Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
CAGL0M03047g8.846ON30430415400.0
Smik_13.4948.846ON3042804947e-60
KNAG0J002408.846ON2862964883e-59
Suva_13.4708.846ON3032844894e-59
NDAI0K003308.846ON3132504852e-58
TPHA0I002808.846ON3012874694e-56
KAFR0B039608.846ON2782764622e-55
YMR281W (GPI12)8.846ON3042794591e-54
ZYRO0G14300g8.846ON2802714543e-54
Skud_13.4538.846ON3002804521e-53
TBLA0B033008.846ON3192704419e-52
NCAS0C003808.846ON2762674256e-50
SAKL0D01320g8.846ON2602734185e-49
TDEL0B005208.846ON2682724142e-48
Kwal_27.102278.846ON2542764132e-48
Ecym_46178.846ON2492623974e-46
ABL120W8.846ON2492693966e-46
KLTH0C03740g8.846ON2542753959e-46
Kpol_1068.48.846ON2912443901e-44
KLLA0D01430g8.846ON2632393837e-44
NDAI0H025907.68ON148257750.84
NDAI0H038902.42ON58241712.1
Skud_4.1834.267ON981117712.2
Kwal_56.239208.324ON937108676.2
NDAI0C014005.474ON70589677.5
KAFR0A009801.357ON64297667.6
Kpol_1035.281.315ON326150659.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0M03047g
         (304 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0M03047g Chr13 (346435..347349) [915 bp, 304 aa] {ON} weakly...   597   0.0  
Smik_13.494 Chr13 (815351..816265) [915 bp, 304 aa] {ON} YMR281W...   194   7e-60
KNAG0J00240 Chr10 complement(32153..33013) [861 bp, 286 aa] {ON}...   192   3e-59
Suva_13.470 Chr13 (815029..815940) [912 bp, 303 aa] {ON} YMR281W...   192   4e-59
NDAI0K00330 Chr11 (63765..64706) [942 bp, 313 aa] {ON} Anc_8.846...   191   2e-58
TPHA0I00280 Chr9 (54103..55008) [906 bp, 301 aa] {ON} Anc_8.846 ...   185   4e-56
KAFR0B03960 Chr2 (829312..830148) [837 bp, 278 aa] {ON} Anc_8.84...   182   2e-55
YMR281W Chr13 (832339..833253) [915 bp, 304 aa] {ON}  GPI12ER me...   181   1e-54
ZYRO0G14300g Chr7 (1145709..1146551) [843 bp, 280 aa] {ON} simil...   179   3e-54
Skud_13.453 Chr13 (805536..806438) [903 bp, 300 aa] {ON} YMR281W...   178   1e-53
TBLA0B03300 Chr2 (771332..772291) [960 bp, 319 aa] {ON} Anc_8.84...   174   9e-52
NCAS0C00380 Chr3 complement(55971..56801) [831 bp, 276 aa] {ON} ...   168   6e-50
SAKL0D01320g Chr4 complement(99898..100680) [783 bp, 260 aa] {ON...   165   5e-49
TDEL0B00520 Chr2 complement(94560..95366) [807 bp, 268 aa] {ON} ...   164   2e-48
Kwal_27.10227 s27 complement(249716..250480) [765 bp, 254 aa] {O...   163   2e-48
Ecym_4617 Chr4 (1209745..1210494) [750 bp, 249 aa] {ON} similar ...   157   4e-46
ABL120W Chr2 (175065..175814) [750 bp, 249 aa] {ON} Syntenic hom...   157   6e-46
KLTH0C03740g Chr3 complement(323371..324135) [765 bp, 254 aa] {O...   156   9e-46
Kpol_1068.4 s1068 complement(6124..6999) [876 bp, 291 aa] {ON} c...   154   1e-44
KLLA0D01430g Chr4 complement(122369..123160) [792 bp, 263 aa] {O...   152   7e-44
NDAI0H02590 Chr8 (635376..639824) [4449 bp, 1482 aa] {ON}              33   0.84 
NDAI0H03890 Chr8 (955857..957605) [1749 bp, 582 aa] {ON} Anc_2.4...    32   2.1  
Skud_4.183 Chr4 (322130..325075) [2946 bp, 981 aa] {ON} YDL073W ...    32   2.2  
Kwal_56.23920 s56 (776647..779460) [2814 bp, 937 aa] {ON} YLR129...    30   6.2  
NDAI0C01400 Chr3 (292788..294905) [2118 bp, 705 aa] {ON} Anc_5.474     30   7.5  
KAFR0A00980 Chr1 complement(182578..184506) [1929 bp, 642 aa] {O...    30   7.6  
Kpol_1035.28 s1035 complement(66045..67025) [981 bp, 326 aa] {ON...    30   9.6  

>CAGL0M03047g Chr13 (346435..347349) [915 bp, 304 aa] {ON} weakly
           similar to uniprot|P23797 Saccharomyces cerevisiae
           YMR281w GPI12 N-acetylglucosaminyl phosphatidylinositol
           deacetylase
          Length = 304

 Score =  597 bits (1540), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 291/304 (95%), Positives = 291/304 (95%)

Query: 1   MLKRPNTPTMKSIRNFPFSXXXXXXXXXXXXXQVLYIYFTPKVEDLNKENLTKLLPTHDN 60
           MLKRPNTPTMKSIRNFPFS             QVLYIYFTPKVEDLNKENLTKLLPTHDN
Sbjct: 1   MLKRPNTPTMKSIRNFPFSKLLFKLTKLTIIFQVLYIYFTPKVEDLNKENLTKLLPTHDN 60

Query: 61  FGVLNLVIAHPDDEIMFFSPTILQLIDHVQELNVVCLSNGDADGLGELRAKELKDAIGYL 120
           FGVLNLVIAHPDDEIMFFSPTILQLIDHVQELNVVCLSNGDADGLGELRAKELKDAIGYL
Sbjct: 61  FGVLNLVIAHPDDEIMFFSPTILQLIDHVQELNVVCLSNGDADGLGELRAKELKDAIGYL 120

Query: 121 TVNRNLRNVSLNILDYTDGQNEVWSGVATDLKKYILTSEPGVKQKDIILTFDREGISGHR 180
           TVNRNLRNVSLNILDYTDGQNEVWSGVATDLKKYILTSEPGVKQKDIILTFDREGISGHR
Sbjct: 121 TVNRNLRNVSLNILDYTDGQNEVWSGVATDLKKYILTSEPGVKQKDIILTFDREGISGHR 180

Query: 181 NHIACNEGVISYLKTIKSNSFVFLELKSLSTWQIISKYSGVVPKLLEIIYNKIRASNKTF 240
           NHIACNEGVISYLKTIKSNSFVFLELKSLSTWQIISKYSGVVPKLLEIIYNKIRASNKTF
Sbjct: 181 NHIACNEGVISYLKTIKSNSFVFLELKSLSTWQIISKYSGVVPKLLEIIYNKIRASNKTF 240

Query: 241 VSYLPNRDSIATDSNVCFISTFDQYALSFAAMCYAHKSQMVWFRYLWWSFSRYVFVNDLS 300
           VSYLPNRDSIATDSNVCFISTFDQYALSFAAMCYAHKSQMVWFRYLWWSFSRYVFVNDLS
Sbjct: 241 VSYLPNRDSIATDSNVCFISTFDQYALSFAAMCYAHKSQMVWFRYLWWSFSRYVFVNDLS 300

