Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
CAGL0M03025g8.845ON1254125460130.0
SAKL0D01342g8.845ON1270112516140.0
TDEL0B005308.845ON1301113016160.0
Suva_13.4688.845ON141899516100.0
NCAS0C003908.845ON1164107215570.0
YMR280C (CAT8)8.845ON1433100315510.0
KNAG0J002508.845ON1237108715210.0
Smik_13.4938.845ON1433100415260.0
KLTH0C03762g8.845ON1206108015090.0
Skud_13.4528.845ON1432100315200.0
Kwal_27.102328.845ON120993914431e-178
KAFR0B039508.845ON1246100013241e-160
ZYRO0G14278g8.845ON125096913121e-159
KLLA0D01452g8.845ON144576712911e-154
ABL121C8.845ON128596112351e-147
NDAI0K003908.845ON149570412011e-141
Ecym_46168.845ON15775109311e-103
Kpol_1016.201.277ON1086482105e-16
ZYRO0G15136g1.277ON1027482062e-15
AFR096W1.277ON852482024e-15
TPHA0I028201.277ON1044482025e-15
KLTH0D03564g1.277ON862481999e-15
Kwal_26.7397singletonOFF201481851e-14
SAKL0D05654g1.277ON919481981e-14
KLLA0F14322g1.277ON717481971e-14
KAFR0A014801.277ON725491972e-14
Ecym_63401.277ON952481972e-14
YJL089W (SIP4)1.277ON829481918e-14
Skud_10.1251.277ON833481891e-13
Suva_6.1611.277ON832481882e-13
Smik_10.1531.277ON829481873e-13
TDEL0D014501.277ON945481854e-13
TBLA0D054201.277ON757481837e-13
NDAI0G055301.277ON1186481802e-12
KNAG0B018401.277ON1072491802e-12
CAGL0L03377g1.277ON1209481722e-11
NCAS0A094101.277ON932451668e-11
KLTH0E08778gna 1ON8733531372e-07
Kwal_47.17681na 1ON8542291372e-07
KLLA0C10923g5.235ON775491301e-06
SAKL0G11902g5.235ON906481283e-06
NDAI0I023505.235ON889441283e-06
NCAS0D041906.279ON890451239e-06
Smik_12.775.235ON903441221e-05
TDEL0E039105.235ON862441221e-05
YLR014C (PPR1)5.235ON904441212e-05
Smik_6.4526.279ON878471212e-05
Kwal_23.4016singletonON6281511192e-05
YPL248C (GAL4)6.279ON881471202e-05
NDAI0F012206.279ON960451193e-05
KLLA0E13993gsingletonON678441193e-05
Skud_12.825.235ON899441193e-05
KNAG0D006906.279ON875451184e-05
KLTH0G07898g5.235ON866481184e-05
NDAI0I007406.279ON1033451184e-05
KLLA0F04609g2.231ON916331174e-05
TBLA0G018006.279ON1154451185e-05
TBLA0G026102.231ON1000331175e-05
KNAG0B051205.235ON888441175e-05
Kwal_23.29055.235ON881481175e-05
NCAS0D025405.235ON890441166e-05
KAFR0J017102.231ON848331166e-05
KAFR0F014901.128ON6582371166e-05
Suva_10.945.235ON906441166e-05
NCAS0B065502.231ON906331167e-05
KAFR0J006905.235ON864441158e-05
SAKL0C02024gsingletonON898481158e-05
Smik_9.392.231ON1012331158e-05
Kpol_1018.306.279ON881451159e-05
Skud_9.372.231ON954331159e-05
NDAI0B038502.231ON930331159e-05
YIL130W (ASG1)2.231ON964331159e-05
Suva_9.592.231ON926331159e-05
TDEL0C044802.231ON852331141e-04
Kwal_23.47542.231ON812331131e-04
KLTH0G09108g2.231ON782331131e-04
KNAG0E017602.231ON902331131e-04
SAKL0E08998g2.231ON823331131e-04
NCAS0D04860singletonON701391131e-04
Suva_16.596.279ON895431132e-04
TPHA0F013802.231ON8901791132e-04
Kpol_495.213.109ON1085371132e-04
TPHA0H019806.279ON993471132e-04
CAGL0G08844g2.231ON847411122e-04
NCAS0G011006.279ON935451122e-04
AGR280C6.75ON11061101122e-04
Kpol_1039.112.231ON992331122e-04
ZYRO0E08272g6.279ON794471112e-04
ZYRO0A10956g5.235ON855441112e-04
YGL013C (PDR1)4.113ON1068381112e-04
NDAI0A087907.17ON1059341103e-04
Smik_7.2774.113ON1069381094e-04
Skud_7.2744.113ON1080381094e-04
ZYRO0C18150g1.128ON571381085e-04
KLTH0H16170gna 2ON619331085e-04
KLLA0C03201g1.128ON6502661076e-04
SAKL0A02860g6.279ON745451076e-04
KLTH0E03256gsingletonON6741751077e-04
KLLA0D12672g6.279ON865451078e-04
Ecym_7440na 3ON898421078e-04
SAKL0H24860gna 4ON971821079e-04
KLTH0E14454gna 3ON902451060.001
TDEL0E00160singletonON631471050.001
Suva_7.2684.113ON1000381050.001
AER370W2.231ON801331050.001
CAGL0A00451g4.113ON1107371040.002
Smik_11.2402.654ON9761611040.002
TPHA0N002307.17ON1232331040.002
Smik_2.438na 5ON469451030.002
KLTH0D02222gna 6ON847471040.002
Ecym_53972.231ON826331030.002
Kpol_467.11.380ON12892721040.002
KNAG0E002107.17ON948331030.002
Kwal_8.580singletonON638291020.003
TBLA0C040504.113ON12072061020.003
KLLA0A09119g4.113ON1082361020.003
KAFR0F010406.279ON834471020.003
YKL015W (PUT3)2.654ON9791571020.003
SAKL0C03938g1.128ON780331010.004
KAFR0E023305.59ON704391010.004
YBR297W (MAL33)na 5ON468471000.004
ZYRO0E06270g2.565ON912461000.005
Kwal_14.778na 7ON6651421000.005
KLTH0E00440gsingletonON6882291000.005
KLTH0B10076gsingletonON6882291000.005
SAKL0A09856g2.547ON1020511000.006
CAGL0I07755g3.109ON105336990.006
Skud_15.546na 8ON54246990.006
KLLA0A02585gna 9ON37026980.006
Smik_1.137.17ON104633990.006
Smik_15.561na 8ON54647980.008
KLTH0H02684g6.279ON74945980.008
KAFR0C049807.17ON95141980.008
TDEL0C056801.128ON69130980.009
Smik_10.251.128ON772265980.009
KLLA0C18953gna 7ON703203980.009
AFL160C6.279ON64847970.010
CAGL0F02519g1.128ON832227970.011
KAFR0F034104.113ON99537970.011
TPHA0H012405.59ON87739970.011
KLTH0B00352gsingletonON93433970.011
Ecym_50177.17ON97846970.012
KAFR0I002307.17ON104533970.012
KLTH0D07260g2.547ON97951970.013
Suva_1.147.17ON104533970.013
NDAI0G041403.109ON100145970.013
YJL206C1.128ON758176960.014
Skud_10.101.128ON833105960.014
Klac_YGOB_39601.128aON81037960.015
Suva_16.25singletonON14345900.015
Ecym_8404na 4ON88570960.017
Skud_1.107.17ON104033960.017
TBLA0A012101.380ON142230960.017
Kwal_34.15751na 2ON62833950.017
Skud_11.2142.654ON981157950.017
ZYRO0C00726g7.17ON103533960.017
Skud_2.427na 5ON46838940.018
CAGL0M12298g7.17ON99446950.018
TBLA0A058601.128aON81046950.018
NCAS0A035804.113ON111337950.018
SAKL0D14520g7.17ON98333950.019
TBLA0A007302.654ON1037166950.019
TDEL0H043407.17ON98933950.019
SAKL0B04620gna 9ON36226940.020
Kwal_47.175064.113ON924133950.020
KLLA0F09559gsingletonON65841950.020
YAL051W (OAF1)7.17ON104733950.020
TBLA0A097606.75ON153043950.021
KNAG0I005601.128ON66333940.021
NCAS0I002707.17ON94434950.022
SAKL0D01100g4.113ON94045940.023
ACL058Wna 4ON817109940.023
YKL038W (RGT1)2.547ON117051940.024
Suva_6.2851.128ON786119940.024
KLLA0F02750g3.109ON114836940.025
NDAI0D035504.113ON111842940.025
SAKL0B06732gna 3ON87842940.026
KLLA0C04620g6.75ON126931940.028
CAGL0D02904g5.235ON88748940.028
TPHA0A06090singletonON84733930.029
NDAI0F00110singletonON50833930.029
ZYRO0G00308gsingletonON649165930.030
TDEL0D051503.109ON99641930.030
Smik_17.27singletonON68833930.030
SAKL0D14542gna 10ON94633930.030
ZYRO0E00572g2.654ON838174930.031
YOR380W (RDR1)na 8ON54637930.032
SAKL0H01958g5.59ON65839930.032
SAKL0B01870gsingletonON100934930.032
ADR403C7.17ON97033930.033
Ecym_31126.75ON1144108930.034
TBLA0E007007.17ON127433930.037
Suva_8.436na 8ON54537920.038
YGR288W (MAL13)na 11ON47330920.038
Kpol_1061.424.113ON112944920.040
NCAS0D029606.75ON117238920.042
TBLA0C062306.60ON79540920.046
KAFR0A021302.565ON70738920.046
SAKL0D00264g8.879ON84841920.046
TPHA0B036301.380ON142932920.047
Suva_15.773.109ON102941920.047
TPHA0N004407.56ON75739920.047
CAGL0F09229gna 12ON83533920.048
YLR278C6.75ON134131920.049
Skud_12.3616.75ON134231920.050
CAGL0J07150g7.17ON102233920.051
SAKL0F00418gsingletonON55945910.052
SAKL0H00682gna 13ON92246910.052
Smik_12.3576.75ON128831920.052
KLLA0F22990g1.380ON125330920.053
KLLA0D10153gsingletonON65530910.053
Suva_10.3766.75ON130231910.054
ZYRO0G22550gsingletonON72445910.054
SAKL0F16522gsingletonON708170910.056
KAFR0C032308.109ON40620900.056
KNAG0E041507.17ON113646910.057
NDAI0A034204.113ON110833910.057
SAKL0C09944g3.109ON106136910.058
Ecym_42868.283ON62749900.064
Suva_11.2132.654ON985157910.066
NDAI0D03540na 14ON110742910.067
KNAG0M009706.75ON117738910.068
NDAI0H019907.17ON116133900.070
TPHA0A045403.109ON117837900.070
Skud_7.627na 11ON47430900.070
ZYRO0A13596gsingletonON64831900.071
KAFR0G024506.75ON106831900.071
KLLA0A03421gna 10ON88047900.074
AER183Cna 3ON87942900.078
Kpol_538.427.17ON108842900.080
KLTH0E06666gna 4ON946237900.082
TBLA0B079205.59ON76739890.087
TBLA0G00490singletonON91838890.089
CAGL0K05841g1.380ON137230900.089
Skud_7.638singletonON47339890.090
Skud_15.643.109ON103241890.090
TBLA0B04800singletonON77726890.092
CAGL0F07865g8.423ON84429890.094
ZYRO0D06688g8.283ON59545890.100
TPHA0F026306.75ON126236890.10
KLLA0F19602g8.283ON60329880.10
Skud_11.1902.547ON117151890.10
TBLA0G011308.879ON113234890.10
Kpol_1009.56.75ON117831890.11
Suva_11.1872.547ON117151890.11
ZYRO0A03058g3.264ON73643880.11
NCAS0A076107.17ON102233890.11
Kpol_260.25.59ON75641880.12
KLLA0F10373g6.154ON34835870.12
Suva_2.517.389ON115546880.12
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0M03025g
         (1254 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0M03025g Chr13 complement(341849..345613) [3765 bp, 1254 aa]...  2320   0.0  
SAKL0D01342g Chr4 (101095..104907) [3813 bp, 1270 aa] {ON} simil...   626   0.0  
TDEL0B00530 Chr2 (95898..99803) [3906 bp, 1301 aa] {ON} Anc_8.84...   627   0.0  
Suva_13.468 Chr13 complement(809712..812654,812694..814007) [425...   624   0.0  
NCAS0C00390 Chr3 (57333..60827) [3495 bp, 1164 aa] {ON} Anc_8.845     604   0.0  
YMR280C Chr13 complement(827028..831329) [4302 bp, 1433 aa] {ON}...   602   0.0  
KNAG0J00250 Chr10 (33322..37035) [3714 bp, 1237 aa] {ON} Anc_8.8...   590   0.0  
Smik_13.493 Chr13 complement(810035..814336) [4302 bp, 1433 aa] ...   592   0.0  
KLTH0C03762g Chr3 (324666..328286) [3621 bp, 1206 aa] {ON} simil...   585   0.0  
Skud_13.452 Chr13 complement(800289..804587) [4299 bp, 1432 aa] ...   590   0.0  
Kwal_27.10232 s27 (251015..254644) [3630 bp, 1209 aa] {ON} YMR28...   560   e-178
KAFR0B03950 Chr2 complement(823760..827500) [3741 bp, 1246 aa] {...   514   e-160
ZYRO0G14278g Chr7 complement(1141297..1145049) [3753 bp, 1250 aa...   509   e-159
KLLA0D01452g Chr4 (124018..128355) [4338 bp, 1445 aa] {ON} simil...   501   e-154
ABL121C Chr2 complement(170782..174639) [3858 bp, 1285 aa] {ON} ...   480   e-147
NDAI0K00390 Chr11 (84641..89128) [4488 bp, 1495 aa] {ON} Anc_8.845    467   e-141
Ecym_4616 Chr4 complement(1204091..1208824) [4734 bp, 1577 aa] {...   363   e-103
Kpol_1016.20 s1016 (51828..55088) [3261 bp, 1086 aa] {ON} (51828...    86   5e-16
ZYRO0G15136g Chr7 complement(1218989..1222072) [3084 bp, 1027 aa...    84   2e-15
AFR096W Chr6 (606993..609551) [2559 bp, 852 aa] {ON} Syntenic ho...    82   4e-15
TPHA0I02820 Chr9 complement(620925..624059) [3135 bp, 1044 aa] {...    82   5e-15
KLTH0D03564g Chr4 (343546..346134) [2589 bp, 862 aa] {ON} weakly...    81   9e-15
Kwal_26.7397 s26 complement(342483..343085) [603 bp, 201 aa] {OF...    76   1e-14
SAKL0D05654g Chr4 (457485..460244) [2760 bp, 919 aa] {ON} weakly...    81   1e-14
KLLA0F14322g Chr6 (1328925..1331078) [2154 bp, 717 aa] {ON} unip...    80   1e-14
KAFR0A01480 Chr1 (294040..296217) [2178 bp, 725 aa] {ON} Anc_1.2...    80   2e-14
Ecym_6340 Chr6 complement(652943..655801) [2859 bp, 952 aa] {ON}...    80   2e-14
YJL089W Chr10 (265926..268415) [2490 bp, 829 aa] {ON}  SIP4C6 zi...    78   8e-14
Skud_10.125 Chr10 (233921..236422) [2502 bp, 833 aa] {ON} YJL089...    77   1e-13
Suva_6.161 Chr6 complement(283370..284500,284547..284764,284948....    77   2e-13
Smik_10.153 Chr10 (257677..260166) [2490 bp, 829 aa] {ON} YJL089...    77   3e-13
TDEL0D01450 Chr4 (284869..287706) [2838 bp, 945 aa] {ON} Anc_1.2...    76   4e-13
TBLA0D05420 Chr4 complement(1334955..1337228) [2274 bp, 757 aa] ...    75   7e-13
NDAI0G05530 Chr7 (1360413..1363973) [3561 bp, 1186 aa] {ON}            74   2e-12
KNAG0B01840 Chr2 (345204..348422) [3219 bp, 1072 aa] {ON} Anc_1....    74   2e-12
CAGL0L03377g Chr12 complement(384929..388558) [3630 bp, 1209 aa]...    71   2e-11
NCAS0A09410 Chr1 complement(1865924..1868722) [2799 bp, 932 aa] ...    69   8e-11
KLTH0E08778g Chr5 complement(795841..798462) [2622 bp, 873 aa] {...    57   2e-07
Kwal_47.17681 s47 complement(513119..515683) [2565 bp, 854 aa] {...    57   2e-07
KLLA0C10923g Chr3 complement(939148..941475) [2328 bp, 775 aa] {...    55   1e-06
SAKL0G11902g Chr7 (1016915..1019635) [2721 bp, 906 aa] {ON} simi...    54   3e-06
NDAI0I02350 Chr9 (536448..539117) [2670 bp, 889 aa] {ON} Anc_5.235     54   3e-06
NCAS0D04190 Chr4 (793242..795914) [2673 bp, 890 aa] {ON} Anc_6.279     52   9e-06
Smik_12.77 Chr12 complement(159125..161836) [2712 bp, 903 aa] {O...    52   1e-05
TDEL0E03910 Chr5 (732533..735121) [2589 bp, 862 aa] {ON} Anc_5.2...    52   1e-05
YLR014C Chr12 complement(172268..174982) [2715 bp, 904 aa] {ON} ...    51   2e-05
Smik_6.452 Chr6 (741922..744558) [2637 bp, 878 aa] {ON} YPL248C ...    51   2e-05
Kwal_23.4016 s23 (529580..531466) [1887 bp, 628 aa] {ON} YKL015W...    50   2e-05
YPL248C Chr16 complement(79711..82356) [2646 bp, 881 aa] {ON}  G...    51   2e-05
NDAI0F01220 Chr6 complement(295418..298300) [2883 bp, 960 aa] {O...    50   3e-05
KLLA0E13993g Chr5 complement(1239566..1241602) [2037 bp, 678 aa]...    50   3e-05
Skud_12.82 Chr12 complement(164119..166818) [2700 bp, 899 aa] {O...    50   3e-05
KNAG0D00690 Chr4 (105640..108267) [2628 bp, 875 aa] {ON} Anc_6.2...    50   4e-05
KLTH0G07898g Chr7 (636890..639490) [2601 bp, 866 aa] {ON} simila...    50   4e-05
NDAI0I00740 Chr9 complement(160212..163313) [3102 bp, 1033 aa] {...    50   4e-05
KLLA0F04609g Chr6 complement(451579..454329) [2751 bp, 916 aa] {...    50   4e-05
TBLA0G01800 Chr7 complement(469668..473132) [3465 bp, 1154 aa] {...    50   5e-05
TBLA0G02610 Chr7 complement(689843..692845) [3003 bp, 1000 aa] {...    50   5e-05
KNAG0B05120 Chr2 (982236..984902) [2667 bp, 888 aa] {ON}               50   5e-05
Kwal_23.2905 s23 (69235..71880) [2646 bp, 881 aa] {ON} YLR014C (...    50   5e-05
NCAS0D02540 Chr4 complement(484060..486732) [2673 bp, 890 aa] {O...    49   6e-05
KAFR0J01710 Chr10 complement(327570..330116) [2547 bp, 848 aa] {...    49   6e-05
KAFR0F01490 Chr6 complement(290988..292964) [1977 bp, 658 aa] {O...    49   6e-05
Suva_10.94 Chr10 complement(178366..181086) [2721 bp, 906 aa] {O...    49   6e-05
NCAS0B06550 Chr2 complement(1242371..1245091) [2721 bp, 906 aa] ...    49   7e-05
KAFR0J00690 Chr10 (124449..127043) [2595 bp, 864 aa] {ON} Anc_5....    49   8e-05
SAKL0C02024g Chr3 complement(174858..177554) [2697 bp, 898 aa] {...    49   8e-05
Smik_9.39 Chr9 (80510..83548) [3039 bp, 1012 aa] {ON} YIL130W (R...    49   8e-05
Kpol_1018.30 s1018 complement(81534..83840,83842..84180) [2646 b...    49   9e-05
Skud_9.37 Chr9 (79947..82811) [2865 bp, 954 aa] {ON} YIL130W (REAL)    49   9e-05
NDAI0B03850 Chr2 complement(970366..973158) [2793 bp, 930 aa] {O...    49   9e-05
YIL130W Chr9 (102782..105676) [2895 bp, 964 aa] {ON}  ASG1Zinc c...    49   9e-05
Suva_9.59 Chr9 (97521..100298) [2778 bp, 926 aa] {ON} YIL130W (R...    49   9e-05
TDEL0C04480 Chr3 (799022..801580) [2559 bp, 852 aa] {ON} Anc_2.2...    49   1e-04
Kwal_23.4754 s23 (845550..847988) [2439 bp, 812 aa] {ON} YIL130W...    48   1e-04
KLTH0G09108g Chr7 (744062..746410) [2349 bp, 782 aa] {ON} weakly...    48   1e-04
KNAG0E01760 Chr5 (350254..352962) [2709 bp, 902 aa] {ON} Anc_2.2...    48   1e-04
SAKL0E08998g Chr5 complement(747085..749556) [2472 bp, 823 aa] {...    48   1e-04
NCAS0D04860 Chr4 (933920..936025) [2106 bp, 701 aa] {ON}               48   1e-04
Suva_16.59 Chr16 complement(88631..91318) [2688 bp, 895 aa] {ON}...    48   2e-04
TPHA0F01380 Chr6 complement(318207..320879) [2673 bp, 890 aa] {O...    48   2e-04
Kpol_495.21 s495 (71447..74704) [3258 bp, 1085 aa] {ON} (71447.....    48   2e-04
TPHA0H01980 Chr8 (467688..470669) [2982 bp, 993 aa] {ON} Anc_6.2...    48   2e-04
CAGL0G08844g Chr7 complement(846590..849133) [2544 bp, 847 aa] {...    48   2e-04
NCAS0G01100 Chr7 complement(193052..195859) [2808 bp, 935 aa] {O...    48   2e-04
AGR280C Chr7 complement(1266912..1270232) [3321 bp, 1106 aa] {ON...    48   2e-04
Kpol_1039.11 s1039 (29727..32705) [2979 bp, 992 aa] {ON} (29727....    48   2e-04
ZYRO0E08272g Chr5 (651705..654089) [2385 bp, 794 aa] {ON} simila...    47   2e-04
ZYRO0A10956g Chr1 (881429..883996) [2568 bp, 855 aa] {ON} simila...    47   2e-04
YGL013C Chr7 complement(469092..472298) [3207 bp, 1068 aa] {ON} ...    47   2e-04
NDAI0A08790 Chr1 complement(2026171..2029350) [3180 bp, 1059 aa]...    47   3e-04
Smik_7.277 Chr7 complement(461108..464317) [3210 bp, 1069 aa] {O...    47   4e-04
Skud_7.274 Chr7 complement(472171..475413) [3243 bp, 1080 aa] {O...    47   4e-04
ZYRO0C18150g Chr3 (1418645..1420360) [1716 bp, 571 aa] {ON} some...    46   5e-04
KLTH0H16170g Chr8 complement(1391996..1393855) [1860 bp, 619 aa]...    46   5e-04
KLLA0C03201g Chr3 complement(286973..288925) [1953 bp, 650 aa] {...    46   6e-04
SAKL0A02860g Chr1 complement(259388..261625) [2238 bp, 745 aa] {...    46   6e-04
KLTH0E03256g Chr5 complement(294997..297021) [2025 bp, 674 aa] {...    46   7e-04
KLLA0D12672g Chr4 complement(1076011..1078608) [2598 bp, 865 aa]...    46   8e-04
Ecym_7440 Chr7 complement(902108..904804) [2697 bp, 898 aa] {ON}...    46   8e-04
SAKL0H24860g Chr8 complement(2162455..2165370) [2916 bp, 971 aa]...    46   9e-04
KLTH0E14454g Chr5 complement(1282704..1285412) [2709 bp, 902 aa]...    45   0.001
TDEL0E00160 Chr5 (16083..17978) [1896 bp, 631 aa] {ON}                 45   0.001
Suva_7.268 Chr7 complement(460629..463631) [3003 bp, 1000 aa] {O...    45   0.001
AER370W Chr5 (1320487..1322892) [2406 bp, 801 aa] {ON} Syntenic ...    45   0.001
CAGL0A00451g Chr1 (47557..50880) [3324 bp, 1107 aa] {ON} similar...    45   0.002
Smik_11.240 Chr11 (395459..395932,395981..398437) [2931 bp, 976 ...    45   0.002
TPHA0N00230 Chr14 (39855..43553) [3699 bp, 1232 aa] {ON} Anc_7.1...    45   0.002
Smik_2.438 Chr2 (786437..787846) [1410 bp, 469 aa] {ON} YBR297W ...    44   0.002
KLTH0D02222g Chr4 (220570..223113) [2544 bp, 847 aa] {ON} weakly...    45   0.002
Ecym_5397 Chr5 (805712..808192) [2481 bp, 826 aa] {ON} similar t...    44   0.002
Kpol_467.1 s467 (471..4340) [3870 bp, 1289 aa] {ON} (471..4340) ...    45   0.002
KNAG0E00210 Chr5 (24545..27391) [2847 bp, 948 aa] {ON} Anc_7.17 ...    44   0.002
Kwal_8.580 s8 (13266..15182) [1917 bp, 638 aa] {ON} [contig 311]...    44   0.003
TBLA0C04050 Chr3 complement(980010..983633) [3624 bp, 1207 aa] {...    44   0.003
KLLA0A09119g Chr1 complement(797533..800781) [3249 bp, 1082 aa] ...    44   0.003
KAFR0F01040 Chr6 complement(195192..197696) [2505 bp, 834 aa] {O...    44   0.003
YKL015W Chr11 (408544..411483) [2940 bp, 979 aa] {ON}  PUT3Trans...    44   0.003
SAKL0C03938g Chr3 complement(377431..379773) [2343 bp, 780 aa] {...    44   0.004
KAFR0E02330 Chr5 (468300..470414) [2115 bp, 704 aa] {ON} Anc_5.5...    44   0.004
YBR297W Chr2 (800523..801929) [1407 bp, 468 aa] {ON}  MAL33MAL-a...    43   0.004
ZYRO0E06270g Chr5 (475960..478698) [2739 bp, 912 aa] {ON} weakly...    43   0.005
Kwal_14.778 s14 complement(40408..42405) [1998 bp, 665 aa] {ON} ...    43   0.005
KLTH0E00440g Chr5 complement(42945..45011) [2067 bp, 688 aa] {ON...    43   0.005
KLTH0B10076g Chr2 (841024..843090) [2067 bp, 688 aa] {ON} some s...    43   0.005
SAKL0A09856g Chr1 complement(867959..871021) [3063 bp, 1020 aa] ...    43   0.006
CAGL0I07755g Chr9 complement(745585..748746) [3162 bp, 1053 aa] ...    43   0.006
Skud_15.546 Chr15 (990335..991963) [1629 bp, 542 aa] {ON} YOR380...    43   0.006
KLLA0A02585g Chr1 complement(226562..227674) [1113 bp, 370 aa] {...    42   0.006
Smik_1.13 Chr1 (31514..34654) [3141 bp, 1046 aa] {ON} YAL051W (R...    43   0.006
Smik_15.561 Chr15 (997239..998879) [1641 bp, 546 aa] {ON} YOR380...    42   0.008
KLTH0H02684g Chr8 complement(235527..237776) [2250 bp, 749 aa] {...    42   0.008
KAFR0C04980 Chr3 (987900..990755) [2856 bp, 951 aa] {ON} Anc_7.1...    42   0.008
TDEL0C05680 Chr3 complement(1020646..1022721) [2076 bp, 691 aa] ...    42   0.009
Smik_10.25 Chr10 complement(45977..48295) [2319 bp, 772 aa] {ON}...    42   0.009
KLLA0C18953g Chr3 (1682246..1684357) [2112 bp, 703 aa] {ON} some...    42   0.009
AFL160C Chr6 complement(130842..132788) [1947 bp, 648 aa] {ON} S...    42   0.010
CAGL0F02519g Chr6 (245120..247618) [2499 bp, 832 aa] {ON} weakly...    42   0.011
KAFR0F03410 Chr6 complement(677156..680143) [2988 bp, 995 aa] {O...    42   0.011
TPHA0H01240 Chr8 (274496..277129) [2634 bp, 877 aa] {ON} Anc_5.5...    42   0.011
KLTH0B00352g Chr2 complement(31952..34756) [2805 bp, 934 aa] {ON...    42   0.011
Ecym_5017 Chr5 (36647..39583) [2937 bp, 978 aa] {ON} similar to ...    42   0.012
KAFR0I00230 Chr9 (48095..51232) [3138 bp, 1045 aa] {ON} Anc_7.17...    42   0.012
KLTH0D07260g Chr4 complement(635598..638537) [2940 bp, 979 aa] {...    42   0.013
Suva_1.14 Chr1 (25653..28790) [3138 bp, 1045 aa] {ON} YAL051W (R...    42   0.013
NDAI0G04140 Chr7 (994071..997076) [3006 bp, 1001 aa] {ON} Anc_3....    42   0.013
YJL206C Chr10 complement(47659..49935) [2277 bp, 758 aa] {ON} Pu...    42   0.014
Skud_10.10 Chr10 complement(21672..24173) [2502 bp, 833 aa] {ON}...    42   0.014
Klac_YGOB_3960 Chr3 (291786..293297,293300..294220) [2433 bp, 81...    42   0.015
Suva_16.25 Chr16 complement(31437..31868) [432 bp, 143 aa] {ON} ...    39   0.015
Ecym_8404 Chr8 complement(834988..837645) [2658 bp, 885 aa] {ON}...    42   0.017
Skud_1.10 Chr1 (24510..27632) [3123 bp, 1040 aa] {ON} YAL051W (R...    42   0.017
TBLA0A01210 Chr1 (276151..280419) [4269 bp, 1422 aa] {ON} Anc_1....    42   0.017
Kwal_34.15751 s34 (40148..42034) [1887 bp, 628 aa] {ON} [contig ...    41   0.017
Skud_11.214 Chr11 (389377..389855,389895..392361) [2946 bp, 981 ...    41   0.017
ZYRO0C00726g Chr3 (53977..57084) [3108 bp, 1035 aa] {ON} similar...    42   0.017
Skud_2.427 Chr2 (769889..771295) [1407 bp, 468 aa] {ON} YGR288W ...    41   0.018
CAGL0M12298g Chr13 complement(1227303..1230287) [2985 bp, 994 aa...    41   0.018
TBLA0A05860 Chr1 (1449582..1452014) [2433 bp, 810 aa] {ON}             41   0.018
NCAS0A03580 Chr1 complement(712039..715380) [3342 bp, 1113 aa] {...    41   0.018
SAKL0D14520g Chr4 complement(1192788..1195739) [2952 bp, 983 aa]...    41   0.019
TBLA0A00730 Chr1 (156043..159156) [3114 bp, 1037 aa] {ON} Anc_2....    41   0.019
TDEL0H04340 Chr8 complement(746566..749535) [2970 bp, 989 aa] {O...    41   0.019
SAKL0B04620g Chr2 complement(406622..407710) [1089 bp, 362 aa] {...    41   0.020
Kwal_47.17506 s47 (431921..434695) [2775 bp, 924 aa] {ON} YGL013...    41   0.020
KLLA0F09559g Chr6 complement(876719..878695) [1977 bp, 658 aa] {...    41   0.020
YAL051W Chr1 (48564..51707) [3144 bp, 1047 aa] {ON}  OAF1Oleate-...    41   0.020
TBLA0A09760 Chr1 complement(2398683..2403275) [4593 bp, 1530 aa]...    41   0.021
KNAG0I00560 Chr9 complement(93785..95776) [1992 bp, 663 aa] {ON}...    41   0.021
NCAS0I00270 Chr9 complement(33129..35963) [2835 bp, 944 aa] {ON}...    41   0.022
SAKL0D01100g Chr4 complement(81235..84057) [2823 bp, 940 aa] {ON...    41   0.023
ACL058W Chr3 (261723..264176) [2454 bp, 817 aa] {ON} NOHBY305; N...    41   0.023
YKL038W Chr11 (365605..369117) [3513 bp, 1170 aa] {ON}  RGT1Gluc...    41   0.024
Suva_6.285 Chr6 (499581..501941) [2361 bp, 786 aa] {ON} YJL206C ...    41   0.024
KLLA0F02750g Chr6 complement(250368..253814) [3447 bp, 1148 aa] ...    41   0.025
NDAI0D03550 Chr4 complement(843265..846621) [3357 bp, 1118 aa] {...    41   0.025
SAKL0B06732g Chr2 complement(578508..581144) [2637 bp, 878 aa] {...    41   0.026
KLLA0C04620g Chr3 complement(422705..426514) [3810 bp, 1269 aa] ...    41   0.028
CAGL0D02904g Chr4 complement(302952..305615) [2664 bp, 887 aa] {...    41   0.028
TPHA0A06090 Chr1 complement(1372559..1375102) [2544 bp, 847 aa] ...    40   0.029
NDAI0F00110 Chr6 (10745..12271) [1527 bp, 508 aa] {ON}                 40   0.029
ZYRO0G00308g Chr7 (20674..22623) [1950 bp, 649 aa] {ON} similar ...    40   0.030
TDEL0D05150 Chr4 (932888..935878) [2991 bp, 996 aa] {ON} Anc_3.1...    40   0.030
Smik_17.27 Chr17 complement(29476..31542) [2067 bp, 688 aa] {ON}...    40   0.030
SAKL0D14542g Chr4 complement(1195951..1198791) [2841 bp, 946 aa]...    40   0.030
ZYRO0E00572g Chr5 (35940..38456) [2517 bp, 838 aa] {ON} similar ...    40   0.031
YOR380W Chr15 (1051290..1052930) [1641 bp, 546 aa] {ON}  RDR1Tra...    40   0.032
SAKL0H01958g Chr8 complement(193079..195055) [1977 bp, 658 aa] {...    40   0.032
SAKL0B01870g Chr2 (185897..188926) [3030 bp, 1009 aa] {ON} weakl...    40   0.032
ADR403C Chr4 complement(1429115..1432027) [2913 bp, 970 aa] {ON}...    40   0.033
Ecym_3112 Chr3 (203876..207310) [3435 bp, 1144 aa] {ON} similar ...    40   0.034
TBLA0E00700 Chr5 complement(138121..141945) [3825 bp, 1274 aa] {...    40   0.037
Suva_8.436 Chr8 (788699..790336) [1638 bp, 545 aa] {ON} YOR380W ...    40   0.038
YGR288W Chr7 (1070293..1071714) [1422 bp, 473 aa] {ON}  MAL13MAL...    40   0.038
Kpol_1061.42 s1061 complement(116430..119819) [3390 bp, 1129 aa]...    40   0.040
NCAS0D02960 Chr4 complement(563406..566924) [3519 bp, 1172 aa] {...    40   0.042
TBLA0C06230 Chr3 (1509702..1512089) [2388 bp, 795 aa] {ON} Anc_6...    40   0.046
KAFR0A02130 Chr1 (447063..449186) [2124 bp, 707 aa] {ON} Anc_2.5...    40   0.046
SAKL0D00264g Chr4 complement(24754..27300) [2547 bp, 848 aa] {ON...    40   0.046
TPHA0B03630 Chr2 (844571..848860) [4290 bp, 1429 aa] {ON} Anc_1....    40   0.047
Suva_15.77 Chr15 complement(123654..126743) [3090 bp, 1029 aa] {...    40   0.047
TPHA0N00440 Chr14 complement(82249..84522) [2274 bp, 757 aa] {ON...    40   0.047
CAGL0F09229g Chr6 complement(908186..910693) [2508 bp, 835 aa] {...    40   0.048
YLR278C Chr12 complement(699999..704024) [4026 bp, 1341 aa] {ON}...    40   0.049
Skud_12.361 Chr12 complement(641047..645075) [4029 bp, 1342 aa] ...    40   0.050
CAGL0J07150g Chr10 complement(688858..691926) [3069 bp, 1022 aa]...    40   0.051
SAKL0F00418g Chr6 (34751..36430) [1680 bp, 559 aa] {ON} conserve...    40   0.052
SAKL0H00682g Chr8 complement(81989..84757) [2769 bp, 922 aa] {ON...    40   0.052
Smik_12.357 Chr12 complement(638342..642208) [3867 bp, 1288 aa] ...    40   0.052
KLLA0F22990g Chr6 (2134385..2138146) [3762 bp, 1253 aa] {ON} uni...    40   0.053
KLLA0D10153g Chr4 (858016..859983) [1968 bp, 655 aa] {ON} some s...    40   0.053
Suva_10.376 Chr10 complement(660780..664688) [3909 bp, 1302 aa] ...    40   0.054
ZYRO0G22550g Chr7 complement(1856064..1858238) [2175 bp, 724 aa]...    40   0.054
SAKL0F16522g Chr6 (1361716..1363842) [2127 bp, 708 aa] {ON} some...    40   0.056
KAFR0C03230 Chr3 complement(655300..656520) [1221 bp, 406 aa] {O...    39   0.056
KNAG0E04150 Chr5 complement(823063..826473) [3411 bp, 1136 aa] {...    40   0.057
NDAI0A03420 Chr1 complement(782010..785336) [3327 bp, 1108 aa] {...    40   0.057
SAKL0C09944g Chr3 complement(899127..902312) [3186 bp, 1061 aa] ...    40   0.058
Ecym_4286 Chr4 (613587..615470) [1884 bp, 627 aa] {ON} similar t...    39   0.064
Suva_11.213 Chr11 (392506..392993,393045..395514) [2958 bp, 985 ...    40   0.066
NDAI0D03540 Chr4 complement(838966..842289) [3324 bp, 1107 aa] {...    40   0.067
KNAG0M00970 Chr13 (169393..172926) [3534 bp, 1177 aa] {ON} Anc_6...    40   0.068
NDAI0H01990 Chr8 complement(481983..485468) [3486 bp, 1161 aa] {...    39   0.070
TPHA0A04540 Chr1 (1031790..1035326) [3537 bp, 1178 aa] {ON} Anc_...    39   0.070
