQ 190

Query: 205 LGPYGDKQTIAHFLMLRSGALQDLWKIDVSNGNNKKQAFYK--INGSHRNVKSTYNVLDS 262
           L    D QT+  +  L  G+L  LW          + A Y   + GS R     YN L  
Sbjct: 191 LP--RDHQTLVTYFQLYLGSLASLWPTP-----KVQSACYDKLVRGSRRPKYVVYNSLPE 243

Query: 263 VKLFEIVRYILRYNDKDNHSQPVYFDEGILKNVILCLGYVGQTTLIEDIINKIWELDSVS 322
             ++++++ +L  ND   H +    D  IL +  LC  +  +  L E  + + W +  V 
Sbjct: 244 GIMYDVLQKLLE-NDDWKHLRSSELDAKILYS--LC--HYNRMDLFEGFMERAWGI--VD 296

Query: 323 VPPKYNITVT----------SDLLTAIVSAYSKCGKSIQPGLVIADKFFGKIPNIIVKDD 372
            P K    V           S++L AIV+++S     ++  + + D F  K P + ++ +
Sbjct: 297 HPKKVEKEVPVDISSGTYPGSEVLIAIVTSFS-YRNDLEKAVRLVDAFLNKYPQMDLRTE 355

Query: 373 FWINLQKWN-IILPNKWRSTIDLSKRTWELMKSWRNSTNNGGFITANVEFLNLVYKVL-- 429
           FW  L  W  ++   K      L K  W  M SW  S   G  +  +    +  Y++L  
Sbjct: 356 FWEKLFLWTRVMFDRKLDPLGSLQKACWLRMLSWYKS--RGESVPYSSYLASCRYEILKQ 413

Query: 430 SSDYIKLKDLEWIYDIFQHSLVTLYSKNSLTVDEIKLLKKFQIFTIKKMVYFGHYSKCLQ 489
           +S+Y   KD      +F   +  +Y+K++     + +++K+Q F I+++   G    C Q
Sbjct: 414 TSNY---KD---AMAMFPDYMSAVYAKSAAAKHNLTVVRKYQKFVIRELSARGKRDACTQ 467

Query: 490 FIKEWSYDAANKQQLTNLFVVLRNRYLQKRGYNQEKEMTKVQKK 533
           FI++W ++  N+++L + F     R+  K    QEK  +  + K
Sbjct: 468 FIEQWRFNEENEKELQDTF----QRHWNKYTIRQEKRRSSARNK 507

>NCAS0C00370 Chr3 (54433..55920) [1488 bp, 495 aa] {ON} Anc_8.847
           YMR282C
          Length = 495

 Score = 94.4 bits (233), Expect = 8e-20,   Method: Compositional matrix adjust.
 Identities = 106/457 (23%), Positives = 211/457 (46%), Gaps = 51/457 (11%)

Query: 102 GSVEDAIQLLQDSNVSI------QEFSSMIQPVLNRTNLVGKYHMGYLSKLMQIYISLTR 155
           G ++D I ++ +  VSI      +E+S  +  VL+  +     ++  + +L +IY    R
Sbjct: 80  GRIKDLISMILNPMVSIHEHFTLEEYSLFLGKVLSMKD--SDVNVNVVFQLFEIY---AR 134

Query: 156 THNG-GSVDALNKDDMNKFIKRFIEGSQLKRAQTALQFLLDGYKERGEDLLGPYGDKQTI 214
            + G GS++AL   D+NK IK FI+  QLK+ Q  L F++  Y   G + +  + D  ++
Sbjct: 135 MYCGEGSLNALQIYDLNKLIKYFIKRDQLKQGQIVLDFIIMKYG--GIENMIAHRDLISL 192

Query: 215 AHFLMLRSGALQDLWKIDVSNGNNKKQAFYKINGSHRNVKSTYNVLDSVKLFEIVRYILR 274
            + L L++G+L   WK +   G N +          R  +  Y  LD   L +I   +L 
Sbjct: 193 NNHLKLKNGSLVKDWKFE---GKNLRYL------QSRQGRLNYKFLDGWSLLKIADLVL- 242