Query: 301 RITV 304
           RITV
Sbjct: 301 RITV 304

>Smik_13.494 Chr13 (815351..816265) [915 bp, 304 aa] {ON} YMR281W
           (REAL)
          Length = 304

 Score =  194 bits (494), Expect = 7e-60,   Method: Compositional matrix adjust.
 Identities = 113/280 (40%), Positives = 164/280 (58%), Gaps = 21/280 (7%)

Query: 34  VLYIYFTPKVEDLNKENLTKLLPTHDNFGVLNLVIAHPDDEIMFFSPTILQLIDHVQE-- 91
           +LYIYFTPK+   N E+L  + P   +   +NL+IAHPDDE+MFFSP I QL  +     
Sbjct: 27  ILYIYFTPKIISRNNESLQHVFPNKYSDYQINLIIAHPDDEVMFFSPMISQLHSYFPNTV 86

Query: 92  -LNVVCLSNGDADGLGELRAKELKDAIGYLTVNRNLRNVSLNILDYTDGQNEVWS--GVA 148
             N++CLS G+A+GLG+ R +EL D+   L    N R VS+ ++D+ DG NEVW    + 
Sbjct: 87  PFNIICLSKGNAEGLGQTRVRELNDSAALLL--HNERAVSVQVMDFQDGMNEVWDIDSIT 144

Query: 149 TDLKKYILTSEPGVKQKDIILTFDREGISGHRNHIACNEGVISYL---------KTIKSN 199
           + L + I  +   + Q  II+TFD  G+SGH NH +C+  V   +         K +K+ 
Sbjct: 145 STLSQTIGINNNELNQ--IIVTFDSYGVSGHINHKSCHTAVRKLIADYTRSNVRKEVKTP 202

Query: 200 SFVFLELKSLSTWQIISKYSGVVPKLLEIIYNKIRASNKTFVSYLPNRDSIATDSNVCFI 259
               L L+S     I+ KY+  + ++L ++Y  I    KT    LP+ D +A  +++  +
Sbjct: 203 LITALYLRSYKN-NIVLKYNSFIWEILRMLYGLISPFRKT-TQALPS-DVVAEKNSLLLM 259

Query: 260 STFDQYALSFAAMCYAHKSQMVWFRYLWWSFSRYVFVNDL 299
           +T  QY L+FAAM  AHKSQ+VWFRY WW  SR+VFVN+ 
Sbjct: 260 NTHAQYILAFAAMLNAHKSQVVWFRYGWWILSRFVFVNEF 299

>KNAG0J00240 Chr10 complement(32153..33013) [861 bp, 286 aa] {ON}
           Anc_8.846 YMR281W
          Length = 286

 Score =  192 bits (488), Expect = 3e-59,   Method: Compositional matrix adjust.
 Identities = 121/296 (40%), Positives = 165/296 (55%), Gaps = 22/296 (7%)

Query: 16  FPFSXXXXXXXXXXXXXQVLYIYF-TPKVEDLNKENLTKLLPTHDNFGVLNLVIAHPDDE 74
           F FS              +LYIY  T K+   N  NL + L  HD    +NLVIAHPDDE
Sbjct: 4   FNFSRFIYKVTKLSLLLGILYIYASTSKIGSFNYTNL-ETLGEHD-INSVNLVIAHPDDE 61

Query: 75  IMFFSPTILQLIDHVQE----LNVVCLSNGDADGLGELRAKELKDAIGYLTVNRNLRNVS 130
           +MFF+P+++ L + +++     N++C SNG ADGLG +R +EL D+I  L   RN    S
Sbjct: 62  VMFFAPSLINLNEQIRDPSTVFNIICFSNGGADGLGNVREQELSDSIAMLLPTRN---TS 118

Query: 131 LNILDYTDGQNEVWSGVATDLKKYILTSEPGVKQ--KDIILTFDREGISGHRNHIACNEG 188
           + +LD+ DG  E W     D+K+ I      V +   +++LTFD +G+SGH NHIAC   
Sbjct: 119 IVVLDFKDGMKEKW-----DVKEMIAKLRNIVPKLGHNVLLTFDGKGVSGHLNHIACYRA 173

Query: 189 VISYLKTIKS-NSFVFLELKSLSTWQIISKYSGVVPKLLEIIYNKIRASNKTFVSYLPNR 247
            + Y    KS      L L+S S   I+ KYS  + +L++++Y+    S    V  LP R
Sbjct: 174 ALGYYNEFKSKQKLTVLSLQSYSK-NIVKKYSSYIWELIKLLYSSWVPSRLGNV--LPKR 230

Query: 248 DSIATDSNVCFISTFDQYALSFAAMCYAHKSQMVWFRYLWWSFSRYVFVNDLSRIT 303
            S      +   ST+ QY LS AAM  AHK+Q+VWFRY WW FSR VFVNDL  I+
Sbjct: 231 GS-NVARKITIFSTYPQYVLSLAAMLNAHKTQVVWFRYGWWFFSRLVFVNDLDVIS 285

>Suva_13.470 Chr13 (815029..815940) [912 bp, 303 aa] {ON} YMR281W
           (REAL)
          Length = 303

 Score =  192 bits (489), Expect = 4e-59,   Method: Compositional matrix adjust.
 Identities = 114/284 (40%), Positives = 164/284 (57%), Gaps = 20/284 (7%)

Query: 34  VLYIYFTPKVEDLNKENLTKLLPTHDNFGVLNLVIAHPDDEIMFFSPTILQLIDHVQE-- 91
           VLYIYFTPK+   N ++L  + P  D    +NLVIAHPDDE+MFFSP I QL  +  +  
Sbjct: 25  VLYIYFTPKILSRNTDSLQHVFPHRDRNSQINLVIAHPDDEVMFFSPVISQLHAYFPDTV 84

Query: 92  -LNVVCLSNGDADGLGELRAKELKDAIGYLTVNRNLRNVSLNILDYTDGQNEVW--SGVA 148
             N++CLS GDA+GLGE RAKEL D+   L   RN R VS+ ++D+ DG +EVW    + 
Sbjct: 85  PFNILCLSKGDAEGLGETRAKELNDSAVLLL--RNERPVSVQVMDFEDGMDEVWDIDSIT 142

Query: 149 TDLKKYILTSEPGVKQKDIILTFDREGISGHRNHIACNEGVISYL--------KTIKSNS 200
           + L + I  +   V Q  II+TFD  G+S H NH +C+  V  ++        K    N+
Sbjct: 143 STLSQTIDVNNEKVSQ--IIVTFDSYGVSNHINHKSCHIAVEKFIDDYVGSKTKEKAENA 200

Query: 201 FV-FLELKSLSTWQIISKYSGVVPKLLEIIYNKIRASNKTFVSYLPNRDSIATDSNVCFI 259
            +  L L+S     I  KY+  + ++L+++Y  +    ++ +  L    +    + +  +
Sbjct: 201 HITALYLRSYKN-NIFLKYNSFIWEILKMLYRTVSPFGRS-IQPLAAPSTTTEKNGLLLM 258

Query: 260 STFDQYALSFAAMCYAHKSQMVWFRYLWWSFSRYVFVNDLSRIT 303
           +T  QY L+FAAM  AHKSQ+VWFRY WW  SR+VFVN+    T
Sbjct: 259 NTHSQYILAFAAMLNAHKSQVVWFRYGWWILSRFVFVNEFDIFT 302

>NDAI0K00330 Chr11 (63765..64706) [942 bp, 313 aa] {ON} Anc_8.846
           YMR281W
          Length = 313