Skud_7.627 Chr7 (1048240..1049664) [1425 bp, 474 aa] {ON} YBR297...    39   0.070
ZYRO0A13596g Chr1 complement(1080653..1082599) [1947 bp, 648 aa]...    39   0.071
KAFR0G02450 Chr7 (508147..511353) [3207 bp, 1068 aa] {ON} Anc_6....    39   0.071
KLLA0A03421g Chr1 (308414..311056) [2643 bp, 880 aa] {ON} weakly...    39   0.074
AER183C Chr5 complement(975879..978518) [2640 bp, 879 aa] {ON} N...    39   0.078
Kpol_538.42 s538 complement(89752..93018) [3267 bp, 1088 aa] {ON...    39   0.080
KLTH0E06666g Chr5 (611348..614188) [2841 bp, 946 aa] {ON} conser...    39   0.082
TBLA0B07920 Chr2 complement(1877300..1879603) [2304 bp, 767 aa] ...    39   0.087
TBLA0G00490 Chr7 (99344..102100) [2757 bp, 918 aa] {ON}                39   0.089
CAGL0K05841g Chr11 (573144..577262) [4119 bp, 1372 aa] {ON} simi...    39   0.089
Skud_7.638 Chr7 (1060062..1061483) [1422 bp, 473 aa] {ON} YFL052...    39   0.090
Skud_15.64 Chr15 complement(109746..112844) [3099 bp, 1032 aa] {...    39   0.090
TBLA0B04800 Chr2 complement(1127000..1129333) [2334 bp, 777 aa] ...    39   0.092
CAGL0F07865g Chr6 complement(768270..770804) [2535 bp, 844 aa] {...    39   0.094
ZYRO0D06688g Chr4 (577455..577507,577577..579311) [1788 bp, 595 ...    39   0.100
TPHA0F02630 Chr6 complement(583511..587299) [3789 bp, 1262 aa] {...    39   0.10 
KLLA0F19602g Chr6 complement(1814949..1816760) [1812 bp, 603 aa]...    39   0.10 
Skud_11.190 Chr11 (345221..348736) [3516 bp, 1171 aa] {ON} YKL03...    39   0.10 
TBLA0G01130 Chr7 (287952..291350) [3399 bp, 1132 aa] {ON} Anc_8....    39   0.10 
Kpol_1009.5 s1009 complement(10170..13706) [3537 bp, 1178 aa] {O...    39   0.11 
Suva_11.187 Chr11 (348570..352085) [3516 bp, 1171 aa] {ON} YKL03...    39   0.11 
ZYRO0A03058g Chr1 (247954..250164) [2211 bp, 736 aa] {ON} simila...    39   0.11 
NCAS0A07610 Chr1 complement(1512914..1515982) [3069 bp, 1022 aa]...    39   0.11 
Kpol_260.2 s260 complement(3488..5758) [2271 bp, 756 aa] {ON} co...    39   0.12 
KLLA0F10373g Chr6 (957948..958994) [1047 bp, 348 aa] {ON} some s...    38   0.12 
Suva_2.51 Chr2 complement(93709..97176) [3468 bp, 1155 aa] {ON} ...    39   0.12 
NDAI0I01940 Chr9 (450330..454112) [3783 bp, 1260 aa] {ON} Anc_6.75     39   0.12 
Skud_2.39 Chr2 complement(80293..83772) [3480 bp, 1159 aa] {ON} ...    39   0.13 
TBLA0C01120 Chr3 complement(233451..237911) [4461 bp, 1486 aa] {...    39   0.13 
YBL066C Chr2 complement(96669..100115) [3447 bp, 1148 aa] {ON}  ...    39   0.13 
TPHA0C04980 Chr3 (1072547..1075105) [2559 bp, 852 aa] {ON} Anc_8...    39   0.13 
Kwal_23.6537 s23 complement(1632048..1633706) [1659 bp, 552 aa] ...    39   0.13 
CAGL0A04455g Chr1 (437546..440842) [3297 bp, 1098 aa] {ON} simil...    39   0.13 
NCAS0C04780 Chr3 (974254..976998) [2745 bp, 914 aa] {ON}               39   0.13 
Smik_2.50 Chr2 complement(90559..94011) [3453 bp, 1150 aa] {ON} ...    39   0.14 
AGL099C Chr7 complement(516587..518830) [2244 bp, 747 aa] {ON} S...    39   0.14 
TPHA0C02220 Chr3 (504550..506658) [2109 bp, 702 aa] {ON} Anc_8.4...    39   0.14 
Kwal_26.6805 s26 (71596..74430) [2835 bp, 944 aa] {ON} YAL051W (...    39   0.14 
Kwal_26.8109 s26 complement(650270..653182) [2913 bp, 970 aa] {O...    39   0.14 
KNAG0I01450 Chr9 (277513..281943) [4431 bp, 1476 aa] {ON}              39   0.14 
SAKL0A00704g Chr1 complement(78811..80967) [2157 bp, 718 aa] {ON...    38   0.14 
Kwal_56.23058 s56 complement(381390..383717) [2328 bp, 775 aa] {...    39   0.14 
SAKL0B10538g Chr2 (910662..912767) [2106 bp, 701 aa] {ON} simila...    38   0.15 
KLLA0A06039g Chr1 (557368..559341) [1974 bp, 657 aa] {ON} weakly...    38   0.15 
KLTH0C07480g Chr3 (645219..647546) [2328 bp, 775 aa] {ON} simila...    38   0.15 
CAGL0B03421g Chr2 complement(336071..340138) [4068 bp, 1355 aa] ...    39   0.15 
KAFR0C03730 Chr3 (759382..761757) [2376 bp, 791 aa] {ON}               38   0.15 
ADR404C Chr4 complement(1432320..1434947) [2628 bp, 875 aa] {ON}...    38   0.16 
KAFR0I02030 Chr9 complement(416471..420172) [3702 bp, 1233 aa] {...    38   0.16 
Kwal_47.17233 s47 (309658..312504) [2847 bp, 948 aa] {ON} [conti...    38   0.16 
NCAS0H03420 Chr8 complement(648059..650767) [2709 bp, 902 aa] {O...    38   0.16 
KLLA0C17050g Chr3 (1490472..1493339) [2868 bp, 955 aa] {ON} cons...    38   0.16 
TPHA0F00830 Chr6 complement(188299..191877) [3579 bp, 1192 aa] {...    38   0.17 
NDAI0G05260 Chr7 (1277631..1282376) [4746 bp, 1581 aa] {ON} Anc_...    38   0.17 
KAFR0A04940 Chr1 (975356..978913) [3558 bp, 1185 aa] {ON} Anc_6....    38   0.17 
CAGL0E05434g Chr5 (532814..535264) [2451 bp, 816 aa] {ON} simila...    38   0.17 
NCAS0E02620 Chr5 complement(523279..526626) [3348 bp, 1115 aa] {...    38   0.18 
TDEL0D00260 Chr4 complement(44685..46628) [1944 bp, 647 aa] {ON}       38   0.18 
NDAI0D02730 Chr4 (629970..633647) [3678 bp, 1225 aa] {ON} Anc_6....    38   0.18 
Smik_11.210 Chr11 (352056..355565) [3510 bp, 1169 aa] {ON} YKL03...    38   0.18 
Kwal_23.3122 s23 complement(166388..168754) [2367 bp, 788 aa] {O...    38   0.18 
KLLA0A03443g Chr1 (311628..314555) [2928 bp, 975 aa] {ON} simila...    38   0.18 
KNAG0A02550 Chr1 complement(262867..265059) [2193 bp, 730 aa] {O...    38   0.19 
KAFR0E02410 Chr5 (489279..491354) [2076 bp, 691 aa] {ON} Anc_7.5...    38   0.19 
SAKL0D07898g Chr4 complement(653332..657066) [3735 bp, 1244 aa] ...    38   0.19 
Smik_16.20 Chr16 complement(26236..27657) [1422 bp, 473 aa] {ON}...    38   0.19 
KLLA0A10329g Chr1 (903873..905792) [1920 bp, 639 aa] {ON} conser...    38   0.19 
TBLA0F03550 Chr6 complement(875734..876630) [897 bp, 298 aa] {ON...    37   0.19 
Skud_5.331 Chr5 complement(543439..543951) [513 bp, 170 aa] {ON}...    36   0.19 
YHR178W Chr8 (459299..461530) [2232 bp, 743 aa] {ON}  STB5Transc...    38   0.20 
Kwal_YGOB_0.139 s0 complement(61752..63560,63594..65507) [3723 b...    38   0.20 
Kpol_1061.26 s1061 (69833..73657) [3825 bp, 1274 aa] {ON} (69833...    38   0.20 
CAGL0L01903g Chr12 (220700..224563) [3864 bp, 1287 aa] {ON} simi...    38   0.20 
NCAS0A08840 Chr1 (1746841..1751277) [4437 bp, 1478 aa] {ON} Anc_...    38   0.21 
KLTH0H11572g Chr8 complement(989095..992808) [3714 bp, 1237 aa] ...    38   0.21 
AAL175W Chr1 (32874..35525) [2652 bp, 883 aa] {ON} Non-syntenic ...    38   0.21 
ZYRO0G19338g Chr7 complement(1601895..1603856) [1962 bp, 653 aa]...    38   0.21 
KLLA0F25630g Chr6 (2378464..2381487) [3024 bp, 1007 aa] {ON} som...    38   0.21 
KAFR0A03180 Chr1 complement(655176..657716) [2541 bp, 846 aa] {O...    38   0.22 
NDAI0C00260 Chr3 (40019..43144) [3126 bp, 1041 aa] {ON} Anc_2.65...    38   0.22 
Skud_9.220 Chr9 complement(396576..398957) [2382 bp, 793 aa] {ON...    38   0.22 
YOL089C Chr15 complement(150398..153490) [3093 bp, 1030 aa] {ON}...    38   0.22 
NCAS0C02730 Chr3 (513280..515607) [2328 bp, 775 aa] {ON} Anc_8.423     38   0.22 
KLLA0F20680g Chr6 (1924148..1926511) [2364 bp, 787 aa] {ON} weak...    38   0.22 
KNAG0A07100 Chr1 complement(1113008..1116868) [3861 bp, 1286 aa]...    38   0.22 
KLTH0D01804g Chr4 complement(173650..175608) [1959 bp, 652 aa] {...    38   0.23 
YDR213W Chr4 (889751..892492) [2742 bp, 913 aa] {ON}  UPC2Sterol...    38   0.23 
KLTH0E07854g Chr5 (719642..722458) [2817 bp, 938 aa] {ON} weakly...    38   0.24 
YLR256W Chr12 (646415..650923) [4509 bp, 1502 aa] {ON}  HAP1Zinc...    38   0.24 
ZYRO0G10252g Chr7 (819658..822768) [3111 bp, 1036 aa] {ON} simil...    38   0.24 
NCAS0I02410 Chr9 (451205..453964) [2760 bp, 919 aa] {ON} Anc_3.1...    38   0.24 
NCAS0A01630 Chr1 complement(317259..320390) [3132 bp, 1043 aa] {...    38   0.25 
NCAS0A15020 Chr1 (2957420..2959849) [2430 bp, 809 aa] {ON} Anc_7...    37   0.25 
NCAS0A04750 Chr1 (944929..948354) [3426 bp, 1141 aa] {ON} Anc_2....    38   0.26 
NDAI0F02050 Chr6 complement(503400..504740) [1341 bp, 446 aa] {O...    37   0.26 
KNAG0E00450 Chr5 complement(74721..76853) [2133 bp, 710 aa] {ON}...    37   0.26 
AFR117C Chr6 complement(646829..650287) [3459 bp, 1152 aa] {ON} ...    38   0.26 
KAFR0B01450 Chr2 (273614..276880) [3267 bp, 1088 aa] {ON} Anc_2....    37   0.26 
SAKL0H25146g Chr8 complement(2185695..2187632) [1938 bp, 645 aa]...    37   0.26 
Skud_15.532 Chr15 complement(959437..962439) [3003 bp, 1000 aa] ...    37   0.27 
NDAI0D00900 Chr4 (205039..207636) [2598 bp, 865 aa] {ON}               37   0.27 
Smik_18.8 Chr18 (12069..14396) [2328 bp, 775 aa] {ON} YOR172W (R...    37   0.28 
NDAI0E03460 Chr5 (742144..744993) [2850 bp, 949 aa] {ON} Anc_8.423     37   0.28 
Smik_4.460 Chr4 (833609..836365) [2757 bp, 918 aa] {ON} YDR213W ...    37   0.28 
YOR363C Chr15 complement(1020222..1023212) [2991 bp, 996 aa] {ON...    37   0.29 
TDEL0B07490 Chr2 complement(1314447..1317044) [2598 bp, 865 aa] ...    37   0.30 
KNAG0D03520 Chr4 complement(642517..645609) [3093 bp, 1030 aa] {...    37   0.30 
KNAG0H00250 Chr8 (37360..40050) [2691 bp, 896 aa] {ON} Anc_2.654...    37   0.31 
ZYRO0G21626g Chr7 complement(1781790..1783031) [1242 bp, 413 aa]...    37   0.31 
NDAI0C03450 Chr3 (789514..791844) [2331 bp, 776 aa] {ON} Anc_5.59      37   0.31 
Kwal_0.142 s0 complement(63621..65507) [1887 bp, 629 aa] {OFF} Y...    37   0.32 
TPHA0L01060 Chr12 (220857..223778) [2922 bp, 973 aa] {ON} Anc_8....    37   0.32 
Skud_4.475 Chr4 (844018..846759) [2742 bp, 913 aa] {ON} YDR213W ...    37   0.32 
Skud_12.335 Chr12 (592952..597391) [4440 bp, 1479 aa] {ON} YLR25...    37   0.32 
Ecym_2732 Chr2 (1410290..1413886) [3597 bp, 1198 aa] {ON} simila...    37   0.33 
NCAS0C00220 Chr3 (22532..25051) [2520 bp, 839 aa] {ON} Anc_8.879       37   0.33 
Suva_2.381 Chr2 (669136..671892) [2757 bp, 918 aa] {ON} YDR213W ...    37   0.33 
Smik_12.327 Chr12 (590984..595495) [4512 bp, 1503 aa] {ON} YLR25...    37   0.33 
CAGL0G09757g Chr7 (930351..934622) [4272 bp, 1423 aa] {ON} some ...    37   0.33 
KAFR0H01800 Chr8 complement(333664..336048) [2385 bp, 794 aa] {O...    37   0.33 
Skud_8.242 Chr8 (430739..432958) [2220 bp, 739 aa] {ON} YHR178W ...    37   0.33 
CAGL0F07909g Chr6 (776659..779808) [3150 bp, 1049 aa] {ON} some ...    37   0.33 
SAKL0H13024g Chr8 complement(1119585..1121849) [2265 bp, 754 aa]...    37   0.34 
Suva_13.186 Chr13 (302887..305571) [2685 bp, 894 aa] {ON} YMR019...    37   0.34 
NDAI0C04840 Chr3 (1117201..1120047) [2847 bp, 948 aa] {ON} Anc_8...    37   0.37 
TDEL0B06260 Chr2 (1104557..1108300) [3744 bp, 1247 aa] {ON} Anc_...    37   0.37 
KAFR0L02130 Chr12 (403953..406601) [2649 bp, 882 aa] {ON} Anc_8....    37   0.38 
KLLA0C14212g Chr3 complement(1229219..1232341) [3123 bp, 1040 aa...    37   0.38 
Ecym_2522 Chr2 (1017930..1020710) [2781 bp, 926 aa] {ON} similar...    37   0.38 
NCAS0E02310 Chr5 (452368..454524) [2157 bp, 718 aa] {ON} Anc_7.56      37   0.39 
NDAI0A03410 Chr1 complement(778569..781511) [2943 bp, 980 aa] {O...    37   0.39 
ZYRO0G17512g Chr7 complement(1447970..1449541) [1572 bp, 523 aa]...    37   0.39 
SAKL0G19470g Chr7 complement(1677759..1680254) [2496 bp, 831 aa]...    37   0.40 
KNAG0C05980 Chr3 complement(1164771..1167677) [2907 bp, 968 aa] ...    37   0.40 
Suva_8.421 Chr8 complement(757924..760932) [3009 bp, 1002 aa] {O...    37   0.40 
KLTH0F03014g Chr6 (260568..262406) [1839 bp, 612 aa] {ON} simila...    37   0.40 
KLTH0E05786g Chr5 (517896..520349) [2454 bp, 817 aa] {ON} weakly...    37   0.41 
Suva_10.351 Chr10 (613486..614460) [975 bp, 324 aa] {ON} YLR256W...    36   0.41 
TPHA0K01100 Chr11 (228134..231619) [3486 bp, 1161 aa] {ON} Anc_6...    37   0.42 
Kpol_345.3 s345 complement(7411..11517) [4107 bp, 1368 aa] {ON} ...    37   0.43 
CAGL0I02552g Chr9 (227257..230274) [3018 bp, 1005 aa] {ON} weakl...    37   0.43 
KNAG0M02120 Chr13 (395195..397021) [1827 bp, 608 aa] {ON} Anc_2....    37   0.43 
TDEL0B00480 Chr2 (83911..86418) [2508 bp, 835 aa] {ON} Anc_8.879...    37   0.44 
KLLA0E18129g Chr5 (1613115..1615712) [2598 bp, 865 aa] {ON} simi...    37   0.44 
Suva_10.323 Chr10 complement(566314..568755) [2442 bp, 813 aa] {...    37   0.44 
Suva_2.187 Chr2 complement(320833..323187) [2355 bp, 784 aa] {ON...    37   0.45 
KLTH0E16500g Chr5 (1460844..1463345) [2502 bp, 833 aa] {ON} simi...    37   0.45 
TPHA0C02180 Chr3 complement(493972..496632) [2661 bp, 886 aa] {O...    37   0.45 
Smik_8.262 Chr8 (436380..438584) [2205 bp, 734 aa] {ON} YHR178W ...    37   0.45 
ZYRO0E05412g Chr5 (410945..414679) [3735 bp, 1244 aa] {ON} simil...    37   0.45 
Smik_16.15 Chr16 complement(14421..15812) [1392 bp, 463 aa] {ON}...    37   0.46 
TPHA0F02550 Chr6 (559614..562013) [2400 bp, 799 aa] {ON} Anc_6.6...    37   0.47 
Kwal_27.9688 s27 complement(21328..23853) [2526 bp, 841 aa] {ON}...    37   0.47 
KLLA0D05038g Chr4 (433653..435674) [2022 bp, 673 aa] {ON} simila...    37   0.48 
Smik_13.183 Chr13 (304049..304060,304064..306787) [2736 bp, 911 ...    37   0.48 
NDAI0H03240 Chr8 complement(775826..777718) [1893 bp, 630 aa] {O...    37   0.48 
KLLA0E20307g Chr5 (1806005..1809364) [3360 bp, 1119 aa] {ON} uni...    37   0.49 
AGR061C Chr7 complement(831052..832890) [1839 bp, 612 aa] {ON} S...    37   0.49 
YBL005W Chr2 (217470..220400) [2931 bp, 976 aa] {ON}  PDR3Transc...    37   0.49 
KAFR0E01250 Chr5 complement(249538..251748) [2211 bp, 736 aa] {O...    37   0.49 
SAKL0D03586g Chr4 (290224..292629) [2406 bp, 801 aa] {ON} simila...    37   0.49 
SAKL0D13464g Chr4 (1116277..1118340) [2064 bp, 687 aa] {ON} weak...    37   0.50 
NCAS0H01240 Chr8 (235885..237312) [1428 bp, 475 aa] {ON} Anc_6.154     36   0.51 
CAGL0C01199g Chr3 complement(121944..124712) [2769 bp, 922 aa] {...    37   0.52 
KLTH0F07854g Chr6 complement(677647..680013) [2367 bp, 788 aa] {...    37   0.52 
TPHA0E00880 Chr5 complement(177030..180164) [3135 bp, 1044 aa] {...    37   0.54 
KNAG0K00820 Chr11 complement(153470..156622) [3153 bp, 1050 aa] ...    37   0.54 
Ecym_8159 Chr8 (330207..332933) [2727 bp, 908 aa] {ON} similar t...    37   0.56 
TDEL0F02330 Chr6 complement(429974..433234) [3261 bp, 1086 aa] {...    37   0.56 
AER291C Chr5 complement(1172383..1174374) [1992 bp, 663 aa] {ON}...    36   0.56 
Smik_15.547 Chr15 complement(966368..969355) [2988 bp, 995 aa] {...    37   0.56 
TBLA0E03480 Chr5 (865043..868183) [3141 bp, 1046 aa] {ON} Anc_3....    37   0.58 
NCAS0A03070 Chr1 (603639..605609) [1971 bp, 656 aa] {ON}               36   0.58 
CAGL0L04400g Chr12 complement(513759..516722) [2964 bp, 987 aa] ...    36   0.59 
NCAS0F00370 Chr6 complement(61819..65148) [3330 bp, 1109 aa] {ON...    36   0.60 
ZYRO0A00440g Chr1 complement(27895..30447) [2553 bp, 850 aa] {ON...    36   0.61 
Smik_12.6 Chr12 complement(17429..19966) [2538 bp, 845 aa] {ON} ...    36   0.62 
KAFR0G03520 Chr7 complement(728360..729694) [1335 bp, 444 aa] {O...    36   0.64 
NDAI0B02520 Chr2 complement(631209..633341) [2133 bp, 710 aa] {O...    36   0.65 
KAFR0G01360 Chr7 complement(305620..308121) [2502 bp, 833 aa] {O...    36   0.67 
TPHA0O00600 Chr15 complement(107944..112062) [4119 bp, 1372 aa] ...    36   0.67 
YMR019W Chr13 (312156..315005) [2850 bp, 949 aa] {ON}  STB4Putat...    36   0.67 
Smik_3.209 Chr3 (306620..309118) [2499 bp, 832 aa] {ON} YCR106W ...    36   0.68 
ZYRO0B02574g Chr2 complement(204817..206541) [1725 bp, 574 aa] {...    36   0.68 
KLTH0C10516g Chr3 (871091..872776) [1686 bp, 561 aa] {ON} simila...    36   0.68 
Suva_4.499 Chr4 complement(871565..872917) [1353 bp, 450 aa] {ON...    36   0.69 
TPHA0G00380 Chr7 complement(65673..68294) [2622 bp, 873 aa] {ON}       36   0.70 
SAKL0C03960g Chr3 (380387..383488) [3102 bp, 1033 aa] {ON} conse...    36   0.70 
TDEL0D03610 Chr4 (664819..666993) [2175 bp, 724 aa] {ON} Anc_3.2...    36   0.70 
Suva_15.378 Chr15 (665572..667815) [2244 bp, 747 aa] {ON} YHR178...    36   0.71 
KNAG0E00780 Chr5 (140071..142353) [2283 bp, 760 aa] {ON} Anc_5.5...    36   0.71 
ZYRO0E00638g Chr5 complement(44716..48036) [3321 bp, 1106 aa] {O...    36   0.73 
ADR365W Chr4 (1355407..1357512) [2106 bp, 701 aa] {ON} Syntenic ...    36   0.74 
Skud_3.181 Chr3 (293773..296268) [2496 bp, 831 aa] {ON} YCR106W ...    36   0.77 
KLLA0A04169g Chr1 complement(376273..378600) [2328 bp, 775 aa] {...    36   0.78 
TPHA0L02050 Chr12 complement(423921..426563) [2643 bp, 880 aa] {...    36   0.79 
NCAS0C04280 Chr3 complement(882224..883384) [1161 bp, 386 aa] {O...    35   0.79 
Smik_15.67 Chr15 complement(113506..116598) [3093 bp, 1030 aa] {...    36   0.81 
TPHA0F02540 Chr6 (556797..559178) [2382 bp, 793 aa] {ON} Anc_6.6...    36   0.81 
Ecym_2345 Chr2 (676841..678754) [1914 bp, 637 aa] {ON} similar t...    36   0.81 
TBLA0G01100 Chr7 complement(279553..281454) [1902 bp, 633 aa] {O...    36   0.82 
Skud_2.372 Chr2 complement(669194..670552) [1359 bp, 452 aa] {ON...    36   0.82 
Ecym_4153 Chr4 complement(330831..333281) [2451 bp, 816 aa] {ON}...    36   0.83 
CAGL0L09383g Chr12 (1020856..1021956) [1101 bp, 366 aa] {ON} som...    35   0.84 
KAFR0B02820 Chr2 complement(576317..578311) [1995 bp, 664 aa] {O...    36   0.86 
NCAS0A12720 Chr1 (2510574..2512853) [2280 bp, 759 aa] {ON} Anc_2...    36   0.87 
Skud_13.173 Chr13 (298693..298722,298729..301461) [2763 bp, 920 ...    36   0.89 
SAKL0H13266g Chr8 (1138536..1140362) [1827 bp, 608 aa] {ON} some...    36   0.90 
KNAG0A04550 Chr1 (642548..645208) [2661 bp, 886 aa] {ON} Anc_8.4...    36   0.90 
NDAI0A05750 Chr1 complement(1302180..1304459) [2280 bp, 759 aa] ...    36   0.90 
NDAI0B01540 Chr2 complement(359639..362050) [2412 bp, 803 aa] {O...    36   0.91 
Smik_2.115 Chr2 (210321..213236) [2916 bp, 971 aa] {ON} YBL005W ...    36   0.92 
YBR240C Chr2 complement(700490..701842) [1353 bp, 450 aa] {ON}  ...    35   0.93 
AFR171W Chr6 (752589..754427) [1839 bp, 612 aa] {ON} NOHBY629; N...    35   0.94 
Kwal_26.6664 s26 complement(11094..12833) [1740 bp, 579 aa] {ON}...    35   0.95 
Kpol_538.52 s538 (126243..128966) [2724 bp, 907 aa] {ON} (126243...    36   0.97 
Smik_2.383 Chr2 complement(686676..688022) [1347 bp, 448 aa] {ON...    35   0.99 
YDR034C Chr4 complement(509737..512109) [2373 bp, 790 aa] {ON}  ...    35   1.0  
TBLA0E01110 Chr5 (243534..246755) [3222 bp, 1073 aa] {ON} Anc_6....    35   1.0  
KLTH0D03718g Chr4 complement(362790..364790) [2001 bp, 666 aa] {...    35   1.0  
KNAG0F03040 Chr6 complement(576753..580325) [3573 bp, 1190 aa] {...    35   1.0  
Ecym_7235 Chr7 (489574..492405) [2832 bp, 943 aa] {ON} similar t...    35   1.0  
Kwal_23.4370 s23 complement(689686..691764) [2079 bp, 692 aa] {O...    35   1.0  
ABL099W Chr2 (212830..215232) [2403 bp, 800 aa] {ON} Syntenic ho...    35   1.1  
NDAI0K00150 Chr11 complement(20792..23653) [2862 bp, 953 aa] {ON...    35   1.1  
Kwal_55.20674 s55 complement(515392..516147) [756 bp, 252 aa] {O...    35   1.1  
TPHA0N01100 Chr14 (231308..232501) [1194 bp, 397 aa] {ON} Anc_6....    35   1.1  
SAKL0H00660g Chr8 complement(78740..81478) [2739 bp, 912 aa] {ON...    35   1.1  
TDEL0F05470 Chr6 (1017743..1020175) [2433 bp, 810 aa] {ON} Anc_8...    35   1.1  
YLR228C Chr12 complement(600019..602463) [2445 bp, 814 aa] {ON} ...    35   1.1  
KLTH0C06776g Chr3 complement(586976..590140) [3165 bp, 1054 aa] ...    35   1.1  
SAKL0F11616g Chr6 complement(901066..902841) [1776 bp, 591 aa] {...    35   1.1  
KLTH0B08580g Chr2 (697066..698970) [1905 bp, 634 aa] {ON} simila...    35   1.1  
Smik_12.289 Chr12 complement(540824..543262) [2439 bp, 812 aa] {...    35   1.2  
Skud_12.296 Chr12 complement(540407..542851) [2445 bp, 814 aa] {...    35   1.2  
Kpol_1002.5 s1002 (11943..14819) [2877 bp, 958 aa] {ON} (11943.....    35   1.2  
ZYRO0D04422g Chr4 (366583..368877) [2295 bp, 764 aa] {ON} simila...    35   1.2  
KLTH0C10098g Chr3 complement(836528..838843) [2316 bp, 771 aa] {...    35   1.2  
TDEL0G04100 Chr7 complement(746975..749074) [2100 bp, 699 aa] {O...    35   1.2  
YER184C Chr5 complement(556296..558680) [2385 bp, 794 aa] {ON} P...    35   1.3  
TBLA0A05850 Chr1 complement(1446872..1448845) [1974 bp, 657 aa] ...    35   1.3  
SAKL0G07634g Chr7 (636596..639364) [2769 bp, 922 aa] {ON} some s...    35   1.3  
Skud_4.287 Chr4 complement(501344..503698) [2355 bp, 784 aa] {ON...    35   1.3  
KNAG0M00620 Chr13 (99320..100699) [1380 bp, 459 aa] {ON} Anc_6.1...    35   1.4  
TBLA0G00510 Chr7 (104797..107604) [2808 bp, 935 aa] {ON} Anc_6.6...    35   1.4  
Skud_2.106 Chr2 (200722..203754) [3033 bp, 1010 aa] {ON} YBL005W...    35   1.4  
TDEL0H03950 Chr8 (674423..676411) [1989 bp, 662 aa] {ON} Anc_7.5...    35   1.5  
Kwal_14.819 s14 complement(63184..64890) [1707 bp, 568 aa] {ON} ...    35   1.5  
ZYRO0D14432g Chr4 complement(1222977..1226489) [3513 bp, 1170 aa...    35   1.5  
AFL033W Chr6 (373485..374633) [1149 bp, 382 aa] {ON} Syntenic ho...    35   1.6  
TDEL0C01380 Chr3 (237170..237949) [780 bp, 259 aa] {ON} Anc_8.10...    34   1.6  
KLLA0D11286g Chr4 complement(964642..966678) [2037 bp, 678 aa] {...    35   1.6  
Skud_7.108 Chr7 (203544..204437) [894 bp, 297 aa] {ON} YGL162W (...    34   1.6  
Suva_2.121 Chr2 (211466..214381) [2916 bp, 971 aa] {ON} YBL005W ...    35   1.6  
Kwal_47.18089 s47 complement(680481..682718) [2238 bp, 745 aa] {...    35   1.7  
Kpol_534.28 s534 (64772..66079) [1308 bp, 435 aa] {ON} (64772..6...    35   1.7  
SAKL0C05918g Chr3 complement(558911..561538) [2628 bp, 875 aa] {...    35   1.7  
KLTH0D07898g Chr4 (672516..674534) [2019 bp, 672 aa] {ON} weakly...    35   1.8  
KLTH0A03498g Chr1 complement(301696..303915) [2220 bp, 739 aa] {...    35   1.8  
KLLA0D00484g Chr4 (44879..47893) [3015 bp, 1004 aa] {ON} conserv...    35   1.8  
Kpol_1042.6 s1042 (9848..11548,11550..11612,11615..12193) [2343 ...    35   1.8  
TBLA0G00520 Chr7 (108060..110696) [2637 bp, 878 aa] {ON} Anc_6.6...    35   1.8  
Kpol_2001.16 s2001 (44110..46518) [2409 bp, 802 aa] {ON} (44110....    35   1.9  
NCAS0B05740 Chr2 (1090374..1091687) [1314 bp, 437 aa] {ON} Anc_8...    34   1.9  
TBLA0D04050 Chr4 (1007986..1009809) [1824 bp, 607 aa] {ON} Anc_8...    35   2.0  
KAFR0A06690 Chr1 complement(1354262..1357255) [2994 bp, 997 aa] ...    35   2.0  
Ecym_6141 Chr6 complement(258221..258565) [345 bp, 114 aa] {ON} ...    32   2.1  
Smik_25.2 Chr25 (2105..4462) [2358 bp, 785 aa] {ON} YER184C (REAL)     35   2.1  
Smik_15.342 Chr15 complement(595611..595820,595851..598070) [243...    35   2.1  
CAGL0H01683g Chr8 (162753..164852) [2100 bp, 699 aa] {ON} simila...    35   2.1  
ADR405C Chr4 complement(1435702..1438125) [2424 bp, 807 aa] {ON}...    35   2.1  
TDEL0G03970 Chr7 (720080..723187) [3108 bp, 1035 aa] {ON} Anc_6....    35   2.2  
NCAS0A03570 Chr1 complement(708718..711654) [2937 bp, 978 aa] {O...    35   2.2  
Smik_23.3 Chr23 complement(4675..6111) [1437 bp, 478 aa] {ON} YB...    34   2.2  
Kpol_1033.15 s1033 complement(32885..34586,34699..34781) [1785 b...    34   2.2  
Kwal_26.7095 s26 (211883..214399) [2517 bp, 838 aa] {ON} YOR363C...    34   2.3  
SAKL0G02992g Chr7 (243859..247044) [3186 bp, 1061 aa] {ON} conse...    34   2.3  
Kwal_14.1524 s14 complement(357148..358332) [1185 bp, 394 aa] {O...    34   2.3  
ZYRO0C18282g Chr3 (1431515..1433665) [2151 bp, 716 aa] {ON} cons...    34   2.4  
ZYRO0D14058g Chr4 (1188615..1190891) [2277 bp, 758 aa] {ON} simi...    34   2.5  
AGL091W Chr7 (535317..537917) [2601 bp, 866 aa] {ON} Syntenic ho...    34   2.5  
NDAI0E03850 Chr5 (846504..848810) [2307 bp, 768 aa] {ON} Anc_7.56      34   2.5  
NCAS0B05110 Chr2 complement(951685..953485,953561..953643) [1884...    34   2.5  
SAKL0A08074g Chr1 (711985..715425) [3441 bp, 1146 aa] {ON} simil...    34   2.7  
SAKL0H16544g Chr8 (1454826..1454875,1454943..1456692) [1800 bp, ...    34   2.7  
KLTH0H05720g Chr8 (505672..507006) [1335 bp, 444 aa] {ON} simila...    34   2.7  
YOR337W Chr15 (954344..956623) [2280 bp, 759 aa] {ON}  TEA1Ty1 e...    34   2.7  
KLLA0E19603g Chr5 complement(1739869..1741914) [2046 bp, 681 aa]...    34   2.8  
Skud_15.502 Chr15 (894741..897020) [2280 bp, 759 aa] {ON} YOR337...    34   2.8  
Kwal_14.915 s14 (110216..112684) [2469 bp, 822 aa] {ON} YKL015W ...    34   2.9  
Ecym_5015 Chr5 (29616..32099) [2484 bp, 827 aa] {ON} similar to ...    34   2.9  
KLTH0G13200g Chr7 (1133333..1133382,1133450..1135100) [1701 bp, ...    34   2.9  
Kwal_26.7448 s26 complement(369897..372041) [2145 bp, 714 aa] {O...    34   2.9  
Suva_8.387 Chr8 (696078..698357) [2280 bp, 759 aa] {ON} YOR337W ...    34   2.9  
KAFR0G02520 Chr7 complement(522206..524722) [2517 bp, 838 aa] {O...    34   3.0  
TDEL0D06620 Chr4 (1197405..1199084) [1680 bp, 559 aa] {ON}             34   3.1  
Smik_15.515 Chr15 (903950..906229) [2280 bp, 759 aa] {ON} YOR337...    34   3.1  
Ecym_2263 Chr2 (518089..519615) [1527 bp, 508 aa] {ON} similar t...    34   3.3  
TBLA0E01900 Chr5 (462299..464821) [2523 bp, 840 aa] {ON} Anc_7.5...    34   3.5  
Kwal_23.6529 s23 (1627853..1629649) [1797 bp, 598 aa] {ON} YDR03...    34   3.5  
YCR106W Chr3 (310958..313456) [2499 bp, 832 aa] {ON}  RDS1Putati...    34   3.7  
NDAI0F04500 Chr6 complement(1093752..1096181) [2430 bp, 809 aa] ...    33   3.8  
KLTH0G17050g Chr7 (1475875..1477173) [1299 bp, 432 aa] {ON} some...    33   3.8  
CAGL0M11440g Chr13 complement(1127298..1129025) [1728 bp, 575 aa...    33   4.2  
SAKL0A01386g Chr1 (132287..134599) [2313 bp, 770 aa] {ON} conser...    33   4.2  
KLLA0A09251g Chr1 (808253..810319) [2067 bp, 688 aa] {ON} simila...    33   4.4  
Kwal_56.23308 s56 complement(485779..487092) [1314 bp, 438 aa] {...    33   4.4  
Kwal_14.1631 s14 (397794..399125) [1332 bp, 443 aa] {ON} YBR240C...    33   4.6  
KLTH0C00814g Chr3 (76637..79141) [2505 bp, 834 aa] {ON} similar ...    33   4.8  
KLTH0F08074g Chr6 (701778..703685) [1908 bp, 635 aa] {ON} some s...    33   4.9  
TBLA0G02350 Chr7 complement(605666..610141) [4476 bp, 1491 aa] {...    33   5.2  
TPHA0E01880 Chr5 complement(376865..379270) [2406 bp, 801 aa] {O...    33   5.5  
KLTH0B09262g Chr2 (758773..761235) [2463 bp, 820 aa] {ON} weakly...    33   5.6  
CAGL0L04576g Chr12 (528957..531554) [2598 bp, 865 aa] {ON} simil...    33   5.6  
KLTH0A06644g Chr1 complement(553084..555270) [2187 bp, 728 aa] {...    33   5.6  
KLLA0F04213g Chr6 (400673..402979) [2307 bp, 768 aa] {ON} simila...    33   5.8  
TDEL0A02690 Chr1 (485785..487953) [2169 bp, 722 aa] {ON}               33   5.8  
TBLA0A02610 Chr1 (634322..635191) [870 bp, 289 aa] {ON} Anc_5.46...    33   6.0  
YPR196W Chr16 (931376..932788) [1413 bp, 470 aa] {ON} Putative m...    33   6.0  
Skud_6.15 Chr6 complement(24031..25701) [1671 bp, 556 aa] {ON} Y...    33   7.2  
CAGL0L09691g Chr12 complement(1041796..1044270) [2475 bp, 824 aa...    33   7.6  
KLLA0A03091g Chr1 (276333..277484) [1152 bp, 383 aa] {ON} some s...    32   7.9  
Sklu_YGOB_gneas1 Chr3 complement(352893..354335) [1443 bp, 480 a...    32   8.3  
KAFR0C03900 Chr3 (787524..789980) [2457 bp, 818 aa] {ON} Anc_2.6...    32   8.8  
KAFR0A00220 Chr1 complement(42494..45250) [2757 bp, 918 aa] {ON}...    32   9.3  