Query: 275 YNDKDNHSQPVYFDEGILKNVILCLGYVGQTTLIEDIINKIWELDSVSVPPKYNITVTSD 334
            ND      P+     +  ++I  LG++ Q  L++  I+++W  ++   P    +   ++
Sbjct: 243 -ND------PMKCQNVLTNSIIYSLGHLRQVELLDHFIDQMWMQETR--PRNGLLYPDTN 293

Query: 335 LLTAIVSAYSKCGKSIQPGLVIADKFFGKIPNIIVKDDFWINLQKWNIIL-PNKWRSTID 393
            + AI+++Y     ++     + D+   K   +     FW  L +W I+  PN  +  I 
Sbjct: 294 NIIAIITSYCYNYGNMDKSFDVLDRILEKYSGLKFDKFFWRRLFQWCILTEPNANKGFI- 352

Query: 394 LSKRTWELMKSWRNSTNNGGFITANVEFLNLVYKVLSSDYIKLKDLEWIYDIFQHSLVTL 453
              + W LM+               VEF  ++ ++L    +K++D+     + +  ++ L
Sbjct: 353 -LGQCWSLMEK-----------QEKVEFDGVLLELLREKIVKVRDVPLALRVLKMIVIEL 400

Query: 454 YSKNSLTVDEIKLLKKFQIFTIKKMVYFGHYSKCLQFIK--EWSYDAANKQQLTNLFVVL 511
              N +   +++LL K+Q F   K+       K ++ +   +++ +  NK  +   +   
Sbjct: 401 KKVNFINELDMELLLKYQKFVFSKLGEINKTVKAMELLSCDDYTINKENKAFMRAYYFEN 460

Query: 512 RNRYLQKRGYNQEKEMTKVQKKYDEEEQEDMLLGGLW 548
           +    +K   + + +   +Q+KYDE ++EDM++G LW
Sbjct: 461 KREKRKKNKRSNQYD--DLQRKYDEMDEEDMIIGKLW 495

>NDAI0K00340 Chr11 complement(64928..66802) [1875 bp, 624 aa] {ON}
           Anc_8.847 YMR282C
          Length = 624

 Score = 92.4 bits (228), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 111/433 (25%), Positives = 189/433 (43%), Gaps = 58/433 (13%)

Query: 157 HNGGSVDALNKDDMNKFIKRFIEGSQLKRAQTALQFLLDGYKERGEDLLGPYGDKQTIAH 216
           +N   ++ L   D+N+FIK F+   QLK+AQ  L +++D +   G + L    D  T+ +
Sbjct: 209 NNTNQLNPLMVYDLNQFIKYFLREGQLKKAQLVLDYIIDRFG--GIEQLIKSKDLTTLDN 266

Query: 217 FLMLRSGALQDLWK-IDVSNGNNKKQAFYKINGSHRNVKS--TYNVLDSVKLFEIVRYIL 273
            L L++GA+   WK +  S  N   Q    +     N K    Y  LD   L +I+  +L
Sbjct: 267 HLKLKNGAIYKNWKPLTDSESNTFLQYRLSLEDKSHNFKGFKNYKFLDGWSLLKIIDMVL 326

Query: 274 RYNDKDNHSQPVYFDEGILKNVILCLGYVGQTTLIEDIINKIWEL---DSVSVP----PK 326
              DK  H   +  +E IL      LG + Q   +E  I +IW++   D+V        K
Sbjct: 327 --TDK-THCLNI-LNESIL----YSLGTLRQIEFMEHFIKQIWDVHPDDAVEERNHQLDK 378