 Score =  191 bits (485), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 111/250 (44%), Positives = 156/250 (62%), Gaps = 22/250 (8%)

Query: 64  LNLVIAHPDDEIMFFSPTILQL---IDHVQELNVVCLSNGDADGLGELRAKELKDAIGYL 120
           L+LVIAHPDDE+MFF+PT+LQL   +      N++C S+GDA+GLG LR KEL D+I  L
Sbjct: 63  LSLVIAHPDDELMFFAPTLLQLNRFLPTSIPFNIICFSDGDAEGLGYLRRKELHDSINLL 122

Query: 121 TVNRNLRNVSLNILDYTDGQNEVWSG--VATDLKKYILTSEPGVKQKDIILTFDREGISG 178
             + N R ++++ILD+ DG ++VW G  + + L+  +L + P   + +I+LTFD  GIS 
Sbjct: 123 LSSSNNRKINISILDFIDGMDQVWDGKQLLSSLQNELLVNVPPSIKNNILLTFDANGISN 182

Query: 179 HRNHIACNEGV---ISY-LKTIKSNSFVFLELKSLS-----TWQIISKYSGVVPKLLEII 229
           H NHIACN+ V   ISY     K  + + L L S S        ++SKY+  V  L+++ 
Sbjct: 183 HPNHIACNKAVHDLISYDGGKDKEMNIIGLMLSSKSDEYNIVMNLLSKYTFFVIDLVKVY 242

Query: 230 YNKIRASNKTFVSYLPNRDSIATDSNVCFISTFDQYALSFAAMCYAHKSQMVWFRYLWWS 289
           +N    +  T    +PN  S+     + FI+T+ QY LS+A+M   HKSQMVWFRY WW 
Sbjct: 243 WNLATGTFNT----IPNSASLE----LSFINTYSQYILSYASMLNTHKSQMVWFRYGWWW 294

Query: 290 FSRYVFVNDL 299
           FSR+VF NDL
Sbjct: 295 FSRFVFSNDL 304

>TPHA0I00280 Chr9 (54103..55008) [906 bp, 301 aa] {ON} Anc_8.846
           YMR281W
          Length = 301

 Score =  185 bits (469), Expect = 4e-56,   Method: Compositional matrix adjust.
 Identities = 115/287 (40%), Positives = 169/287 (58%), Gaps = 21/287 (7%)

Query: 34  VLYIYFTPKVEDLNKENL---TKLLPTHDNFGVLNLVIAHPDDEIMFFSPTILQLID--- 87
           +LYI+ TP +EDLN ++     +L  +  +   +NL+IAHPDDE+MFF+PT+LQL D   
Sbjct: 16  ILYIWLTPHIEDLNLKSFYSNVQLNISQQSLKSVNLIIAHPDDEVMFFTPTLLQLDDILP 75

Query: 88  -HVQELNVVCLSNG-DADG--LGELRAKELKDAIGYLTVNRNL---RNVSLNILDYTDGQ 140
            HV   NV+CLS G D DG  +G+LR+ E+ D++  L  +R     R V L+  +Y DG 
Sbjct: 76  THV-PFNVICLSKGVDVDGRAVGDLRSNEIMDSLTMLLGHRRAGLNREVKLHQFEYEDGM 134

Query: 141 NEVW--SGVATDLKKYILTSEPGVKQKDIILTFDREGISGHRNHIACNEGVISYLKTIKS 198
           ++ W  S V TD++  I         K  +LTFD +G+S H NHIAC + +++ LK   S
Sbjct: 135 DKQWDISKVVTDIQNTISMESNVDGLKHWLLTFDAQGVSEHPNHIACYDAMMT-LKQKSS 193

Query: 199 N--SFVFLELKSLSTWQIISKYSGVVPKLLEIIYNKIRASNKTF-VSYLPNRDSIATDSN 255
           N   ++ + L S  +  II KYS  +P + +++ N I    + F +  +P          
Sbjct: 194 NPGDYLLMTLNSYGS-NIILKYSSFLPVVFKLLINIINDKFRIFELKQVPFLSMHKEHDQ 252

Query: 256 VCFISTFDQYALSFAAMCYAHKSQMVWFRYLWWSFSRYVFVNDLSRI 302
           + FI+TF  Y ++ ++M  +H SQMVWFRY WWSFSR+VFVNDL  I
Sbjct: 253 IQFINTFPHYIMALSSMLNSHTSQMVWFRYGWWSFSRFVFVNDLHII 299

>KAFR0B03960 Chr2 (829312..830148) [837 bp, 278 aa] {ON} Anc_8.846
           YMR281W
          Length = 278

 Score =  182 bits (462), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 114/276 (41%), Positives = 159/276 (57%), Gaps = 26/276 (9%)

Query: 35  LYIYFTPKVEDLNKENLTKLLPT----HDNFGVLNLVIAHPDDEIMFFSPTILQLIDHVQ 90
           LYI  +PK++  N + L   +P+      N   L LV+AHPDDE+MFFSPT+LQL  H+ 
Sbjct: 21  LYIVLSPKIQLSNDQILNTFIPSLIKDRSNDPSLTLVVAHPDDEVMFFSPTLLQLDSHLP 80

Query: 91  ---ELNVVCLSNGDADGLGELRAKELKDAIGYLTVNRNLRNVSLNILDYTDGQNEVWSGV 147
              + N++  S+GDA+GLG LR+ EL  +I  L   RN     + I ++TDG NEVW   
Sbjct: 81  PNCKFNIISYSDGDAEGLGSLRSNELAHSIDMLIPRRN---KEIFIFNHTDGMNEVWDN- 136

Query: 148 ATDLKKYILTSEPGVKQKDIILTFDREGISGHRNHIACNEGVISYLKTIKSNSFVFLELK 207
              L  + L S     Q +I+LTFD+ G+S H NH AC++ V SY+++   N+F  L L 
Sbjct: 137 --KLMLHQLESILSDSQTNILLTFDQFGVSNHINHKACHQVVTSYIQSHAKNNFALL-LD 193

Query: 208 SLSTWQIISKYSGVVPKLLEIIYNKIRASNKTFVSYLPNRDSIATDSNVCFISTFDQYAL 267
           S S+  ++ KY+G   +L+ +  N      KT    LPN D +A        + +  Y  
Sbjct: 194 SYSS-NLLKKYTGFAWQLVFLAKN-YWIHGKT----LPNLDHLA------LFNPYSDYIT 241

Query: 268 SFAAMCYAHKSQMVWFRYLWWSFSRYVFVNDLSRIT 303
           ++A M  AHKSQMVWFRY WW FSR+V+VNDL   T
Sbjct: 242 AYATMLKAHKSQMVWFRYGWWFFSRFVYVNDLKLYT 277

>YMR281W Chr13 (832339..833253) [915 bp, 304 aa] {ON}  GPI12ER
           membrane protein involved in the second step of
           glycosylphosphatidylinositol (GPI) anchor assembly, the
           de-N-acetylation of the
           N-acetylglucosaminylphosphatidylinositol intermediate;
           functional homolog of human PIG-Lp
          Length = 304

 Score =  181 bits (459), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 105/279 (37%), Positives = 158/279 (56%), Gaps = 19/279 (6%)

Query: 34  VLYIYFTPKVEDLNKENLTKLLPTHDNFGVLNLVIAHPDDEIMFFSPTILQLIDHVQE-- 91
           +LYIYFTPK+   N  +L  + P       +NLVIAHPDDE+MFFSP I QL  +     
Sbjct: 27  ILYIYFTPKIVSRNNASLQHIFPHKYGDYEINLVIAHPDDEVMFFSPIISQLNSYFPRTV 86