>CAGL0M03025g Chr13 complement(341849..345613) [3765 bp, 1254 aa] {ON}
            similar to uniprot|P39113 Saccharomyces cerevisiae
            YMR280c CAT8 transcription factor involved in
            gluconeogenesis
          Length = 1254

 Score = 2320 bits (6013), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1151/1254 (91%), Positives = 1151/1254 (91%)

Query: 1    MVSNADETFVAPRLIRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXYRVAQAC 60
            MVSNADETFVAPRLIR                                     YRVAQAC
Sbjct: 1    MVSNADETFVAPRLIRVAGGGDDDVHGSGSGAGPANGNSVSGSNTGSRGSTPTYRVAQAC 60

Query: 61   DRCRLKKTKCDGKIPQCSQCALVGFECKISDRLNRKSFPRGYXXXXXXXXXXXXXXNKRL 120
            DRCRLKKTKCDGKIPQCSQCALVGFECKISDRLNRKSFPRGY              NKRL
Sbjct: 61   DRCRLKKTKCDGKIPQCSQCALVGFECKISDRLNRKSFPRGYTETLEERVRELETENKRL 120

Query: 121  MALCNSDLGSNTRSDGLEKQXXXXXXXXXXMERDSERGFTENMELQLQQSCSSCGNSDPN 180
            MALCNSDLGSNTRSDGLEKQ          MERDSERGFTENMELQLQQSCSSCGNSDPN
Sbjct: 121  MALCNSDLGSNTRSDGLEKQSPSKRKRSPSMERDSERGFTENMELQLQQSCSSCGNSDPN 180

Query: 181  HRCVHLKPVVSNIIVDSNTDVSFEQNVAPGLPAVKALNSMAEREESAQLAMLVSLALPRS 240
            HRCVHLKPVVSNIIVDSNTDVSFEQNVAPGLPAVKALNSMAEREESAQLAMLVSLALPRS
Sbjct: 181  HRCVHLKPVVSNIIVDSNTDVSFEQNVAPGLPAVKALNSMAEREESAQLAMLVSLALPRS 240

Query: 241  TEEILFIPQLMANIQKTFGFSSKQSLYTVSLLSSLKKNLPTPNSNSSDENLSPNYYVSED 300
            TEEILFIPQLMANIQKTFGFSSKQSLYTVSLLSSLKKNLPTPNSNSSDENLSPNYYVSED
Sbjct: 241  TEEILFIPQLMANIQKTFGFSSKQSLYTVSLLSSLKKNLPTPNSNSSDENLSPNYYVSED 300

Query: 301  FRPFFYEVLKFDILGETETENGSNRNESPDSTIPNSRSDDLLSWMEIQRLVDVYFECWSN 360
            FRPFFYEVLKFDILGETETENGSNRNESPDSTIPNSRSDDLLSWMEIQRLVDVYFECWSN
Sbjct: 301  FRPFFYEVLKFDILGETETENGSNRNESPDSTIPNSRSDDLLSWMEIQRLVDVYFECWSN 360

Query: 361  TIPIFSRKLFIKQMKAFKTEVDKFGDRLFEVYKTEQIKINFLKIFATVLAVMCQMALLSR 420
            TIPIFSRKLFIKQMKAFKTEVDKFGDRLFEVYKTEQIKINFLKIFATVLAVMCQMALLSR
Sbjct: 361  TIPIFSRKLFIKQMKAFKTEVDKFGDRLFEVYKTEQIKINFLKIFATVLAVMCQMALLSR 420

Query: 421  LKQLEATTQELECKRTQNLIAHYNQLIEKIHLDSFFQDMSTTTVQSLQLLSFISFYFLNV 480
            LKQLEATTQELECKRTQNLIAHYNQLIEKIHLDSFFQDMSTTTVQSLQLLSFISFYFLNV
Sbjct: 421  LKQLEATTQELECKRTQNLIAHYNQLIEKIHLDSFFQDMSTTTVQSLQLLSFISFYFLNV 480

Query: 481  GDIPRLYQLRGTVISMAQQLRLHRCPSAVLLSASGSTMQKFEQGERRLLFWAIYYLDVFY 540
            GDIPRLYQLRGTVISMAQQLRLHRCPSAVLLSASGSTMQKFEQGERRLLFWAIYYLDVFY
Sbjct: 481  GDIPRLYQLRGTVISMAQQLRLHRCPSAVLLSASGSTMQKFEQGERRLLFWAIYYLDVFY 540

Query: 541  SLQLGVPRLIKDHEIECALPVSEEEDSQLEGRVSDFSLAVIRYAKVLGNILDSIFKRNMM 600
            SLQLGVPRLIKDHEIECALPVSEEEDSQLEGRVSDFSLAVIRYAKVLGNILDSIFKRNMM
Sbjct: 541  SLQLGVPRLIKDHEIECALPVSEEEDSQLEGRVSDFSLAVIRYAKVLGNILDSIFKRNMM 600

Query: 601  SEAATESMAFVHEKALDIWKNRLPEKYGFRLEANGLFNFDELTVVKNSEKDLIEKSSILL 660
            SEAATESMAFVHEKALDIWKNRLPEKYGFRLEANGLFNFDELTVVKNSEKDLIEKSSILL
Sbjct: 601  SEAATESMAFVHEKALDIWKNRLPEKYGFRLEANGLFNFDELTVVKNSEKDLIEKSSILL 660

Query: 661  FYFLAKCMIHLPVIATRSASLEQQLQPGTSSDTSETPKESQNKTPTRVCPSYILMQKAAS 720
            FYFLAKCMIHLPVIATRSASLEQQLQPGTSSDTSETPKESQNKTPTRVCPSYILMQKAAS
Sbjct: 661  FYFLAKCMIHLPVIATRSASLEQQLQPGTSSDTSETPKESQNKTPTRVCPSYILMQKAAS 720

Query: 721  TMLQVMHYTSEYYLPSPINISRTKARFALLTACSAVEYLKGGSLYVETXXXXXXXXXXXX 780
            TMLQVMHYTSEYYLPSPINISRTKARFALLTACSAVEYLKGGSLYVET            
Sbjct: 721  TMLQVMHYTSEYYLPSPINISRTKARFALLTACSAVEYLKGGSLYVETKNLLENLIIKLE 780

Query: 781  XXXXXXXPGIISWHSXXXXXXXXXXXXQSPTTKMEKLDKLVQKKINHYNRQMGIPAMKLS 840
                   PGIISWHS            QSPTTKMEKLDKLVQKKINHYNRQMGIPAMKLS
Sbjct: 781  LERKLDLPGIISWHSLKLLDMALMLLLQSPTTKMEKLDKLVQKKINHYNRQMGIPAMKLS 840

Query: 841  NSRKNNKKIKLENESSQLSSTSNPIAKGELKSDSVVCEEDDNVNDNEVTTTAKLEENNEF 900
            NSRKNNKKIKLENESSQLSSTSNPIAKGELKSDSVVCEEDDNVNDNEVTTTAKLEENNEF
Sbjct: 841  NSRKNNKKIKLENESSQLSSTSNPIAKGELKSDSVVCEEDDNVNDNEVTTTAKLEENNEF 900

Query: 901  INPNKIEQGVTSNTLAFSFSSTDLSALFNAPESLFKVPNENTQYNQQHEMHNNSISSSHS 960
            INPNKIEQGVTSNTLAFSFSSTDLSALFNAPESLFKVPNENTQYNQQHEMHNNSISSSHS
Sbjct: 901  INPNKIEQGVTSNTLAFSFSSTDLSALFNAPESLFKVPNENTQYNQQHEMHNNSISSSHS 960

Query: 961  KEPVNKERDSDKQELNAIFNETQNRSTSFAKLMLLLNNEHKSLSSSLENDVRNVGNKLSS 1020
            KEPVNKERDSDKQELNAIFNETQNRSTSFAKLMLLLNNEHKSLSSSLENDVRNVGNKLSS
Sbjct: 961  KEPVNKERDSDKQELNAIFNETQNRSTSFAKLMLLLNNEHKSLSSSLENDVRNVGNKLSS 1020

Query: 1021 ENAGQLPSHGATSGLNSKGNEFLSMNTLYGGDNDFIIDASLGLAPLLSENNEIHRQHEGT 1080
            ENAGQLPSHGATSGLNSKGNEFLSMNTLYGGDNDFIIDASLGLAPLLSENNEIHRQHEGT
Sbjct: 1021 ENAGQLPSHGATSGLNSKGNEFLSMNTLYGGDNDFIIDASLGLAPLLSENNEIHRQHEGT 1080

Query: 1081 QVQAGNNDILSTRIGFNGKDDYSNSRSFTNEMFGGSDTKRTRSDTTALLTANSELTHDSQ 1140
            QVQAGNNDILSTRIGFNGKDDYSNSRSFTNEMFGGSDTKRTRSDTTALLTANSELTHDSQ
Sbjct: 1081 QVQAGNNDILSTRIGFNGKDDYSNSRSFTNEMFGGSDTKRTRSDTTALLTANSELTHDSQ 1140

Query: 1141 DGNVNFGSTNSELHERLNNNHFDAATSYLPEQKSEYGSSFGNKNTVKSLSPSTSFLDDDT 1200
            DGNVNFGSTNSELHERLNNNHFDAATSYLPEQKSEYGSSFGNKNTVKSLSPSTSFLDDDT
Sbjct: 1141 DGNVNFGSTNSELHERLNNNHFDAATSYLPEQKSEYGSSFGNKNTVKSLSPSTSFLDDDT 1200

Query: 1201 LSLSFGDYSTQXXXXXXXXXXXTLGKDSLAMKTEINGGRNQGNLHDLFQWQNSK 1254
            LSLSFGDYSTQ           TLGKDSLAMKTEINGGRNQGNLHDLFQWQNSK
Sbjct: 1201 LSLSFGDYSTQRRPRRYPNYNNTLGKDSLAMKTEINGGRNQGNLHDLFQWQNSK 1254

>SAKL0D01342g Chr4 (101095..104907) [3813 bp, 1270 aa] {ON} similar to
            uniprot|Q75DZ4 Ashbya gossypii ABL121C ABL121Cp and
            similar to YMR280C uniprot|P39113 Saccharomyces
            cerevisiae YMR280C CAT8 Zinc cluster transcriptional
            activator
          Length = 1270

 Score =  626 bits (1614), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 425/1125 (37%), Positives = 591/1125 (52%), Gaps = 130/1125 (11%)

Query: 54   YRVAQACDRCRLKKTKCDGKIPQCSQCALVGFECKISDRLNRKSFPRGYXXXXXXXXXXX 113
            YRVAQACDRCR KKT+CDGK PQCSQCA VGFECKISD+L+R++FPRGY           
Sbjct: 85   YRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDKLSRRAFPRGYTETLEERVREL 144

Query: 114  XXXNKRLMALCNSDLG----------SNTRSDGL-EKQXXXXXXXXXXMERDSERGFTEN 162
               N+RL+ALC  DL           SN R+  + E +              S R  + N
Sbjct: 145  EAENRRLVALC--DLKEEQLHLVSKYSNKRTSEISENEDEQILQQLSAANGGSLRVSSTN 202

Query: 163  MEL------------------QLQQSCSSCGNSDPNHRCVHLKPVVSNIIVDSNTDVSFE 204
            + L                  +    C+  G +  +   +H KPV +N+  +  T +SFE
Sbjct: 203  LYLLNKTTPGDQQDEEDQMSSKTTVDCNGVGCNHSHQPNIHDKPVSTNL--NDPTSISFE 260

Query: 205  QNVAPGLPAVKALNSMAEREESAQLAMLVSLALPRSTEEILFIPQLMANIQKTFGFSSKQ 264
            QN APGLPAVKAL SMA  E S QLA LV+L++PRSTEEIL IPQL+A I +  G +SKQ
Sbjct: 261  QNEAPGLPAVKALTSMANHEHSVQLATLVALSVPRSTEEILLIPQLLARIGQVHGLTSKQ 320

Query: 265  SLYTVSLLSSLKKNLPTPNSNSSDENLSPNYYVSEDFRPFFYEVLKFDILGETETENGSN 324
            SLYT SLL+SLK+++P     + D   S N +  +D   FF  V KFDI  E+ T     
Sbjct: 321  SLYTASLLASLKESIPLTLPTNVDMLKSTNLWEVDDVIQFFQTVFKFDIQAESSTT---- 376

Query: 325  RNESPDSTIPNSRSDDLLSWMEIQRLVDVYFECWSNTIPIFSRKLFIKQMKAFKTEV--D 382
                         S D L   EI  LV  +F  W N IPI  +  F      FKT++   
Sbjct: 377  -------------SQDHLIATEIDGLVSDFFSQWYNFIPILDKDEFYNYYNKFKTDLMDP 423

Query: 383  KFGDRLFEVYKTEQIKINFLKIFATVLAVMCQMALLSRLK--QLEATTQELECKRTQNLI 440
             F D    ++      I++ KIF  +L ++CQM L+S++K   L AT       +   L+
Sbjct: 424  NFFDDEKNLFNKRNKSISY-KIFGCILLIICQMGLISKVKAENLPAT------NKYSQLM 476

Query: 441  AHYNQLIEKIHLDSFFQDMSTTTVQSLQLLSFISFYFLNVGDIPRLYQLRGTVISMAQQL 500
            A+Y+ ++ ++ ++ +F ++ +T++QSLQ  S   FYFLN+G++  +Y LRG V+SM+QQL
Sbjct: 477  AYYDIVVRQLMMNPYF-NLKSTSIQSLQFTSLQLFYFLNIGEVSSVYDLRGKVVSMSQQL 535

Query: 501  RLHRCPSAVLLSASGSTMQKFEQGERRLLFWAIYYLDVFYSLQLGVPRLIKDHEIECALP 560
            RLHRCPSAV L  +GS + K +QGERR+LFW IYYLDVF +LQLGVPRL+KDHEIECALP
Sbjct: 536  RLHRCPSAV-LGGNGSAVSKAQQGERRILFWGIYYLDVFSALQLGVPRLLKDHEIECALP 594

Query: 561  VSEEEDSQ---------LEGRVSDFSLAVIRYAKVLGNILDSIFKRNMMSEAATESMAFV 611
            V++ +D +         LEGRVS  SL+VIR+AKVLGNILDSIFKR  MS + T+ ++ V
Sbjct: 595  VADNDDQKVNLAGQMIALEGRVSMLSLSVIRFAKVLGNILDSIFKRG-MSASLTKQISLV 653

Query: 612  HEKALDIWKNRLPEKYGFRLEANGLFNFDELTVVK--NSEKDLI--EKSSILLFYFLAKC 667
            HE ALD W+  LP++  F L+ NG  N DE   +K  ++  ++   E  S+++ YF+AKC
Sbjct: 654  HENALDNWRRGLPQQLKFELDVNGTINMDEFNHLKQLDTSGNMYSKENKSLMVLYFMAKC 713

Query: 668  MIHLPVIATRSASLEQQLQPGTSSDTSETPKESQNKTPTRVCPSYILMQKAASTMLQVMH 727
            MIHLPV+A R    + +  P +S     TP    N    R   SY+L+Q+A +T+L V  
Sbjct: 714  MIHLPVVAKRPLVNDPEQSPESS-----TPS---NNCGDRSSSSYVLLQQATNTLLNVFT 765

Query: 728  YTSEYYLPSPINISRTKARFALLTACSAVEYLKGGSLYVETXXXXXXXXXXXXXXXXXXX 787
                 Y P PIN+SRTK RF+LL+A  ++EY KGG+L+ +                    
Sbjct: 766  SLRNVYPPIPINVSRTKTRFSLLSARGSLEYTKGGALFQDNKALLLDLVKELEVDKKLEL 825

Query: 788  PGIISWHSXXXXXXXXXXXXQSPTTKMEKLDKLVQKKINHY----NRQMGIPAMKLSNSR 843
            PG +SWHS            Q   TK EKL+K++Q+K+N+Y    NR+  +   + ++S 
Sbjct: 826  PGTLSWHSLKLLDMSISLILQPANTKPEKLEKMLQRKLNYYNKLTNRRSNLGGGRSASSP 885

Query: 844  KNNKKIKL-ENESSQLSSTSNPI-AKGELKSDSVVCEEDDN------VNDNEVTTTAKLE 895
              N K KL EN+ S       P  +KG+   D  +  ED        V+ +  + + K E
Sbjct: 886  GGNSKRKLDENQGSAEPPKLTPASSKGDTPPDKKIKLEDTGFVPVRAVSQHSQSDSEKFE 945

Query: 896  ENNEFINP-NKIEQGVTSNTLAFS--FSSTDLSALFNAPESLFKVPNENTQYNQQHEMHN 952
                 + P N I +    + +  +  FS+TDL+A FN       VP           + N
Sbjct: 946  NFQPPVAPQNSIAEAFHLDPVLNNNPFSNTDLNAFFNTNNG--NVP---AALRSGGSLFN 1000

Query: 953  NSISSSHSKEPVNKERDSDKQELN-AIFNETQNRSTSFAKLMLLLNNEHKSLSSSLENDV 1011
             + +++ S    N    S+   LN  +F    N           L + +    +S     
Sbjct: 1001 IAATAAASGNNANSTAPSNT--LNEGLFKVPSNGD--------FLKDYYNVPGASSSQLN 1050

Query: 1012 RNVGNKLSSENAGQLPSHGATSGLNSKGNEFLSMNTLYGGDNDFIIDASLGLAPLLSENN 1071
                N  +S    QL    A SG  ++ N+    N  +G    F +DAS GLAPLL  + 
Sbjct: 1051 LLFLNNNASNGKPQLNGSSAHSGTQAQNND----NNGFG----FAVDASWGLAPLLEWSP 1102

Query: 1072 EIHRQHEGTQVQAGNNDILSTRIG------FNGKDDYSNSRSFTN 1110
                   GT     N+ IL T           G   +SN+RS+T+
Sbjct: 1103 AGKPVDPGTCNANENSIILDTSAANMESEMATGGRLHSNTRSYTD 1147

>TDEL0B00530 Chr2 (95898..99803) [3906 bp, 1301 aa] {ON} Anc_8.845
            YMR280C
          Length = 1301

 Score =  627 bits (1616), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 433/1130 (38%), Positives = 596/1130 (52%), Gaps = 154/1130 (13%)

Query: 55   RVAQACDRCRLKKTKCDGKIPQCSQCALVGFECKISDRLNRKSFPRGYXXXXXXXXXXXX 114
            RVAQACDRCR KKT+CDGK PQCSQCA VGFEC+ISD+L+R++FPRGY            
Sbjct: 97   RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECRISDKLSRRAFPRGYTETLEERVRELE 156

Query: 115  XXNKRLMALCN---------SDLGSNTRSDGLEKQXXXXXXXXXXMER---DSERGFTEN 162
              N+RL+ALC+         S   +N +  G   +            R    S   F  N
Sbjct: 157  AENRRLVALCDIKEQQIHLVSHFPTNKKKIGGNDEQMLQELTGANNGRLRISSTNLFLLN 216

Query: 163  MELQLQQSCSSCGNSD----PNH------RC--------VHLKPVVSNIIVDSNTDVSFE 204
                 +Q  +     D    P+H      RC        +H KPV +N+  +  T +SFE
Sbjct: 217  KARDGKQPATISNGDDHMTKPDHEHTGKHRCDELDCNNKLHSKPVSTNL--NDPTAISFE 274

Query: 205  QNVAPGLPAVKALNSMAEREESAQLAMLVSLALPRSTEEILFIPQLMANIQKTFGFSSKQ 264
            QN APGLPAVKAL SMA RE+S QLA LV+L++PRSTEEILFIPQL+A I +  GF+SKQ
Sbjct: 275  QNEAPGLPAVKALTSMATREQSTQLATLVALSVPRSTEEILFIPQLLARIIQIHGFTSKQ 334

Query: 265  SLYTVSLLSSLKKNLPTPNSNSSDE---NLSPNYYVSEDFRPFFYEVLKFDILGETETEN 321
             LY+VSLL+SLK NLP P     DE     + N +  ++   FF+E LKF+IL    +++
Sbjct: 335  CLYSVSLLASLKNNLPGPQLVKWDELDYLKTTNLWEVDNLDKFFHETLKFNILRPGVSDD 394

Query: 322  GSNRNESPDSTIPNSRSDDLLSWMEIQRLVDVYFECWSNTIPIFSRKLFIKQMKAFKTEV 381
            G +                 LS  EI  LV+++F+ W+  IPI  ++ F       K ++
Sbjct: 395  GESLG---------------LSIKEIDELVNLFFDSWAVHIPILDKEEFFSYYDKLKKDI 439

Query: 382  DKFGDRLFEVYKT---EQIKINFLKIFATVLAVMCQMALLSRLKQLEATTQELECKRTQN 438
                  LF+   +    + KI   KIFA +L  +CQM LL+++K  + T+ +    +   
Sbjct: 440  ST-QPGLFQEGPSNFARRNKIISYKIFACILFTVCQMGLLTKVKGEKITSADSPYVK--- 495

Query: 439  LIAHYNQLIEKIHLDSFFQDMSTTTVQSLQLLSFISFYFLNVGDIPRLYQLRGTVISMAQ 498
            L ++Y++ I  I+L+ +F  + TT++QSLQ LS + FYF+N G++  +Y+LRG V+SMAQ
Sbjct: 496  LTSYYHRAISLIYLNPYFGVL-TTSLQSLQFLSLLLFYFVNTGNVSAIYELRGRVVSMAQ 554

Query: 499  QLRLHRCPSAVLLSASGSTMQKFEQGERRLLFWAIYYLDVFYSLQLGVPRLIKDHEIECA 558
            QLRLHRCPSAV L  SGSTM K EQG+RR+LFW IYYLDVF +LQLGVPRLIKD EIECA
Sbjct: 555  QLRLHRCPSAV-LGGSGSTMNKREQGDRRVLFWGIYYLDVFSALQLGVPRLIKDFEIECA 613

Query: 559  LPVSEEEDSQ---------LEGRVSDFSLAVIRYAKVLGNILDSIFKRNMMSEAATESMA 609
            LPV+E +D +         LEGRVS FSLA+IR+AKVLGNILD++FKR  M+E+ ++ +A
Sbjct: 614  LPVAENDDREVSLAGQMIRLEGRVSQFSLAIIRFAKVLGNILDTVFKRG-MTESVSKKLA 672

Query: 610  FVHEKALDIWKNRLPEKYGFRLEANGLFNFDELTVVK--NSEKDLIEKSSILLFYFLAKC 667
             +HE ALD W+  LP +  F +E NG  N D+   +K  N+  + +E+  +L+ YFLAKC
Sbjct: 673  LIHENALDNWRRGLPAELIFEIEVNGTINMDKFNEMKQNNATVENVEQMVLLVSYFLAKC 732

Query: 668  MIHLPVIATRSASLEQQLQPGTSSDTSETPKESQNKTPTRVCPSYILMQKAASTMLQVMH 727
            MIHLPV+ATR              +     K  ++    R   SY+L+Q+A +TML V+ 
Sbjct: 733  MIHLPVVATRPLPSSDDPNSDIKEEEEVNDKNGESNFAIRSSSSYVLLQQATNTMLNVLE 792

Query: 728  YTSEYYLPSPINISRTKARFALLTACSAVEYLKGGSLYVETXXXXXXXXXXXXXXXXXXX 787
                 YLP P N++RTKARFALL+A  ++EY+KGG+L+++                    
Sbjct: 793  SLKSIYLPLPFNVARTKARFALLSARGSLEYIKGGALFLDNKALLLDVVKSIEEDRKLEI 852

Query: 788  PGIISWHSXXXXXXXXXXXXQSPTTKMEKLDKLVQKKINHYNRQMGIPAMKLS------N 841
            PG+ISWH             Q P TK+EKLD+L++KK+N+Y+R MG P +K S      N
Sbjct: 853  PGVISWHGLKLLDMTISLLLQPPNTKVEKLDRLLKKKLNYYSRVMGRPILKTSSLRQEAN 912

Query: 842  SRKNN---------------------------------KKIKLENESSQLSSTSNPIAKG 868
             ++ N                                 KKIKLE+ESS    TSN +   
Sbjct: 913  GKRRNSSDDKLSRSGTEENFRATNLTPISSKSDGSPVEKKIKLEDESSD---TSNALVDK 969

Query: 869  ELKSDSVVCEEDDNVNDNEVTTTAKLEENNEFINPNKIEQGVTSNTLAFSFSSTDLSALF 928
                D         V  +  T  A+    +  +N N +             S  DL+A F
Sbjct: 970  SYTDDLSSSANQPQVPASTQTAIAEALHLDPVLNNNIL-------------SVADLAAFF 1016

Query: 929  --NAPESLFKVPNENTQYNQQHEMHNNSISS----------SHSKEPVNKERDSDKQELN 976
              N P +     N+++ Y  Q++     +            +H K  V       +   N
Sbjct: 1017 GGNMPAA---GGNQHSSYTNQNDFAPKHMRKEKEPAAFSDLAHKKSSVTGVDGLFRVPSN 1073

Query: 977  AIF--NETQNRSTSFAKLMLLLNNEHK-----SLSSSLENDVRNVGNKLSSENAGQLPSH 1029
            A F  +E     TS   L L  NN +       LS     D   V    + +   Q  +H
Sbjct: 1074 ADFLMDEYYPSGTSHINLTLFNNNANNHDDTFGLSDGHGKDT-GVNTNFNVKGGHQSTNH 1132

Query: 1030 GATSGLNSK--GNEFL---SMNTLYGGDNDFIIDASLGLAPLLSENNEIH 1074
               +  N +  GN+     S N   G D +F +DASLGLAPLL  + E+H
Sbjct: 1133 SHLTNFNDRLQGNQLGFTNSGNMNSGSDFNFAVDASLGLAPLLDWSPEMH 1182

>Suva_13.468 Chr13 complement(809712..812654,812694..814007) [4257 bp,
            1418 aa] {ON} YMR280C (REAL)
          Length = 1418

 Score =  624 bits (1610), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 405/995 (40%), Positives = 550/995 (55%), Gaps = 129/995 (12%)

Query: 54   YRVAQACDRCRLKKTKCDGKIPQCSQCALVGFECKISDRLNRKSFPRGYXXXXXXXXXXX 113
            YR+AQACDRCR KKT+CDGK PQCSQCA VGFEC+ISD+L RK++P+GY           
Sbjct: 63   YRIAQACDRCRSKKTRCDGKRPQCSQCAAVGFECRISDKLLRKAYPKGYTESLEERVREL 122

Query: 114  XXXNKRLMALCN-----SDLGS---------NTRSDG----LEKQXXXXXXXXXXMERDS 155
               NKRL+ALC+      +L S         NT SD     L+            +   +
Sbjct: 123  EAENKRLLALCDIKEQQINLVSQSRPPTSLDNTVSDNFKQDLKDAPLNLSSTNIYLLNQT 182

Query: 156  ERGFTENMELQLQQSCSSCG---NSDP----NHRC--------VHLKPVVSNIIVDSNTD 200
                 +N ++   +S S+ G    S P    +H C        +H KP  +++  +  T 
Sbjct: 183  VNKQLQNGKIDTNRSDSTMGLLATSPPLPQKDHVCDGVSCTNNLHAKPTSTSL--NDPTA 240

Query: 201  VSFEQNVAPGLPAVKALNSMAEREESAQLAMLVSLALPRSTEEILFIPQLMANIQKTFGF 260
            +SFEQN APGLPAVKAL SM   + S QLA LVSL++PRSTEEILFIPQL+  I++ FGF
Sbjct: 241  ISFEQNEAPGLPAVKALKSMTTHQRSTQLATLVSLSIPRSTEEILFIPQLLTRIRQIFGF 300

Query: 261  SSKQSLYTVSLLSSLKKNLPTP-------------NSNSSDENLSPNYYVSE--DFRPFF 305
            +SKQ LYTVSLLSSLK  LP P             N +S   N      ++E  D + F 
Sbjct: 301  NSKQCLYTVSLLSSLKNRLPAPKLLLSSTSTKIKENDDSKFLNTFETTSLAEFGDLKKFL 360

Query: 306  YEVLKFDILGETETENGSNRNESPDSTIPNSRSD-DLLSWMEIQRLVDVYFECWSNTIPI 364
               LKFDI         S  N+ P+  + N++SD DLLS  EI+ L+ ++F+ WSN + I
Sbjct: 361  IS-LKFDI--------NSFSNQQPE--VQNNKSDNDLLSLNEIKELLHLFFKFWSNQVSI 409

Query: 365  FSRKLFIKQMKAFKTEVDKFGDRLFEVYKTEQIKINFLKIFATVLAVMCQMALLSRLK-- 422
             +   F+     F   +      L +   T+       +IFA  L +M QM LL ++K  
Sbjct: 410  LNNDHFLLYFNNFVEVIKALPLELKKTNGTKTHATTNHQIFALKLLIMLQMGLLIKVKRE 469

Query: 423  QLEATTQELECKRTQNLIAHYNQLIEKIHLDSFFQDMSTTTVQSLQLLSFISFYFLNVGD 482
            +++ T    +  +   L+ +Y+Q+   I  + +F +MSTT++ SLQLLS  SFYFLNVGD
Sbjct: 470  KIKDTVPGNQNSKFAKLMVYYHQVSSIIPKNPYFLNMSTTSLPSLQLLSLTSFYFLNVGD 529

Query: 483  IPRLYQLRGTVISMAQQLRLHRCPSAVLLSASGSTMQKFEQGERRLLFWAIYYLDVFYSL 542
            IP +Y LRG ++SM+QQLRLHRCPSAVL   S   +Q+FEQ ERRLLFWA+YY+DVF SL
Sbjct: 530  IPAIYGLRGRIVSMSQQLRLHRCPSAVLSVHSNPVLQRFEQSERRLLFWAVYYIDVFASL 589

Query: 543  QLGVPRLIKDHEIECALPVS--EEEDS---------------QLEGRVSDFSLAVIRYAK 585
            QLGVPRL+KD +IECALP+S  E ED                QL+G+VS FSL +IR+AK
Sbjct: 590  QLGVPRLLKDFDIECALPISDVEFEDQLASENEKTKNKTKKIQLQGQVSSFSLQIIRFAK 649

Query: 586  VLGNILDSIFKRNMMSEAATESMAFVHEKALDIWKNRLPEKYGFRLEANGLFNFDEL--- 642
            +LGNILDSIFKR MM E  T  +A VHE ALD W+N+LPE Y F++  NG  N D++   
Sbjct: 650  ILGNILDSIFKRGMMDERVTSEVALVHENALDNWRNQLPEMYYFQITVNGTVNLDDIRAN 709

Query: 643  ----TVVKNSEKDLI--EKSSILLFYFLAKCMIHLPVIATRSASLEQQLQPGT------- 689
                T  K   KD+I  EK+ +LLFYFLAK MIHLPVIAT+   L + +   T       
Sbjct: 710  NSRNTEAKFDRKDIICFEKNVLLLFYFLAKSMIHLPVIATK--PLPKTVDNSTKKKHSMF 767

Query: 690  SSDTSETPKESQN------KTPT-RVCPSYILMQKAASTMLQVMHYTSEYYLPSPINISR 742
            ++DT     +  +       +P  R   SYI++Q+A +  L +    +  YLP P+N+SR
Sbjct: 768  NNDTKSINNQDHSVVDVDMTSPAIRTSSSYIILQQATNATLTLFQSINSVYLPLPLNVSR 827

Query: 743  TKARFALLTACSAVEYLKGGSLYVETXXXXXXXXXXXXXXXXXXXPGIISWHSXXXXXXX 802
            T  RF+LL A  ++EY KGG+L+++                    PG+ SWH+       
Sbjct: 828  TLIRFSLLCARGSLEYTKGGALFLDNKNLLLDTIKDIENDRLLDLPGVASWHTLKLFDMT 887

Query: 803  XXXXXQSPTTKMEKLDKLVQKKINHYNRQMGIPAMKLSNSR----KNNKKIKLENESSQL 858
                 ++P  K+E+LDK ++KK+N+YNR MG+P    ++S       +K        S +
Sbjct: 888  INLLLKAPNVKVERLDKFLEKKLNYYNRLMGLPPTTTTSSEPLFSSQSKNTPANGSRSSI 947

Query: 859  SSTSNP---------IAKGELKSDSVVCEEDDNVN---DNEVTTTAKLEENNEFINPN-- 904
                NP         I  G    D    E+  NVN    +E + +  ++++N   N N  
Sbjct: 948  VKRENPENEYLYGDGINNGNTDMDKPSTEDARNVNKRLKHEKSISQSIDDDNMSRNQNGS 1007

Query: 905  KIEQG-----VTSNTLAFSFSSTDLSALFNAPESL 934
            K +Q       TSN   FSFS+TDL+ALF  PE L
Sbjct: 1008 KFQQDSKKNMSTSNLFPFSFSNTDLTALFTNPEGL 1042

>NCAS0C00390 Chr3 (57333..60827) [3495 bp, 1164 aa] {ON} Anc_8.845
          Length = 1164

 Score =  604 bits (1557), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 399/1072 (37%), Positives = 582/1072 (54%), Gaps = 134/1072 (12%)

Query: 55   RVAQACDRCRLKKTKCDGKIPQCSQCALVGFECKISDRLNRKSFPRGYXXXXXXXXXXXX 114
            R+AQACDRCR KKT+CDGK PQCSQCA+VGFECKISD+L RKSFPRGY            
Sbjct: 76   RIAQACDRCRSKKTRCDGKRPQCSQCAIVGFECKISDKLQRKSFPRGYTETLEEKVRELE 135

Query: 115  XXNKRLMALCNSDLGSNTRSDGLEKQXXXXXXXXXXMERDSERGFTENMELQLQQSC--S 172
              N+RL+A+C  +   + ++D ++                S      +  +    +C  +
Sbjct: 136  NENRRLLAICQFNKLQSQKNDTIDNSTTQEEVYSIRSNSASSTAIETDSNIT---TCLDT 192

Query: 173  SCGNSDPNHRCVHLKPVVSNIIVDSNTDVSFEQNVAPGLPAVKALNSMAEREESAQLAML 232
            +C N   NH  +H+KPV +         +SFEQN APGL AVKAL SMA  E+S QLA L
Sbjct: 193  NCNNDTHNH--LHMKPVSTK---PPQNIISFEQNEAPGLSAVKALKSMANHEQSTQLATL 247

Query: 233  VSLALPRSTEEILFIPQLMANIQKTFGFSSKQSLYTVSLLSSLKKNLPTPNSNSSDENLS 292
            V+LA+PRST+EILFIPQL++ I++ FGF+SK  LYTVSLLSSLK NLP P   +++  ++
Sbjct: 248  VALAIPRSTDEILFIPQLLSKIRQNFGFTSKHCLYTVSLLSSLKPNLPPPKMIANNLEMT 307

Query: 293  P---------NYYVSEDFRPFFYEVLKFDILGETETENGSNRNESPDSTIPNSRSDDLLS 343
                      N +  +D   F  + LK D L +                     S+DLL+
Sbjct: 308  KKLLNQLKITNLWKFDDLSQFINQYLKLDPLNQ-------------------KNSNDLLN 348

Query: 344  WMEIQRLVDVYFECWSNTIPIFSRKLFIKQMKAFKTEV-DKFGDRLFEVYKTEQIKINFL 402
             +E+  L++ +F+ W++ IPI +++ F+    AFK ++ +   D+L     +  +K+N+ 
Sbjct: 349  QIEMDELINFFFQDWNDIIPIINKEEFLSNYNAFKLDLKNSERDKL-----SSNLKMNY- 402

Query: 403  KIFATVLAVMCQMALLSRLKQLEA-TTQELECKRTQNLIAHYNQLIEKIHLDSFFQDMST 461
            KIF  +L +MCQM LL+++K     ++  +  K   +++A+Y+QLI  + +++FFQ ++T
Sbjct: 403  KIFGCILVLMCQMGLLTKIKATNGKSSPNIHLK---SIMAYYHQLIANLPINNFFQ-IAT 458