Query: 327 YNITVTSDLLTAIVSAYSKCGKSIQPGLVIADKFFGKIPNIIVK----DDFWINLQKWNI 382
           YN+   ++ L AI+++Y +  KS+    ++ DK   K P  +      + FWI + +W I
Sbjct: 379 YNLPPDTNELIAILTSYCQTYKSMDRAFLLLDKLIQKYPEPMKSRLNDNKFWIKMLQWGI 438

Query: 383 ILPNK-----WRSTID----------LSKRTWELMKSWRNSTNNGGFITANVEFLNLVYK 427
            + +K       +TID          L  +    ++ W+   + G  +   +  L+ + K
Sbjct: 439 KIADKNGNNVNGTTIDNCLEIMEEWFLKGKKKTALEHWKIDDDYGSIL---INLLHNIMK 495

Query: 428 VLSSDYIKLKDLEWIYDIFQHSLVTLYSKNSLTVDEIKLLKKFQIFTIKKMVYFGHYSKC 487
              +  I LK +E      +   V  Y + +LT     +L   Q    +K+   G Y+K 
Sbjct: 496 ERKNVDIGLKAIENFVQKLKLGSVNKYYERNLT----HVLYGLQKCIFRKIAESGSYNKG 551

Query: 488 LQFIKEWSY--DAANKQQLTNLFVVLRNRYLQKRGY----------NQEKEMTKVQKKYD 535
           L  I   +Y  ++  +  L   ++        KR             ++ E  K+Q+KYD
Sbjct: 552 LALIDNGAYTQNSGVESMLREYYITTVKEIRSKRSRRNKAQSNIQDREQDEFEKLQQKYD 611

Query: 536 EEEQEDMLLGGLW 548
           E E+E M++G LW
Sbjct: 612 EIEEEGMIIGKLW 624

>TBLA0B03310 Chr2 complement(772555..774396) [1842 bp, 613 aa] {ON}
           Anc_8.847 YMR282C
          Length = 613

 Score = 81.6 bits (200), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 100/375 (26%), Positives = 171/375 (45%), Gaps = 47/375 (12%)

Query: 157 HNGGSVDALNKDDMNKFIKRFIEGSQLKRAQTALQFLLDGYKERGEDLLGPYGDKQTIAH 216
           H+   ++ +   D+NK I  FI+  QLK+A TAL ++L  Y    E    P  D +TI +
Sbjct: 216 HSSTPLNPIQLYDLNKVITWFIKAGQLKKATTALMYILKRY--NAEIFQIP--DSKTIIN 271

Query: 217 FLMLRSGALQDLWKIDVSN----GNNKKQAFYKI--NGSHRNVKSTYNVLDSVKLFEIVR 270
           FL L  G L   W+I+  N     N  K++F K+  N S+  + S+Y  +      +IV 
Sbjct: 272 FLKLYCGGLPTNWRIEPINHRFIKNQGKRSF-KLGNNSSYYRLPSSYKAVYEKVPIQIVE 330

Query: 271 YILRYNDKDNHSQPVY-------FDEGILKNVILCLGYVGQTTLIEDIINKIWELDSVSV 323
           +I +  +    S  ++       FD  +    I  L  +G+  L E      W  DS   
Sbjct: 331 HIKKNTNDMKLSGKLFHFIRTGEFDSTL----IYSLTSLGRFDLAEQYFKDNWLSDSCD- 385

Query: 324 PPKYNITVTSDLLTAIVSAYS-KCGKSIQPGLVIADKFFGKIPNIIVKDDFWINLQKWNI 382
               ++ +TSD++ AI S+Y      +I+    +  +   + P++ +    W  + +WNI
Sbjct: 386 ----DVELTSDIVIAIFSSYVYNNSNNIEKANKLIQEIIKRYPDLHLNISTWCRIIRWNI 441

Query: 383 ILPNKWRSTIDLSKR----TWELMKSW------RNSTNNGGFITANVEFLNLVYKVLSSD 432
            +   W +T D +      ++  M ++      RNST     I  N   L  +Y + ++ 
Sbjct: 442 QM---WDTTTDFNGEIPYDSFYTMLTYYSNYCSRNSTFKSCHIPYNKMLLGDLYHLFNTK 498