Query: 92  -LNVVCLSNGDADGLGELRAKELKDAIGYLTVNRNLRNVSLNILDYTDGQNEVWS--GVA 148
             N++CLS G+A+GLGE R +EL ++   L    N R VS+ ++D+ DG +E+W    + 
Sbjct: 87  PFNIICLSKGNAEGLGETRVRELNESAALLL--HNERAVSVQVMDFQDGMDEIWDIDSIT 144

Query: 149 TDLKKYILTSEPGVKQKDIILTFDREGISGHRNHIACNEGVISYL------KTIKSNSFV 202
           + L + I      + Q  II+TFD  G+S H NH +C   V   +      KT ++    
Sbjct: 145 SSLSQKIDIKNHNLNQ--IIVTFDSYGVSNHINHKSCYAAVKKLVDDYAQPKTKRNEQPP 202

Query: 203 FLELKSLSTWQ--IISKYSGVVPKLLEIIYNKIRASNKTFVSYLPNRDSIATDSNVCFIS 260
            +    L +++  I+ KY+  + ++L+I+Y+ I    +   +  PN  + A    +  ++
Sbjct: 203 HVTALYLRSYKNNIVLKYNSFIWEILKILYDLISPFRRIIQALPPN--TAAEKDKLSLMN 260

Query: 261 TFDQYALSFAAMCYAHKSQMVWFRYLWWSFSRYVFVNDL 299
           T  QY L+FA M  AH+SQ+VWFRY WW FSR+VFVN+ 
Sbjct: 261 THAQYVLAFATMLNAHESQVVWFRYGWWIFSRFVFVNEF 299

>ZYRO0G14300g Chr7 (1145709..1146551) [843 bp, 280 aa] {ON} similar
           to uniprot|P23797 Saccharomyces cerevisiae YMR281W GPI12
           ER membrane protein involved in the second step of
           glycosylphosphatidylinositol (GPI) anchor assembly the
           de-N-acetylation of the N-
           acetylglucosaminylphosphatidylinositol intermediate
           functional homolog of human PIG-Lp
          Length = 280

 Score =  179 bits (454), Expect = 3e-54,   Method: Compositional matrix adjust.
 Identities = 109/271 (40%), Positives = 153/271 (56%), Gaps = 16/271 (5%)

Query: 34  VLYIYFTPKVEDLNKENLTKLLPTHDNFGVLNLVIAHPDDEIMFFSPTILQLIDHVQ--- 90
           VL+I F+ +++  N       L   D    L+LV+AHPDDE+MFF+PTIL+L   +    
Sbjct: 16  VLFIAFSVRIKSRNGSVFNDNLKFLDEIDSLSLVVAHPDDEVMFFAPTILELDSRLPPNV 75

Query: 91  ELNVVCLSNGDADGLGELRAKELKDAIGYLTVNRNLRNVSLNILDYTDGQNEVW--SGVA 148
           E NVVCLS G AD LG+ R +ELK+++  L  N   R   L   DY DG  E W    V 
Sbjct: 76  EFNVVCLSKGGADELGDTRVQELKESVNLLLANSK-RQYQLQQHDYPDGHEETWDQESVQ 134

Query: 149 TDLKKYILTSEPGVKQKDIILTFDREGISGHRNHIACNEGVISYLKTIKSNSFVFLELKS 208
           + +K  +L      ++  ++LTFD +G+S H NHIAC+E V S L   +SN    L L S
Sbjct: 135 STIKDSVLQG----RRSSVLLTFDDKGVSKHVNHIACHEAV-SNLVQDESNVKAALYLDS 189

Query: 209 LSTWQIISKYSGVVPKLLEIIYNKIRASNKTFVSYLPNRDSIATDSNVCFISTFDQYALS 268
                I+ KYS    ++ ++  +          SY  N+ +    + +  +S +  Y LS
Sbjct: 190 YGD-NIVLKYSAFFWEIWKLTRDWFLHRVLPTSSYNENKPA----TEITLMSDYSSYILS 244

Query: 269 FAAMCYAHKSQMVWFRYLWWSFSRYVFVNDL 299
           FA+M ++HKSQMVWFRY WW+FSR+VFVNDL
Sbjct: 245 FASMLHSHKSQMVWFRYGWWTFSRFVFVNDL 275

>Skud_13.453 Chr13 (805536..806438) [903 bp, 300 aa] {ON} YMR281W
           (REAL)
          Length = 300

 Score =  178 bits (452), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 110/280 (39%), Positives = 158/280 (56%), Gaps = 23/280 (8%)

Query: 34  VLYIYFTPKVEDLNKENLTKLLPTHDNFGVLNLVIAHPDDEIMFFSPTILQLIDHVQ--- 90
           +LYI+FTPK+   N E L  + P  +    +NLVIAHPDDE+MFFSP I QL  +     
Sbjct: 25  ILYIFFTPKIISRNDELLQHVFPHKNRDSQINLVIAHPDDEVMFFSPVISQLHSYFPITV 84

Query: 91  ELNVVCLSNGDADGLGELRAKELKDAIGYLTVNRNLRNVSLNILDYTDGQNEVW--SGVA 148
             N++CLS G+ADGLGE R KEL  +   L   +N R VS+ ++D+ DG +EVW  + + 
Sbjct: 85  PFNIICLSKGNADGLGESRVKELNGSAALLL--QNERPVSVQVMDFEDGMDEVWDINSIV 142

Query: 149 TDLKKYILTSEPGVKQKDIILTFDREGISGHRNHIACNEGV---ISYLKTIKSNS----- 200
           + + + I  S   + Q  II+TFD  G+S H NH +C+  V   I      K+ +     
Sbjct: 143 STISQTIDLSNEQLNQ--IIVTFDSYGVSDHINHKSCHTAVKRLIDRYAESKAETNEETP 200

Query: 201 -FVFLELKSLSTWQIISKYSGVVPKLLEIIYNKIRASNKTFVSYLPNRDSIATDSNVCFI 259
               L LKS     I+ KY+  + ++L+I+Y+ I      F   +    +    S +  +
Sbjct: 201 HITALYLKSYKN-NIVLKYNSFIWEILKILYSVIVP----FPKTIQPPTTTTQRSKLLLM 255

Query: 260 STFDQYALSFAAMCYAHKSQMVWFRYLWWSFSRYVFVNDL 299
           +T  QY L++AAM  AHKSQ+VWFRY WW  SR+VFVN+ 
Sbjct: 256 NTHAQYVLAYAAMLNAHKSQVVWFRYGWWILSRFVFVNEF 295

>TBLA0B03300 Chr2 (771332..772291) [960 bp, 319 aa] {ON} Anc_8.846
           YMR281W
          Length = 319

 Score =  174 bits (441), Expect = 9e-52,   Method: Compositional matrix adjust.
 Identities = 108/270 (40%), Positives = 151/270 (55%), Gaps = 31/270 (11%)

Query: 58  HDNFGVLNLVIAHPDDEIMFFSPTILQLIDHVQE---LNVVCLSNGDADGLGEL----RA 110
           H     L+L+IAHPDDEIMFFSPT+LQL +++++    NVVCLS G  D  G      R 
Sbjct: 51  HVKINSLSLIIAHPDDEIMFFSPTLLQLNNYLEKDIMFNVVCLSQG-LDSTGSFKDPQRV 109