Query: 462  TTVQSLQLLSFISFYFLNVGDIPRLYQLRGTVISMAQQLRLHRCPSAVLLSASGSTMQKF 521
             ++  L+L   I FY LNVGDI  +Y+LRG +ISM+QQLRLHRCPSAV LS S  TM K 
Sbjct: 459  ISIPQLKLYVLILFYNLNVGDISAIYELRGRIISMSQQLRLHRCPSAV-LSGSSLTMNKL 517

Query: 522  EQGERRLLFWAIYYLDVFYSLQLGVPRLIKDHEIECALPVSEEEDS------QLEGRVSD 575
            +Q  RR+LFW IY LD   SLQLGVPRL+KD+EIECALP++ E+        +LEG VS 
Sbjct: 518  DQSNRRILFWTIYSLDALSSLQLGVPRLLKDYEIECALPITMEDKERDKTKIKLEGTVSP 577

Query: 576  FSLAVIRYAKVLGNILDSIFKRNMMSEAATESMAFVHEKALDIWKNRLPEKYGFRLEANG 635
            FSLA+ R++K+LGNILD IFKRN M+E+ T+S++ +HE ALD W+  LPE   F+L   G
Sbjct: 578  FSLAIFRFSKILGNILDMIFKRN-MTESMTKSVSLIHENALDQWRYDLPEDLTFKLNIQG 636

Query: 636  LFNFDELTVVKNSEKDLIEKSSILL-FYFLAKCMIHLPVIATRSASLEQQLQPGTSSDTS 694
                 +L V+        +K+ IL+ FYF A  MIHLPV+A R                 
Sbjct: 637  SI---DLNVMHQGNSTPGKKNLILMFFYFFAVSMIHLPVVAAR----------------- 676

Query: 695  ETPKESQNKTPTRVCPSYILMQKAASTMLQVMHYTS----EYYLPSPINISRTKARFALL 750
              P + +N  P R   SYI +Q A +TML V+   +     YYLP PIN+SR + R AL+
Sbjct: 677  --PLDVKNAMPDRSSSSYIALQHAINTMLNVLELLNNQPKNYYLPVPINMSRLQIRSALI 734

Query: 751  TACSAVEYLKGGSLYVETXXXXXXXXXXXXXXXXXXXPGIISWHSXXXXXXXXXXXXQSP 810
            ++   ++Y+KGG+L+++                    PG++SWHS            Q+ 
Sbjct: 735  SSRGMLDYIKGGALFLDNKTLLLQVIKNLERDRTLDLPGVVSWHSLKLFDLTITLFIQNS 794

Query: 811  TTKMEKLDKLVQKKINHYNRQMGIPAMKLSNSRKNNKKIKLEN-ESSQLSSTSNPIAKGE 869
              K+EKLDK+++KK N+YN+ MG P    +N+  ++KK K E  E S  S TS P+ K  
Sbjct: 795  NIKLEKLDKILEKKSNYYNKLMGKPTSNNTNNNISSKKRKQETIEISTPSPTSPPLKKMS 854

Query: 870  LKSDSVVCEEDDNVNDNEVTTTAKLEENNEFINPNKIEQGVTSNTLAFSFSSTDLSALF- 928
             KS S + +    +  ++          N+  +  + +  + SN  +++FS+ DLS  F 
Sbjct: 855  KKSKSPILQS--TILPSQTLQNYNNNIQNQLADALQFDPILNSN--SYNFSNFDLSNYFQ 910

Query: 929  -NAPESLFKVPNENTQYN-------QQHEMHNNSISSSHS-------KEPVNKERDSDKQ 973
             N  E   ++P   T  N       +  E+ N +  +  S         P      +   
Sbjct: 911  PNENEKTVQLPKLTTNNNVTNEDPTKYKELFNPTAVTGTSLLNLSTLASPGTSTGLTTTS 970

Query: 974  ELNAIF-----------------NETQNRSTSFAKLMLLLNNEHKSLSSSLENDVRNVGN 1016
            + N I                  N   N + + + +M+L+NNE   +  S  N      N
Sbjct: 971  DNNNILTKGNNNNNNNTNTVFLNNRDNNSTDNLSTMMMLVNNE---IPFSNLNLSELWNN 1027

Query: 1017 KLSSENAGQLPSHGATSGLNSKGNEFLSM-NTLYGGDNDFIIDASLGLAPLL 1067
            KLS+E+  +    G         N+ + M N+ YG    + +DASLGLAPLL
Sbjct: 1028 KLSTEDKDK---QGQEQNQPRNTNDDVGMTNSNYG----YFVDASLGLAPLL 1072

>YMR280C Chr13 complement(827028..831329) [4302 bp, 1433 aa] {ON}
            CAT8Zinc cluster transcriptional activator necessary for
            derepression of a variety of genes under non-fermentative
            growth conditions, active after diauxic shift, binds
            carbon source responsive elements
          Length = 1433

 Score =  602 bits (1551), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 395/1003 (39%), Positives = 536/1003 (53%), Gaps = 141/1003 (14%)

Query: 54   YRVAQACDRCRLKKTKCDGKIPQCSQCALVGFECKISDRLNRKSFPRGYXXXXXXXXXXX 113
            YR+AQACDRCR KKT+CDGK PQCSQCA VGFEC+ISD+L RK++P+GY           
Sbjct: 64   YRIAQACDRCRSKKTRCDGKRPQCSQCAAVGFECRISDKLLRKAYPKGYTESLEERVREL 123

Query: 114  XXXNKRLMALCN---------SDLGSNTRSDGLEKQXXXXXXXXXXMERDSERGFTENME 164
               NKRL+ALC+         S     T +D               +   S   +  N  
Sbjct: 124  EAENKRLLALCDIKEQQISLVSQSRPQTSTDNTINGNFKHDLKDAPLNLSSTNIYLLNQT 183

Query: 165  L--QLQQSCSSCGNSD--------------PNHRC--------VHLKPVVSNIIVDSNTD 200
            +  QLQ       NS                +H C        +H+KP  +++  +  T 
Sbjct: 184  VNKQLQNGKMDGDNSGSAMSPLGAPPPPPHKDHLCDGVSCTNHLHVKPTSTSL--NDPTA 241

Query: 201  VSFEQNVAPGLPAVKALNSMAEREESAQLAMLVSLALPRSTEEILFIPQLMANIQKTFGF 260
            +SFEQ+ APGLPAVKAL SM   + S QLA LVSL++PRSTEEILFIPQL+  I++ FGF
Sbjct: 242  ISFEQDEAPGLPAVKALKSMTTHQRSTQLATLVSLSIPRSTEEILFIPQLLTRIRQIFGF 301

Query: 261  SSKQSLYTVSLLSSLKKNLPTPN----SNSSDENLSPNYYVSEDFRPF-----------F 305
            +SKQ LYTVSLLSSLK  LP P     S S+           +D   F           F
Sbjct: 302  NSKQCLYTVSLLSSLKNRLPAPRLLAPSTSTKLKEKDEDKKLDDDSAFVKRFQSTNLSEF 361

Query: 306  YEVLKFDILGETETENGSNRNESPDSTIPNSRSDDLLSWMEIQRLVDVYFECWSNTIPIF 365
             ++ KF I  +    + S ++E P     N + D+LLS  EI+ L+ ++F+ WSN +PI 
Sbjct: 362  VDLKKFLISLKFNINSFSKQSEKP----ANDQDDELLSLTEIKELLHLFFKFWSNQVPIL 417

Query: 366  SRKLFIKQMKAFKTEVDKFGDRLFEVYKTEQIKINF-LKIFATVLAVMCQMALLSRLK-- 422
            +   F+     F   V        E   T +  +    +IFA  L +M QM LL ++K  
Sbjct: 418  NNDHFLIYFNNFVEVVKHLSTENLETNNTTKSTVTTNHEIFALKLLMMLQMGLLVKIKME 477

Query: 423  QLEATTQELECKRTQNLIAHYNQLIEKIHLDSFFQDMSTTTVQSLQLLSFISFYFLNVGD 482
            +++ T  +    +   L+A+Y+QL   I  + +F +MSTT++ SLQLLS  SFY+LNVGD
Sbjct: 478  KIKYTVPKNPKAKYARLMAYYHQLSLIIPKNPYFLNMSTTSLPSLQLLSLASFYYLNVGD 537

Query: 483  IPRLYQLRGTVISMAQQLRLHRCPSAVLLSASGSTMQKFEQGERRLLFWAIYYLDVFYSL 542
            I  +Y +RG ++SMAQQLRLHRCPSAVL   S   +QKFEQ ERRLLFWAIYY+DVF SL
Sbjct: 538  ISAIYGVRGRIVSMAQQLRLHRCPSAVLSVHSNPVLQKFEQSERRLLFWAIYYVDVFASL 597

Query: 543  QLGVPRLIKDHEIECALPVSEEE-----------------DSQLEGRVSDFSLAVIRYAK 585
            QLGVPRL+KD +IECALP+S+ E                   QL+G+VS FSL +IR+AK
Sbjct: 598  QLGVPRLLKDFDIECALPISDVEYKDQLSMENEKADKKAKKIQLQGQVSSFSLQIIRFAK 657

Query: 586  VLGNILDSIFKRNMMSEAATESMAFVHEKALDIWKNRLPEKYGFRLEANGLFNFDEL--- 642
            +LGNILDSIFKR MM E  T  +A VHE ALD W+N+LPE Y F++  NG  N DE+   
Sbjct: 658  ILGNILDSIFKRGMMDERITSEVALVHENALDNWRNQLPEMYYFQITVNGTVNLDEIRAT 717

Query: 643  ----TVVKNSEKDLI--EKSSILLFYFLAKCMIHLPVIATRSASLEQQLQPGTSSDTSET 696
                T  K  +KD+I  EK  +LLFYFLAK MIHLPVIAT+   L + +   T    S  
Sbjct: 718  NQRNTETKFDKKDIILFEKKILLLFYFLAKSMIHLPVIATK--PLPKNVDNATKKKQSMF 775

Query: 697  PKESQNKT--------------PTRVCPSYILMQKAASTMLQVMHYTSEYYLPSPINISR 742
              +S+  T                R   SYI++Q+A +  L +    +  YLP P+N+SR
Sbjct: 776  NNDSKGATNQDHMILDVDMTSPAIRTSSSYIILQQATNATLTIFQAINSMYLPLPLNVSR 835

Query: 743  TKARFALLTACSAVEYLKGGSLYVETXXXXXXXXXXXXXXXXXXXPGIISWHSXXXXXXX 802
            T  RF+LL A  ++EY KGG+L+++                    PGI SWH+       
Sbjct: 836  TLIRFSLLCARGSLEYTKGGALFLDNKNLLLDTIKDIENDRLLDLPGIASWHTLKLFDMS 895

Query: 803  XXXXXQSPTTKMEKLDKLVQKKINHYNRQMGIPAMKLSN--------------SRKNNKK 848
                 ++P  K+E+LDK ++KK+N+YNR MG+P    ++              +R+    
Sbjct: 896  INLLLKAPNVKVERLDKFLEKKLNYYNRLMGLPPATTTSLKPLFGSQSKNSLENRQRTPN 955

Query: 849  IKLENES-------------------SQLSSTSNPIAKGELKSDSVVCEEDDNVNDNEVT 889
            +K EN                     S +++T+N   + + + D+    +D  +      
Sbjct: 956  VKRENPEHEYLYGNDSNNNNNSEAGHSPMTNTTNGNKRLKYEKDAKRNAKDGGI------ 1009

Query: 890  TTAKLEENNEFINPNKIEQGVTSNTLAFSFSSTDLSALFNAPE 932
              +K E  + F N  K +   TSN   FSFS+TDL+ALF  PE
Sbjct: 1010 --SKGENAHNFQNDTK-KNMSTSNLFPFSFSNTDLTALFTHPE 1049

 Score = 48.9 bits (115), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 80/323 (24%), Positives = 129/323 (39%), Gaps = 56/323 (17%)

Query: 894  LEENNEFINPNKIEQGVTSNTLAFSFSST-DL--SALFNAPESLFKVPNENTQYNQQHEM 950
            L+  N  I  N IE         FS  S  DL    + + PE L  V  +N + ++ ++ 
Sbjct: 1088 LQTGNSNIGQNTIENKPMHMDAIFSLPSNLDLMKDNMDSKPEQLEPVIKQNPENSKNNQF 1147

Query: 951  HNNSISSSHSKEPVNKERDSDKQELNAIFNETQNRSTSFAKLMLLLNNEHKSLSSSLEN- 1009
            H              K + ++ ++ N  FN   N S    KLM LLNN++   + S+ N 
Sbjct: 1148 HQ-------------KGKSTNMEKNNLSFNNKSNYS--LTKLMRLLNNDNSFSNISINNF 1192

Query: 1010 ------------------DVRNVGNKLSSENAGQLPSHGATSGLNSKG------------ 1039
                               V N G      + G   S G+  G    G            
Sbjct: 1193 LYQNDQNSASADPGTNKKAVTNAGANFKPPSTGSNTSQGSILGSTKHGMDNCDFNDLGNF 1252

Query: 1040 NEFLSMNTLYGGDNDFIIDASLGLAPLLSENNEI--HRQHEGTQVQAGNNDILSTRIGFN 1097
            N F++     G D D+I+DASLGLAPLL +  +I        T  ++ N+ IL T   FN
Sbjct: 1253 NNFMTNVNYSGVDYDYIVDASLGLAPLLVDTPDISNTNTTSTTSNRSKNSIILDT--TFN 1310

Query: 1098 GKDDYSNSRSFTNEMFGGSDTKRTRSDTTALLTANSELTHDSQDGNVNFGSTNSELHER- 1156
              DD   SR    E+   +D+  ++   +++ T N+        GN + G ++S+ + + 
Sbjct: 1311 --DDLDRSRMNAREVLNPTDSILSQGMVSSVSTRNTSNQRSLSSGNDSKGDSSSQENSKS 1368

Query: 1157 LNNNHFDAATSYLPEQKSEYGSS 1179
               N  D  ++    +++  G S
Sbjct: 1369 ATGNQLDTPSTLFQMRRTSSGPS 1391

>KNAG0J00250 Chr10 (33322..37035) [3714 bp, 1237 aa] {ON} Anc_8.845
            YMR280C
          Length = 1237

 Score =  590 bits (1521), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 410/1087 (37%), Positives = 572/1087 (52%), Gaps = 169/1087 (15%)

Query: 55   RVAQACDRCRLKKTKCDGKIPQCSQCALVGFECKISDRLNRKSFPRGYXXXXXXXXXXXX 114
            R +QACDRCRLKK KCD K PQCS CA VGFECK+SD+L R SFPRGY            
Sbjct: 171  RASQACDRCRLKKIKCDLKRPQCSSCASVGFECKLSDKLTRNSFPRGYTESLEERIRELE 230

Query: 115  XXNKRLMALCNSDLGSNTRSDGLEKQXXXXXXXXXXMERDSERGFTENMELQLQQSCSSC 174
              N+RL+A+          +D  E+Q          +  D +     + EL    S +  
Sbjct: 231  SENRRLLAM----------NDLKEQQLFK-------IPEDIQSVVDVDAELN---SSNQT 270

Query: 175  GNSDPNHRC---------VHLKPVVSNIIVDSNTDVSFEQNVAPGLPAVKALNSMAEREE 225
             N    H C         +H +PV +N  ++  T VSFEQN APGL A +A++ ++  E+
Sbjct: 271  KNMYATHVCDGICCQDTKLHSRPVATNFNLNDPTSVSFEQNEAPGLMAARAIDQISNHEQ 330

Query: 226  SAQLAMLVSLALPRSTEEILFIPQLMANIQKTFGFSSKQSLYTVSLLSSLKKNLPTPN-- 283
            S QLA+LVSL++PRSTEEILFIPQL+A I++ FGF+SKQ LYTVSLLSSLK +LP PN  
Sbjct: 331  STQLAILVSLSIPRSTEEILFIPQLLAKIRQVFGFTSKQCLYTVSLLSSLKDDLPPPNLL 390

Query: 284  -------SNSSDENL--SPNYYVSEDFRPFFYEVLKFDILGETETENGSNRNESPDSTIP 334
                    NSS+ ++  S N +  E+   FF  VLK +IL              PD    
Sbjct: 391  KNSKMILQNSSNFDILTSVNLWHLENLSNFFQNVLKLNIL--------------PDDDDH 436

Query: 335  NSRSDDLLSWMEIQRLVDVYFECWSNTIPIFSRKLFIKQMKAFKTEVDKF---GDRLFEV 391
              ++DD L+  EI  LV +YF+ WS++IPIF+ K F    + FK ++ K    G    E 
Sbjct: 437  LKKNDDHLALSEIDELVALYFKYWSDSIPIFNEKEFNSNYRVFKADLMKLSKNGPSSLE- 495

Query: 392  YKTEQIKINFLKIFATVLAVMCQMALLSRLKQLEATTQELECKRTQNLIAHYNQLIEKIH 451
                   I  +KIF  +L V+CQM +L + K  +  + + E      L+++Y+ L+  + 
Sbjct: 496  ------NILNIKIFGCLLTVICQMGILIKYKNFKNKSPKFE-----KLLSYYHHLMYVLP 544

Query: 452  LDSFFQDMSTTTVQSLQLLSFISFYFLNVGDIPRLYQLRGTVISMAQQLRLHRCPSAVLL 511
             +S+F  + TT+++++Q+LS I FY LN GDI ++Y LRG +ISMAQQLRLHRCPSAV L
Sbjct: 545  KNSYF-GVITTSIKTVQILSLILFYHLNTGDIIQIYDLRGMIISMAQQLRLHRCPSAV-L 602

Query: 512  SASGSTMQKFEQGERRLLFWAIYYLDVFYSLQLGVPRLIKDHEIECALPVSEE------- 564
            + SGS M + EQG RR LFW IYYLDVF SLQLGVPRLIKDHEIECALP+S E       
Sbjct: 603  TGSGSKMDRLEQGNRRTLFWCIYYLDVFCSLQLGVPRLIKDHEIECALPLSSEIHNTDKM 662

Query: 565  EDSQLEGRVSDFSLAVIRYAKVLGNILDSIFKRNMMSEAATESMAFVHEKALDIWKNRLP 624
            +  QLEG +S+FSL+V+R AKVLGNILDSIFKRN MSE+ TE +  +HE ALD W+ +LP
Sbjct: 663  DGVQLEGTMSEFSLSVVRCAKVLGNILDSIFKRN-MSESITEQVYTIHENALDSWRTKLP 721

Query: 625  EKYGFRLEANGLFNFDELTVVKNSEKDLIEKSSILLFYFLAKCMIHLPVIATRSASLEQQ 684
            +KY F+L ANG+ + + L           E   ++L +FL K MI++P+    SA  E  
Sbjct: 722  KKYQFKLNANGMVDLEHLNH---------ENLILVLLFFLVKSMIYMPL---SSAITELA 769

Query: 685  LQPGTSSDTSETPKESQNKTPTRVCPSYILMQKAASTMLQVMHYTSEYYLPSPINISRTK 744
              P   +D     K S              +Q++ + +L V    +  YLP P+N SRT 
Sbjct: 770  NNPKVKNDYYMNHKVSHTS-----------LQQSINALLSVFKNINNQYLPLPLNSSRTM 818

Query: 745  ARFALLTACSAVEYLKGGSLYVETXXXXXXXXXXXXXXXXXXXPGIISWHSXXXXXXXXX 804
             RFAL++A  ++EY KGG L+ +                    PGII WHS         
Sbjct: 819  TRFALVSAKGSLEYKKGGLLFEDNKVLLLSVIQEIEKDRKLELPGIIPWHSLKLLDLAVN 878

Query: 805  XXXQSPTTKMEKLDKLVQKKINHYNRQMGIPAMKLSNSRKNNKKIKLENESSQLSSTSNP 864
                 PT   +KL+K +QKKIN+YN+ MG P +    S K  +K     +S +   T+N 
Sbjct: 879  LFLLGPTINSDKLEKFLQKKINYYNKIMGKPLITSLPSSKTKRK-----QSKEDLFTANK 933

Query: 865  IAKGELKSDSVVCE------------EDDNVNDNEVTTTAKLEENNEFINPNKIEQGVTS 912
              K ++K++    E             +   N  E T +A       F+   +++  + +
Sbjct: 934  KRKQQVKTELSTLEVKREPQQVQLLKREGQGNTTESTQSA-------FVEALQLDPILNA 986

Query: 913  NTLAFSFSSTDLSALFNAPESLFKVPNENTQYNQQHEMHN---------------NSISS 957
            N   ++FS TDLS  F + ++   VP E+ +   Q  + +               +S+  
Sbjct: 987  NI--YNFSGTDLSNFFISNQN-GDVPRESREPAVQQPIPDRTSLPATNTSVVTGFDSLPK 1043

Query: 958  SHSKEPVNKERDSDKQELNAIFNETQNRSTSFAKLMLLLNNEHKSLSSSLENDVRNVGNK 1017
              + +P         ++    F  T++ + S + +M+ LNN++   S +L       G K
Sbjct: 1044 PENSKPAKDAIGPSLKKGYPSFIGTKSHNNSVSTMMMFLNNDYPFSSMNLNALYAPDGYK 1103

Query: 1018 LSSENAGQLPSHGATSGLNSKGNEFLSMNTLYGG------DNDFIIDASLGLAPLLSENN 1071
             SS   G+               +F    TL  G      D   I+DASLGLAPLL+E  
Sbjct: 1104 ESSAQPGK---------------QF----TLNTGEPHSTYDFGMIVDASLGLAPLLNEAP 1144

Query: 1072 EIHRQHE 1078
            EI  Q E
Sbjct: 1145 EIPGQPE 1151

>Smik_13.493 Chr13 complement(810035..814336) [4302 bp, 1433 aa] {ON}
            YMR280C (REAL)
          Length = 1433

 Score =  592 bits (1526), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 395/1004 (39%), Positives = 540/1004 (53%), Gaps = 143/1004 (14%)

Query: 54   YRVAQACDRCRLKKTKCDGKIPQCSQCALVGFECKISDRLNRKSFPRGYXXXXXXXXXXX 113
            YR+AQACDRCR KKT+CDGK PQCSQCA VGFEC+ISD+L RK++P+GY           
Sbjct: 64   YRIAQACDRCRSKKTRCDGKRPQCSQCAAVGFECRISDKLLRKAYPKGYTESLEERVREL 123

Query: 114  XXXNKRLMALCNS-----DLGSNTR--------SDGLEKQXXXXXXXXXXMERDSERGFT 160
               NKRL+ALC+       L S +R        ++G  KQ                   T
Sbjct: 124  EAENKRLLALCDIKEQQISLVSQSRPPTSMDNTANGSFKQELKDAPLNLSSTNIYLLNQT 183

Query: 161  ENMELQLQQSCSSCGNSDPN------------HRC--------VHLKPVVSNIIVDSNTD 200
             N +LQ  +  S   N+  N            H C        +H+KP  +++  +  T 
Sbjct: 184  VNKQLQNGKMDSDNSNTVMNSLAAAPLPPQKDHVCDGISCTNHLHVKPTSTSL--NDPTA 241

Query: 201  VSFEQNVAPGLPAVKALNSMAEREESAQLAMLVSLALPRSTEEILFIPQLMANIQKTFGF 260
            +SFEQ+ APGLPAVKAL  M   + S QLA LVSL++PRSTEEILFIPQL+  I++ FGF
Sbjct: 242  ISFEQDEAPGLPAVKALKLMTTHQRSTQLATLVSLSIPRSTEEILFIPQLLTRIRQIFGF 301

Query: 261  SSKQSLYTVSLLSSLKKNLPTPN----SNSSDENLSPNYYVSEDFRPFFYEV-------- 308
            +SKQ LYTVSLLSSLK  LP P     S S+         + +D   FF +         
Sbjct: 302  NSKQCLYTVSLLSSLKNRLPAPRLLPPSTSTKLKEKGEDKILDDDSAFFKKFQTTNLSEF 361

Query: 309  ---------LKFDILGETETENGSNRNESPDSTIPNSRSDDLLSWMEIQRLVDVYFECWS 359
                     LKFDI      ++ S ++E+    +PN   ++LLS  EI+ L+ ++F+ WS
Sbjct: 362  VDLKGFLVSLKFDI------DSFSKQSEN----LPNDHDNELLSLTEIKELLHLFFKFWS 411

Query: 360  NTIPIFSRKLFIKQMKAFKTEVDKFGDRLFE--VYKTEQIKINFLKIFATVLAVMCQMAL 417
            N +PI +   F+     F   V        +  V  T  +  N  ++FA  L++M  M L
Sbjct: 412  NQVPILNNDHFLLYFNNFVEVVKDLSSANLKTNVTNTSIVTTNH-ELFALKLSMMLLMGL 470

Query: 418  LSRLK--QLEATTQELECKRTQNLIAHYNQLIEKIHLDSFFQDMSTTTVQSLQLLSFISF 475
            L ++K  +++ T  +    +   L+A+Y+QL   I  + +F +MSTT++ SLQLLS  SF
Sbjct: 471  LVKIKMEKIKYTVPKNPNSKYARLMAYYHQLSLIIPKNPYFLNMSTTSLPSLQLLSLASF 530

Query: 476  YFLNVGDIPRLYQLRGTVISMAQQLRLHRCPSAVLLSASGSTMQKFEQGERRLLFWAIYY 535
            Y+LNVGDI  +Y +RG ++SMAQQLRLHRCPSAVL   S   +QKFEQ ERRLLFWAIYY
Sbjct: 531  YYLNVGDISAIYGVRGRIVSMAQQLRLHRCPSAVLSVHSNPVLQKFEQSERRLLFWAIYY 590

Query: 536  LDVFYSLQLGVPRLIKDHEIECALPVSEEE-----------------DSQLEGRVSDFSL 578
            +DVF SLQLGVPRL+KD +IECALP+S+ E                   QL+G+VS FSL
Sbjct: 591  VDVFASLQLGVPRLLKDFDIECALPISDVEYKDQLFMENKKTNKKAKKIQLQGQVSSFSL 650

Query: 579  AVIRYAKVLGNILDSIFKRNMMSEAATESMAFVHEKALDIWKNRLPEKYGFRLEANGLFN 638
             +IR+AK+LGNILDSIFKR MM E  T  +A VHE ALD W+++LP+ Y F++  NG  N
Sbjct: 651  QIIRFAKILGNILDSIFKRGMMDERITSEVALVHENALDNWRSQLPKMYYFQITVNGTVN 710

Query: 639  FDELTV--VKNSE-----KDLI--EKSSILLFYFLAKCMIHLPVIATRSASLEQQLQPGT 689
             DE+ V   KN E     KD+I  EK  +LLFYFLAK MIHLPVIAT+   L + +  GT
Sbjct: 711  LDEIRVNDSKNIETRFEKKDIILFEKKILLLFYFLAKSMIHLPVIATK--PLPKNIDNGT 768

Query: 690  SSDTSETPKESQNK-------------TPT-RVCPSYILMQKAASTMLQVMHYTSEYYLP 735
                S    +S+               +P  R   SYI++Q+A +  L +    +  Y+P
Sbjct: 769  KKKQSVFSNDSKGSNDQDHMIVDVDMTSPAIRTSSSYIILQQATNATLMIFQTINWMYIP 828

Query: 736  SPINISRTKARFALLTACSAVEYLKGGSLYVETXXXXXXXXXXXXXXXXXXXPGIISWHS 795
             P+N+SRT  RF+LL A  ++EY KGG+L+++                    PG  SWH+
Sbjct: 829  LPLNVSRTLIRFSLLCARGSLEYTKGGALFLDNKNLLLDTIKDIENDRLLDLPGTASWHT 888

Query: 796  XXXXXXXXXXXXQSPTTKMEKLDKLVQKKINHYNRQMGIPAMKLSNSRKNNKKIKLENES 855
                        ++P  K+E+LDK ++KK+N+YNR MG+P   L+ +      +  +++ 
Sbjct: 889  LKLYDMTINLLLKAPNVKVERLDKFLEKKLNYYNRLMGLP---LATTTSIKPILGSQSKD 945

Query: 856  SQLSSTSNPIAKGELKSDSVVCEEDDNVNDNEVTTTAKLE-------------------- 895
            S  +     I K E      +  +DDN  +N     + +E                    
Sbjct: 946  SPETRPRKSIVKRENPEYEYLYGKDDNKKNNSGPDQSPIENTSNGSKRLKYETDTKRGVD 1005

Query: 896  -------ENNEFINPNKIEQGVTSNTLAFSFSSTDLSALFNAPE 932
                   +N E    N  +   TSN   FSFS+TDL+ALF  PE
Sbjct: 1006 TGSIFKSQNAENFQHNNKKTMSTSNLFPFSFSNTDLTALFTHPE 1049

 Score = 42.0 bits (97), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 53/196 (27%), Positives = 84/196 (42%), Gaps = 38/196 (19%)

Query: 954  SISSSHSKEPVNKERDSDKQELNAIFNETQNRSTSFAKLMLLLNNEHKSLSSSLENDV-- 1011
            S++SS   E   K +DS  +  N  FN   N S    KLM LLNN++   + S+ N +  
Sbjct: 1141 SLASSKLHE---KNKDSIMENNNLAFNNKSNYS--LTKLMRLLNNDNSFSNISINNFLYQ 1195

Query: 1012 -------RNVG-NKLSSENAGQLPSHGATSGLNSKG---------------------NEF 1042
                   R+ G +  ++ N G +    +T+G  S+                      N F
Sbjct: 1196 NDQSSISRDPGADNKTATNTGSIFKPPSTAGHRSQSSSIGNTNHGVDNCDFNDLGNFNNF 1255

Query: 1043 LSMNTLYGGDNDFIIDASLGLAPLLSENNEIHRQHEGTQVQAGNNDILSTRIGFNGKDDY 1102
            ++     G D D+I+DASLGLAPLL +  +I   +  +     + + +     FN  DD 
Sbjct: 1256 MTNVNYSGVDYDYIVDASLGLAPLLVDTPDISNTNTTSTTSNRSKNSIILDPTFN--DDM 1313

Query: 1103 SNSRSFTNEMFGGSDT 1118
              SR    E+   +D+
Sbjct: 1314 DQSRRNAKEVLNPTDS 1329

>KLTH0C03762g Chr3 (324666..328286) [3621 bp, 1206 aa] {ON} similar to
            uniprot|P39113 Saccharomyces cerevisiae YMR280C CAT8 Zinc
            cluster transcriptional activator
          Length = 1206

 Score =  585 bits (1509), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 400/1080 (37%), Positives = 567/1080 (52%), Gaps = 127/1080 (11%)

Query: 54   YRVAQACDRCRLKKTKCDGKIPQCSQCALVGFECKISDRLNRKSFPRGYXXXXXXXXXXX 113
            YRVAQACDRCR KKT+CDGK PQCSQCA VGFECK+SD+L+R++FPRGY           
Sbjct: 68   YRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSRRAFPRGYTETLEERVREL 127

Query: 114  XXXNKRLMALCN---------SDLGSNTRSDGLEKQXXXXXXXXXXMERDSERGFTENME 164
               N+RL+ALC+             SN R +    +              S R  + N  
Sbjct: 128  EAENRRLVALCDLKDEQMHLVYKYSSNKRPEPSSTEEEQMLEQLSSSNGGSLRVSSTN-- 185

Query: 165  LQLQQSCSSCGNSDP-NHRC------------VHLKPVVSNIIVDSNTDVSFEQNVAPGL 211
            L L    S  G+  P NH+C            +H KP VS  + D  T +SFEQ+ APGL
Sbjct: 186  LYLLNKTSPAGHEVPENHKCQGIDCNHTSHPHLHEKP-VSTTLSDPTT-ISFEQHEAPGL 243

Query: 212  PAVKALNSMAEREESAQLAMLVSLALPRSTEEILFIPQLMANIQKTFGFSSKQSLYTVSL 271
            PAVKAL+SMA  E S QLA LV+L++PRSTEEILFIPQL+A + +  G +SKQ LYT SL
Sbjct: 244  PAVKALSSMANHEYSTQLACLVALSVPRSTEEILFIPQLLARLGQVHGLTSKQCLYTASL 303

Query: 272  LSSLKK--NLPTPNSNSSDENLSPNYYVSEDFRPFFYEVLKFDILGETETENGSNRNESP 329
            L+SLK+      P ++   E    + +  +D   FF +  KF++  + + E         
Sbjct: 304  LASLKEPSQAVVPTTDGLTELKCTSLWEIDDPMRFFKDSCKFNLGSDNDVE--------- 354

Query: 330  DSTIPNSRSDDLLSWMEIQRLVDVYFECWSNTIPIFSRKLFIKQMKAFKTE--VDK-FGD 386
                       LLS  EI+ L+ +YFE     IP+ +   F K    FK    VD  F  
Sbjct: 355  -----------LLSISEIEDLISIYFEECHALIPVLNENEFYKYYNKFKESLTVDPNFFG 403

Query: 387  RLFEVYKTEQIKINFLKIFATVLAVMCQMALLSRLKQLEATTQELECK-RTQNLIAHYNQ 445
            +    +      I++ KIFA +L V+CQ+ ++S++K+     ++L  K +   ++A+YN 
Sbjct: 404  KANSSFAHRSKSISY-KIFACILLVVCQLGIMSKVKR-----EQLPAKSKFSRIMAYYNN 457

Query: 446  LIEKIHLDSFFQDMSTTTVQSLQLLSFISFYFLNVGDIPRLYQLRGTVISMAQQLRLHRC 505
             I  + L+ +F  + TT+V++LQL+S + FYFLNVG++  +Y+LRGT++SMAQQLRLHRC
Sbjct: 458  AILALKLNPYF-SVKTTSVKTLQLMSLLLFYFLNVGEVSSVYELRGTIVSMAQQLRLHRC 516

Query: 506  PSAVLLSASGSTMQKFEQGERRLLFWAIYYLDVFYSLQLGVPRLIKDHEIECALPVSE-- 563
            PSAV L   GSTM K EQG+RRLLFW IYYLDVF +LQLGVPRL+KDHEIECALP+SE  
Sbjct: 517  PSAV-LGTEGSTMSKSEQGDRRLLFWGIYYLDVFSALQLGVPRLLKDHEIECALPISENG 575

Query: 564  -------EEDSQLEGRVSDFSLAVIRYAKVLGNILDSIFKRNMMSEAATESMAFVHEKAL 616
                   ++  +LEG+VS+FSL+++R++K+LGNILDSIFKR M S  A + +A +HE AL
Sbjct: 576  HPGVSLADQVIRLEGQVSEFSLSLLRFSKILGNILDSIFKRGMTSSIA-QQVALIHENAL 634

Query: 617  DIWKNRLPEKYGFRLEANGLFNFDELTVVKNSEKDL-----IEKSSILLFYFLAKCMIHL 671
            D W+  LP+   F L+ NG  N +EL    + +KD       +  ++++ YFL KC++HL
Sbjct: 635  DSWRRGLPKNLTFELDVNGTINMEELNSGSHWKKDYSTAPSCDNRTLMVLYFLVKCLVHL 694

Query: 672  PVIATRSASLEQQLQPGTSSDTSETPK-ESQNKTPTRVCPSYILMQKAASTMLQVMHYTS 730
            PV+A +       L   +  DT  T   +  +    R   SY+L+Q+A +T L V     
Sbjct: 695  PVLAAKPL-----LGGASEVDTDATLAFDDASSGADRSSSSYVLLQQATNTFLSVQSSLK 749

Query: 731  EYYLPSPINISRTKARFALLTACSAVEYLKGGSLYVETXXXXXXXXXXXXXXXXXXXPGI 790
              +LP  +N+ R KARFALL+A   +EY KGG+L+                      PG 
Sbjct: 750  SRHLPLALNLPRIKARFALLSARGILEYTKGGALFQGNKALLLDVVKELETTKRLEIPGS 809

Query: 791  ISWHSXXXXXXXXXXXXQSPTTKMEKLDKLVQKKINHYNRQMGIPAMKLSNSRKNNKKIK 850
            +SWHS            Q P TK  KLDKL++ K+++YN+ MG  A   S  RK      
Sbjct: 810  LSWHSLILLDMAVSLIMQPPHTKAGKLDKLLEAKLSYYNKLMGRSANVASTKRKK----- 864

Query: 851  LENESSQLSSTS--NPIAKGELKS--DSVVCEEDDNVNDNEVTTTAKLEENN---EFINP 903
             E +++ LS+ +   P++          V  E  D V +  V      + N    E    
Sbjct: 865  -EEDNTSLSNATKLTPLSSDSSSPSEKRVKLEHTDKVGETPVGVENTGQPNGNTQEHYAA 923

Query: 904  NKIEQGVTSNTLAFS-----------FSSTDLSALFNAPESLFKVPNENTQYNQQHEMHN 952
                Q    +T+A +           FS+ DL+A F+    +  +    +  N       
Sbjct: 924  TWSNQNQPHSTVAEAFHLDPVLNNNPFSNGDLTAFFSTDNGMPNLSGGASMLNMVGVDQA 983

Query: 953  NSISSSHSKEPVNKERDSDKQELNAIFNETQNRSTSFAKLMLLLNNEHKSLSSSLENDVR 1012
            +S + + ++  VN    ++ Q+ + +FN+   R  S    +                D  
Sbjct: 984  HSTAGNDAQNTVN----ANSQQ-STLFNDGLFRVPSNGDFL---------------KDYY 1023