Query: 433 YIKLKDLEWIYD-IFQHSLVTLYSKNSLTVDEIKLLKKFQIFTIKKMVYFGHYS--KCLQ 489
            I L    +I D  F+ SL    SK  +T  + ++L K+Q   +K ++     +  K L 
Sbjct: 499 -ISLNKCLFIMDNCFKKSLFKTPSK--VTTKDYQILLKYQKMILKYLINDRKLTSNKPLD 555

Query: 490 FIKEWSYDAANKQQL 504
           FI+++S D  NK+QL
Sbjct: 556 FIEKYSLDTNNKEQL 570

>KLLA0D01408g Chr4 (120712..122268) [1557 bp, 518 aa] {ON} weakly
           similar to uniprot|P22136 Saccharomyces cerevisiae
           YMR282C AEP2 Mitochondrial protein likely involved in
           translation of the mitochondrial OLI1 mRNA exhibits
           genetic interaction with the OLI1 mRNA 5'- untranslated
           leader
          Length = 518

 Score = 73.9 bits (180), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 93/389 (23%), Positives = 166/389 (42%), Gaps = 57/389 (14%)

Query: 169 DMNKFIKRFIEGSQLKRAQTALQFLLDGYKERGEDLLGPYGDKQTIAHFLMLRSGALQDL 228
           D+N+F++ FI  + L  A+   Q +L   K  GE       D QTI  +L L  GAL +L
Sbjct: 151 DLNQFVRMFINLNDLPLARNVFQLILKNSKN-GEIP----KDVQTICMYLRLYCGALSEL 205

Query: 229 WKIDVSNGNNKKQAFYK--------INGSHRNVKS--TYNVLDSVKLFEIVRYILRYNDK 278
           W    S      + FY+         N S   + S   Y  +  V  F+++   L  + +
Sbjct: 206 WTTQTS------RNFYQDLIGSLSGSNASSIRIPSHIAYPTI-GVPQFQLLLRKLVEDPE 258

Query: 279 DNHSQPVYFDEGILKNVILCLGYVGQTTLIEDIINKIWELD-SVSV----PPKYNITVTS 333
            +  +    D  I++     LG+  +   ++  I+  + +D +V++    P    +T  S
Sbjct: 259 YSKLRNTEMDSLIIQ----ALGHYKEVPFLKQYISIFYGIDENVTITETHPGIKKLTPDS 314

Query: 334 DLLTAIVSAYSKCGKSIQPGLVIADKFFGKIPNIIVKDDFWINLQKWNIILPNKWR-STI 392
            LL +++SAY     +I  G+ +   F  K P + +   FW     W++   NK++ S  
Sbjct: 315 QLLKSVISAYGH-NNNITSGMTVIGSFMEKYPEMNLDKSFWRTTIYWSLREWNKYKDSKG 373

Query: 393 DLSKRTWELMKSWRNSTNNGGFITANVEFLNLVYKVLSSDY-IKLKDLEWIYD-IFQHSL 450
              K+ W LM +W  +          +    L +     D+   ++D++ ++  IF  + 
Sbjct: 374 SQPKKAWNLMLNWYATIGKAVPFDQKIMLYRLSFLKSRKDHNAAIRDVQQVFKRIFIKT- 432

Query: 451 VTLYSKNSLTVDEIKLLKKFQIFTIKKMVYFGHYSKCLQFIKEWSYDAANKQQLTNLFVV 510
                KN+  V+ + +L  +Q F IK +V     +KC+ FI EW  D  N + L   F  
Sbjct: 433 ----EKNTFIVERL-VLYAYQRFIIKNLVNQNENAKCVDFINEWRIDFENGRYLERYF-- 485