Query: 111 KELKDAIGYL----TVNRNLRNVSLNILDYTDGQNEVWSG--VATDLKKYILTSEPGVKQ 164
            EL D++  L    + N + RN  L  LDYTDG  E+W+   +  DL + +  ++ G+  
Sbjct: 110 HELNDSLNLLFNRGSNNEHNRNFKLIQLDYTDGMKEIWNMDLIVDDLLQNLNFTDNGI-- 167

Query: 165 KDIILTFDREGISGHRNHIACNEGVISYLKTIKSNSFVFLELKSLSTWQIISKYSGVVPK 224
            +++LTFD+ G+S H+NH+ACNE V   LK    +S +     +  +     KYS  V K
Sbjct: 168 -NLLLTFDKSGVSNHKNHLACNEAVTKLLKYSNPDSNLIGIFLNSHSKNFFLKYSFFVSK 226

Query: 225 LLEIIYNKIRASNKTFVSY-LPNRD-------------SIATDSNVCFISTFDQYALSFA 270
           L  II  K   S   F S+  PN D             +  T+ +  F + F +Y LS++
Sbjct: 227 LFTIIKLKFFRSISLFYSFCFPNSDFLQSYQIISHYDLNTKTNLSFTFFNPFAKYMLSYS 286

Query: 271 AMCYAHKSQMVWFRYLWWSFSRYVFVNDLS 300
            M  AH+SQMVWFRYLWW FSR+ F+NDL+
Sbjct: 287 TMLNAHESQMVWFRYLWWIFSRFAFINDLT 316

>NCAS0C00380 Chr3 complement(55971..56801) [831 bp, 276 aa] {ON}
           Anc_8.846 YMR281W
          Length = 276

 Score =  168 bits (425), Expect = 6e-50,   Method: Compositional matrix adjust.
 Identities = 101/267 (37%), Positives = 154/267 (57%), Gaps = 27/267 (10%)

Query: 42  KVEDLNKENLTKLLPTHDNFGV-LNLVIAHPDDEIMFFSPTILQLIDHVQEL----NVVC 96
           ++E  N  N ++L     + G  LNLVIAHPDDE+MFF+PT+LQL D++  L    NV+C
Sbjct: 32  RIEQFNTLNYSQLNTKIFHEGTTLNLVIAHPDDEVMFFAPTLLQL-DNLMPLSIPINVIC 90

Query: 97  LSNGDADGLGELRAKELKDAIGYLTVNRNLRNVSLNILDYTDGQNEVWSGVATDLKKYIL 156
            SNGDA GLGE R  EL+ +I  L  N+   NV+  +L + DG +++W      + +Y+ 
Sbjct: 91  FSNGDAQGLGEKRQHELQSSIHALIQNQRQTNVT--VLHFQDGNDQIWD--IDQMTQYLP 146

Query: 157 TSEPGVKQKDIILTFDREGISGHRNHIACNEGVISYLKTIKSNSFVFLELKSLSTWQIIS 216
            ++         LTFD  G+SGH+NHIAC+  V +   T  +N+   L L S+    +++
Sbjct: 147 QND-----HQAFLTFDSHGVSGHKNHIACHNAVWNLKNT--NNNVTILTLDSIHH-SLLA 198

Query: 217 KYSGVVPKLLEIIYNKIRASNKTFVSYLPNRDSIATDSNVCFISTFDQYALSFAAMCYAH 276
           KY+  +  L+++ +N  +   +      P  +S      + F + + QY L+++ M  AH
Sbjct: 199 KYTFFIIDLVKLYWNLWKDQQQ------PQWES---HDKITFFNAYSQYILAYSTMLNAH 249

Query: 277 KSQMVWFRYLWWSFSRYVFVNDLSRIT 303
           KSQ+VWFRY WW+FSR+VF N L   T
Sbjct: 250 KSQVVWFRYGWWAFSRFVFSNHLKITT 276

>SAKL0D01320g Chr4 complement(99898..100680) [783 bp, 260 aa] {ON}
           similar to uniprot|P23797 Saccharomyces cerevisiae
           YMR281W GPI12 ER membrane protein involved in the second
           step of glycosylphosphatidylinositol (GPI) anchor
           assembly the de-N-acetylation of the N-
           acetylglucosaminylphosphatidylinositol intermediate
           functional homolog of human PIG-Lp
          Length = 260

 Score =  165 bits (418), Expect = 5e-49,   Method: Compositional matrix adjust.
 Identities = 101/273 (36%), Positives = 140/273 (51%), Gaps = 40/273 (14%)

Query: 34  VLYIYFTPKVEDLNKENLTKLLPTHDNFGVLNLVIAHPDDEIMFFSPTILQLIDHVQ--- 90
           VLYI  + ++   N++    + P+     V NL++AHPDDE MFFSPT+LQL  HV    
Sbjct: 19  VLYICVSQRIAAHNRQVFRNVFPSRTPTSV-NLIVAHPDDETMFFSPTLLQL--HVNYPP 75

Query: 91  --ELNVVCLSNGDADGLGELRAKELKDAIGYLTVNRNLRNVSLNILDYTDGQNEVWS--G 146
              L V+CL+NGDADGLG +R +EL+ ++  L      RN S+ +  + DG    W    
Sbjct: 76  SVPLRVICLTNGDADGLGAVREQELRLSMQLLL---PARNTSVIVEGFEDGMGVEWDTRQ 132

Query: 147 VATDLKKYILTSEPGVKQKDIILTFDREGISGHRNHIACNEGVISYLKTIKSNSFVFLEL 206
           V   + +++  + P      ++LTFD  G+SGH NH++CN  V + ++  +     F  L
Sbjct: 133 VVATINRHVSDASP------LLLTFDEHGVSGHVNHVSCNTAVSALVEQREQREQRFTAL 186

Query: 207 KSLSTWQIISKYSGVVPKLLEIIYNKIRASNKTFVSYLPNRDSIATDSNVCFISTFDQYA 266
              S      KY      L  II  +                         F+STF QY 
Sbjct: 187 YLNSKRYFPPKYGSFAVDLARIITGR---------------------QPPVFMSTFPQYL 225

Query: 267 LSFAAMCYAHKSQMVWFRYLWWSFSRYVFVNDL 299
           LS AAMC AH SQMVWFR+ WW  SR+VFVN+L
Sbjct: 226 LSLAAMCNAHVSQMVWFRWGWWLASRFVFVNEL 258

>TDEL0B00520 Chr2 complement(94560..95366) [807 bp, 268 aa] {ON}
           Anc_8.846 YMR281W
          Length = 268

 Score =  164 bits (414), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 99/272 (36%), Positives = 147/272 (54%), Gaps = 32/272 (11%)

Query: 34  VLYIYFTPKVEDLNKENLTKLLPTHDNFGVLNLVIAHPDDEIMFFSPTILQL---IDHVQ 90
           +LY+  T ++   N+    +          L L+IAHPDDE+MFFSP++LQL   +    
Sbjct: 19  ILYVALTARINGRNEVQWQQHAAAIGTPESLTLLIAHPDDEVMFFSPSLLQLDRLLPQSV 78

Query: 91  ELNVVCLSNGDADGLGELRAKELKDAIGYLTVNRNLRNVSLNILDYTDGQNEVWSGVATD 150
             N VCLS GDAD LGE R  EL+ ++  LT N   R   L   DY DG +E W     +
Sbjct: 79  RFNFVCLSKGDADHLGETRELELQRSLNLLTSNSQ-RKTQLYQFDYPDGFDEKW-----E 132