Query: 1013 NVGNKLSSENAGQLPSHGATSGLNSKGNEFLSMNTLYGGDNDFIIDASLGLAPLLSENNE 1072
             V    SS+    L   G +SG N +  +    NT   G   F +DASLGLAPLL+ + E
Sbjct: 1024 RVPGASSSQLNLMLMGSG-SSGSNQRQAKQQQTNTTDPGFG-FTVDASLGLAPLLAWSPE 1081

>Skud_13.452 Chr13 complement(800289..804587) [4299 bp, 1432 aa] {ON}
            YMR280C (REAL)
          Length = 1432

 Score =  590 bits (1520), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 384/1003 (38%), Positives = 527/1003 (52%), Gaps = 141/1003 (14%)

Query: 54   YRVAQACDRCRLKKTKCDGKIPQCSQCALVGFECKISDRLNRKSFPRGYXXXXXXXXXXX 113
            YR+AQACDRCR KKT+CDGK PQCSQCA VGFEC+ISD+L RK++P+GY           
Sbjct: 63   YRIAQACDRCRSKKTRCDGKRPQCSQCAAVGFECRISDKLLRKAYPKGYTESLEERVREL 122

Query: 114  XXXNKRLMALCN-------------------SDLGSNTRSD------GLEKQXXXXXXXX 148
               NKRL+ALC+                   S++  N + +       L           
Sbjct: 123  EAENKRLLALCDIKEQQISLVSQSRPSTSLDSNVDGNCKKELKDAPLNLSSTNIYLLNQT 182

Query: 149  XXMERDSERGFTENMELQLQQSCSSCGNSDPNHRC--------VHLKPVVSNIIVDSNTD 200
               +  S +   +N +  +    +S      +H C        +H+KP  +++     T 
Sbjct: 183  VNKQLQSGKMDNDNSDAAIDSLAASPSPPPKDHVCDGVSCTNRLHVKPTSTSL--SDPTA 240

Query: 201  VSFEQNVAPGLPAVKALNSMAEREESAQLAMLVSLALPRSTEEILFIPQLMANIQKTFGF 260
            +SFEQN APGLPAVKAL SM   + S QLA LVSL++PRSTEEILFIPQL+  I++ FGF
Sbjct: 241  ISFEQNEAPGLPAVKALKSMTTHQRSTQLATLVSLSIPRSTEEILFIPQLLTRIRQIFGF 300

Query: 261  SSKQSLYTVSLLSSLKKNLPTP---------NSNSSDENLSPN-----------YYVSE- 299
            +SKQ LYTVSLLSSLK  LP P         NS   +E+ +PN             +SE 
Sbjct: 301  NSKQCLYTVSLLSSLKNRLPAPSILLPSTSTNSKEKNEDKTPNDDSAFLKTFQSTSLSEF 360

Query: 300  -DFRPFFYEVLKFDILG-ETETENGSNRNESPDSTIPNSRSDDLLSWMEIQRLVDVYFEC 357
             D + F    LKFDI     + E  +N ++S           DLLS  EI+ L+ ++F+ 
Sbjct: 361  VDLKKFLIS-LKFDIDSFSKQPEKQANGHDS-----------DLLSLTEIKELLHLFFKF 408

Query: 358  WSNTIPIFSRKLFIKQMKAFKTEVDKFGDRLFEVYKTEQIKINFLKIFATVLAVMCQMAL 417
            WSN +PI +   F+     F   +  F   L         K N           +  M  
Sbjct: 409  WSNQVPILNNDHFLLYFNNFVEIIKDFS--LISTKANSTTKNNVTTNHEIFTLKLLMMLQ 466

Query: 418  LSRLKQLEATTQELECKRTQN-----LIAHYNQLIEKIHLDSFFQDMSTTTVQSLQLLSF 472
            +  L +++    +    R  N     L+++Y+Q+   I  + +F +MSTT++ SLQLLS 
Sbjct: 467  MGLLIKIKKDKIKDTVPRNSNAKYIRLMSYYHQISLIIPKNPYFLNMSTTSLPSLQLLSL 526

Query: 473  ISFYFLNVGDIPRLYQLRGTVISMAQQLRLHRCPSAVLLSASGSTMQKFEQGERRLLFWA 532
             SFY+LNVGDI  +Y +RG ++SMAQQLRLHRCPSAVL   S   +QKFEQ ERRLLFWA
Sbjct: 527  ASFYYLNVGDISAIYGIRGRIVSMAQQLRLHRCPSAVLSVHSNPVLQKFEQSERRLLFWA 586

Query: 533  IYYLDVFYSLQLGVPRLIKDHEIECALPVSEEE-----------------DSQLEGRVSD 575
            IYY+DVF SLQLGVPRL+KD +IECALP+S+ E                   QL+G+VS 
Sbjct: 587  IYYVDVFASLQLGVPRLLKDFDIECALPISDVEYKDQLSMENEKMKNKAKKIQLQGQVSS 646

Query: 576  FSLAVIRYAKVLGNILDSIFKRNMMSEAATESMAFVHEKALDIWKNRLPEKYGFRLEANG 635
            FSL +IR+AK+LGNILDSIFKR MM E  +  +A VHE ALD W+N+LPE Y F++  NG
Sbjct: 647  FSLQIIRFAKILGNILDSIFKRGMMDERISSEVALVHENALDNWRNQLPEMYYFKITVNG 706

Query: 636  LFNFDELTVVKNSE-------KDLI--EKSSILLFYFLAKCMIHLPVIATRSAS-----L 681
              N DE+    + +       KD+I  EK  +LLFYFLAK MIHLPVIAT+  S     +
Sbjct: 707  TVNLDEIRANNSRDIETPFETKDIILFEKKILLLFYFLAKSMIHLPVIATKPLSKNVDNV 766

Query: 682  EQQLQPGTSSDTSETPKESQ-------NKTPTRVCPSYILMQKAASTMLQVMHYTSEYYL 734
             ++ Q   ++D+  T                 R   SYI++Q+A +  L +    +  YL
Sbjct: 767  MKKKQSMFNNDSKGTNNHDHMAVDVDMTSPAIRTSSSYIILQQATNATLTIFQSINWMYL 826

Query: 735  PSPINISRTKARFALLTACSAVEYLKGGSLYVETXXXXXXXXXXXXXXXXXXXPGIISWH 794
            P P+N+SRT  RF+LL A  ++EY KGG+L+++                    PGI SWH
Sbjct: 827  PLPLNVSRTLVRFSLLCARGSLEYTKGGALFLDNKNLLLDTIKDIENDRLLELPGIASWH 886

Query: 795  SXXXXXXXXXXXXQSPTTKMEKLDKLVQKKINHYNRQMGIPAMKLSNSR-------KNNK 847
            +            ++P  K+E+LDK ++KK+N+YNR MG+P    ++ +       KN+ 
Sbjct: 887  TLKLFDMTINLLLKAPNVKVERLDKFLEKKLNYYNRLMGLPLATTTSLKPLFGFQSKNSP 946

Query: 848  KIKLENESSQLSSTSNPIAKGELKSDSVVCEEDDNVNDNEVTT----------------- 890
            + K    + +  +  N    G   +++   E D     N   T                 
Sbjct: 947  ETKPRKSTVKRETPDNDYLYGNDTNNNNNPETDQPRTANVGNTNKRLKYAKDTRQSVDKD 1006

Query: 891  -TAKLEENNEFINPNKIEQGVTSNTLAFSFSSTDLSALFNAPE 932
              AK ++ + F + NK      SN   FSFS+TDL+ALF  PE
Sbjct: 1007 GIAKAQDASNFHHDNKKTMSA-SNLFPFSFSNTDLTALFAHPE 1048

 Score = 46.2 bits (108), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 87/378 (23%), Positives = 152/378 (40%), Gaps = 70/378 (18%)

Query: 910  VTSNTLAFSFSSTDLSALFNAPESLFKVPNE-NTQYNQQHEMHNNSISSSHSKEPVNKER 968
            VT+N  A    +    A+F+ P +L  + N  +++  +++ +   +  SS + +  ++++
Sbjct: 1092 VTTNQNAVCDKTIHKDAIFSLPSNLDLMKNNMDSKPEKKNSIIKQNPKSSSNSQLQHRDK 1151

Query: 969  DSDKQELNAIFNETQNRSTSFAKLMLLLNNEHKSLSSSLENDVRNVGNKLSSENAGQLPS 1028
            D + +  N  FN   N S    KLM LLN+++   S S+ N +       ++++ G    
Sbjct: 1152 DVNIESNNPPFNSKSNYS--LTKLMRLLNSDNSFSSISINNFLYQNDQNSAAQDTGTNNR 1209

Query: 1029 HGATSGLNSK--------------GNEFLSM----------------NTLYGG-DNDFII 1057
             G+ +G N K              GN    M                N  Y G D D+I+
Sbjct: 1210 AGSNTGSNFKPASSASNESQSSITGNAKHGMDNCDFNDFGNFNNFMTNVNYSGVDYDYIV 1269

Query: 1058 DASLGLAPLLSENNEIHRQHEGTQVQAGNNDILSTRIGFNGKDDYSNSRSFTNEMFGGSD 1117
            DASLGLAPLL +  +I   +  +     + + +     FN  DD   S +   E+   +D
Sbjct: 1270 DASLGLAPLLVDTPDISNTNTTSTTSNRSKNSIILDSTFN--DDLDRSHTNAREVLNHAD 1327

Query: 1118 TKRTRSDTTALLTANSELTHDSQDGNVNFGSTNSELHER-LNNNHFDAATSYLPEQKSEY 1176
            +  ++   +++ T  +++   S  GN +  +  S+ + +  NN   DA ++    +++  
Sbjct: 1328 SILSQGIMSSISTRTADIQRSSSSGNDSKSNGYSQKNPKNANNGQLDAPSTLFQMRRTSS 1387

Query: 1177 GSSFGNKNTVKSLSPSTSFLDDDTLSLSFGDYSTQXXXXXXXXXXXTLGKDSLAMKTEIN 1236
            G             PSTS           G    Q             G           
Sbjct: 1388 G-------------PSTSHR---------GPRRPQKHRYSTDQSKGFSG----------- 1414

Query: 1237 GGRNQGNLHDLFQWQNSK 1254
            G  N  NL DLFQWQN+K
Sbjct: 1415 GSSNADNLPDLFQWQNAK 1432

>Kwal_27.10232 s27 (251015..254644) [3630 bp, 1209 aa] {ON} YMR280C
           (CAT8) - Zinc-cluster protein involved in activating
           gluconeogenic genes; related to Gal4p [contig 39] FULL
          Length = 1209

 Score =  560 bits (1443), Expect = e-178,   Method: Compositional matrix adjust.
 Identities = 359/939 (38%), Positives = 522/939 (55%), Gaps = 108/939 (11%)

Query: 54  YRVAQACDRCRLKKTKCDGKIPQCSQCALVGFECKISDRLNRKSFPRGYXXXXXXXXXXX 113
           YRVAQACDRCR KKT+CDGK PQCSQCA VGFECK+SD+L+R++FPRGY           
Sbjct: 68  YRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSRRAFPRGYTETLEERVREL 127

Query: 114 XXXNKRLMALCN---------SDLGSNTRSDGLEKQXXXXXXXXXXMERDSERGFTENME 164
              N+RL+ALC+         S   SN R +    +           +  S R  + N+ 
Sbjct: 128 EAENRRLVALCDLKDEQMHLVSKYSSNKRHEPSSTEEGRMLEQLSNSDGGSLRVSSTNLY 187

Query: 165 L------QLQ-----QSCSSCGNSDPNHRCVHLKPVVSNIIVDSNTDVSFEQNVAPGLPA 213
           L       +Q       C   G +  +H  +H KPV +++       +SFEQN APGLPA
Sbjct: 188 LLNKTTPAVQDGSELHKCQGLGCNHASHPHLHEKPVSTSL--SDPAAISFEQNEAPGLPA 245

Query: 214 VKALNSMAEREESAQLAMLVSLALPRSTEEILFIPQLMANIQKTFGFSSKQSLYTVSLLS 273
           VKALN+MA  E SAQLA LV+L++PRST+EILFIPQL+A + +  G +SKQ LY+ SLL+
Sbjct: 246 VKALNTMANHEYSAQLAYLVALSVPRSTDEILFIPQLLARLGQVHGLTSKQCLYSASLLA 305

Query: 274 SLKKNLPTPNSNSSDENLSPNY--------YVSEDFRPFFYEVLKFDILGETETENGSNR 325
           +LK+      S+ +    SP+Y        +  +D   FF    KF++            
Sbjct: 306 ALKE------SSQTSFQGSPDYKDLKDKSLWEIDDCMTFFKTGCKFNLT----------- 348

Query: 326 NESPDSTIPNSRSDDLLSWMEIQRLVDVYF-ECWSNTIPIFSRKLFIKQMKAFKTEV--- 381
                    +S+  + L+  EI+ L+ +YF EC +  IP+ +   F K    FK+ +   
Sbjct: 349 ---------SSKDAECLTISEIEELISIYFGECHA-LIPVLNEAEFYKYYNKFKSNLTTD 398

Query: 382 DKFGDRLFEVYKTEQIKINFLKIFATVLAVMCQMALLSRLKQLEATTQELECKRTQNLIA 441
            +F       +      I++ KIFA +L V+CQ  L++++K+ +  T+     +   L++
Sbjct: 399 PEFFKTSTPSFAQRSKSISY-KIFACILLVICQFGLMAKVKREQLPTK----NKFSLLMS 453

Query: 442 HYNQLIEKIHLDSFFQDMSTTTVQSLQLLSFISFYFLNVGDIPRLYQLRGTVISMAQQLR 501
           +Y+  +  +  + +F  +  T++Q+LQLLS + FY+LNVG++  +Y++RGTV+SMAQQLR
Sbjct: 454 YYSNALLALKTNPYF-SVKNTSIQTLQLLSLLLFYYLNVGEVSSVYEIRGTVVSMAQQLR 512

Query: 502 LHRCPSAVLLSASGSTMQKFEQGERRLLFWAIYYLDVFYSLQLGVPRLIKDHEIECALPV 561
           LHRCPSAV L   GSTM K EQG+RRLLFW IYYLDVF +LQLGVPRL+KDHEIECALP+
Sbjct: 513 LHRCPSAV-LGTEGSTMSKSEQGDRRLLFWGIYYLDVFGALQLGVPRLLKDHEIECALPI 571

Query: 562 SEEEDS---------QLEGRVSDFSLAVIRYAKVLGNILDSIFKRNMMSEAATESMAFVH 612
           SE   +         +LEG+VS+ SL+++R++K+LGNILDSIFKR M S AA + +A +H
Sbjct: 572 SEHAHAGVSLADQVIKLEGQVSELSLSLLRFSKILGNILDSIFKRGMTSSAA-QQVALIH 630

Query: 613 EKALDIWKNRLPEKYGFRLEANGLFNFDELTVVKNSEKDLIEKSS-----ILLFYFLAKC 667
           E ALD W+  LP+   F L+ NG    +ELT    + +D  + +S     ++L YFL KC
Sbjct: 631 ENALDNWRRGLPKNLTFELDVNGTIKIEELTGSAQNNQDFTKNASSDKKILMLLYFLVKC 690

Query: 668 MIHLPVIATRSASLEQQLQPGTSSDTSETPK-ESQNKTPTRVCPSYILMQKAASTMLQVM 726
           ++HLPV+A +       L   +  D   TP  +  +    R   SY+L+Q+A +T L V 
Sbjct: 691 LVHLPVLAAKPL-----LGGSSEPDKDATPAFDDASSGADRSSSSYVLLQQATNTFLSVQ 745

Query: 727 HYTSEYYLPSPINISRTKARFALLTACSAVEYLKGGSLYVETXXXXXXXXXXXXXXXXXX 786
                 +LP  I++ R KARFALL+A   +EY KGG+L+ +                   
Sbjct: 746 SCFKTRHLPLAIDLPRIKARFALLSARGILEYTKGGALFQDNKALLLEVVKELEASKKLE 805

Query: 787 XPGIISWHSXXXXXXXXXXXXQSPTTKMEKLDKLVQKKINHYNRQMGIPAMKLSNSRKN- 845
            PG +SWHS            Q P TK +KLDKL++ ++N+YN+ MG   +  +  RKN 
Sbjct: 806 LPGSLSWHSLILLDMATLLIMQPPQTKTDKLDKLLETRLNYYNKLMGRSTLTSNGKRKNE 865

Query: 846 -----NKKIKLENESSQLSSTSNPIAK-------GELKSDSVVCEEDDNVNDNEVTTTAK 893
                +K  KL   SS+ ++ S+   K       G + S+S      D++ +++ +T   
Sbjct: 866 ENDATSKVSKLTPLSSEYNTPSDKRIKVESIGSSGNVPSNSESVHHFDDIQNDKFSTN-- 923

Query: 894 LEENNEFINPNKIEQGVTSNTL--AFSFSSTDLSALFNA 930
              NN    PN I +    + +     FS+ DL+A FN+
Sbjct: 924 WPSNNP--QPNAIAEAFHLDPVLNGNPFSNGDLTAFFNS 960

>KAFR0B03950 Chr2 complement(823760..827500) [3741 bp, 1246 aa] {ON}
            Anc_8.845 YMR280C
          Length = 1246

 Score =  514 bits (1324), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 378/1000 (37%), Positives = 544/1000 (54%), Gaps = 150/1000 (15%)

Query: 184  VHLKPVVSNIIVDSNTDVSFEQNVAPGLPAVKALNSMAEREESAQLAMLVSLALPRSTEE 243
            +H +PV +N   +  T +SFEQ+ APGL A KAL S+  +EE+ QLA+LVSL++PRSTEE
Sbjct: 254  LHPQPVATN--YNDPTSISFEQSEAPGLVAAKALKSINNQEEATQLAILVSLSVPRSTEE 311

Query: 244  ILFIPQLMANIQKTFGFSSKQSLYTVSLLSSLKKNLPTPNS-----NSSDENL--SPNYY 296
            ILFIPQL+A I++  GF+SKQ LYTVSLLSSLK +LP+P S     NS +  L  + N +
Sbjct: 312  ILFIPQLLAKIRQVHGFTSKQCLYTVSLLSSLKNSLPSPKSDFLMDNSQNSLLLKNTNIW 371

Query: 297  VSEDFRPFFYEVLKFDILGETETENGSNRNESPDSTIPNSRSDDLLSWMEIQRLVDVYFE 356
               D   FF ++LKF+I            N+S  ST        LLS+ +I  L ++YF 
Sbjct: 372  QINDLNVFFTDLLKFNI-----------SNDSKTST--------LLSFDDIDDLTNLYFN 412

Query: 357  CWSNTIPIFSRKLFIKQMKAFKTEVDKFGDRLFEVYKTEQIKINFLKIFATVLAVMCQMA 416
             WSN IP+ + + F  +   FK +   F      +   +   +   K F   L VMCQM 
Sbjct: 413  HWSNLIPVLNEEEFFNRYNNFKIQCQSF------IQGNQSNNLRDYKFFGCFLMVMCQMG 466

Query: 417  LLSRLKQLEATTQELECKRTQNLIAHYNQLIEKIHLDSFFQDMSTTTVQSLQLLSFISFY 476
            LL +LK+ ++     +      ++ +Y+QL   +  +  + D +TT+++S+QLL+ + FY
Sbjct: 467  LLIKLKEHKSNNSLFK------ILTYYHQLTYILPKNPVY-DFATTSIKSVQLLALLLFY 519

Query: 477  FLNVGDIPRLYQLRGTVISMAQQLRLHRCPSAVLLSASGSTMQKFEQGERRLLFWAIYYL 536
             LN+G+I ++Y+LRG +ISMA QLRLHRCPSAVL + SGSTMQK EQ  RRLLFW IYYL
Sbjct: 520  HLNMGNIEQIYELRGNIISMAHQLRLHRCPSAVL-TGSGSTMQKLEQSNRRLLFWTIYYL 578

Query: 537  DVFYSLQLGVPRLIKDHEIECALPVS--------EEEDSQLEGRVSDFSLAVIRYAKVLG 588
            DVF SLQLGVPRL+KD+EIECALPV         +    +LEG VS  SL + R+AKVLG
Sbjct: 579  DVFSSLQLGVPRLLKDYEIECALPVDNTTTMDAIDGTSIKLEGTVSQISLTLFRFAKVLG 638

Query: 589  NILDSIFKRNMMSEAATESMAFVHEKALDIWKNRLPEKYGFRLEANGLFNFDELTVVKNS 648
            NI+DSIFKRNM S + +  +A +HE ALD W++RLPE++ F+L+ NG  N ++L   +NS
Sbjct: 639  NIVDSIFKRNM-STSISRQVALIHENALDNWRSRLPEQFQFKLDVNGTINLNDLDT-ENS 696

Query: 649  EKDLIEKSSILLFYFLAKCMIHLPVIATRSASLEQQLQPGTSSDTSETPKESQNKTPTRV 708
            +   +     ++FYFLAKCMIHLPV +T+   LE ++   T +D              R 
Sbjct: 697  DTIFL-----IVFYFLAKCMIHLPVCSTK-VDLEDKVTE-TGNDVIYN---------DRF 740

Query: 709  CPSYILMQKAASTMLQVMHYTSEYYLPSPINISRTKARFALLTACSAVEYLKGGSLYVET 768
              SY+ +Q++ +TML  +    + YLP P N+SRT  RF L++A  +++Y+KGGSL+++ 
Sbjct: 741  STSYVSLQQSTNTMLNALRMIRDKYLPMPFNVSRTLTRFTLISAKGSLDYIKGGSLFIDN 800

Query: 769  XXXXXXXXXXXXXXXXXXXPGIISWHSXXXXXXXXXXXXQSPTTKMEKLDKLVQKKINHY 828
                               PGIISWHS            Q+  TK EK++KL+QKK+N+Y
Sbjct: 801  KKLLLDCVQDIEANRKLDLPGIISWHSLKLLDLTLNLFLQNSNTKPEKIEKLLQKKLNYY 860

Query: 829  NRQMG------IPAMKLSNSRKNN-------KKIK--LENESSQLSSTSNPIA---KGEL 870
            N+ MG      +P  K +N  K N       KK+K  LEN+ + L    +PI    +G  
Sbjct: 861  NKLMGKPLVKNLPIQKRTNQNKGNNNDEPSRKKVKKELENDINSL----HPILIDNEGVT 916

Query: 871  KSDSVVCEEDDNVNDNEVTTTAKLEENNEFINPNKIEQGVTSNTLAFSFSSTDLSALFNA 930
             SD+       N N N    T +    NEF    +++  + S+   + FS+ DL+ LFN+
Sbjct: 917  PSDAAPLINKTNSNTNNPVVTTQ----NEFAEALQVDPILNSD--YYQFSNLDLATLFNS 970

Query: 931  --------------------PESLFKVPN-------ENTQYNQQHEMHNN---SISSS-- 958
                                P +   +P         N+  N +  + N    +IS +  
Sbjct: 971  DKLNKINSHHGSSINLIDQKPFNDSLIPKFSQVNTASNSTLNMEQLLRNQGKFNISPNIF 1030

Query: 959  ----HSKEPVNKERDSDKQELNAIFNETQNRST--SFAKLMLLLNNE--HKSLSSSL-EN 1009
                 SKE +     + K   N +++  +N S   S   +M+LLNNE    S++S+  E+
Sbjct: 1031 SPNFQSKENL---LGNSKVNNNLLYSNLKNNSNNQSLTTMMMLLNNEIPFSSINSNTGES 1087

Query: 1010 DV-RNVGNKLSSENAGQLPSHGATSGLNSKGNEFLSMNTLYGGDNDFIIDASLGLAPLLS 1068
             V +   N   ++N   +      +  N  GN   + N  Y  D  +IID SLGLAPLL+
Sbjct: 1088 GVNKQNANATENDNVETINFKQDLTNKNESGNMLSTEN--YLSDFSYIIDGSLGLAPLLA 1145

Query: 1069 -------ENNEIHRQHEGTQVQAGNNDILSTRIGFNGKDD 1101
                   ENN ++     T  Q  N  +LS++     KDD
Sbjct: 1146 NPFKPTGENNLVNVSSIETTGQCINPKVLSSQSSDANKDD 1185

 Score =  108 bits (271), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 44/72 (61%), Positives = 53/72 (73%)

Query: 54  YRVAQACDRCRLKKTKCDGKIPQCSQCALVGFECKISDRLNRKSFPRGYXXXXXXXXXXX 113
           YRV QACDRCR KKT+CDG+ PQCSQCA VGFECK+SD+L RK++PRGY           
Sbjct: 26  YRVTQACDRCRSKKTRCDGRKPQCSQCAAVGFECKVSDKLIRKAYPRGYTESIEERVREL 85

Query: 114 XXXNKRLMALCN 125
              N+RL+ALC+
Sbjct: 86  EAENRRLLALCD 97

>ZYRO0G14278g Chr7 complement(1141297..1145049) [3753 bp, 1250 aa]
            {ON} similar to uniprot|Q75DZ4 Ashbya gossypii ABL121C
            ABL121Cp and similar to YMR280C uniprot|P39113
            Saccharomyces cerevisiae YMR280C CAT8 Zinc cluster
            transcriptional activator
          Length = 1250

 Score =  509 bits (1312), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 366/969 (37%), Positives = 530/969 (54%), Gaps = 144/969 (14%)

Query: 184  VHLKPVVSNIIVDSNTDVSFEQNVAPGLPAVKALNSMAEREESAQLAMLVSLALPRSTEE 243
            +H+KPV +N+  +  T VSFEQ+ APGLPAV+AL S+A RE+S QLA LV+L++PRSTEE
Sbjct: 254  LHVKPVSTNL--NDPTSVSFEQSEAPGLPAVQALTSVATREQSNQLATLVALSVPRSTEE 311

Query: 244  ILFIPQLMANIQKTFGFSSKQSLYTVSLLSSLKKNLPTPN--SNSSDENL-SPNYYVSED 300
            ILFIPQL+A I++ +GF+SKQ LYTVSLLSSLK +LP P+   +   E L S N +  +D
Sbjct: 312  ILFIPQLLARIRQIYGFTSKQCLYTVSLLSSLKSSLPEPHLVKHEPLETLASTNLWEMDD 371

Query: 301  FRPFFYEVLKFDILGETETENGSNRNESPDSTIPNSRSDDLLSWMEIQRLVDVYFECWSN 360
               FF E+ KF +            ++SP S     +    L+  EI+ L+ ++FE  S 
Sbjct: 372  LEQFFAEIFKFKL-----------ESKSPSSY----KGGAQLNLSEIEELISIFFEHSSI 416

Query: 361  TIPIFSRKLFIKQMKAFKTEVDKFGDRLFEVYKT---------EQIKINFLKIFATVLAV 411
             IPI  +  F      FK  V +      E  KT          + KI   KIF  ++ +
Sbjct: 417  HIPILVKDEFYHYFNQFKENVLQN----LEFLKTPLQGPALTARRGKIISYKIFGCIILM 472

Query: 412  MCQMALLSRLK--QLEATTQELECKRTQNLIAHYNQLIEKIHLDSFFQDMSTTTVQSLQL 469
            +CQ+ LLS++K   L AT++         L ++Y++ I  ++++ +F  +S T++QSLQ 
Sbjct: 473  LCQLGLLSKIKAENLGATSKH------HRLASYYHKAISLVYMNPYFGVLS-TSLQSLQF 525

Query: 470  LSFISFYFLNVGDIPRLYQLRGTVISMAQQLRLHRCPSAVLLSASGSTMQKFEQGERRLL 529
            LS + FYFLN+G++  +Y+LRG V+SMAQQLRLHRCPSAV L  +GSTM K EQG+RR+L
Sbjct: 526  LSLVLFYFLNIGNVSAIYELRGRVVSMAQQLRLHRCPSAV-LGGAGSTMNKREQGDRRVL 584

Query: 530  FWAIYYLDVFYSLQLGVPRLIKDHEIECALPVSEEEDS---------QLEGRVSDFSLAV 580
            FW IYYLDVF +LQLGVPRLIKD EIECALPV++ +D          +LEG+V+++SLA+
Sbjct: 585  FWGIYYLDVFSALQLGVPRLIKDFEIECALPVADNDDRTVNLAGQQIRLEGQVTNYSLAI 644

Query: 581  IRYAKVLGNILDSIFKRNMMSEAATESMAFVHEKALDIWKNRLPEKYGFRLEANGLFNFD 640
            IR++KVLGNILDSIFKR  M+E+ T+ ++ +HE ALD W++ LP++  F L+ NG  N D
Sbjct: 645  IRFSKVLGNILDSIFKRG-MTESITKQVSLIHENALDNWRHGLPKELIFELDVNGTINID 703

Query: 641  ELTVVK--NSEKDLIEKSSILLFYFLAKCMIHLPVIATRSASLEQQLQPGTSSDTSETPK 698
            E   +K  N   +  E  ++L+ YFLAKCMIHLPV+ATR       L    S+DT ET  
Sbjct: 704  EFNRLKQMNVTVERSENMTLLVMYFLAKCMIHLPVVATRP------LPTNDSNDTGETSN 757

Query: 699  ESQN------KTPT---------RVCPSYILMQKAASTMLQVMHYTSEYYLPSPINISRT 743
             + N      + P+         R   SY+L+Q+A +TML V+      +LP P+NISRT
Sbjct: 758  ATSNGNNVRARDPSTERNQAAADRSSSSYVLLQQATNTMLNVLESLKTLFLPLPLNISRT 817

Query: 744  KARFALLTACSAVEYLKGGSLYVETXXXXXXXXXXXXXXXXXXXPGIISWHSXXXXXXXX 803
            KARFALL+A  ++EY KGG+L+++                    PG+ISW+S        
Sbjct: 818  KARFALLSARGSLEYTKGGALFLDNKSLLLDVIKDLEEDRKLDLPGVISWNSLKLLDMSI 877

Query: 804  XXXXQSPTTKMEKLDKLVQKKINHYNRQMGIPAMKLSNSRKNN----------------K 847
                Q P T++ KLD+L++KK+N+YNR MG P +K   + K +                K
Sbjct: 878  NLLLQPPNTEVGKLDRLLKKKLNYYNRLMGRPTVKQEPASKGHDLTPASSKDEEDTPAAK 937

Query: 848  KIKLENESSQLSSTSNPIAKGELKSDSVVCEEDDNVNDNEVTTTAKLEENNEFINPNKIE 907
            +IK+E  S  L+    P  +  +++ + V      V + +        +           
Sbjct: 938  RIKIEETSIPLAV---PQQQQHMQAPAPVM-----VQEKQQPQPQPQPQPQPQPQLQPQP 989

Query: 908  QGVTSNTLAFSFSSTDLSALFNA--------PESLFKVPNENTQYNQQHEMHNNSISSSH 959
            Q +     AF+  +  L  + N+        P +L+  P++     Q H       + + 
Sbjct: 990  QQLQLPQTAFA-EALQLDPVLNSNVSFQNAPPTTLYDGPHDQPHQYQHH-------AQTQ 1041

Query: 960  SKEPVNKERDSDKQELNAIF----------NETQNRSTSFAKLMLLLNNEHKSLSSSLEN 1009
             ++P    R SDK  L+ +F          +++ N   +F    LL   E   L  S  +
Sbjct: 1042 PQDPHLDTRSSDK--LHGLFKVPSTADFLMDDSANSQLNF----LLGTTELGVLDPSQPS 1095

Query: 1010 DVRNVGNKLSSENAGQLPS----------HGATSGLNSKGNEFLSMNTLYGGDNDFIIDA 1059
               N G+  S+     +PS           G+T    +  N   +     GG N F +DA
Sbjct: 1096 YTNNPGSG-SAIGINNMPSGLNLSNLFDLEGSTDQPPTNTNATQATQANSGGFN-FAVDA 1153

Query: 1060 SLGLAPLLS 1068
            SLGLAPLL+
Sbjct: 1154 SLGLAPLLA 1162

 Score =  112 bits (280), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 47/71 (66%), Positives = 54/71 (76%)

Query: 55  RVAQACDRCRLKKTKCDGKIPQCSQCALVGFECKISDRLNRKSFPRGYXXXXXXXXXXXX 114
           RVAQACDRCR KKT+CDGK PQCSQCA VGFECKISDRL+R++FPRGY            
Sbjct: 99  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDRLSRRAFPRGYTETLEERVRELE 158

Query: 115 XXNKRLMALCN 125
             N+RL+ALC+
Sbjct: 159 AENRRLVALCD 169

>KLLA0D01452g Chr4 (124018..128355) [4338 bp, 1445 aa] {ON} similar to
            uniprot|Q75DZ4 Ashbya gossypii ABL121C ABL121Cp and
            similar to YMR280C uniprot|P39113 Saccharomyces
            cerevisiae YMR280C CAT8 Zinc cluster transcriptional
            activator
          Length = 1445

 Score =  501 bits (1291), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 298/767 (38%), Positives = 442/767 (57%), Gaps = 90/767 (11%)

Query: 201  VSFEQNVAPGLPAVKALNSMAEREESAQLAMLVSLALPRSTEEILFIPQLMANIQKTFGF 260
            +SFEQN APGLPA+KAL+S+++ ++  QLA LV++++PR+TEEILF+PQL+A I +  GF
Sbjct: 375  ISFEQNEAPGLPALKALSSLSKYKQGTQLATLVAVSVPRTTEEILFVPQLLARIGQIHGF 434

Query: 261  SSKQSLYTVSLLSSLKKNLPTPNSNSSDENL----SPNYYVSEDFRPFFYEVLKFDILGE 316
            +SKQ +YT S+L+SLK+N    N +S    L    + N +  +D   F+  V K D +  
Sbjct: 435  TSKQCIYTASVLASLKEN----NISSIPPELEVLKNHNLWEIDDVLHFWKNVFKLDFMTH 490

Query: 317  TETENGSNRNESPDSTIPNSRSDDLLSWMEIQRLVDVYFECWSNTIPIFSRKLFIKQMKA 376
            T  ++ S                  L++ E++ L+ ++F+ W   IP+F +  F    + 
Sbjct: 491  TAVDHSSTH----------------LNFAEVEELMQLFFQDWYELIPLFDKNEFNSYYEK 534

Query: 377  FK---TEVDKFGDRLFEVYKTEQIKINFLKIFATVLAVMCQMALLSRLKQLEATTQELEC 433
            FK   T+ + F  +   V+      I++ KIF+ +L ++ QM +LS++K+ + T+ +L  
Sbjct: 535  FKLNVTDPNFFVRKDDTVFNNRTRSISY-KIFSCLLIIIVQMGMLSKIKRDKITSGKLST 593

Query: 434  KRTQNLIAHYNQLIEKIHLDSFFQDMSTTTVQSLQLLSFISFYFLNVGDIPRLYQLRGTV 493
                 L+ +Y++L+  I ++ +F   + T++Q LQ LS + FY LNVGDI  +Y+LRG V
Sbjct: 594  -----LMKYYDKLMTHIWINPYFNSRN-TSIQVLQCLSMLLFYMLNVGDISSIYELRGKV 647

Query: 494  ISMAQQLRLHRCPSAVLLSASGSTMQKFEQGERRLLFWAIYYLDVFYSLQLGVPRLIKDH 553
            +SM+QQLRLHRCPSAV L   GST+ K +QGERR+LFW+IYYLDVF +LQLGVPRL+KD 
Sbjct: 648  VSMSQQLRLHRCPSAV-LGGDGSTVSKVQQGERRILFWSIYYLDVFSALQLGVPRLLKDF 706

Query: 554  EIECALPVSEEEDSQ---------LEGRVSDFSLAVIRYAKVLGNILDSIFKRNMMSEAA 604
            EIECALPV+ ++D Q         LEG+VS FSL+VIR+AKV+GNILDS FKR M + + 
Sbjct: 707  EIECALPVTSDDDRQVNLAGQMIALEGKVSQFSLSVIRFAKVMGNILDSTFKRGMTT-SL 765

Query: 605  TESMAFVHEKALDIWKNRLPEKYGFRLEANGLFNFDELTVVKNSEKDLIEKSS------- 657
            T+  A VHE ALD W++ L +   F+L+ NG  N DE    K   K L  +++       
Sbjct: 766  TKQAALVHENALDNWRHGLQKDLFFQLDVNGTINMDEFNQQKQYSKSLSPRTAAFTHNSL 825

Query: 658  -ILLFYFLAKCMIHLPVIATRSASLEQQLQPGTSSDTSETPKESQNKTPTRVCPSYILMQ 716
             ++  YF+AKCMIHLPV+AT+    E    P        T  +++N +  R   SY+L+Q
Sbjct: 826  VLMTLYFMAKCMIHLPVVATKPLVAEAIQTP--------TDNQTENGSVDRSLSSYVLLQ 877

Query: 717  KAASTMLQVMHYTSEYYLPSPINISRTKARFALLTACSAVEYLKGGSLYVETXXXXXXXX 776
            +A +T+L V+   +  YLP PIN++RTK RF L +A  ++EY KGG+L+ +         
Sbjct: 878  QATNTLLNVLTALNSIYLPLPINLARTKTRFGLFSARGSLEYTKGGALFQDNKALLLDLV 937