Query: 511 LRNRYLQKRGYNQEKEMTKVQKKYDEEEQ 539
                         KE+T  + + DE+++
Sbjct: 486 --------------KELTHPKNESDEQKK 500

>KNAG0J00230 Chr10 (30660..32084) [1425 bp, 474 aa] {ON} Anc_8.847
           YMR282C
          Length = 474

 Score = 63.9 bits (154), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 84/354 (23%), Positives = 146/354 (41%), Gaps = 65/354 (18%)

Query: 169 DMNKFIKRFIEGSQLKRAQTALQFLLDGYKERGEDLLGPYGDKQTIAHFLMLRSGALQDL 228
           D N     FI  +QLK+AQ  + FLL       +D+     D   I ++  LR G+    
Sbjct: 140 DFNLMCDYFIACNQLKKAQLIMDFLLQ------QDV---KFDVFMIKNYTKLRCGS---- 186

Query: 229 WKIDVSNGNNKKQAFYKINGSHRNVKSTYNVLDSVKLFEIVRYILRYNDKDNHSQPVYFD 288
                   NNK                 Y V D   +F+++  +      +   +  +++
Sbjct: 187 -SFGKQTLNNK----------------AYKVFDQNTVFQLIGKV------EADRKFAFWN 223

Query: 289 EGILKNVILCLGYVGQTTLIEDIINKIWELDSVSVPPKYNITV-----------TSDLLT 337
             I+ +    LGY    TL+E  I  +W + S+      NI +           +S +L 
Sbjct: 224 NEIVSS----LGYTNNITLMEIYIWDLWRI-SIHDHSTENIKIDHLQQGDAMYPSSKVLA 278

Query: 338 AIVSAYSKCGKSIQPGLVIADKFFGKIPNIIVKDDFWINLQKWNIILPNKWRSTIDLSK- 396
            IVS+Y++  ++++  + I ++F    P +++   FW  L    I    K   + D S+ 
Sbjct: 279 TIVSSYARHDQTMKRAVDIVERFAKSYPKLLLNVHFWSTLLNCAI----KCGGSKDPSQF 334

Query: 397 -RTWELMKSWRNSTNNGGFITANVEFLNLVYKVLSSDYIKLKDLEWIYDIFQHSLVTLY- 454
              W LMK W   T     +      L  + + +     +  +L    DI Q+ L  LY 
Sbjct: 335 LACWNLMKKWH--TQRSKLMPFQSALLVTILRYMR----QTSNLHGTVDILQYWLGPLYL 388

Query: 455 SKNSLTVDEIKLLKKFQIFTIKKMVYFGHYSKCLQFIKEWSYDAANKQQLTNLF 508
            + ++   E  +L K+Q   ++K+V    Y+ C  FI +WS DA+NK+ L   +
Sbjct: 389 KRGNIPEFERDVLIKYQKQILRKLVDKRKYNWCTAFIDQWSIDASNKEDLEAFY 442

>ABL119C Chr2 complement(175840..177453) [1614 bp, 537 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YMR282C
           (AEP2)
          Length = 537

 Score = 45.4 bits (106), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 68/337 (20%), Positives = 129/337 (38%), Gaps = 20/337 (5%)

Query: 169 DMNKFIKRFIEGSQLKRAQTALQFLLDGYKERGEDLLGPYGDKQTIAHFLMLRSGALQDL 228
           D N F + F+  S+L+ A+T    L+    E    L     D +TI   L L  GA    
Sbjct: 189 DANSFARWFMAESKLRLARTVFAELVGNPTE----LAKLPRDTETIITLLQLHLGAKHIF 244

Query: 229 WKIDVSNGNNKKQAFYKINGSHRNVKSTYNVLDSVKLFEIVRYILRYNDKDNHSQPVYFD 288
           W+     GN+  +       +H  V + YN L      E +  +LR    D   + V   
Sbjct: 245 WR---DPGNSVGRGGQLFTPAHMAVVTAYNSLGE----ETLLRLLRLLQSDPQWKSVCSP 297