Query: 151 LKKYILTSEPGV---KQKDIILTFDREGISGHRNHIACNEGVISYLKTIKSNSFVFLELK 207
           ++  +   E  V      +++LTFD  G+S H NH+AC+  V   ++  K +  ++L   
Sbjct: 133 IESVVSIVESKVFIGSGFNLLLTFDAHGVSNHPNHVACHNAVARLIE--KGHKALYLNSH 190

Query: 208 SLSTWQIISKYSGVVPKLLEIIYNKIRASNKTFVSYLPNRDSIATDSNVCFISTFDQYAL 267
           S +   +  KYSG + +L+ ++ + +    +T                + F+++F QY L
Sbjct: 191 SRN---LPLKYSGFIWELIRMLSDSVMKLERT---------------GLTFMNSFPQYIL 232

Query: 268 SFAAMCYAHKSQMVWFRYLWWSFSRYVFVNDL 299
           +FAAM  AH+SQ+VWFRY WWS SR+VFVNDL
Sbjct: 233 AFAAMANAHESQLVWFRYGWWSLSRFVFVNDL 264

>Kwal_27.10227 s27 complement(249716..250480) [765 bp, 254 aa] {ON}
           YMR281W (GPI12) -
           N-acetylglucosaminylphosphatidylinositol de-N-acetylase
           [contig 39] FULL
          Length = 254

 Score =  163 bits (413), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 106/276 (38%), Positives = 149/276 (53%), Gaps = 50/276 (18%)

Query: 34  VLYIYFTPKVEDLNKENLTKLL----PTHDNFGVLNLVIAHPDDEIMFFSPTILQLIDHV 89
           ++YI  + ++E  N+  L  L     PT      +NLVIAHPDDE+MFF+PT+LQ+ + +
Sbjct: 16  LVYILGSVQIERSNRRALGSLFRGSAPTS-----INLVIAHPDDEVMFFAPTLLQIDEWL 70

Query: 90  Q---ELNVVCLSNGDADGLGELRAKELKDAIGYLTVNRNLRNVSLNILDYTDGQNEVW-- 144
               E+NV+ L++G ADGLG+LR KEL+D +  L   R     S+ +LD+ DG +  W  
Sbjct: 71  PGSIEVNVISLTDGGADGLGDLRTKELQDCVRLLLRKRK---ASVEVLDFLDGMDVEWDL 127

Query: 145 SGVATDLKKYILTSEPGVKQKDIILTFDREGISGHRNHIACNEGVISYLKTI-KSNSFVF 203
                 L++ IL   P      + LTFD  GISGH NHI+C + V    K   KS+ F  
Sbjct: 128 ERAVKALQERILDESP------LFLTFDENGISGHVNHISCYKAVQKVRKHYSKSSCF-- 179

Query: 204 LELKSLSTWQIISKYSGVVPKLLEIIYNKIRASNKTFVSYLPNRDSIATDSNVCFISTFD 263
              K +S   +  KYSG +P L             +F+S  P+            I++F 
Sbjct: 180 ---KLVSKRYLFEKYSGFIPALFH-----------SFISSSPS----------TLINSFR 215

Query: 264 QYALSFAAMCYAHKSQMVWFRYLWWSFSRYVFVNDL 299
           QY L+ ++M  AH SQMVWFRY WW FS YV+ N+L
Sbjct: 216 QYLLALSSMMNAHVSQMVWFRYGWWLFSYYVYANEL 251

>Ecym_4617 Chr4 (1209745..1210494) [750 bp, 249 aa] {ON} similar to
           Ashbya gossypii ABL120W
          Length = 249

 Score =  157 bits (397), Expect = 4e-46,   Method: Compositional matrix adjust.
 Identities = 94/262 (35%), Positives = 136/262 (51%), Gaps = 43/262 (16%)

Query: 43  VEDLNKENLTKLLPTHDNFGVLNLVIAHPDDEIMFFSPTILQLIDHVQE---LNVVCLSN 99
           +E  N +    L+ +H N+  + L+IAHPDDE+MFF+PT+LQL   + +     VVCL++
Sbjct: 26  LETHNSKVYEYLVGSHGNYTSVTLIIAHPDDEVMFFAPTLLQLDARMAQSVPFRVVCLTD 85

Query: 100 GDADGLGELRAKELKDAIGYLTVNRNLRNVSLNILDYTDGQNEVWSG--VATDLKKYILT 157
           GDADGLGE+R +EL  A+  L +    R+V + +  + DG +E W    V  +L + +  
Sbjct: 86  GDADGLGEVRRRELHKALRLLVLE---RDVEIQMGGFKDGMDEEWKMEVVREELAQVVTD 142

Query: 158 SEPGVKQKDIILTFDREGISGHRNHIACNEGVISYLKTIKSNSFVFLELKSLSTWQIISK 217
             P      ++LTFD  G+SGHRNHIAC             +  + L+    S   +I K
Sbjct: 143 RRP------LVLTFDERGVSGHRNHIACAHAAAKL-----GHHTLHLD----SGHNLIRK 187

Query: 218 YSGVVPKLLEIIYNKIRASNKTFVSYLPNRDSIATDSNVCFISTFDQYALSFAAMCYAHK 277
           YS     L  +++             +P            F+STF QY  S   M  AHK
Sbjct: 188 YSFFFVDLFRLLFGYP----------MPT----------VFLSTFSQYLHSLVTMLVAHK 227

Query: 278 SQMVWFRYLWWSFSRYVFVNDL 299
           SQMVWFR+ WW+ SRYV+ N+ 
Sbjct: 228 SQMVWFRWGWWTASRYVYANEF 249

>ABL120W Chr2 (175065..175814) [750 bp, 249 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR281W (GPI12)
          Length = 249

 Score =  157 bits (396), Expect = 6e-46,   Method: Compositional matrix adjust.
 Identities = 93/269 (34%), Positives = 137/269 (50%), Gaps = 43/269 (15%)

Query: 35  LYIYFTPKVEDLNKENLTKLLPTHDNFGVLNLVIAHPDDEIMFFSPTILQL---IDHVQE 91
           +Y +   ++E  N +   +L+        L LVIAHPDDE+MFF+PT+LQL   +     
Sbjct: 18  VYCWSRRRLERHNTQVFERLVGGDSQHTSLTLVIAHPDDEVMFFAPTLLQLDARLPAWMP 77

Query: 92  LNVVCLSNGDADGLGELRAKELKDAIGYLTVNRNLRNVSLNILDYTDGQNEVW--SGVAT 149
             VVCL++G A+GLG+LR  EL+ A+  L +  +   V+L + D+TDG  E W  + V T
Sbjct: 78  FRVVCLTDGGAEGLGQLRRAELQKALRLLVLEHD---VTLEVADFTDGMKEDWDLAEVRT 134

Query: 150 DLKKYILTSEPGVKQKDIILTFDREGISGHRNHIACNEGVISYLKTIKSNSFVFLELKSL 209
            L + +  ++P      ++LTFD  G+SGHRNHI C             +  +FL     
Sbjct: 135 RLGELVTDAKP------LVLTFDERGVSGHRNHIGCALAAARL-----GHKTLFLR---- 179

Query: 210 STWQIISKYSGVVPKLLEIIYNKIRASNKTFVSYLPNRDSIATDSNVCFISTFDQYALSF 269
           S   ++ KYS  V  +  +++                     T     F+ST  QY  + 
Sbjct: 180 SERNLLRKYSFFVLDVFRVVFG--------------------TPPPTVFVSTLAQYLHAL 219