Query: 777  XXXXXXXXXXXPGIISWHSXXXXXXXXXXXXQSPTTKMEKLDKLVQKKINHYNRQMGIPA 836
                       PG  SWHS            Q   +  EK +K++QKKIN+YN+ MG P 
Sbjct: 938  KELETDKKLELPGNTSWHSLKLFDLSINLILQPVNSNPEKTEKMIQKKINYYNKLMGQPT 997

Query: 837  MKLSNSR------KNNKKIKLENESSQLSSTSNPIAKGELKSDSVVCEE-------DDNV 883
            + +   R        +KK+K+E++ SQ     + I  GE  +D+V  EE       + NV
Sbjct: 998  VAVKRKRDPKATENTSKKVKVEDDHSQ--DNLHNITTGE-TTDTVHSEELVKDVPKELNV 1054

Query: 884  NDNEVTTTAKLEENNEFINPNKIEQGVTSNTLAFSFSSTDLSALFNA 930
                 TT  +  + +  +N N              FS+TDL  LFN+
Sbjct: 1055 YPENYTTIEEAFQMDPVLNTNL-------------FSNTDLKTLFNS 1088

 Score =  112 bits (281), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 45/72 (62%), Positives = 54/72 (75%)

Query: 54  YRVAQACDRCRLKKTKCDGKIPQCSQCALVGFECKISDRLNRKSFPRGYXXXXXXXXXXX 113
           YRVAQACDRCR KK +CDGK PQC+QCA VGFECKISD+L+R++FPRGY           
Sbjct: 177 YRVAQACDRCRAKKIRCDGKRPQCTQCAAVGFECKISDKLSRRAFPRGYTETLEERVREL 236

Query: 114 XXXNKRLMALCN 125
              N+RL+ALC+
Sbjct: 237 EAENRRLVALCD 248

>ABL121C Chr2 complement(170782..174639) [3858 bp, 1285 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YMR280C
            (CAT8)
          Length = 1285

 Score =  480 bits (1235), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 343/961 (35%), Positives = 493/961 (51%), Gaps = 153/961 (15%)

Query: 199  TDVSFEQNVAPGLPAVKALNSMAEREESAQLAMLVSLALPRSTEEILFIPQLMANIQKTF 258
            T +SFEQ+ APGLPAVKAL+S+A  EES+QLA LV++++PR+TEEILF+PQL+A I +  
Sbjct: 282  TSISFEQDQAPGLPAVKALSSLASHEESSQLAALVAVSIPRTTEEILFVPQLLARIGQMH 341

Query: 259  GFSSKQSLYTVSLLSSLKKNLPTPNSNSSDENLSPNYYVSEDFRPFFYEVLKFDIL---- 314
            GF+SKQ LYT S+L+SLK+  P   S+  ++  + N +  ++   F  E L+ DI     
Sbjct: 342  GFTSKQCLYTASVLASLKEITPRKTSSILEQLKAKNLWEIDNVDTFLLEGLQIDIRRGSS 401

Query: 315  GETETENGS-----NRNESPDSTIPNSRSDDLLSWMEIQRLVDVYFECWSNTIPIFSRKL 369
            G+   EN +     N         P  +    L++ EI+ L+ ++F+ W + IPIF R  
Sbjct: 402  GDFNLENPNGYKLENEYHQTKDAHPELQELTPLTFQEIEELIQLFFDDWYSLIPIFDRSE 461

Query: 370  FIKQMKAFKTEVD-----KFGDRLFEVYKTEQIKINFLKIFATVLAVMCQMALLSRLKQL 424
            F      FK  V        GD LF+        I++ KIFA +L  +CQM L+S++K+ 
Sbjct: 462  FESYWVKFKDNVSTPGFFTSGDTLFD---RRHKSISY-KIFACLLLTVCQMGLMSKVKR- 516

Query: 425  EATTQELECKRTQNLIAHYNQLIEKIHLDSFFQDMSTTTVQSLQLLSFISFYFLNVGDIP 484
                +     R  NL+ +Y++ I  + ++ +F   ST+      L   + FYFLNVGD+ 
Sbjct: 517  ---ERHERGDRLNNLMTYYDRAISHVIMNPYFSSSSTSIQSLQLLSL-LLFYFLNVGDVS 572

Query: 485  RLYQLRGTVISMAQQLRLHRCPSAVLLSASGSTMQKFEQGERRLLFWAIYYLDVFYSLQL 544
             +Y+LRG V+S+ QQLRLHRCPSAV L + GST+ K +QGERR+LFW +YYLDVF SLQL
Sbjct: 573  NVYELRGKVVSLTQQLRLHRCPSAV-LGSDGSTVGKIQQGERRVLFWGVYYLDVFSSLQL 631

Query: 545  GVPRLIKDHEIECALPVSEEEDSQ---------LEGRVSDFSLAVIRYAKVLGNILDSIF 595
            GVPRL+KDHEIECALPVS ++D+          LEG++S FSL++IR++KVLGN+LDSIF
Sbjct: 632  GVPRLMKDHEIECALPVSSDDDNHVNLAGQMIALEGKMSPFSLSIIRFSKVLGNVLDSIF 691

Query: 596  KRNMMSEAATESMAFVHEKALDIWKNRLPEKYGFRLEANGLFNFDELTVVK----NSEKD 651
            KR  M+E+ T+ +A VHE ALD W++ LP+   F+L+ NG  N ++L  +K    N +  
Sbjct: 692  KRG-MTESMTKQVALVHENALDNWRHALPDNLRFQLDVNGTINMEDLNQLKRDYLNKDTA 750

Query: 652  LIEKSSILL-FYFLAKCMIHLPVIATRSASLEQQLQ-----PGTSSDTSETPKESQNKTP 705
            L   ++I +  YFLAK MIHLPV+AT+    + Q       PG+  D S +         
Sbjct: 751  LKLNNAIFMALYFLAKIMIHLPVVATKPIIDKPQPVVDTNIPGSQIDRSSS--------- 801

Query: 706  TRVCPSYILMQKAASTMLQVMHYTSEYYLPSPINISRTKARFALLTACSAVEYLKGGSLY 765
                 SY+L+Q+A +T L V+   S  YLP P+NI+RTK RF L++A  ++EY KGG+L+
Sbjct: 802  -----SYVLLQQATNTFLNVLSSVSSLYLPLPLNITRTKTRFGLVSARGSLEYTKGGALF 856

Query: 766  VETXXXXXXXXXXXXXXXXXXXPGIISWHSXXXXXXXXXXXXQSPTTKMEKLDKLVQKKI 825
             +                    PG ISWHS            Q P TK EK +KL+QKKI
Sbjct: 857  QDNKNLLLDLLKDLEADKKLNMPGTISWHSLKLLDMAVNLILQPPNTKPEKQEKLLQKKI 916

Query: 826  NHYNR----QMG-----------------------IPAMKLSNSRKNN------------ 846
            N+YN+     +G                       IP  +   S K +            
Sbjct: 917  NYYNKLIDSHLGPTASLPTPGQTAPRKPEPAHARPIPEKEKPPSSKRHRGDDNAAASMPP 976

Query: 847  ---KKIKLENESSQLSSTSNPIAKGELKSD-SVVCEEDDNVNDNEVTTTAKLEENNEFIN 902
               KK+KLE  +S + +   PI+   L  D   V +     N +     AK E      +
Sbjct: 977  LLEKKVKLEAPASNMPTPPAPISA--LHEDVPRVLDGHLGANSSLAVLAAKHEPEGSLHS 1034

Query: 903  P--NKIEQGVTSNTL--AFSFSSTDLSALFN-----APESL------FKVPNENTQYNQQ 947
               N I +    + +     FS+TDL + F      AP  L      +  P++  Q   Q
Sbjct: 1035 SAGNAITEAFQLDPILQPTPFSNTDLPSFFGVDQYAAPPELQPFPAGYAAPDKVPQAAAQ 1094

Query: 948  HEMHNNSISSSHSKEPVNKERDSDKQELNAIFNETQNRSTSFAKLMLLLNNEHKSLSSSL 1007
                      S +  P    +DS       +F    N           L + +  +SS+ 
Sbjct: 1095 --------GPSATAGPPLSSKDS-------LFKVPSNGD--------FLKDYYSGMSSAQ 1131

Query: 1008 ENDVRNVGNKLSSENAGQLPSHGATSGLNSKGNEFLSMNTLYGGDNDFIIDASLGLAPLL 1067
             N +    ++         P    + GL  +          YG    F++DASLGLAPLL
Sbjct: 1132 LNSLFTAPDRRDVRPRAPQPDRAPSDGLQQQPG--------YG----FVVDASLGLAPLL 1179

Query: 1068 S 1068
            +
Sbjct: 1180 A 1180

 Score =  114 bits (285), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 47/72 (65%), Positives = 55/72 (76%)

Query: 54  YRVAQACDRCRLKKTKCDGKIPQCSQCALVGFECKISDRLNRKSFPRGYXXXXXXXXXXX 113
           YRVAQACDRCR KKT+CDGK PQCSQCA VGFECKISD+L+R++FPRGY           
Sbjct: 72  YRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDKLSRRAFPRGYTETLEERVREL 131

Query: 114 XXXNKRLMALCN 125
              N+RL+ALC+
Sbjct: 132 EAENRRLVALCD 143

>NDAI0K00390 Chr11 (84641..89128) [4488 bp, 1495 aa] {ON} Anc_8.845
          Length = 1495

 Score =  467 bits (1201), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 286/704 (40%), Positives = 407/704 (57%), Gaps = 69/704 (9%)

Query: 178 DPNHRCVHLKPVVSNIIVDSNTDVSFEQNVAPGLPAVKALNSMAEREESAQLAMLVSLAL 237
           D N   +H KPV +N   +    +SFEQN APGL  VKAL SM   E++ QLA LVSLA+
Sbjct: 284 DTNDHHLHPKPVSTN--SNGLNSISFEQNEAPGLSTVKALKSMVNDEKNTQLATLVSLAI 341

Query: 238 PRSTEEILFIPQLMANIQKTFGFSSKQSLYTVSLLSSLKKNLPTPN-----SNSSDENL- 291
           PRSTEEILFIPQ++A +++ FGF+SK  LYTVSLLSSLK  L   N     +++ ++NL 
Sbjct: 342 PRSTEEILFIPQILAKVRQNFGFTSKHCLYTVSLLSSLKSFLSNSNNSISAASADNKNLE 401

Query: 292 ---SPNYYVSEDFRPFFYEVLKFDILGET-ETENGSNRNESPDSTIPNSRSDDLLSWM-- 345
              + N +       FF   LK D L  + E +N   +N   ++   NS + D +S +  
Sbjct: 402 TLKNTNLWKFNALFQFFTAFLKLDFLDSSLEKQNKGKKNGKVNNNNNNSANQDGISPLSS 461

Query: 346 -EIQRLVDVYFECWSNTIPIFSRKLFIKQMKAFKTEVDKFGDRLFEVYKTEQIKINFLKI 404
            EI  L+ ++F+ WS+ + + + K F +    FK+++         + K     +   KI
Sbjct: 462 SEIDELLKLFFQNWSDFVLMINEKEFYQYYSVFKSDLQNNN-----ISKMSLSTLMNYKI 516

Query: 405 FATVLAVMCQMALLSRLKQLEATTQELECKRTQNL---IAHYNQLIEKIHLDSFFQDMST 461
           F  ++ + CQM LLS++K     T+    K+  +L   + +Y+ LI K+  + FF+ +S 
Sbjct: 517 FGLIILLFCQMGLLSKIKLSSNNTKSKNFKQQYHLKKVMNYYHNLINKLMWNEFFK-ISN 575

Query: 462 TTVQSLQLLSFISFYFLNVGDIPRLYQLRGTVISMAQQLRLHRCPSAVLLSASGSTMQ-- 519
            T+QSL+LLS I FY L++G+I  +Y+LR  VISM+QQLRLHRCPSAVL    GST++  
Sbjct: 576 VTLQSLKLLSLILFYNLHMGNISNIYELRSKVISMSQQLRLHRCPSAVLC---GSTLKIH 632

Query: 520 KFEQGERRLLFWAIYYLDVFYSLQLGVPRLIKDHEIECALPVSEEEDS------------ 567
           K EQ  RRLLFW IYYLD+F SLQLGVPRL+KDHEIECALP+  + DS            
Sbjct: 633 KLEQSNRRLLFWNIYYLDIFASLQLGVPRLLKDHEIECALPIPMDTDSKSDNQSQRSAAT 692

Query: 568 ---------QLEGRVSDFSLAVIRYAKVLGNILDSIFKRNMMSEAATESMAFVHEKALDI 618
                    +LEG VS  SL +IRY++++GNILD IFKRN M+E+ T+S+A +H  ALD 
Sbjct: 693 NAENDDNKIKLEGCVSHLSLVIIRYSQIVGNILDMIFKRN-MTESMTKSIALIHIHALDD 751

Query: 619 WKNRLPEKYGFRLEANGLFNF----DELTVVKNSEKDLIEKSSILLFYFLAKCMIHLPVI 674
           W+N LP    F L  NG  +     D+  + +  ++   +K  ++  YF    MIH+PV+
Sbjct: 752 WRNTLPSNLKFDLNVNGSIDLSSFIDQQNLNEEEQRTQQQKLLVIFLYFFGVNMIHMPVV 811

Query: 675 ATRSASLEQQLQPGTSSDTSETPKESQNKTPTRVCPSYILMQKAASTMLQVMHYTSEYYL 734
           A+R   L +               +S N+ P R   SYI +Q A +TML V+   S  Y+
Sbjct: 812 ASRPLPLVEN--------------DSLNQIPDRSSSSYIALQHATNTMLNVLDLLSPTYV 857

Query: 735 PSPINISRTKARFALLTACSAVEYLKGGSLYVETXXXXXXXXXXXXXXXXXXXPGIISWH 794
           P PIN+SRT  RF++++AC  ++++KGGSL++E                    PG+ISWH
Sbjct: 858 PLPINMSRTMVRFSMISACGMLDFIKGGSLFLENKALLAQVVKNIETDRFLDLPGVISWH 917

Query: 795 SXXXXXXXXXXXXQSPTTKMEKLDKLVQKKINHYNRQMGIPAMK 838
           S            Q+   K+EKLDKL++KK N+YNR MG P ++
Sbjct: 918 SLKLFDLTLTLFFQNTNIKLEKLDKLLEKKSNYYNRLMGKPIVR 961

 Score =  109 bits (272), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 44/71 (61%), Positives = 53/71 (74%)

Query: 55  RVAQACDRCRLKKTKCDGKIPQCSQCALVGFECKISDRLNRKSFPRGYXXXXXXXXXXXX 114
           R++QACDRCR KKT+CDGK PQCSQCA+VGFECK+SD+L RKS+PRGY            
Sbjct: 103 RISQACDRCRSKKTRCDGKRPQCSQCAIVGFECKVSDKLQRKSYPRGYTETLEEKIRELQ 162

Query: 115 XXNKRLMALCN 125
             NKRL+A+ N
Sbjct: 163 TENKRLLAIYN 173

 Score = 38.5 bits (88), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 61/222 (27%), Positives = 92/222 (41%), Gaps = 57/222 (25%)

Query: 972  KQELNAIF----NETQNRSTSFAKLMLLLNNEHKSLSSSLENDVRNVGNKLSSENAGQ-- 1025
            KQ  N +F       +N   S + +M+L+NNE    S +L   ++   +K S++NA    
Sbjct: 1263 KQATNTVFLNKDKANKNDIGSLSTMMMLINNEIPFSSVNLSELLKPSESKTSNDNASNGI 1322

Query: 1026 -LPSH-----GATSGLNSKGNEFLSMN-----------TLYGG--------DNDFIIDAS 1060
               SH     G T  LN  GN  ++ N           TL           D ++ +DAS
Sbjct: 1323 SANSHNSLEFGNTLKLNQNGNSNVTTNGTSMNQVEIPSTLIADSLTDTPIPDYNYFVDAS 1382

Query: 1061 LGLAPLLSENNEIHRQH----EGTQ--------VQAGNNDILSTRIGFNGKDDYSNSRSF 1108
            LGLAPLL    E  R+H    E +Q        +  GN  + ST    N     +N+  +
Sbjct: 1383 LGLAPLL----ETQRRHNSFPETSQPLVNTSNAMNLGNASLSSTANNNNTMPSIANNVGY 1438

Query: 1109 TNEMFGGSDTKRTR----SDTTALLTANSELTHDSQDGNVNF 1146
             N     S  ++ R    +DT  +L  N +L+      N+NF
Sbjct: 1439 NNPPLLSSSKQKPRHLPTNDTGDILNFNGDLS------NLNF 1474

>Ecym_4616 Chr4 complement(1204091..1208824) [4734 bp, 1577 aa] {ON}
            similar to Ashbya gossypii ABL121C
          Length = 1577

 Score =  363 bits (931), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 217/510 (42%), Positives = 300/510 (58%), Gaps = 42/510 (8%)

Query: 342  LSWMEIQRLVDVYFECWSNTIPIFSRKLFIKQMKAFKTEVDK-----FGDRLFEVYKTEQ 396
            LS+ E   ++ ++F+ W + IPIF +  F    + FK  V        GD +F     ++
Sbjct: 594  LSFQECDEMIHLFFDEWYSLIPIFDKSEFDNYWQKFKENVSTPEFFTSGDTIF----AKR 649

Query: 397  IKINFLKIFATVLAVMCQMALLSRLKQLEATTQELECKRTQN-LIAHYNQLIEKIHLDSF 455
             K    KIFA +L  + QM L++++K+     + L  +   N L+ +Y++ +  I  + +
Sbjct: 650  HKSISYKIFACLLVTVVQMGLMTKVKR-----ENLGRRHKLNILMTYYDRALSHIITNPY 704

Query: 456  FQDMSTTTVQSLQLLSFISFYFLNVGDIPRLYQLRGTVISMAQQLRLHRCPSAVLLSASG 515
            F   ST+ +QSLQLLS + FYFLNVGDI  +Y+LRG V+S AQQLRLHRCPSAVL    G
Sbjct: 705  FGSNSTS-IQSLQLLSLLLFYFLNVGDISNIYELRGKVVSFAQQLRLHRCPSAVL-GGDG 762

Query: 516  STMQKFEQGERRLLFWAIYYLDVFYSLQLGVPRLIKDHEIECALPVSEEEDSQ------- 568
             T+ + +QGERR+LFW +YYLDVF SLQLGVPRL+KDHEIECALPVS + D Q       
Sbjct: 763  CTVSRIQQGERRVLFWGVYYLDVFASLQLGVPRLLKDHEIECALPVSSDSDRQVNLAGQM 822

Query: 569  --LEGRVSDFSLAVIRYAKVLGNILDSIFKRNMMSEAATESMAFVHEKALDIWKNRLPEK 626
              LEG++S FSL+VIR++KVLGN+LDSIFKR  M+ + T+ +A VHE ALD W++ LP+ 
Sbjct: 823  ISLEGKMSPFSLSVIRFSKVLGNVLDSIFKRG-MTISITKEVALVHENALDNWRHGLPDG 881

Query: 627  YGFRLEANGLFNFDELTVVK----NSEKDLIEKSSILL--FYFLAKCMIHLPVIATRSAS 680
              F+L+ NG  N DE   +K    N++     K + +    YFLAK MIH+PV+A +   
Sbjct: 882  LRFQLDVNGTINMDEFNQLKHEYLNNDNSKFNKENFIFMTLYFLAKSMIHIPVVAGK--- 938

Query: 681  LEQQLQPGTSSDTSETPKESQNKTPTRVCPSYILMQKAASTMLQVMHYTSEYYLPSPINI 740
                  P   +   E    + ++   R   SYIL+Q+A +T L V+      YLP PINI
Sbjct: 939  ------PPVDTSVQEKNDPAISRQADRSSSSYILLQQATNTFLNVLTSMRTAYLPLPINI 992

Query: 741  SRTKARFALLTACSAVEYLKGGSLYVETXXXXXXXXXXXXXXXXXXXPGIISWHSXXXXX 800
            SR K RF L +A  ++EY KGG+L+ +                    PG ISWHS     
Sbjct: 993  SRAKTRFGLFSARGSLEYTKGGALFQDNKSLLLNLIKELEVDRKLGIPGTISWHSLKLFD 1052

Query: 801  XXXXXXXQSPTTKMEKLDKLVQKKINHYNR 830
                   Q P TK EK +KL+QKKI++YN+
Sbjct: 1053 MAINLILQPPNTKPEKEEKLLQKKISYYNK 1082

 Score =  115 bits (287), Expect = 6e-25,   Method: Compositional matrix adjust.
 Identities = 47/72 (65%), Positives = 55/72 (76%)

Query: 54  YRVAQACDRCRLKKTKCDGKIPQCSQCALVGFECKISDRLNRKSFPRGYXXXXXXXXXXX 113
           YRVAQACDRCR KKT+CDGK PQCSQCA VGFECKISD+L+R++FPRGY           
Sbjct: 123 YRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDKLSRRAFPRGYTETLEERVREL 182

Query: 114 XXXNKRLMALCN 125
              N+RL+ALC+
Sbjct: 183 EAENRRLVALCD 194

 Score =  114 bits (285), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 62/135 (45%), Positives = 88/135 (65%), Gaps = 3/135 (2%)

Query: 199 TDVSFEQNVAPGLPAVKALNSMAEREESAQLAMLVSLALPRSTEEILFIPQLMANIQKTF 258
           T +SFEQ+ APGL AVKAL++MA  E+S+QLA LV++++PR+TEEILF+PQL+A I +  
Sbjct: 388 TSISFEQDQAPGLSAVKALSTMANHEQSSQLATLVAMSIPRTTEEILFVPQLLARIGQVH 447

Query: 259 GFSSKQSLYTVSLLSSLKKNLPTPNSNSSDENLSPNYYVSEDFRPFFYEVLKFDILGETE 318
           GF+SKQ LYT S+L+SLK+ +P   S   +   S + +  +D   F  + L+F     T 
Sbjct: 448 GFTSKQCLYTASVLASLKEIVPYQTSPELELLRSKSLWEIDDVDSFLSKGLRFSFPSATS 507

Query: 319 TENGSNRNESPDSTI 333
            E   N NE P   +
Sbjct: 508 AE---NNNEEPGCGV 519

>Kpol_1016.20 s1016 (51828..55088) [3261 bp, 1086 aa] {ON}
           (51828..55088) [3261 nt, 1087 aa]
          Length = 1086

 Score = 85.5 bits (210), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 33/48 (68%), Positives = 37/48 (77%)

Query: 55  RVAQACDRCRLKKTKCDGKIPQCSQCALVGFECKISDRLNRKSFPRGY 102
           R++QACDRCRLKK KCDG  P CSQC  V F CK SD+L R+ FPRGY
Sbjct: 93  RLSQACDRCRLKKIKCDGLKPNCSQCLKVNFICKTSDKLTRRGFPRGY 140

>ZYRO0G15136g Chr7 complement(1218989..1222072) [3084 bp, 1027 aa]
           {ON} weakly similar to uniprot|P46954 Saccharomyces
           cerevisiae YJL089W SIP4 Possibly involved in Snf1p
           regulated transcriptional activation shows homology to
           DNA binding domain of Gal4p has a leucine zipper motif
           and acidic region lexA-Sip4p activates transcription
          Length = 1027

 Score = 84.0 bits (206), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 33/48 (68%), Positives = 36/48 (75%)

Query: 55  RVAQACDRCRLKKTKCDGKIPQCSQCALVGFECKISDRLNRKSFPRGY 102
           R +QACDRCRLKK KCDG  P CSQC  V F C+ SDRL R+ FPRGY
Sbjct: 33  RQSQACDRCRLKKIKCDGMKPTCSQCTKVNFTCRTSDRLTRRGFPRGY 80

>AFR096W Chr6 (606993..609551) [2559 bp, 852 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YJL089W (SIP4)
          Length = 852

 Score = 82.4 bits (202), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 30/48 (62%), Positives = 37/48 (77%)

Query: 55  RVAQACDRCRLKKTKCDGKIPQCSQCALVGFECKISDRLNRKSFPRGY 102
           R +QACDRCRLKK KCDG  P C+ C  +G++CK SD+L R+ FPRGY
Sbjct: 24  RSSQACDRCRLKKIKCDGLRPSCTSCKKIGYQCKTSDKLTRRGFPRGY 71

>TPHA0I02820 Chr9 complement(620925..624059) [3135 bp, 1044 aa] {ON}
           Anc_1.277 YJL089W
          Length = 1044

 Score = 82.4 bits (202), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 30/48 (62%), Positives = 37/48 (77%)

Query: 55  RVAQACDRCRLKKTKCDGKIPQCSQCALVGFECKISDRLNRKSFPRGY 102
           R++QACDRCRLKK KCDG  P C+ C+ + F CK SDRL R+ FP+GY
Sbjct: 79  RLSQACDRCRLKKIKCDGLKPSCTHCSKIKFACKTSDRLTRRGFPKGY 126

>KLTH0D03564g Chr4 (343546..346134) [2589 bp, 862 aa] {ON} weakly
           similar to uniprot|P46954 Saccharomyces cerevisiae
           YJL089W SIP4 Possibly involved in Snf1p regulated
           transcriptional activation shows homology to DNA binding
           domain of Gal4p has a leucine zipper motif and acidic
           region lexA-Sip4p activates transcription
          Length = 862

 Score = 81.3 bits (199), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 30/48 (62%), Positives = 38/48 (79%)

Query: 55  RVAQACDRCRLKKTKCDGKIPQCSQCALVGFECKISDRLNRKSFPRGY 102
           R++QACDRCRLKK KCDG  P C+ C  +GF C+ SD+L+R+ FPRGY
Sbjct: 24  RMSQACDRCRLKKIKCDGIKPTCTPCTKIGFHCQTSDKLSRRGFPRGY 71

>Kwal_26.7397 s26 complement(342483..343085) [603 bp, 201 aa] {OFF}
           YJL089W (SIP4) - shows homology to DNA binding domain of
           Gal4p, has a leucine zipper motif and acidic region;
           lexA-Sip4p activates transcription [contig 304] PARTIAL
          Length = 201

 Score = 75.9 bits (185), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 29/48 (60%), Positives = 37/48 (77%)

Query: 55  RVAQACDRCRLKKTKCDGKIPQCSQCALVGFECKISDRLNRKSFPRGY 102
           R++QACDRCRLKK KCDG  P C  C+ + F C+ SD+L+R+ FPRGY
Sbjct: 24  RMSQACDRCRLKKIKCDGVKPTCGPCSKIKFHCQTSDKLSRRGFPRGY 71

>SAKL0D05654g Chr4 (457485..460244) [2760 bp, 919 aa] {ON} weakly
           similar to uniprot|P46954 Saccharomyces cerevisiae
           YJL089W SIP4 Possibly involved in Snf1p regulated
           transcriptional activation shows homology to DNA binding
           domain of Gal4p has a leucine zipper motif and acidic
           region lexA-Sip4p activates transcription
          Length = 919

 Score = 80.9 bits (198), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 31/48 (64%), Positives = 36/48 (75%)

Query: 55  RVAQACDRCRLKKTKCDGKIPQCSQCALVGFECKISDRLNRKSFPRGY 102
           R +QACDRCRLKK KCDG  P C+ C  VGF C+ SD+L R+ FPRGY
Sbjct: 24  RSSQACDRCRLKKIKCDGLKPNCTSCKKVGFHCQTSDKLTRRGFPRGY 71

>KLLA0F14322g Chr6 (1328925..1331078) [2154 bp, 717 aa] {ON}
           uniprot|Q7Z8R2 Kluyveromyces lactis Sip4 protein
          Length = 717

 Score = 80.5 bits (197), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 30/48 (62%), Positives = 35/48 (72%)

Query: 55  RVAQACDRCRLKKTKCDGKIPQCSQCALVGFECKISDRLNRKSFPRGY 102
           R +QACDRCRLKK KCDG  P CS C  +G+ C  SD+L R+ FPRGY
Sbjct: 58  RFSQACDRCRLKKIKCDGIKPSCSNCKKIGYHCSTSDKLTRRGFPRGY 105

>KAFR0A01480 Chr1 (294040..296217) [2178 bp, 725 aa] {ON} Anc_1.277
           YJL089W
          Length = 725

 Score = 80.5 bits (197), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 29/49 (59%), Positives = 38/49 (77%)

Query: 54  YRVAQACDRCRLKKTKCDGKIPQCSQCALVGFECKISDRLNRKSFPRGY 102
           +RV+QACDRCRLKK KCDG+ P+CS C  + F C IS +L+R+  P+GY
Sbjct: 10  FRVSQACDRCRLKKIKCDGQKPRCSNCKKINFNCAISTKLSRRGLPKGY 58

>Ecym_6340 Chr6 complement(652943..655801) [2859 bp, 952 aa] {ON}
           similar to Ashbya gossypii AFR096W
          Length = 952

 Score = 80.5 bits (197), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 29/48 (60%), Positives = 37/48 (77%)

Query: 55  RVAQACDRCRLKKTKCDGKIPQCSQCALVGFECKISDRLNRKSFPRGY 102
           R +QACDRCRLKK KCDG  P C+ C  +G++C+ SD+L R+ FPRGY
Sbjct: 25  RSSQACDRCRLKKIKCDGVRPSCTSCKKIGYQCRTSDKLTRRGFPRGY 72

>YJL089W Chr10 (265926..268415) [2490 bp, 829 aa] {ON}  SIP4C6 zinc
           cluster transcriptional activator that binds to the
           carbon source-responsive element (CSRE) of gluconeogenic
           genes; involved in the positive regulation of
           gluconeogenesis; regulated by Snf1p protein kinase;
           localized to the nucleus
          Length = 829

 Score = 78.2 bits (191), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 30/48 (62%), Positives = 35/48 (72%)

Query: 55  RVAQACDRCRLKKTKCDGKIPQCSQCALVGFECKISDRLNRKSFPRGY 102
           R A ACDRCRLKK KCDG  P CS CA + F CK SD+L+R+  P+GY
Sbjct: 41  RKAHACDRCRLKKIKCDGLKPNCSNCAKIDFPCKTSDKLSRRGLPKGY 88

>Skud_10.125 Chr10 (233921..236422) [2502 bp, 833 aa] {ON} YJL089W
           (REAL)
          Length = 833

 Score = 77.4 bits (189), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 29/48 (60%), Positives = 35/48 (72%)

Query: 55  RVAQACDRCRLKKTKCDGKIPQCSQCALVGFECKISDRLNRKSFPRGY 102
           R A ACDRCRLKK KCDG  P CS C+ + F CK SD+L+R+  P+GY
Sbjct: 41  RKAHACDRCRLKKIKCDGLKPNCSNCSKIDFPCKTSDKLSRRGLPKGY 88

>Suva_6.161 Chr6
           complement(283370..284500,284547..284764,284948..285781,
           285812..286127) [2499 bp, 832 aa] {ON} YJL089W (REAL)
          Length = 832

 Score = 77.0 bits (188), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 29/48 (60%), Positives = 34/48 (70%)

Query: 55  RVAQACDRCRLKKTKCDGKIPQCSQCALVGFECKISDRLNRKSFPRGY 102
           R A ACDRCRLKK KCDG  P CS C  + F CK SD+L+R+  P+GY
Sbjct: 41  RKAHACDRCRLKKIKCDGLKPNCSNCGKIDFPCKTSDKLSRRGLPKGY 88

>Smik_10.153 Chr10 (257677..260166) [2490 bp, 829 aa] {ON} YJL089W
           (REAL)
          Length = 829

 Score = 76.6 bits (187), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 28/48 (58%), Positives = 34/48 (70%)

Query: 55  RVAQACDRCRLKKTKCDGKIPQCSQCALVGFECKISDRLNRKSFPRGY 102
           R A ACDRCRLKK +CDG  P CS C  + F CK SD+L+R+  P+GY
Sbjct: 41  RKAHACDRCRLKKIRCDGLKPNCSNCTKINFPCKTSDKLSRRGLPKGY 88

>TDEL0D01450 Chr4 (284869..287706) [2838 bp, 945 aa] {ON} Anc_1.277
           YJL089W
          Length = 945

 Score = 75.9 bits (185), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 28/48 (58%), Positives = 34/48 (70%)

Query: 55  RVAQACDRCRLKKTKCDGKIPQCSQCALVGFECKISDRLNRKSFPRGY 102
           R + ACDRCRLKK +CDG  P CSQC+   F C  SD+L R+ FP+GY
Sbjct: 54  RHSHACDRCRLKKVRCDGLKPSCSQCSRANFRCTTSDKLTRRGFPKGY 101

>TBLA0D05420 Chr4 complement(1334955..1337228) [2274 bp, 757 aa]
           {ON} Anc_1.277 YJL089W
          Length = 757

 Score = 75.1 bits (183), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 26/48 (54%), Positives = 35/48 (72%)

Query: 55  RVAQACDRCRLKKTKCDGKIPQCSQCALVGFECKISDRLNRKSFPRGY 102
           R +QACDRCRLKK KCDG IP C+ C  + F C+ + +L+R+  P+GY
Sbjct: 96  RHSQACDRCRLKKIKCDGLIPHCTNCRKINFNCQTTHKLSRRGLPKGY 143

>NDAI0G05530 Chr7 (1360413..1363973) [3561 bp, 1186 aa] {ON} 
          Length = 1186

 Score = 73.9 bits (180), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 29/48 (60%), Positives = 33/48 (68%)

Query: 55  RVAQACDRCRLKKTKCDGKIPQCSQCALVGFECKISDRLNRKSFPRGY 102
           R  QACDRCRLKK KCD   P CSQC    F+CK +D+L R+ F RGY
Sbjct: 117 RKIQACDRCRLKKIKCDDLKPSCSQCLKADFQCKTTDKLARRGFSRGY 164

>KNAG0B01840 Chr2 (345204..348422) [3219 bp, 1072 aa] {ON} Anc_1.277
           YJL089W
          Length = 1072

 Score = 73.9 bits (180), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 28/49 (57%), Positives = 35/49 (71%)

Query: 54  YRVAQACDRCRLKKTKCDGKIPQCSQCALVGFECKISDRLNRKSFPRGY 102
           +R  QACDRCRLKK KCDG  P C+ CA + F CK S +L+R+  P+GY
Sbjct: 22  FRKNQACDRCRLKKIKCDGLKPTCTNCAKINFLCKTSHKLSRRGLPKGY 70

>CAGL0L03377g Chr12 complement(384929..388558) [3630 bp, 1209 aa]
           {ON} some similarities with uniprot|P46954 Saccharomyces
           cerevisiae YJL089w SIP4 interacts with SNF1 protein
           kinase
          Length = 1209

 Score = 70.9 bits (172), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 28/48 (58%), Positives = 35/48 (72%), Gaps = 1/48 (2%)

Query: 55  RVAQACDRCRLKKTKCDGKIPQCSQCALVGFECKISDRLNRKSFPRGY 102
           R +QACDRCR KK KCDG  P CS CA +G+ C  SD+L+R+  P+GY
Sbjct: 24  RHSQACDRCRSKKIKCDGLQP-CSNCAKIGYNCVTSDKLSRRGLPKGY 70

>NCAS0A09410 Chr1 complement(1865924..1868722) [2799 bp, 932 aa]
           {ON} Anc_1.277
          Length = 932

 Score = 68.6 bits (166), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 24/45 (53%), Positives = 31/45 (68%)

Query: 58  QACDRCRLKKTKCDGKIPQCSQCALVGFECKISDRLNRKSFPRGY 102
           QACDRCRLKK KCD + P C+ C   G  C+ ++RL R+ F +GY
Sbjct: 43  QACDRCRLKKIKCDDRTPDCTPCMKAGIPCRTTERLKRRGFAKGY 87

>KLTH0E08778g Chr5 complement(795841..798462) [2622 bp, 873 aa] {ON}
           conserved hypothetical protein
          Length = 873

 Score = 57.4 bits (137), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 83/353 (23%), Positives = 139/353 (39%), Gaps = 67/353 (18%)

Query: 350 LVDVYFECWSNTIPIFSRKLFIKQMKAFKTEVDKFGDRLFEVYKTEQIKINFLKIFATVL 409
           LVD+YF      +PI ++  F K   A                       N   IF  + 
Sbjct: 220 LVDLYFRYIHPLMPIMNQTEFRKAYAA-----------------------NTCSIF-LLQ 255

Query: 410 AVMCQMALLSRLKQLEATTQELECKRTQNLIAHYNQLIEKIHLDSFFQDMSTTTVQSLQL 469
           A++C    LSR   L      ++   + +L ++      K   D  +++     +Q + L
Sbjct: 256 AILCVAVKLSRNPLL------MDKNGSTDLASNIFYQRAKSLYDGRYEENEVCLLQGMML 309

Query: 470 LSFISFYFLNVGDIPRLYQLRGTVISMAQQLRLHRCPSAVLLSASGSTMQKFEQGERRLL 529
           LS  +F   N   +P +Y ++  V ++AQ   LHR       +    T+   E+  R+L+
Sbjct: 310 LSKQAFNEKNTIHMP-MYFIKNAV-TIAQTYGLHRS------ADFHPTLTANEKRARKLI 361

Query: 530 FWAIYYLDVFYSLQLGVPRLIKDHEIECALPVSEEEDSQLEGRVSDFSLAVIRYAKVLGN 589
           +W +Y +D   S+ +G P+ I     +C +PV   +D   EG   + S+ V     ++  
Sbjct: 362 WWILYVIDTLVSISIGRPQAINLD--DCDVPVLTHDDFVFEGEAPEHSMPVDHMDCIIST 419