Query: 289 EGILKNVILCLGYVGQTTLIEDIINKIWELDSVSVP-PKYNITVTSDLLTAIVSAYSKCG 347
           + + +N+IL L +  +  L+     + +   +     P   +     L+ A+V+A++   
Sbjct: 298 D-LDRNIILALAFHNRLDLVHAQAARYYAPAAPGHGLPSTPLLPDGALVGAVVTAFAFKH 356

Query: 348 KSIQPGLVIADKFFGKIPNIIVKDDFWINLQKWNIILPNKWRSTIDLSKRTWELMKSWRN 407
           +  Q GL IA +F  +  ++  + + W  +  W             L    W  M++   
Sbjct: 357 QLAQ-GLAIAYQFLDRFTHLPNEHELWKIIFTWLARRHPTGSQGAALYDEAWSKMRT--R 413

Query: 408 STNNGGFITANVEFLNLVYKVLSSDYIKLKDLEWIYDIFQHSLVTLYSKNSLTVDEIKLL 467
              +G     +       Y+++  D      L  +  +    +  LY + ++   +  LL
Sbjct: 414 YAEHGQPTPYDYSIARASYRIVRRD----SSLRRVRALLNDYMSPLYQQPAVAPRDRLLL 469

Query: 468 KKFQIFTIKKMVYFGHYSKCLQFIKEWSYDAANKQQL 504
            K Q   + ++V     S    F+ +W+ D+  +  L
Sbjct: 470 LKCQAHIVGRLVRARRNSAAADFVDQWALDSEARSHL 506

>Kwal_47.18098 s47 (685497..686621) [1125 bp, 374 aa] {ON} YIL035C
           (CKA1) - alpha subunit of casein kinase II [contig 198]
           FULL
          Length = 374

 Score = 32.0 bits (71), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 20/71 (28%), Positives = 33/71 (46%), Gaps = 5/71 (7%)

Query: 363 KIPNIIVKDDFWINLQKWNIILPNKWRSTIDLSKRTWELMKSWRNSTNNGGFITANVEFL 422
           KI  ++  DDF   L+K+ I LP ++       +R W      R   +    ++ N E L
Sbjct: 283 KIVRVLGSDDFENYLRKYQITLPQEFHDIDQYIRRPWH-----RFVNDANSHLSGNEEIL 337

Query: 423 NLVYKVLSSDY 433
           NL+  +L  D+
Sbjct: 338 NLIDNLLRYDH 348

>SAKL0H25190g Chr8 complement(2196842..2198137) [1296 bp, 431 aa]
           {ON} similar to uniprot|P53095 Saccharomyces cerevisiae
           YGL196W Hypothetical ORF
          Length = 431

 Score = 31.6 bits (70), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 21/83 (25%), Positives = 38/83 (45%), Gaps = 2/83 (2%)

Query: 384 LPNKWRSTIDLSKRTWELMKSWRNSTNNGGFITANVEFLNLVYKVLSSDYIKLKDLEWIY 443
           L N  +  +  S + W L       T+  G  +   EF NL+ K+ S +  ++ DL   Y
Sbjct: 147 LDNLVKFGVPPSGKKWSLFVKVDMGTHRAGVASGTTEFGNLLAKIASPEVREVADLYGFY 206

Query: 444 DIFQH--SLVTLYSKNSLTVDEI 464
               H  S+ T+   +++ ++EI
Sbjct: 207 AHAGHSYSVETIKDAHNILIEEI 229

>TPHA0A03760 Chr1 (821355..824855) [3501 bp, 1166 aa] {ON} Anc_3.330
           YPR049C
          Length = 1166

 Score = 32.0 bits (71), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 17/48 (35%), Positives = 32/48 (66%), Gaps = 1/48 (2%)