Query: 270 AAMCYAHKSQMVWFRYLWWSFSRYVFVND 298
            AM  AH+SQMVWFR+ WW  SRYV+ N+
Sbjct: 220 VAMVVAHRSQMVWFRWGWWMASRYVYANE 248

>KLTH0C03740g Chr3 complement(323371..324135) [765 bp, 254 aa] {ON}
           weakly similar to uniprot|P23797 Saccharomyces
           cerevisiae YMR281W GPI12 ER membrane protein involved in
           the second step of glycosylphosphatidylinositol (GPI)
           anchor assembly the de-N-acetylation of the N-
           acetylglucosaminylphosphatidylinositol intermediate
           functional homolog of human PIG-Lp
          Length = 254

 Score =  156 bits (395), Expect = 9e-46,   Method: Compositional matrix adjust.
 Identities = 105/275 (38%), Positives = 149/275 (54%), Gaps = 48/275 (17%)

Query: 34  VLYIYFTPKVEDLNKENLTKLLPTHDNFGVLNLVIAHPDDEIMFFSPTILQLIDHVQE-- 91
           +LY   + +++  N++  T L     N   +NLVIAHPDDE+MFF+PT+LQL DH  +  
Sbjct: 16  ILYFASSARIKASNEQAFTTLFSVL-NPTSINLVIAHPDDEVMFFAPTLLQL-DHYFDTD 73

Query: 92  --LNVVCLSNGDADGLGELRAKELKDAIGYLTVNRNLRNVSLNILDYTDGQNEVWSGVAT 149
             ++V  L++G ADGLG+LR +EL+D++ +L   R  R   + +L++ DG    W     
Sbjct: 74  IPVSVFSLTDGGADGLGKLREEELRDSV-HLLFRR--RKAEVTVLNFEDGMKVEW----- 125

Query: 150 DLKKYILTSEPGVKQ----KDIILTFDREGISGHRNHIACNEGVISYLKT-IKSNSFVFL 204
           DL+K   TSE   KQ    + + LTFD  G+S H NHI+C E V +      +S SF   
Sbjct: 126 DLQK---TSEALRKQVVGDQPLFLTFDDHGVSSHINHISCYETVRNLRAAHPESRSFSLT 182

Query: 205 ELKSLSTWQIISKYSGVVPKLLEIIYNKIRASNKTFVSYLPNRDSIATDSNVCFISTFDQ 264
             +S     I  KY+  VP L+ ++    R S +                   F+STF Q
Sbjct: 183 SKRS-----IFQKYTAFVPSLITVL----RGSRQA-----------------VFMSTFKQ 216

Query: 265 YALSFAAMCYAHKSQMVWFRYLWWSFSRYVFVNDL 299
           Y L+ + M  AH SQMVWFRY WW FS YVF N++
Sbjct: 217 YLLALSVMMNAHTSQMVWFRYGWWFFSCYVFANEV 251

>Kpol_1068.4 s1068 complement(6124..6999) [876 bp, 291 aa] {ON}
           complement(6124..6999) [876 nt, 292 aa]
          Length = 291

 Score =  154 bits (390), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 95/244 (38%), Positives = 142/244 (58%), Gaps = 17/244 (6%)

Query: 64  LNLVIAHPDDEIMFFSPTILQLIDHVQ---ELNVVCLSNG---DADGLGELRAKELKDAI 117
           +NLVIAHPDDE+MFFSPT++QL + +     +NV+C S G   D    GE RA+ELK ++
Sbjct: 48  VNLVIAHPDDEVMFFSPTLMQLDNWLPNDVAINVICFSKGVNVDGSIAGESRARELKKSV 107

Query: 118 GYLTVNRNLRNVSLNILDYTDGQNEVWS--GVATDLKKYILTSEPGVKQKDIILTFDREG 175
             L    + R V+++ LDY DG++++W    +  DLK  I  S+   K+KD+++TFD  G
Sbjct: 108 SMLI--EHDRPVTVHQLDYKDGKDQIWDLDSMVWDLKTLINPSK-DYKRKDLLITFDEHG 164

Query: 176 ISGHRNHIACNEGVISYLKTIKSNSFVFLELKSLSTWQIISKYSGVVPKLLEIIYNKIRA 235
           +S H NHIAC+  V   ++  +   F+  +L+S ST  +I KYS    ++++  YN    
Sbjct: 165 VSDHPNHIACHNAVHRLIE--EEPLFMAYQLESHST-NVILKYSFFAREIVKYFYNYCHQ 221

Query: 236 SNKTFVSYLPNRDSIATDSNVCFISTFDQYALSFAAMCYAHKSQMVWFRYLWWSFSRYVF 295
             K   S   N D           +T  +Y +++A M  AH+SQ+VWFRY WW FSR  +
Sbjct: 222 RIKGQTSLNKNMD---VPYEYVLFNTHSEYIMAYATMLNAHESQVVWFRYGWWFFSRLTY 278

Query: 296 VNDL 299
            N+L
Sbjct: 279 ANEL 282

>KLLA0D01430g Chr4 complement(122369..123160) [792 bp, 263 aa] {ON}
           similar to uniprot|Q75DZ3 Ashbya gossypii ABL120W
           ABL120Wp and weakly similar to YMR281W uniprot|P23797
           Saccharomyces cerevisiae YMR281W GPI12 ER membrane
           protein involved in the second step of
           glycosylphosphatidylinositol (GPI) anchor assembly the
           de- N-acetylation of the N-
           acetylglucosaminylphosphatidylinositol intermediate
           functional homolog of human PIG-Lp
          Length = 263

 Score =  152 bits (383), Expect = 7e-44,   Method: Compositional matrix adjust.
 Identities = 94/239 (39%), Positives = 132/239 (55%), Gaps = 33/239 (13%)

Query: 64  LNLVIAHPDDEIMFFSPTILQ---LIDHVQELNVVCLSNGDADGLGELRAKELKDAIGYL 120
           + LV+AHPDDE+MFFSPT+ Q   L+     +NVVC++ GDADGLG +R +EL D+   L
Sbjct: 51  VTLVVAHPDDEVMFFSPTLTQFNELLPISIPINVVCMTAGDADGLGHIRKQELVDS---L 107

Query: 121 TVNRNLRNVSLNILDYTDGQNEVWSGVATDLKKYILTSEPGVKQKDIILTFDREGISGHR 180
            +  + R    ++LD+ DG + VW  V   L+K + +S P      ++LTFD+ G+SGH 
Sbjct: 108 RIMFHGRQFGCDVLDFEDGMDAVWDQVL--LEKQLRSSIP--DSNPLVLTFDQFGVSGHI 163

Query: 181 NHIACNEGVISYLKTIKSNSFVFLELKSLSTWQIISKYSGVVPKLLEIIYNKIRASNKTF 240
           NHI+C   V     + K      L L+S     I  KYS  +  + ++        +  +
Sbjct: 164 NHISCGRLVEKLPYSHK------LHLRS--DQPIYVKYSAFIAGIFQL------GISTVY 209

Query: 241 VSYLPNRDSIATDSNVCFISTFDQYALSFAAMCYAHKSQMVWFRYLWWSFSRYVFVNDL 299
             Y   R         CFIST  QY L+ +AM  AH SQMVWFR  WW FSR+ F+N+L
Sbjct: 210 PDYGKPR---------CFISTLPQYLLAASAMSLAHTSQMVWFRVGWWLFSRFCFINEL 259