Query: 590 I----LDSIFKRNMMSEAATESMAFVHEKALDI----WKNRLPEKYGFRLEANGLFNFDE 641
           +    + S   R +   AA    A    +  D+    W+N LPE                
Sbjct: 420 VQIAEIMSRISRELNRPAAAHCDAKFLIQHFDLLLQRWRNNLPES--------------- 464

Query: 642 LTVVKNSE---KDLIEKSSILLFYFLAKCMIHLPVIATR-SASLEQQLQPGTS 690
           LT   N+E   K  I K+ +   Y+   C++H   I     AS EQ L  G +
Sbjct: 465 LTYHSNAEIFTKHSIPKAFVNALYYKTLCLLHKSNIHDMVRASDEQYLSAGIA 517

 Score = 35.8 bits (81), Expect = 0.81,   Method: Compositional matrix adjust.
 Identities = 13/39 (33%), Positives = 23/39 (58%), Gaps = 3/39 (7%)

Query: 55 RVAQACDRCRLKKTKCDG--KIPQCSQCALVGFECKISD 91
          R ++AC+ C  +K +CD   ++P C+ C   G  C++ D
Sbjct: 14 RTSRACEVCHDRKVRCDANIRVP-CTSCQTFGLVCRLRD 51

>Kwal_47.17681 s47 complement(513119..515683) [2565 bp, 854 aa] {ON}
           [contig 206] FULL
          Length = 854

 Score = 57.4 bits (137), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 56/229 (24%), Positives = 100/229 (43%), Gaps = 36/229 (15%)

Query: 453 DSFFQDMSTTTVQSLQLLSFISFYFLNVGDIPRLYQLRGTVISMAQQLRLHRCPSAVLLS 512
           D  +++     +Q + LLS  +F   N   +P +Y ++  V ++AQ   LHR       +
Sbjct: 275 DGRYEENEICLLQGMMLLSKQAFNEKNTIHMP-MYFIKNAV-TVAQTYGLHRS------A 326

Query: 513 ASGSTMQKFEQGERRLLFWAIYYLDVFYSLQLGVPRLIKDHEIECALPVSEEEDSQLEGR 572
               T+   E+  R+L++W +Y +D   S+ +G P+ I     +C +PV   +D   EG 
Sbjct: 327 DFHPTLTANEKRTRKLIWWILYVIDTLVSISIGRPQAINLD--DCDVPVLTHDDFIFEGG 384

Query: 573 VSDFSLAVIRYAKVLGNI----LDSIFKRNMMSEAATESMAFVHEKALDI----WKNRLP 624
             D ++AV     ++  +    + S   R +   AA++  A V  +  D+    W+  LP
Sbjct: 385 APDHAVAVDYMDCIISTVQIVEIMSRISRELNRPAASQCDAKVLIQHFDMLLQRWRKNLP 444

Query: 625 EKYGFRLEANGLFNFDELTVVKNSE---KDLIEKSSILLFYFLAKCMIH 670
           E                LT   N+E   K  I K+ +   Y+   C++H
Sbjct: 445 ES---------------LTYHSNAEIFTKHSIPKAFVNALYYKTLCLLH 478

 Score = 34.7 bits (78), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 13/39 (33%), Positives = 22/39 (56%), Gaps = 3/39 (7%)

Query: 55 RVAQACDRCRLKKTKCDG--KIPQCSQCALVGFECKISD 91
          R  +AC+ C  +K +CD   ++P C+ C   G  C++ D
Sbjct: 14 RTNRACEVCHDRKVRCDANIRVP-CTSCQTFGLVCRLRD 51

>KLLA0C10923g Chr3 complement(939148..941475) [2328 bp, 775 aa] {ON}
           weakly similar to uniprot|P07272 Saccharomyces
           cerevisiae YLR014C PPR1 Zinc finger transcription factor
           containing a Zn(2)-Cys(6) binuclear cluster domain
           positively regulates transcription of genes involved in
           uracil biosynthesis activity may be modulated by
           interaction with Tup1p
          Length = 775

 Score = 54.7 bits (130), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 21/49 (42%), Positives = 26/49 (53%)

Query: 54  YRVAQACDRCRLKKTKCDGKIPQCSQCALVGFECKISDRLNRKSFPRGY 102
           YR   AC RCR++K KCD K P C++C      C   D   R+  PR Y
Sbjct: 14  YRSVAACKRCRIRKIKCDNKFPSCTKCIQAQEPCITIDPSTRREIPRSY 62

>SAKL0G11902g Chr7 (1016915..1019635) [2721 bp, 906 aa] {ON} similar
           to uniprot|P07272 Saccharomyces cerevisiae YLR014C PPR1
           Zinc finger transcription factor containing a
           Zn(2)-Cys(6) binuclear cluster domain positively
           regulates transcription of genes involved in uracil
           biosynthesis activity may be modulated by interaction
           with Tup1p
          Length = 906

 Score = 53.9 bits (128), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 23/48 (47%), Positives = 25/48 (52%)

Query: 55  RVAQACDRCRLKKTKCDGKIPQCSQCALVGFECKISDRLNRKSFPRGY 102
           R   AC RCRLKK KCD K P CS+CA     C   D    +  PR Y
Sbjct: 38  RSIAACKRCRLKKVKCDQKFPSCSKCASANEPCVSLDPATGRDVPRSY 85

 Score = 44.7 bits (104), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 42/194 (21%), Positives = 79/194 (40%), Gaps = 27/194 (13%)

Query: 451 HLDSFFQDMSTTTVQSLQLLSFISFYFLNVGDIPRLYQLRGTVISMAQQLRLHRCPSAVL 510
           ++D+ +   S   +++L  +  I+ Y +   ++P ++ + G+ + +A  L LH       
Sbjct: 396 YIDTLY--CSNDRLEALAGVLLIAIYSIMRPNVPGVWYIMGSALRLAVDLGLH------- 446

Query: 511 LSASGSTMQKFEQGERRLLFWAIYYLDVFYSLQLGVPRLIKDHEIECALPV--------- 561
                     F +  RR LFW  Y LD    +  G P  I D  I    P          
Sbjct: 447 AEKLNKNYDPFTRELRRRLFWCTYALDRQICVHFGRPFGIPDENITAKFPSTLDDALITT 506

Query: 562 ---SEEEDSQLEGRVSDF---SLAVIRYAKVLGNILDSIFKRNMMSEAA---TESMAFVH 612
              S ++ SQ++  ++ +   SLA+ +  K+  +I   ++  N    +     E    V 
Sbjct: 507 AADSIDDYSQVKSSMASYKVISLAIFKIRKIQTSIAQVLYAPNGRLPSHFTDLEKWRAVM 566

Query: 613 EKALDIWKNRLPEK 626
           +  LD W N++  K
Sbjct: 567 DYELDNWYNKVTPK 580

>NDAI0I02350 Chr9 (536448..539117) [2670 bp, 889 aa] {ON} Anc_5.235
          Length = 889

 Score = 53.9 bits (128), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 21/44 (47%), Positives = 25/44 (56%)

Query: 59  ACDRCRLKKTKCDGKIPQCSQCALVGFECKISDRLNRKSFPRGY 102
           AC RCRLKK KCD  +P CS+CA +   C   D    +  PR Y
Sbjct: 21  ACKRCRLKKIKCDNNVPSCSRCAKLRVPCVAVDSATGEDVPRSY 64

>NCAS0D04190 Chr4 (793242..795914) [2673 bp, 890 aa] {ON} Anc_6.279
          Length = 890

 Score = 52.0 bits (123), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 20/45 (44%), Positives = 27/45 (60%)

Query: 56  VAQACDRCRLKKTKCDGKIPQCSQCALVGFECKISDRLNRKSFPR 100
           + QACD CRLKK KC  + P+CS+C   G +C  S ++ R    R
Sbjct: 16  IEQACDNCRLKKLKCSKETPKCSKCLKNGMKCLYSPKVKRSPLTR 60

>Smik_12.77 Chr12 complement(159125..161836) [2712 bp, 903 aa] {ON}
           YLR014C (REAL)
          Length = 903

 Score = 51.6 bits (122), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 21/44 (47%), Positives = 24/44 (54%)

Query: 59  ACDRCRLKKTKCDGKIPQCSQCALVGFECKISDRLNRKSFPRGY 102
           AC RCRLKK KCD + P C +CA +   C   D    K  PR Y
Sbjct: 32  ACKRCRLKKIKCDQEFPSCKRCAKLQVPCVSLDPATGKDVPRSY 75

>TDEL0E03910 Chr5 (732533..735121) [2589 bp, 862 aa] {ON} Anc_5.235
           YLR014C
          Length = 862

 Score = 51.6 bits (122), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 21/44 (47%), Positives = 24/44 (54%)

Query: 59  ACDRCRLKKTKCDGKIPQCSQCALVGFECKISDRLNRKSFPRGY 102
           AC RCRLKK KCD + P C +CA V   C   D    +  PR Y
Sbjct: 29  ACKRCRLKKIKCDQEFPSCLKCARVKVPCVSLDPATGRDVPRSY 72

>YLR014C Chr12 complement(172268..174982) [2715 bp, 904 aa] {ON}
           PPR1Zinc finger transcription factor containing a
           Zn(2)-Cys(6) binuclear cluster domain, positively
           regulates transcription of URA1, URA3, URA4, and URA10,
           which are involved in de novo pyrimidine biosynthesis,
           in response to pyrimidine starvation; activity may be
           modulated by interaction with Tup1p
          Length = 904

 Score = 51.2 bits (121), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 21/44 (47%), Positives = 24/44 (54%)

Query: 59  ACDRCRLKKTKCDGKIPQCSQCALVGFECKISDRLNRKSFPRGY 102
           AC RCRLKK KCD + P C +CA +   C   D    K  PR Y
Sbjct: 33  ACKRCRLKKIKCDQEFPSCKRCAKLEVPCVSLDPATGKDVPRSY 76

>Smik_6.452 Chr6 (741922..744558) [2637 bp, 878 aa] {ON} YPL248C
           (REAL)
          Length = 878

 Score = 51.2 bits (121), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 19/47 (40%), Positives = 28/47 (59%)

Query: 56  VAQACDRCRLKKTKCDGKIPQCSQCALVGFECKISDRLNRKSFPRGY 102
           + QACD CRLKK KC  + P+C++C    +EC+ S +  R    R +
Sbjct: 7   IEQACDICRLKKLKCSKEKPKCAKCLKNNWECRYSPKTKRSPLTRAH 53

>Kwal_23.4016 s23 (529580..531466) [1887 bp, 628 aa] {ON} YKL015W
           (PUT3) - zinc-finger transcription factor of the
           Zn(2)-Cys(6) binuclear cluster domain type [contig 255]
           FULL
          Length = 628

 Score = 50.4 bits (119), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 40/151 (26%), Positives = 65/151 (43%), Gaps = 8/151 (5%)

Query: 449 KIHLDSFFQDMSTTTVQSLQLLSFISFYFLNVGDIPRLYQLRGTVISMAQQLRLHRCPSA 508
           KI L    +D  T TV  +++   +S Y   +  +   Y   GT +  A  L LH     
Sbjct: 244 KIALAIIQEDYDTVTVSFIEVHVLLSLYLTTLNKLKHAYIYSGTALRSAYLLNLH----- 298

Query: 509 VLLSASGSTMQKFEQGERRLLFWAIYYLDVFYSLQLGVPRLIKDHEI-ECALPVSEEEDS 567
           V  + + S     E+   + L+W +Y LD+F S  LG P  I ++ + E   PV    + 
Sbjct: 299 VPATYNDSKYTAVERERMKRLWWTVYNLDIFVSSILGFPMAIHENMVGEVGYPVEGNYNG 358

Query: 568 QLEGRVSDFSLAVIRYAKVLGNILDSIFKRN 598
           +L      F +  I   K+   I+ +I+  N
Sbjct: 359 ELSS--PSFLVERIILTKIKSKIMKTIYSNN 387

>YPL248C Chr16 complement(79711..82356) [2646 bp, 881 aa] {ON}
           GAL4DNA-binding transcription factor required for the
           activation of the GAL genes in response to galactose;
           repressed by Gal80p and activated by Gal3p
          Length = 881

 Score = 50.8 bits (120), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 19/47 (40%), Positives = 28/47 (59%)

Query: 56  VAQACDRCRLKKTKCDGKIPQCSQCALVGFECKISDRLNRKSFPRGY 102
           + QACD CRLKK KC  + P+C++C    +EC+ S +  R    R +
Sbjct: 7   IEQACDICRLKKLKCSKEKPKCAKCLKNNWECRYSPKTKRSPLTRAH 53

>NDAI0F01220 Chr6 complement(295418..298300) [2883 bp, 960 aa] {ON}
           Anc_6.279
          Length = 960

 Score = 50.4 bits (119), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 19/45 (42%), Positives = 27/45 (60%)

Query: 58  QACDRCRLKKTKCDGKIPQCSQCALVGFECKISDRLNRKSFPRGY 102
           QACD CR+KK KC  + P+C++C   G+EC  S +  R    R +
Sbjct: 10  QACDICRIKKLKCSREKPKCAKCMKNGWECCYSPKAKRSPLTRAH 54

>KLLA0E13993g Chr5 complement(1239566..1241602) [2037 bp, 678 aa]
           {ON} some similarities with uniprot|P07272 Saccharomyces
           cerevisiae YLR014C PPR1 Zinc finger transcription factor
           containing a Zn(2)-Cys(6) binuclear cluster domain
           positively regulates transcription of genes involved in
           uracil biosynthesis activity may be modulated by
           interaction with Tup1p
          Length = 678

 Score = 50.4 bits (119), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 16/44 (36%), Positives = 24/44 (54%)

Query: 59  ACDRCRLKKTKCDGKIPQCSQCALVGFECKISDRLNRKSFPRGY 102
           AC  C+ ++ +CDG  PQC  C   G +C   D++  +  PR Y
Sbjct: 66  ACCFCKRRRKRCDGGFPQCGACVNAGIQCTFVDKITGRELPRDY 109

>Skud_12.82 Chr12 complement(164119..166818) [2700 bp, 899 aa] {ON}
           YLR014C (REAL)
          Length = 899

 Score = 50.4 bits (119), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 21/44 (47%), Positives = 24/44 (54%)

Query: 59  ACDRCRLKKTKCDGKIPQCSQCALVGFECKISDRLNRKSFPRGY 102
           AC RCRLKK KCD + P C +CA +   C   D    K  PR Y
Sbjct: 33  ACKRCRLKKIKCDQEFPSCKRCANLEVPCVSLDPATGKDVPRSY 76

>KNAG0D00690 Chr4 (105640..108267) [2628 bp, 875 aa] {ON} Anc_6.279
           YPL248C
          Length = 875

 Score = 50.1 bits (118), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 19/45 (42%), Positives = 24/45 (53%)

Query: 58  QACDRCRLKKTKCDGKIPQCSQCALVGFECKISDRLNRKSFPRGY 102
           QACD CR+KK KC    P C +CA  G+ C  S +  R    R +
Sbjct: 19  QACDLCRIKKLKCSKDKPACRKCAKNGWNCTYSPKAKRSPLTRAH 63

>KLTH0G07898g Chr7 (636890..639490) [2601 bp, 866 aa] {ON} similar
           to uniprot|P07272 Saccharomyces cerevisiae YLR014C PPR1
           Zinc finger transcription factor containing a
           Zn(2)-Cys(6) binuclear cluster domain positively
           regulates transcription of genes involved in uracil
           biosynthesis activity may be modulated by interaction
           with Tup1p
          Length = 866

 Score = 50.1 bits (118), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 20/48 (41%), Positives = 24/48 (50%)

Query: 55  RVAQACDRCRLKKTKCDGKIPQCSQCALVGFECKISDRLNRKSFPRGY 102
           R   AC RCR++K KCD K P CS+C      C   D    +  PR Y
Sbjct: 33  RSIAACKRCRVRKVKCDQKFPSCSRCVTANEPCVSVDPATGRDVPRSY 80

>NDAI0I00740 Chr9 complement(160212..163313) [3102 bp, 1033 aa] {ON}
           Anc_6.279 YPL248C
          Length = 1033

 Score = 50.1 bits (118), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 19/45 (42%), Positives = 24/45 (53%)

Query: 56  VAQACDRCRLKKTKCDGKIPQCSQCALVGFECKISDRLNRKSFPR 100
           + QACD CRLKK KC    P+C QC    + C  S ++ R    R
Sbjct: 7   IEQACDNCRLKKLKCSKHFPKCGQCLKNNWPCIYSPKVKRSPLTR 51

>KLLA0F04609g Chr6 complement(451579..454329) [2751 bp, 916 aa]
          {ON} similar to uniprot|P40467 Saccharomyces cerevisiae
          YIL130W ASG1 Proposed transcriptional activator member
          of the Gal4p family of zinc cluster proteins
          Length = 916

 Score = 49.7 bits (117), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 19/33 (57%), Positives = 22/33 (66%), Gaps = 1/33 (3%)

Query: 55 RVAQACDRCRLKKTKCDGKIPQCSQCALVGFEC 87
          RV +ACD CR KK KCDGK P C  C +  +EC
Sbjct: 9  RVTRACDECRKKKVKCDGKQP-CIHCTVYNYEC 40

 Score = 39.3 bits (90), Expect = 0.078,   Method: Compositional matrix adjust.
 Identities = 48/219 (21%), Positives = 87/219 (39%), Gaps = 39/219 (17%)

Query: 463 TVQSLQLLSFISFYFLNV-GDIPRLYQLRGTVISMAQQLRLHRCPSAVLLSASGSTMQKF 521
           ++Q++ LL    F FL     +   Y   G  +  A +  LHR    +    S +     
Sbjct: 404 SIQTIVLL----FLFLQCSARLSTSYSYIGVAMRSALREGLHR---KIKPDPSKTKTNFI 456

Query: 522 EQGERRLLFWAIYYLDVFYSLQLGVPRLIKDHEIECALPVSEEEDSQLEGRVSDFSLAVI 581
           E   R+ LF+ IY +D++ +  LG+PR I   + +  LP+   +D   E  +        
Sbjct: 457 EIEMRKRLFYTIYKMDIYINTMLGLPRTISPRDFDQELPLELNDDYITEDAI-------- 508

Query: 582 RYAKVLGNILDSIFKRNMMSEAATESMAFVHEKALDIWKNRLPEKYGFRLEANGLFNFDE 641
            Y +  G++L S              +A  H K L I    + + Y  + + N L +   
Sbjct: 509 -YPEEQGDVLSS------------AGIANQHTKILMILDQIMADLYPIK-KTNNLISHQM 554

Query: 642 LTVVKNSEKDLIEKSSILLF---------YFLAKCMIHL 671
           +T ++   +  +++    L          Y  A C++HL
Sbjct: 555 VTNLELKLRQWLDQLPPELIPGLKDVPERYLRANCLLHL 593

>TBLA0G01800 Chr7 complement(469668..473132) [3465 bp, 1154 aa] {ON}
           Anc_6.279 YPL248C
          Length = 1154

 Score = 50.1 bits (118), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 20/45 (44%), Positives = 26/45 (57%)

Query: 58  QACDRCRLKKTKCDGKIPQCSQCALVGFECKISDRLNRKSFPRGY 102
           QACD CRLKK KC  + P+C++C    +EC  S R  R    R +
Sbjct: 16  QACDSCRLKKLKCSKEKPKCAKCLKNIWECCYSPRAKRSPLTRNH 60

>TBLA0G02610 Chr7 complement(689843..692845) [3003 bp, 1000 aa]
          {ON} Anc_2.231 YIL130W
          Length = 1000

 Score = 49.7 bits (117), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 18/33 (54%), Positives = 22/33 (66%), Gaps = 1/33 (3%)

Query: 55 RVAQACDRCRLKKTKCDGKIPQCSQCALVGFEC 87
          RV +ACD CR KK KCDG+ P C  C +  +EC
Sbjct: 61 RVTRACDECRKKKVKCDGQQP-CIHCTVYSYEC 92

 Score = 43.9 bits (102), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 28/100 (28%), Positives = 50/100 (50%), Gaps = 6/100 (6%)

Query: 463 TVQSLQLLSFISFYFLNV-GDIPRLYQLRGTVISMAQQLRLHRC-PSAVLLSASGSTMQK 520
           ++Q++ +L    F FL     +   Y   G  +  A +  LHR  P+  + + + S    
Sbjct: 377 SIQTILML----FIFLQCSARLSTCYSYIGVALRSALREGLHRVIPTNKIGTGTDSRFNC 432

Query: 521 FEQGERRLLFWAIYYLDVFYSLQLGVPRLIKDHEIECALP 560
            E   R+ LF+ IY LD++ +  LG+PR I  ++ + +LP
Sbjct: 433 IEIEMRKRLFYTIYKLDIYVNAMLGLPRSISPNDFDQSLP 472

>KNAG0B05120 Chr2 (982236..984902) [2667 bp, 888 aa] {ON} 
          Length = 888

 Score = 49.7 bits (117), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 20/44 (45%), Positives = 24/44 (54%)

Query: 59  ACDRCRLKKTKCDGKIPQCSQCALVGFECKISDRLNRKSFPRGY 102
           AC RCR KKTKCD K+P C +C  +   C   D    +  PR Y
Sbjct: 45  ACKRCRSKKTKCDQKLPSCGKCTKLNTPCISVDPATGEDVPRSY 88

 Score = 38.5 bits (88), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 32/127 (25%), Positives = 52/127 (40%), Gaps = 11/127 (8%)

Query: 453 DSFFQDMSTTTVQSLQLLSFISFYFLNVGDIPRLYQLRGTVISMAQQLRLHRCPSAVLLS 512
           DS F   +T  ++ L     ++ Y L   ++P ++ + G+V+ +   L LH         
Sbjct: 418 DSLFA--TTDRLEGLSGTLLLAIYSLMRPNVPGVWYIMGSVLRLTVDLGLHT-------E 468

Query: 513 ASGSTMQKFEQGERRLLFWAIYYLDVFYSLQLGVPRLIKDHEIECALPVSEEEDSQL--E 570
                   F +  RR LFW +Y LD       G P  I +  I    P   ++ S L  +
Sbjct: 469 KLNRNYDPFTRELRRRLFWCVYSLDRQICSYFGRPFGIPEESITTRFPSMLDDSSILSND 528

Query: 571 GRVSDFS 577
             V D+S
Sbjct: 529 PAVDDYS 535

>Kwal_23.2905 s23 (69235..71880) [2646 bp, 881 aa] {ON} YLR014C
           (PPR1) - zinc-finger transcription factor of the
           Zn(2)-Cys(6) binuclear cluster domain type [contig 246]
           FULL
          Length = 881

 Score = 49.7 bits (117), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 20/48 (41%), Positives = 24/48 (50%)

Query: 55  RVAQACDRCRLKKTKCDGKIPQCSQCALVGFECKISDRLNRKSFPRGY 102
           R   AC RCR++K KCD K P CS+C      C   D    +  PR Y
Sbjct: 44  RSIAACKRCRIRKVKCDQKFPSCSRCVSANEPCVSIDPATGRDVPRSY 91

>NCAS0D02540 Chr4 complement(484060..486732) [2673 bp, 890 aa] {ON}
           Anc_5.235
          Length = 890

 Score = 49.3 bits (116), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 20/44 (45%), Positives = 23/44 (52%)

Query: 59  ACDRCRLKKTKCDGKIPQCSQCALVGFECKISDRLNRKSFPRGY 102
           AC RCR KK KCD K P C +CA +   C   D    +  PR Y
Sbjct: 40  ACKRCRSKKIKCDQKFPSCDRCAHLKVPCVSVDPATGQDVPRSY 83

 Score = 37.0 bits (84), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 32/116 (27%), Positives = 49/116 (42%), Gaps = 10/116 (8%)

Query: 464 VQSLQLLSFISFYFLNVGDIPRLYQLRGTVISMAQQLRLHRCPSAVLLSASGSTMQKFEQ 523
           +++L  +  ++ Y L   ++P ++   G+V+ +   L LH                 F  
Sbjct: 415 LEALAGMLLLAVYSLMRPNVPGVWYTMGSVLRLTVDLGLH-------TEKLNHNFDAFTV 467

Query: 524 GERRLLFWAIYYLDVFYSLQLGVPRLIKDHEIECALPVSEEEDSQLEG--RVSDFS 577
             RR LFWA Y LD       G P  I +  I    P SE +DS +     VSD+S
Sbjct: 468 EIRRRLFWAAYSLDRQICSYFGRPFGIPEENITTRFP-SELDDSFITPNRNVSDYS 522

>KAFR0J01710 Chr10 complement(327570..330116) [2547 bp, 848 aa]
          {ON} Anc_2.231 YIL130W
          Length = 848

 Score = 49.3 bits (116), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 18/33 (54%), Positives = 22/33 (66%), Gaps = 1/33 (3%)

Query: 55 RVAQACDRCRLKKTKCDGKIPQCSQCALVGFEC 87
          RV +ACD CR KK KCDG+ P C  C +  +EC
Sbjct: 13 RVTRACDECRKKKVKCDGQQP-CIHCTVYSYEC 44

 Score = 37.0 bits (84), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 48/233 (20%), Positives = 94/233 (40%), Gaps = 31/233 (13%)

Query: 345 MEIQRLVDVYFECWSNTIPIFSRKLFIKQMKAFKTEVDKFGDRLFEV----YKTEQIKIN 400
           + +Q + + +  C+   + I+ R  F+KQ+           D L+E     Y  EQ+K  
Sbjct: 211 IALQFVYNTWHSCFV-LLRIYHRPSFLKQL-----------DELYETDPHNYTVEQMK-- 256

Query: 401 FLKIFATVLAVMCQMALLSRLKQLEATTQELECKRTQNLIAHYNQLIEKIHLDSFFQDMS 460
           FL +  + +AV    +  +  K      Q+ + K  Q+    Y   I    L        
Sbjct: 257 FLPLCYSTMAVGALFSKSTISKNNYTKGQDDKNKFLQD--EGYKYFIAARKLIDITNTRD 314

Query: 461 TTTVQSLQLLSFISFYFLNV-GDIPRLYQLRGTVISMAQQLRLHRCPSAVLLSASGSTMQ 519
             ++Q++ +L    F FL     +   Y   G  +    +   HR         +   + 
Sbjct: 315 LNSIQTVLML----FIFLQCSARLSSCYTYIGVAMRSVLREGYHRASDP-----NDPNIN 365

Query: 520 KFEQGERRLLFWAIYYLDVFYSLQLGVPRLIKDHEIECALPVS-EEEDSQLEG 571
             E   ++ LF+ +Y +D++ +  LG+PR ++  + +  LP+   +E+   EG
Sbjct: 366 PIELEMKKRLFYNVYKMDIYINAMLGLPRSLRVEDFDQTLPIELSDENITAEG 418

>KAFR0F01490 Chr6 complement(290988..292964) [1977 bp, 658 aa] {ON}
           Anc_1.128 YJL206C
          Length = 658

 Score = 49.3 bits (116), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 54/237 (22%), Positives = 97/237 (40%), Gaps = 48/237 (20%)

Query: 456 FQDMSTTTVQSLQLLSFISFYFLNVGDIPRLYQLRGTVISMAQQLRLHRCPSAVLLSASG 515
           F+D++   + S+Q +  ++ +    GD+   Y   G  + +A +  LHR PS      +G
Sbjct: 234 FKDIND--IHSIQAIFMMTIFLQCSGDLKACYYYIGIALRIAIRENLHRKPSL-----TG 286

Query: 516 STMQKFEQGERRLLFWAIYYLDVFYSLQLGVPRLIKDHEIECALPVSEEEDSQLEGRV-- 573
            T  + E  +R  LFW+IY +D++ +  LG+P  + +  I+  LP   +++  +   V  
Sbjct: 287 PTAIEDETKKR--LFWSIYKVDIYMNCTLGLPASLNESFIDQELPYDVDDEKIVSDGVIF 344

Query: 574 ----------------SDFSLAVIRYAKVLGNILDSIFKRNMMSEAATESMAFVHEKALD 617
                           +   L +++  + L +I   I K +       E + F       
Sbjct: 345 NENSNIISSCGMNNEHTKLILIMLKIYRTLYSIDVEILKIDANVVLHLEDILFT------ 398

Query: 618 IWKNRLPEKYGFRLEANGLFNFDELTVVKNSEKDLIEKSSILLF--YFLAKCMIHLP 672
            W N LP +   R  A             N E++   K S LL+  Y L K ++  P
Sbjct: 399 -WYNNLPLQLKHREYAT------------NKEREYYLKPSKLLYLDYLLTKLILFKP 442

 Score = 42.7 bits (99), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 18/37 (48%), Positives = 23/37 (62%), Gaps = 1/37 (2%)

Query: 55 RVAQACDRCRLKKTKCDGKIPQCSQCALVGFECKISD 91
          RV +AC  CR KK +CDGK P CS CA     C+ ++
Sbjct: 27 RVFKACIACRKKKRRCDGKSP-CSHCARTSIICEYTN 62

>Suva_10.94 Chr10 complement(178366..181086) [2721 bp, 906 aa] {ON}
           YLR014C (REAL)
          Length = 906

 Score = 49.3 bits (116), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 20/44 (45%), Positives = 23/44 (52%)

Query: 59  ACDRCRLKKTKCDGKIPQCSQCALVGFECKISDRLNRKSFPRGY 102
           AC RCR KK KCD + P C +CA +   C   D    K  PR Y
Sbjct: 33  ACKRCRQKKIKCDQEFPSCKRCAKLKVPCVSLDPATGKDVPRSY 76

>NCAS0B06550 Chr2 complement(1242371..1245091) [2721 bp, 906 aa]
          {ON} Anc_2.231
          Length = 906

 Score = 49.3 bits (116), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 18/33 (54%), Positives = 22/33 (66%), Gaps = 1/33 (3%)

Query: 55 RVAQACDRCRLKKTKCDGKIPQCSQCALVGFEC 87
          RV +ACD CR KK KCDG+ P C  C +  +EC
Sbjct: 32 RVTRACDECRKKKVKCDGQQP-CIHCTVYSYEC 63

 Score = 37.7 bits (86), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 33/124 (26%), Positives = 57/124 (45%), Gaps = 23/124 (18%)

Query: 526 RRLLFWAIYYLDVFYSLQLGVPRLIKDHEIECALPVSEEEDSQLE---------GRVSDF 576
           R+ LF+ IY LD++ +  LG+PR I   + +  LP+   +++  E         G +S  
Sbjct: 408 RKRLFYTIYKLDIYVNAMLGLPRSISPDDFDQTLPIELSDENITEHGYLPENQNGVLSST 467

Query: 577 SLAVIRYAKVLGNILDSIFKR--------NMMSEAATESMAFVHEKALDIWKNRLPEKYG 628
            +A  ++ K+L  IL+SI +         N++S      +    E  L  W + LP +  
Sbjct: 468 GIAN-QHTKLLM-ILNSIVRELYPIKKTNNLISHETVTRL----ELKLRTWMDELPTELV 521

Query: 629 FRLE 632
             LE
Sbjct: 522 PNLE 525

>KAFR0J00690 Chr10 (124449..127043) [2595 bp, 864 aa] {ON} Anc_5.235
           YLR014C
          Length = 864

 Score = 48.9 bits (115), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 20/44 (45%), Positives = 23/44 (52%)

Query: 59  ACDRCRLKKTKCDGKIPQCSQCALVGFECKISDRLNRKSFPRGY 102
           AC RCR KK KCD + P C +CA V   C   D    +  PR Y
Sbjct: 33  ACKRCRAKKIKCDQEFPSCGKCAKVNEPCVSIDPATGEDIPRSY 76

 Score = 38.9 bits (89), Expect = 0.090,   Method: Compositional matrix adjust.
 Identities = 68/269 (25%), Positives = 110/269 (40%), Gaps = 41/269 (15%)

Query: 483 IPRLYQLRGTVISMAQQLRLHRCPSAVLLSASGSTMQKFEQGERRLLFWAIYYLDVFYSL 542
           +P ++ L G+V+ +   L LH   S +L     S    F +  RR LFW++Y LD     
Sbjct: 434 VPGVWYLMGSVLRLTVDLGLH---SEIL----NSNYDPFTREIRRRLFWSVYALDRQVCS 486

Query: 543 QLGVPRLIKDHEIECALPVSEEEDSQLEGR---VSDFS-------------LAVIRYAKV 586
             G P  I +  I    P S  +DS +  +   + D+S             +A+ +  K+
Sbjct: 487 YFGRPFGIPEENITTRYP-SILDDSVIVAKNFVLDDYSDATSQCASSKVIAMAMFKVRKI 545

Query: 587 LGNILDSIFKRNMMSEAATESMAFVHEKALDIWKNRLPEKYGFRLEANGLFNFDELTVVK 646
             +I+  ++  N  SE       F  E+  D  +N+L + Y   +      +FD +    
Sbjct: 546 QADIVKILYAPN--SELPRGFSDF--EQWRDSARNKLDKWYSIEVPK----SFDAMNCKF 597

Query: 647 NS-EKDLIEKSSILLFYFLA-KCMIHLPVIATRSASLEQQLQPGTSSDTSETPKESQNKT 704
           N    DL    S L+ Y LA KC    PV+  ++  +  +   GT  D  +     Q  T
Sbjct: 598 NIFFFDLNYHYSKLILYGLAPKC----PVLNEKAFQIVLESSKGT-IDVFDGLCNKQKLT 652

Query: 705 PTRVCPSYILMQKAASTMLQVMHYTSEYY 733
            T V    I M     T L V +Y ++ +
Sbjct: 653 YTWVAVHNIFM--TGMTYLYVTYYANKTF 679

>SAKL0C02024g Chr3 complement(174858..177554) [2697 bp, 898 aa] {ON}
           similar to uniprot|P07272 Saccharomyces cerevisiae
           YLR014C PPR1 Zinc finger transcription factor containing
           a Zn(2)-Cys(6) binuclear cluster domain positively
           regulates transcription of genes involved in uracil
           biosynthesis activity may be modulated by interaction
           with Tup1p
          Length = 898

 Score = 48.9 bits (115), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 21/48 (43%), Positives = 26/48 (54%)

Query: 55  RVAQACDRCRLKKTKCDGKIPQCSQCALVGFECKISDRLNRKSFPRGY 102
           R   AC+RCR KKTKCD   P C++CA +G  C   D    +   R Y
Sbjct: 48  RSIVACERCRTKKTKCDQNFPSCARCASLGEPCISVDPATGRVVSRSY 95

>Smik_9.39 Chr9 (80510..83548) [3039 bp, 1012 aa] {ON} YIL130W
          (REAL)
          Length = 1012

 Score = 48.9 bits (115), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 18/33 (54%), Positives = 22/33 (66%), Gaps = 1/33 (3%)

Query: 55 RVAQACDRCRLKKTKCDGKIPQCSQCALVGFEC 87
          RV +ACD CR KK KCDG+ P C  C +  +EC
Sbjct: 16 RVTRACDECRKKKVKCDGQQP-CIHCTVYSYEC 47

 Score = 39.7 bits (91), Expect = 0.054,   Method: Compositional matrix adjust.
 Identities = 30/100 (30%), Positives = 49/100 (49%), Gaps = 11/100 (11%)

Query: 463 TVQSLQLLSFISFYFLNV-GDIPRLYQLRGTVISMAQQLRLHRCPSAVLLSASGSTMQKF 521
           ++Q++ +L    F FL     +   Y   G  +  A +   HR     L S+SG +  + 
Sbjct: 348 SIQAILML----FIFLQCSARLSTCYTYIGVAMRSALRAGFHR----KLSSSSGFSPIEI 399

Query: 522 EQGERRLLFWAIYYLDVFYSLQLGVPRLIKDHEIECALPV 561
           E   R+ LF+ IY LDV+ +  LG+PR I   + +  LP+
Sbjct: 400 EM--RKRLFYTIYKLDVYINAMLGLPRSISPDDFDQTLPL 437

>Kpol_1018.30 s1018 complement(81534..83840,83842..84180) [2646 bp,
           881 aa] {ON} complement(81534..83840,83842..84180) [2646
           nt, 882 aa]
          Length = 881

 Score = 48.9 bits (115), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 18/45 (40%), Positives = 25/45 (55%)

Query: 58  QACDRCRLKKTKCDGKIPQCSQCALVGFECKISDRLNRKSFPRGY 102
           Q CD CRLKK KC  + P+C +C    +EC  S ++ R    R +
Sbjct: 8   QVCDSCRLKKLKCSKEKPKCFKCLKHNWECNYSPKIKRSPLTRAH 52

>Skud_9.37 Chr9 (79947..82811) [2865 bp, 954 aa] {ON} YIL130W
          (REAL)
          Length = 954

 Score = 48.9 bits (115), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 18/33 (54%), Positives = 22/33 (66%), Gaps = 1/33 (3%)

Query: 55 RVAQACDRCRLKKTKCDGKIPQCSQCALVGFEC 87
          RV +ACD CR KK KCDG+ P C  C +  +EC
Sbjct: 16 RVTRACDECRKKKVKCDGQQP-CIHCTVYSYEC 47

 Score = 37.7 bits (86), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 29/100 (29%), Positives = 48/100 (48%), Gaps = 11/100 (11%)

Query: 463 TVQSLQLLSFISFYFLNV-GDIPRLYQLRGTVISMAQQLRLHRCPSAVLLSASGSTMQKF 521
           ++Q++ +L    F FL     +   Y   G  +  A +   HR     L + SG +  + 
Sbjct: 346 SIQAILML----FIFLQCSARLSTCYTYIGVAMRSALRAGFHR----KLGTNSGFSPIEI 397