Query: 427 KVLSSDYIKLKDLEWIYDIFQHSLVTLYSKNSLTVDEIKLLK-KFQIF 473
           K L ++ + + DL+  Y++F H+L T+  K+ L++ E ++LK K +IF
Sbjct: 511 KYLKNELLNIADLDNFYEMFNHNLDTIPVKSELSIKESEILKSKLRIF 558

>CAGL0D02838g Chr4 complement(296403..298907) [2505 bp, 834 aa] {ON}
           highly similar to uniprot|Q07844 Saccharomyces
           cerevisiae YLL034c
          Length = 834

 Score = 31.6 bits (70), Expect = 6.6,   Method: Compositional matrix adjust.
 Identities = 20/57 (35%), Positives = 31/57 (54%), Gaps = 5/57 (8%)

Query: 227 DLWKIDVSNGNNKKQAFYKINGSHRNVKSTYNVLDSVKLFEIVRYILRYNDKDNHSQ 283
           D  K+D   GN++K +  +IN     +K+T N++D + L  I R+I  Y D  N  Q
Sbjct: 445 DKNKLDSVEGNSQKDSDSEIN-----LKNTANMIDPLPLSVIQRFIHNYPDPLNDDQ 496

>ZYRO0G19404g Chr7 complement(1612850..1614139) [1290 bp, 429 aa]
           {ON} similar to uniprot|P53095 Saccharomyces cerevisiae
           YGL196W Hypothetical ORF
          Length = 429

 Score = 31.2 bits (69), Expect = 7.6,   Method: Compositional matrix adjust.
 Identities = 21/76 (27%), Positives = 35/76 (46%), Gaps = 10/76 (13%)

Query: 396 KRTWELMKSWRNSTNNGGFITANVEFLNLVYKVLSSDYIKLKDLEWIYDIFQHSLVTLYS 455
           ++ W +       T+  G +  + EFL L+ K LS +  ++ +L   Y    HS    YS
Sbjct: 156 RQKWSVFIKVDMGTHRAGLVADSAEFLELLQKTLSPEVTEVVELYGFYAHAGHS----YS 211

Query: 456 KNSLT------VDEIK 465
            +S+       +DEIK
Sbjct: 212 SSSMEDAHKYLIDEIK 227

>NDAI0C02430 Chr3 complement(556233..559415) [3183 bp, 1060 aa] {ON}
           Anc_5.215 YLL003W
          Length = 1060

 Score = 31.2 bits (69), Expect = 9.7,   Method: Compositional matrix adjust.
 Identities = 33/127 (25%), Positives = 60/127 (47%), Gaps = 8/127 (6%)

Query: 422 LNLVYKVLSSDYIKLKDLEWIYDIFQHSLVTLYSKNSLTVDEIKLLKKFQIFTIKK--MV 479
           +N   K+L  D I+   L+ I   F   L    ++N L     K++KK+ +  IKK    
Sbjct: 407 VNFHNKLLKKDVIRTWQLKRIQKTFDKKL----NENRLNCMFRKIIKKWDVIKIKKERAT 462

Query: 480 YFGHYSKCLQFIKEWSYDAANKQQLTNLFVVLRNRYLQKRGYNQEKEMTKVQKK--YDEE 537
               + +   ++K W+ +    Q   N  V L NR++++   N  K + K +K+    +E
Sbjct: 463 VTNIFFQRSHYLKIWTSNTEKSQIKINELVSLENRFIKQTKMNNLKNIMKRKKQEYITKE 522

Query: 538 EQEDMLL 544
           + +D+LL
Sbjct: 523 KLDDILL 529

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.320    0.136    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 62,288,766
Number of extensions: 2919241
Number of successful extensions: 12005
Number of sequences better than 10.0: 78
Number of HSP's gapped: 12399
Number of HSP's successfully gapped: 78
Length of query: 548
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 433
Effective length of database: 40,294,809
Effective search space: 17447652297
Effective search space used: 17447652297
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 68 (30.8 bits)