>NDAI0H02590 Chr8 (635376..639824) [4449 bp, 1482 aa] {ON} 
          Length = 1482

 Score = 33.5 bits (75), Expect = 0.84,   Method: Compositional matrix adjust.
 Identities = 16/57 (28%), Positives = 33/57 (57%)

Query: 39   FTPKVEDLNKENLTKLLPTHDNFGVLNLVIAHPDDEIMFFSPTILQLIDHVQELNVV 95
             T +  +L KE +  +LP  +   V+N       +EI++F+ TI+ ++D++ +LN+ 
Sbjct: 1103 LTNETSNLIKEAIEGMLPHGNGADVINKTAKKNKNEILYFARTIIIILDYMSKLNLT 1159

>NDAI0H03890 Chr8 (955857..957605) [1749 bp, 582 aa] {ON} Anc_2.42
           YDL227C
          Length = 582

 Score = 32.0 bits (71), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 18/41 (43%), Positives = 22/41 (53%)

Query: 103 DGLGELRAKELKDAIGYLTVNRNLRNVSLNILDYTDGQNEV 143
           D  GE  AK +KD +  L  NR + N+ L  LDY DGQ   
Sbjct: 137 DSDGEKAAKLMKDDLNLLYGNRFIFNLQLRDLDYLDGQTRA 177

>Skud_4.183 Chr4 (322130..325075) [2946 bp, 981 aa] {ON} YDL073W
           (REAL)
          Length = 981

 Score = 32.0 bits (71), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 27/117 (23%), Positives = 49/117 (41%), Gaps = 14/117 (11%)

Query: 178 GHRNHIACNEGVISYLKTIKSNSFVFLELKSLSTWQIISKYSGVVPKLLEIIYNKIRASN 237
            H N  A N G  +++ + + N +VF   K++  W+ +   SG + K             
Sbjct: 363 SHPNFRALN-GNNAFITSERINDYVFSNFKTIKLWECLRSLSGCIVK------------- 408

Query: 238 KTFVSYLPNRDSIATDSNVCFISTFDQYALSFAAMCYAHKSQMVWFRYLWWSFSRYV 294
           +    YL N  S+   S V ++ST   Y    A + Y    Q + F++    F +++
Sbjct: 409 EGHPEYLENMLSLHESSLVDYVSTISAYDYVAANVIYNKIFQFIIFQFESLPFLKFI 465

>Kwal_56.23920 s56 (776647..779460) [2814 bp, 937 aa] {ON} YLR129W
           (DIP2) - interacts with Dom3p [contig 171] FULL
          Length = 937

 Score = 30.4 bits (67), Expect = 6.2,   Method: Compositional matrix adjust.
 Identities = 34/108 (31%), Positives = 50/108 (46%), Gaps = 18/108 (16%)

Query: 85  LIDHVQELNVVCLSNGD-----ADGL--GELRAKELKDA-IGYLTVNRNLRNVSLNILDY 136
           L   ++ +N   + +G+      DGL  G + AK  K A   YL  +   R +++    Y
Sbjct: 38  LTGALENVNCWSMKSGELIGTLTDGLPPGAVDAKSTKPAETSYLQYHPETRLLAVG---Y 94

Query: 137 TDGQNEVWSGVATDLKKYILTSEPGVKQKDIILTFDREG---ISGHRN 181
            DG  ++W      L K +L S  G K    ILTFD+ G   ISG R+
Sbjct: 95  NDGAIKIWDL----LSKSVLISFNGHKSAITILTFDQTGTRLISGSRD 138

>NDAI0C01400 Chr3 (292788..294905) [2118 bp, 705 aa] {ON} Anc_5.474
          Length = 705

 Score = 30.4 bits (67), Expect = 7.5,   Method: Compositional matrix adjust.
 Identities = 24/89 (26%), Positives = 41/89 (46%), Gaps = 4/89 (4%)

Query: 114 KDAIGYLTVNRNLRNVSLNILDYTDGQNEVWSGVATDLKKYILTSEPGVKQKDIILTFDR 173
           K+ I      R+ R+VSL I        ++  G  TD  K IL  +   K+  ++  F  
Sbjct: 345 KEIIHEYKTERDERDVSLPI----SITRQIGRGTKTDPDKIILIEKETEKKFGLMTAFGF 400

Query: 174 EGISGHRNHIACNEGVISYLKTIKSNSFV 202
           + +     H  C++  IS LK  ++N+F+
Sbjct: 401 KILQVSDLHYKCSDESISNLKEFQTNNFI 429

>KAFR0A00980 Chr1 complement(182578..184506) [1929 bp, 642 aa] {ON}
           Anc_1.357 YHR015W
          Length = 642

 Score = 30.0 bits (66), Expect = 7.6,   Method: Compositional matrix adjust.
 Identities = 25/97 (25%), Positives = 47/97 (48%), Gaps = 3/97 (3%)

Query: 82  ILQLIDHVQELNVVCLSNGDADGLGELRAKELKDAIGYLTVNRNLRNVSLN-ILDYTDGQ 140
           +L L  +VQE+         ++ + +   +++K AI YL +   ++  +LN I +Y    
Sbjct: 540 VLPLYRNVQEMPTSNFFRQKSEHVTDTLKRQIKRAINYLKIQIIVKEKNLNCIAEYI--V 597

Query: 141 NEVWSGVATDLKKYILTSEPGVKQKDIILTFDREGIS 177
           N  W G  T+L +Y+L     +  ++I+     E IS
Sbjct: 598 NVFWCGDLTNLSRYLLLLNTNIHYEEILHRQIEEAIS 634

>Kpol_1035.28 s1035 complement(66045..67025) [981 bp, 326 aa] {ON}
           complement(66045..67025) [981 nt, 327 aa]
          Length = 326

 Score = 29.6 bits (65), Expect = 9.6,   Method: Compositional matrix adjust.
 Identities = 41/150 (27%), Positives = 68/150 (45%), Gaps = 20/150 (13%)

Query: 92  LNVVCLSNGDADGLGELRAKELKDAIGYLTVNRNLRNVSLNILDYTDGQNEVWSGVATDL 151
           ++ V L  G + GLG+  AK+      Y    RN +     I+  +  + ++   + +D+
Sbjct: 6   VDQVVLITGGSQGLGKQFAKK------YYEEGRNCK-----IIIVSRSEQKLLKAI-SDI 53

Query: 152 KKYILTSEPGVKQKDIILTFDREGISGHRNHIACNE--GVISYLKTIK--SNSFVFLELK 207
             Y L   P +     +L+  ++ IS    + + NE     S L + K  +N F  L  K
Sbjct: 54  TYYPL---PDIDNNQFLLSVPKDSISTREINESGNELYYFPSDLGSYKGVANLFSILAEK 110

Query: 208 SLSTWQIISKYSGVVPKL-LEIIYNKIRAS 236
           SL   QIIS   G VPKL +E+   ++ A 
Sbjct: 111 SLLPTQIISCAGGSVPKLFVELTREELEAG 140

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.322    0.137    0.410 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 32,980,488
Number of extensions: 1449500
Number of successful extensions: 3766
Number of sequences better than 10.0: 40
Number of HSP's gapped: 3790
Number of HSP's successfully gapped: 41
Length of query: 304
Length of database: 53,481,399
Length adjustment: 109
Effective length of query: 195
Effective length of database: 40,982,805
Effective search space: 7991646975
Effective search space used: 7991646975
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 65 (29.6 bits)