Query: 522 EQGERRLLFWAIYYLDVFYSLQLGVPRLIKDHEIECALPV 561
           E   R+ LF+ IY LDV+ +  LG+PR I   + +  LP+
Sbjct: 398 EM--RKRLFYTIYKLDVYINAMLGLPRSISPDDFDQTLPL 435

>NDAI0B03850 Chr2 complement(970366..973158) [2793 bp, 930 aa]
          {ON} Anc_2.231 YIL130W
          Length = 930

 Score = 48.9 bits (115), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 18/33 (54%), Positives = 22/33 (66%), Gaps = 1/33 (3%)

Query: 55 RVAQACDRCRLKKTKCDGKIPQCSQCALVGFEC 87
          RV +ACD CR KK KCDG+ P C  C +  +EC
Sbjct: 34 RVTRACDECRKKKVKCDGQQP-CIHCTVYSYEC 65

 Score = 42.0 bits (97), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 68/290 (23%), Positives = 121/290 (41%), Gaps = 43/290 (14%)

Query: 364 IFSRKLFIKQMKAFKTEVDKFGDRLFEV----YKTEQIKINFLKIFATVLAVMCQMALLS 419
           I+ R  FIKQ+           D L+E     Y  +Q++  FL +  +V+AV    +   
Sbjct: 281 IYHRPSFIKQV-----------DELYETDPHNYSAKQMQ--FLPLCYSVIAVGALFSKSI 327

Query: 420 RLKQLEATTQELECKRTQNLIAHYNQLIEKIHLDSFFQDMSTTTVQSLQLLSFISFYFLN 479
             ++L  T  +L      +    + Q     +  +  + +  T+ +SL  +  I   F+ 
Sbjct: 328 ANEELNHTPTDLASDTNPSTDTKFLQDEGYKYFIAARKLIDITSARSLDSIQAILMMFIF 387

Query: 480 VGDIPRL---YQLRGTVISMAQQLRLHRCPSAVLLSASGSTMQKFEQGERRLLFWAIYYL 536
           +    RL   Y   G  +  A +  LHR           S     E   R+ LF+ IY L
Sbjct: 388 LQCSARLSTCYSYIGVAMRSALREGLHR------QVGPNSGFNPIEIEMRKRLFYTIYKL 441

Query: 537 DVFYSLQLGVPRLIKDHEIECALPVSEEEDSQLE---------GRVSDFSLAVIRYAKVL 587
           D++ +  LG+PR I  ++ +  LP+   +++  E         G +S   +A   + K+L
Sbjct: 442 DIYVNAMLGLPRSISANDFDQTLPLELSDENITEQGYFPENQNGVLSSTGIAN-EHTKLL 500

Query: 588 GNILDSIFK-----RNMMSEAATESMAFVHEKALDIWKNRLPEKYGFRLE 632
             ILD+I       +   +  + E++A + +K L  W + LP +    LE
Sbjct: 501 M-ILDAIVGELYPIKKTNTFISHETIATLEQK-LRNWLDDLPNELAPNLE 548

>YIL130W Chr9 (102782..105676) [2895 bp, 964 aa] {ON}  ASG1Zinc
          cluster protein proposed to function as a
          transcriptional regulator involved in the stress
          response; null mutants have a respiratory deficiency,
          calcofluor white sensitivity and slightly increased
          cycloheximide resistance
          Length = 964

 Score = 48.9 bits (115), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 18/33 (54%), Positives = 22/33 (66%), Gaps = 1/33 (3%)

Query: 55 RVAQACDRCRLKKTKCDGKIPQCSQCALVGFEC 87
          RV +ACD CR KK KCDG+ P C  C +  +EC
Sbjct: 16 RVTRACDECRKKKVKCDGQQP-CIHCTVYSYEC 47

 Score = 37.4 bits (85), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 25/98 (25%), Positives = 41/98 (41%), Gaps = 6/98 (6%)

Query: 464 VQSLQLLSFISFYFLNVGDIPRLYQLRGTVISMAQQLRLHRCPSAVLLSASGSTMQKFEQ 523
           + S+Q +  +  +      +   Y   G  +  A +   HR  S        S     E 
Sbjct: 343 LNSIQAILMLIIFLQCSARLSTCYTYIGVAMRSALRAGFHRKLSP------NSGFSPIEI 396

Query: 524 GERRLLFWAIYYLDVFYSLQLGVPRLIKDHEIECALPV 561
             R+ LF+ IY LDV+ +  LG+PR I   + +  LP+
Sbjct: 397 EMRKRLFYTIYKLDVYINAMLGLPRSISPDDFDQTLPL 434

>Suva_9.59 Chr9 (97521..100298) [2778 bp, 926 aa] {ON} YIL130W
          (REAL)
          Length = 926

 Score = 48.9 bits (115), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 18/33 (54%), Positives = 22/33 (66%), Gaps = 1/33 (3%)

Query: 55 RVAQACDRCRLKKTKCDGKIPQCSQCALVGFEC 87
          RV +ACD CR KK KCDG+ P C  C +  +EC
Sbjct: 16 RVTRACDECRKKKVKCDGQQP-CIHCTVYSYEC 47

 Score = 40.0 bits (92), Expect = 0.039,   Method: Compositional matrix adjust.
 Identities = 58/259 (22%), Positives = 104/259 (40%), Gaps = 45/259 (17%)

Query: 316 ETETENGSNRNESPDST-----IPNSRSDDLL---SWMEIQRLVDVYFECWSNTIPIFSR 367
           ++++ + S+ N+ PD+T     IP  R   ++     + +Q +   +  C    +  + R
Sbjct: 208 KSDSNSASSYNKEPDNTDMYSNIPVGREIKIILPPKPIALQFVKSTWEHCCV-LLRFYHR 266

Query: 368 KLFIKQMKAFKTEVDKFGDRLFEV----YKTEQIKINFLKIFATVLAVMCQMALLSRLKQ 423
             FI+Q+           D L+E     Y ++Q++   L   A  +  +   +++S    
Sbjct: 267 PSFIRQL-----------DELYETDPNNYTSKQMQFLPLCYAAIAVGALFSKSIVSNDSS 315

Query: 424 LEATTQELECKRTQNLIAHYNQLIEKIHLDSFFQDMSTTTVQSLQLLSFISFYFLNV-GD 482
            E   Q+            Y   I    L          ++Q++ +L    F FL     
Sbjct: 316 REKFLQD----------EGYKYFIAARKLIDITNARDLNSIQAILML----FIFLQCSAR 361

Query: 483 IPRLYQLRGTVISMAQQLRLHRCPSAVLLSASGSTMQKFEQGERRLLFWAIYYLDVFYSL 542
           +   Y   G  +  A +   HR  SA     SG T  + E   R+ LF+ IY LDV+ + 
Sbjct: 362 LSTCYTYIGVAMRSALRAGFHRKLSA----NSGFTPIEIEM--RKRLFYTIYKLDVYINA 415

Query: 543 QLGVPRLIKDHEIECALPV 561
            LG+PR I   + +  LP+
Sbjct: 416 MLGLPRSISPEDFDQTLPL 434

>TDEL0C04480 Chr3 (799022..801580) [2559 bp, 852 aa] {ON}
          Anc_2.231 YIL130W possible pseudogene; NNN added to
          avoid internal stop codon
          Length = 852

 Score = 48.5 bits (114), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 18/33 (54%), Positives = 22/33 (66%), Gaps = 1/33 (3%)

Query: 55 RVAQACDRCRLKKTKCDGKIPQCSQCALVGFEC 87
          RV +ACD CR KK KCDG+ P C  C +  +EC
Sbjct: 15 RVTRACDECRKKKVKCDGQQP-CIHCTVYSYEC 46

 Score = 39.7 bits (91), Expect = 0.051,   Method: Compositional matrix adjust.
 Identities = 29/100 (29%), Positives = 46/100 (46%), Gaps = 11/100 (11%)

Query: 463 TVQSLQLLSFISFYFLNV-GDIPRLYQLRGTVISMAQQLRLHRCPSAVLLSASGSTMQKF 521
           ++Q++ +L    F FL     +   Y   G  +  A +  LHR  S        S     
Sbjct: 331 SIQTILML----FIFLQCSARLSTCYAYIGVAMRSALREGLHRSVSP------DSGFSPI 380

Query: 522 EQGERRLLFWAIYYLDVFYSLQLGVPRLIKDHEIECALPV 561
           E   R+ LF+ IY LDV+ +  LG+PR I  ++ +  LP+
Sbjct: 381 EIEMRKRLFYTIYKLDVYVNAMLGLPRSISSNDFDQTLPI 420

>Kwal_23.4754 s23 (845550..847988) [2439 bp, 812 aa] {ON} YIL130W
          (GIN1) - 1:1 [contig 5] FULL
          Length = 812

 Score = 48.1 bits (113), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 18/33 (54%), Positives = 22/33 (66%), Gaps = 1/33 (3%)

Query: 55 RVAQACDRCRLKKTKCDGKIPQCSQCALVGFEC 87
          RV +ACD CR KK KCDG+ P C  C +  +EC
Sbjct: 10 RVTRACDECRKKKVKCDGQQP-CIHCTVYSYEC 41

 Score = 37.0 bits (84), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 14/36 (38%), Positives = 23/36 (63%)

Query: 526 RRLLFWAIYYLDVFYSLQLGVPRLIKDHEIECALPV 561
           R+ LF+ IY +DV+ +  LG+PR +   + + ALP 
Sbjct: 379 RKRLFYTIYKMDVYVNTMLGLPRSVSQRDFDQALPA 414

>KLTH0G09108g Chr7 (744062..746410) [2349 bp, 782 aa] {ON} weakly
          similar to uniprot|P40467 Saccharomyces cerevisiae
          YIL130W ASG1 Proposed transcriptional activator member
          of the Gal4p family of zinc cluster proteins
          Length = 782

 Score = 48.1 bits (113), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 18/33 (54%), Positives = 22/33 (66%), Gaps = 1/33 (3%)

Query: 55 RVAQACDRCRLKKTKCDGKIPQCSQCALVGFEC 87
          RV +ACD CR KK KCDG+ P C  C +  +EC
Sbjct: 10 RVTRACDECRKKKVKCDGQQP-CIHCTVYSYEC 41

 Score = 39.7 bits (91), Expect = 0.049,   Method: Compositional matrix adjust.
 Identities = 45/180 (25%), Positives = 73/180 (40%), Gaps = 19/180 (10%)

Query: 386 DRLFEV----YKTEQIKINFLKIFATVLAVMCQMALLSRLKQLEATTQELECKRTQNLIA 441
           D L+E     Y  EQ+  +FL +   V+AV    AL S+  Q   T  +           
Sbjct: 217 DELYETDPHDYTHEQM--HFLPLCYAVMAVG---ALFSKSMQSTGTPSDTASPGKFMQDE 271

Query: 442 HYNQLIEKIHLDSFFQDMSTTTVQSLQLLSFISFYFLNV-GDIPRLYQLRGTVISMAQQL 500
            Y   +    L          ++Q++ +L    F FL     +   Y   G  +  A + 
Sbjct: 272 GYKYFVAARKLIDITNARDLNSIQAIVML----FIFLQCSARLSTCYTYIGVAMRNALRE 327

Query: 501 RLHRCPSAVLLSASGSTMQKFEQGERRLLFWAIYYLDVFYSLQLGVPRLIKDHEIECALP 560
            +HR      L+A   +    E   R+ LF+ IY +DV+ +  LG+PR +   + + ALP
Sbjct: 328 GMHRN-----LNADTHSYNPIEIEMRKRLFYTIYKMDVYVNTMLGLPRSVSQRDFDQALP 382

>KNAG0E01760 Chr5 (350254..352962) [2709 bp, 902 aa] {ON}
          Anc_2.231 YIL130W
          Length = 902

 Score = 48.1 bits (113), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 18/33 (54%), Positives = 22/33 (66%), Gaps = 1/33 (3%)

Query: 55 RVAQACDRCRLKKTKCDGKIPQCSQCALVGFEC 87
          RV +ACD CR KK KCDG+ P C  C +  +EC
Sbjct: 32 RVTRACDECRKKKVKCDGQQP-CIHCTVYSYEC 63

 Score = 46.6 bits (109), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 70/295 (23%), Positives = 118/295 (40%), Gaps = 55/295 (18%)

Query: 364 IFSRKLFIKQMKAFKTEVDKFGDRLFEVYKTEQIKINFLKIFATVLAVMCQMALLSRLKQ 423
            + R  FI+Q+       D+  D     Y +EQIK  FL +  + +AV    AL S+  +
Sbjct: 285 FYHRPSFIQQL-------DELYDTDPHNYTSEQIK--FLPLCYSTIAVG---ALFSKAIE 332

Query: 424 LEATTQELECKRTQNLIAH-----YNQLIEKIHLDSFFQDMSTTTVQSLQLLSFISFYFL 478
           ++  T   E +   +         Y   I    L        + ++Q++ +L    F FL
Sbjct: 333 VKENTLGYEKENAMDRGTFLQDEGYKYFIAARKLIDITNTRDSNSIQTVLML----FIFL 388

Query: 479 NV-GDIPRLYQLRGTVISMAQQLRLHRCPSAVLLSASGSTMQKFEQGERRLLFWAIYYLD 537
                +   Y   G  +  A +   HR           S +   E   R+ LF+ IY LD
Sbjct: 389 QCSARLSTCYAYIGVAMRSALREGFHR------KVGPESDLSPLEIEIRKRLFYTIYKLD 442

Query: 538 VFYSLQLGVPRLIKDHEIECALPVSEEEDSQLE---------GRVSDFSLAVIRYAKVLG 588
           V+ +  LG+PR I   + +  LP+   +++  E         G +S   +A      ++ 
Sbjct: 443 VYVNAMLGLPRSISPEDFDQVLPLELSDENITEQAYYPEREDGSLSSTGIANCHTRLIM- 501

Query: 589 NILDSIFKR--------NMMSEAATESMAFVHEKALDIWKNRLPEKYGFRLEANG 635
            ILD+I ++        N++S     ++    EK L  W N LP +    L+ NG
Sbjct: 502 -ILDTIMRKLYPIKRPNNVISHETVTNL----EKLLRDWTNTLPAE----LKPNG 547

>SAKL0E08998g Chr5 complement(747085..749556) [2472 bp, 823 aa]
          {ON} similar to uniprot|P40467 Saccharomyces cerevisiae
          YIL130W ASG1 Proposed transcriptional activator member
          of the Gal4p family of zinc cluster proteins
          Length = 823

 Score = 48.1 bits (113), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 18/33 (54%), Positives = 22/33 (66%), Gaps = 1/33 (3%)

Query: 55 RVAQACDRCRLKKTKCDGKIPQCSQCALVGFEC 87
          RV +ACD CR KK KCDG+ P C  C +  +EC
Sbjct: 10 RVTRACDECRKKKVKCDGQQP-CIHCTVYSYEC 41

 Score = 40.8 bits (94), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 43/174 (24%), Positives = 75/174 (43%), Gaps = 21/174 (12%)

Query: 463 TVQSLQLLSFISFYFLNV-GDIPRLYQLRGTVISMAQQLRLHRCPSAVLLSASGSTMQKF 521
           ++Q++ +L    F FL     +   Y   G  +  A +  LHR    + + A G T  + 
Sbjct: 279 SIQTIVML----FIFLQCSARLSTCYAYIGVAMRSALREGLHR---NLTMGAPGFTPIEI 331

Query: 522 EQGERRLLFWAIYYLDVFYSLQLGVPRLIKDHEIECALPVSEE-----EDSQLEGRVSD- 575
           E   R+ LF+ IY +D++ +  LG+PR I   + + + P+  +     ED     R  D 
Sbjct: 332 EM--RKRLFFTIYKMDIYLNTMLGLPRAISQRDFDQSFPLEIDDEYITEDGIYPERQGDE 389

Query: 576 FSLAVI-----RYAKVLGNILDSIFKRNMMSEAATESMAFVHEKALDIWKNRLP 624
            S A I     +   +L NI+  ++     +   +  +    E  L  W N+LP
Sbjct: 390 LSSAGIANQHTKLIMILDNIVSELYPIKKTNNLISHEVVTNLELKLRQWLNQLP 443

>NCAS0D04860 Chr4 (933920..936025) [2106 bp, 701 aa] {ON} 
          Length = 701

 Score = 48.1 bits (113), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 20/39 (51%), Positives = 25/39 (64%), Gaps = 1/39 (2%)

Query: 55 RVAQACDRCRLKKTKCDGKIPQCSQCALVGF-ECKISDR 92
          RV ++C  CRL+K+KCD   P CS C L G  EC+  DR
Sbjct: 21 RVPKSCTVCRLRKSKCDRIKPYCSSCVLHGIKECRYDDR 59

>Suva_16.59 Chr16 complement(88631..91318) [2688 bp, 895 aa] {ON}
           YPL248C (REAL)
          Length = 895

 Score = 48.1 bits (113), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 20/43 (46%), Positives = 25/43 (58%)

Query: 58  QACDRCRLKKTKCDGKIPQCSQCALVGFECKISDRLNRKSFPR 100
           QACD CRLKK KC  + P+CS+C    +EC  S +  R    R
Sbjct: 9   QACDICRLKKLKCSKEKPKCSKCLKNNWECCYSPKTKRSPLTR 51

>TPHA0F01380 Chr6 complement(318207..320879) [2673 bp, 890 aa] {ON}
           Anc_2.231 YIL130W
          Length = 890

 Score = 48.1 bits (113), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 38/179 (21%), Positives = 75/179 (41%), Gaps = 28/179 (15%)

Query: 465 QSLQLLSFISFYFLNVGDIPRLYQLRGTVISMAQQLRLHRCPSAVLLSASGSTMQKFEQG 524
            S+Q +  + F+      +   Y   G  +  A +   HR      +  + +T+   E  
Sbjct: 417 HSIQTIIILLFFCQCSARLTTCYSYIGAALRAALKEGYHR-----RVDPNNTTLNPIEIE 471

Query: 525 ERRLLFWAIYYLDVFYSLQLGVPRLIKDHEIECALPV-------------SEEEDSQLEG 571
            R+ +F+ IY LDV+ +  +G+PR + + + +  LP+             SE+E  QL  
Sbjct: 472 MRKRIFYTIYKLDVYVNSMMGLPRSLSEDDFDQELPIEISDECITENGYLSEQEGQQLS- 530

Query: 572 RVSDFSLAVIRYAK----VLGNILDSIFKRNMMSEAATESMAFVHEKALDIWKNRLPEK 626
                S+++  Y      +L +I+  ++     + + TE+     E  L  W + LP +
Sbjct: 531 -----SISIANYHTKLYLILADIVQRLYSIKKKNRSITENTVISLENKLRKWADSLPHE 584

 Score = 46.6 bits (109), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 17/33 (51%), Positives = 22/33 (66%), Gaps = 1/33 (3%)

Query: 55 RVAQACDRCRLKKTKCDGKIPQCSQCALVGFEC 87
          RV +ACD CR KK KCDG+ P C  C +  ++C
Sbjct: 67 RVTRACDECRKKKVKCDGQNP-CIHCTVYSYKC 98

>Kpol_495.21 s495 (71447..74704) [3258 bp, 1085 aa] {ON}
           (71447..74704) [3258 nt, 1086 aa]
          Length = 1085

 Score = 48.1 bits (113), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 20/37 (54%), Positives = 24/37 (64%), Gaps = 4/37 (10%)

Query: 55  RVAQACDRCRLKKTKCDG----KIPQCSQCALVGFEC 87
           RVA+ACDRCR +K KCD     K+ +CS C   G EC
Sbjct: 118 RVARACDRCRKRKIKCDEIKNLKVNKCSNCVKYGAEC 154

>TPHA0H01980 Chr8 (467688..470669) [2982 bp, 993 aa] {ON} Anc_6.279
           YPL248C
          Length = 993

 Score = 48.1 bits (113), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 19/47 (40%), Positives = 27/47 (57%)

Query: 56  VAQACDRCRLKKTKCDGKIPQCSQCALVGFECKISDRLNRKSFPRGY 102
           V QACD CR+KK +C  + P+C++C    +EC  S R  R    R +
Sbjct: 8   VDQACDSCRIKKLRCSKENPKCAKCLKNKWECCYSPRKRRSPLTRAH 54

>CAGL0G08844g Chr7 complement(846590..849133) [2544 bp, 847 aa]
          {ON} similar to uniprot|P40467 Saccharomyces cerevisiae
          YIL130w
          Length = 847

 Score = 47.8 bits (112), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 19/41 (46%), Positives = 24/41 (58%), Gaps = 1/41 (2%)

Query: 55 RVAQACDRCRLKKTKCDGKIPQCSQCALVGFECKISDRLNR 95
          +V +ACD CR KK KCDG  P C  C +  +EC  +  L R
Sbjct: 15 KVTRACDDCRKKKVKCDGNQP-CIHCTVYSYECTYNHPLKR 54

 Score = 36.2 bits (82), Expect = 0.73,   Method: Compositional matrix adjust.
 Identities = 60/291 (20%), Positives = 111/291 (38%), Gaps = 62/291 (21%)

Query: 364 IFSRKLFIKQMKAFKTEVDKFGDRLFEV----YKTEQIKINFLKIFATVLAVMCQMALLS 419
            + R  FIKQM           D L+E     Y  EQ++  FL +  + +AV    AL S
Sbjct: 259 FYHRPTFIKQM-----------DELYETDPHNYSHEQMR--FLPLCYSTMAVG---ALFS 302

Query: 420 RLKQLEATTQELECKRTQNLIAHYNQLIEKIHLDSFFQDMSTTTVQSLQLLSFISFYFLN 479
           +         +L    T  ++++          + F QD       + + L  I+    N
Sbjct: 303 K----SIIHDDLNHDHTDEILSN----------NKFLQDEGYKYFIAARKLLDIT----N 344

Query: 480 VGDIPRLYQLRGTVISMAQQLRLHRCPSAVLLSASGSTMQKFEQG-------------ER 526
             D+  +  +    I +    RL  C + + L+      + F +               R
Sbjct: 345 ARDLNSMQTILMMFIFLQCSARLSTCYTYIGLAMRSVLREGFHRNLPDNSIHTPLEIEMR 404

Query: 527 RLLFWAIYYLDVFYSLQLGVPRLIKDHEIECALPVSEEEDSQLEGRV----SDFSLAVIR 582
           + LF+ IY LDV+ +  LG+P  +   + +  LP+   +++  E  +    + +SL+   
Sbjct: 405 KRLFYTIYKLDVYVNAMLGLPGSLDREDFDQELPLDLPDEALTEQGINYDQNPYSLSSTG 464

Query: 583 YAK-------VLGNILDSIFKRNMMSEAATESMAFVHEKALDIWKNRLPEK 626
            A        +LG+IL  ++    ++   +       E  L +W   LP +
Sbjct: 465 IANEHTKLFMILGDILKHLYPIKKINIFISHKTVTDLELKLKMWLEELPRE 515

>NCAS0G01100 Chr7 complement(193052..195859) [2808 bp, 935 aa] {ON}
           Anc_6.279
          Length = 935

 Score = 47.8 bits (112), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 18/45 (40%), Positives = 26/45 (57%)

Query: 58  QACDRCRLKKTKCDGKIPQCSQCALVGFECKISDRLNRKSFPRGY 102
           QACD CR+KK KC  + P+C++C    +EC  S +  R    R +
Sbjct: 11  QACDLCRVKKLKCSKEKPKCAKCLKNNWECCYSPKTRRSPLTRAH 55

>AGR280C Chr7 complement(1266912..1270232) [3321 bp, 1106 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR278C
          Length = 1106

 Score = 47.8 bits (112), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 32/110 (29%), Positives = 60/110 (54%), Gaps = 16/110 (14%)

Query: 462 TTVQSLQLLSFISFYFLNVG-DIPRLYQLRGTVISMAQ-QLRLHRCPSAVLLSASGSTMQ 519
           T VQ ++LL+ + FY + +  D   LY++   V+++ + +L LH+       +  G++ +
Sbjct: 369 TPVQEVELLTLLVFYTIRIDRDSAALYEIIEDVVAICKNKLNLHQ------HTPYGNSDR 422

Query: 520 KFEQGERRLLFWAIYYLDVFYSLQLGVPRLIKDHEIECALPVSEEEDSQL 569
           KF       LFW +Y L+    + +G P +IK+ EI   LP+ +E++  L
Sbjct: 423 KFR------LFWCVYLLERMICVAVGKPYVIKESEI--GLPLFQEDEPSL 464

 Score = 36.2 bits (82), Expect = 0.60,   Method: Compositional matrix adjust.
 Identities = 12/31 (38%), Positives = 19/31 (61%)

Query: 57 AQACDRCRLKKTKCDGKIPQCSQCALVGFEC 87
          +++C  C+ +K +CD KIP C+ C   G  C
Sbjct: 38 SRSCLLCQRRKQRCDHKIPSCTACLKAGVRC 68

>Kpol_1039.11 s1039 (29727..32705) [2979 bp, 992 aa] {ON}
          (29727..32705) [2979 nt, 993 aa]
          Length = 992

 Score = 47.8 bits (112), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 17/33 (51%), Positives = 21/33 (63%), Gaps = 1/33 (3%)

Query: 55 RVAQACDRCRLKKTKCDGKIPQCSQCALVGFEC 87
          RV +ACD CR KK KCDG+ P C  C +  + C
Sbjct: 31 RVTRACDECRKKKVKCDGQQP-CIHCTVYSYNC 62

 Score = 40.0 bits (92), Expect = 0.043,   Method: Compositional matrix adjust.
 Identities = 38/177 (21%), Positives = 73/177 (41%), Gaps = 21/177 (11%)

Query: 462 TTVQSLQLLSFISFYFLNV-GDIPRLYQLRGTVISMAQQLRLHRCPSAVLLSASGSTMQK 520
           T++Q++ +L    F FL     +   Y   G  +  A +  LHR      ++   S +  
Sbjct: 468 TSIQTIIML----FLFLQFSARLSNCYSYIGIALRNALREGLHR-----FVNPKSSNLNP 518

Query: 521 FEQGERRLLFWAIYYLDVFYSLQLGVPRLIKDHEIECALPVS-EEEDSQLEGRVSD---- 575
            +   R+ +F+ IY  D++ +  LG+P+ +   + +  LPV   +E+   EG   D    
Sbjct: 519 LDIEMRKRVFYTIYKCDLYLNSMLGLPKSLSSADFDQVLPVELSDENITEEGYFPDKQNG 578

Query: 576 --FSLAVIRYAK----VLGNILDSIFKRNMMSEAATESMAFVHEKALDIWKNRLPEK 626
              S A+  Y      +L +I   ++     +   +       E  L+ W   LP++
Sbjct: 579 EVSSAAIANYHTKLMLILADITKELYPNKKSNNIVSHETVTQLEMRLENWIQSLPQQ 635

>ZYRO0E08272g Chr5 (651705..654089) [2385 bp, 794 aa] {ON} similar
           to uniprot|P04386 Saccharomyces cerevisiae YPL248C GAL4
           DNA-binding transcription factor required for the
           activation of the GAL genes in response to galactose
           repressed by Gal80p and activated by Gal3p
          Length = 794

 Score = 47.4 bits (111), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 18/47 (38%), Positives = 27/47 (57%)

Query: 56  VAQACDRCRLKKTKCDGKIPQCSQCALVGFECKISDRLNRKSFPRGY 102
           +  ACD CR KK +C  + P+C++C   G+EC  S + NR    R +
Sbjct: 7   IDHACDSCRQKKLRCSKEEPKCAKCIQNGWECCYSPKANRTPLTRAH 53

>ZYRO0A10956g Chr1 (881429..883996) [2568 bp, 855 aa] {ON} similar
           to uniprot|P07272 Saccharomyces cerevisiae YLR014C PPR1
           Zinc finger transcription factor containing a
           Zn(2)-Cys(6) binuclear cluster domain positively
           regulates transcription of genes involved in uracil
           biosynthesis activity may be modulated by interaction
           with Tup1p
          Length = 855

 Score = 47.4 bits (111), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 19/44 (43%), Positives = 22/44 (50%)

Query: 59  ACDRCRLKKTKCDGKIPQCSQCALVGFECKISDRLNRKSFPRGY 102
           AC RCR KK KCD + P C +CA     C   D    +  PR Y
Sbjct: 32  ACKRCRTKKIKCDHEFPSCKKCARANKPCVSLDPATGRDVPRSY 75

 Score = 39.7 bits (91), Expect = 0.053,   Method: Compositional matrix adjust.
 Identities = 43/190 (22%), Positives = 76/190 (40%), Gaps = 28/190 (14%)

Query: 458 DMSTTTVQSLQLLSFISFYFLNVGDIPRLYQLRGTVISMAQQLRLHRCPSAVLLSASGST 517
           + S   ++SL     ++ Y L   ++P ++   G+ + +A  L LH              
Sbjct: 390 NFSPNRLESLAGTVLVAVYSLMRPNVPGVWYTMGSALRLAVDLGLH-------AEKLNRN 442

Query: 518 MQKFEQGERRLLFWAIYYLDVFYSLQLGVPRLIKDHEIECALPVSEEEDSQL---EGRVS 574
              F +  RR LFW +Y LD       G P  I +  I    P S  +D+ +      + 
Sbjct: 443 YDPFTRELRRRLFWCVYSLDRQICSYFGRPFGIPEENITARYP-SMLDDALITTTNDDIV 501

Query: 575 DFS-------------LAVIRYAKVLGNILDSIFKRN---MMSEAATESMAFVHEKALDI 618
           D+S             LA+ +  ++  NI+  ++  N     S +  ES  F   ++LD 
Sbjct: 502 DYSKMKSSMASPKVVALAMFKVRRLQANIVQVLYAPNGEVPRSFSNLESWKFEMHRSLDN 561

Query: 619 W-KNRLPEKY 627
           W +  +P+ Y
Sbjct: 562 WFRKEVPKTY 571

>YGL013C Chr7 complement(469092..472298) [3207 bp, 1068 aa] {ON}
          PDR1Zinc cluster protein that is a master regulator
          involved in recruiting other zinc cluster proteins to
          pleiotropic drug response elements (PDREs) to fine tune
          the regulation of multidrug resistance genes
          Length = 1068

 Score = 47.4 bits (111), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 18/38 (47%), Positives = 25/38 (65%), Gaps = 1/38 (2%)

Query: 55 RVAQACDRCRLKKTKCDGKIPQCSQCALVGFECKISDR 92
          +V++ACD CR +K KC+GK P C+ C +   EC  S R
Sbjct: 41 KVSKACDNCRKRKIKCNGKFP-CASCEIYSCECTFSTR 77

 Score = 37.0 bits (84), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 61/263 (23%), Positives = 102/263 (38%), Gaps = 48/263 (18%)

Query: 433 CKRTQNLIA----HYNQLIEKIHLDSFFQDMSTTTVQSLQLLSFISFYFLNVGDIPRLYQ 488
           C+  + LIA    +YN  +        + D +       QLL F+   F  + +I    +
Sbjct: 440 CQAGEALIALCYSYYNSTLYN------YVDFTCDITHLEQLLYFLDLLFW-LSEIYGFEK 492

Query: 489 LRGTVISMAQQLRLHRCPSAVLLSASGSTMQKFEQGERRLLFWAIYYLDVFYSLQLGVPR 548
           +    +    ++ L R    V L       + F +  RR L+W  +Y +   + +LG P 
Sbjct: 493 VLNVAVHFVSRVGLSRWEFYVGLD------ENFAE-RRRNLWWKAFYFEKTLASKLGYPS 545

Query: 549 LIKDHEIECALPVSEEEDSQLEGRVSDFSLAVIRYAKVLGNILDS--------------- 593
            I D +I C LP +  +   L+ R    ++ ++R ++   N+  S               
Sbjct: 546 NIDDSKINCLLPKNFRDVGFLDNRDFIENVHLVRRSEAFDNMCISDLKYYGELAVLQIVS 605

Query: 594 ------IFKRNMMSEAATESMAFVHEK----ALDIWKNRLPEKYGFRLEANG-LFNF--- 639
                 +F     S   T   + V EK     L+I+ N    KY    E  G LF+    
Sbjct: 606 HFSSSVLFNEKFTSIRNTSKPSVVREKLLFEVLEIF-NETEMKYDAIKEQTGKLFDIAFS 664

Query: 640 DELTVVKNSEKDLIEKSSILLFY 662
            + T +K S +D I  S  +LFY
Sbjct: 665 KDSTELKVSREDKIMASKFVLFY 687

>NDAI0A08790 Chr1 complement(2026171..2029350) [3180 bp, 1059 aa]
          {ON} Anc_7.17
          Length = 1059

 Score = 47.0 bits (110), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 16/34 (47%), Positives = 21/34 (61%)

Query: 54 YRVAQACDRCRLKKTKCDGKIPQCSQCALVGFEC 87
          YR++  C  CR  KTKCD + P CS+C  +G  C
Sbjct: 47 YRLSFVCQECRKSKTKCDKEKPSCSRCLKIGITC 80

>Smik_7.277 Chr7 complement(461108..464317) [3210 bp, 1069 aa]
          {ON} YGL013C (REAL)
          Length = 1069

 Score = 46.6 bits (109), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 17/38 (44%), Positives = 25/38 (65%), Gaps = 1/38 (2%)

Query: 55 RVAQACDRCRLKKTKCDGKIPQCSQCALVGFECKISDR 92
          +V++ACD CR +K KC+GK P C+ C +   EC  + R
Sbjct: 38 KVSKACDNCRKRKIKCNGKFP-CASCEIYSCECTFTTR 74

>Skud_7.274 Chr7 complement(472171..475413) [3243 bp, 1080 aa]
          {ON} YGL013C (REAL)
          Length = 1080

 Score = 46.6 bits (109), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 17/38 (44%), Positives = 25/38 (65%), Gaps = 1/38 (2%)

Query: 55 RVAQACDRCRLKKTKCDGKIPQCSQCALVGFECKISDR 92
          +V++ACD CR +K KC+GK P C+ C +   EC  + R
Sbjct: 38 KVSKACDNCRKRKIKCNGKFP-CASCEIYSCECTFTSR 74

 Score = 36.6 bits (83), Expect = 0.52,   Method: Compositional matrix adjust.
 Identities = 61/263 (23%), Positives = 101/263 (38%), Gaps = 49/263 (18%)

Query: 433 CKRTQNLIA----HYNQLIEKIHLDSFFQDMSTTTVQSLQLLSFISFYFLNVGDIPRLYQ 488
           C+  + LIA    +YN  +        + D +       QLL F+   F  + +I    +
Sbjct: 434 CQAGEALIALCYSYYNSTLYN------YVDFTCDITHLEQLLYFLDLLFW-LAEIYGFEK 486

Query: 489 LRGTVISMAQQLRLHRCPSAVLLSASGSTMQKFEQGERRLLFWAIYYLDVFYSLQLGVPR 548
           +    +    ++ L R    V L  + +         RR L+W  +Y +   + ++G P 
Sbjct: 487 VLNVAVHFVSRVGLSRWEFYVGLDEAFAE-------RRRKLWWKAFYFEKTLASKMGYPS 539

Query: 549 LIKDHEIECALPVSEEEDSQLEGR----------------------VSDFS-LAVIRYAK 585
            I D +I C LP    +   L+ R                      + D+  LAV++   
Sbjct: 540 NIDDSKINCLLPKDFRDVGFLDNRDFIENVHLVHRNEAFDNMSISSLKDYGELAVLQIVS 599

Query: 586 VLGNILDSIFKRNMMSEAATESMAFVHEK-ALDIWK--NRLPEKYGFRLEANG-LFN--F 639
              + +  +F     S   T   + V EK  LD+ +  N    KY    E  G LF+  F
Sbjct: 600 HFSSSV--LFNEKFTSIRNTSKPSIVREKLLLDVLEIFNETEMKYDAIKEQTGKLFDIAF 657

Query: 640 DELTVVKNSEKDLIEKSSILLFY 662
            + T +K S +D I  S  +LFY
Sbjct: 658 SKDTKLKVSREDKIMASRFVLFY 680

>ZYRO0C18150g Chr3 (1418645..1420360) [1716 bp, 571 aa] {ON} some
          similarities with uniprot|P39529 Saccharomyces
          cerevisiae YJL206C
          Length = 571

 Score = 46.2 bits (108), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 22/38 (57%), Positives = 24/38 (63%), Gaps = 1/38 (2%)

Query: 55 RVAQACDRCRLKKTKCDGKIPQCSQCALVGFECKISDR 92
          RV+ ACD CRLKK KCDG+ P C  C     EC  SDR
Sbjct: 23 RVSHACDNCRLKKKKCDGQQP-CKLCKNSENECIYSDR 59

 Score = 43.1 bits (100), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 26/99 (26%), Positives = 46/99 (46%), Gaps = 7/99 (7%)

Query: 462 TTVQSLQLLSFISFYFLNVGDIPRLYQLRGTVISMAQQLRLHRCPSAVLLSASGSTMQKF 521
           T V S+Q +  ++ +    G++ R Y   G  +  A    LHR  S +     G T    
Sbjct: 184 TDVYSIQTMFMLTMFLQCSGNLKRCYSYMGIALRAAIAEGLHRKSSLM-----GPT--PI 236

Query: 522 EQGERRLLFWAIYYLDVFYSLQLGVPRLIKDHEIECALP 560
           E   ++ LFW +Y +D++ +  +G+P+ I    +   LP
Sbjct: 237 EDESKKRLFWTVYKVDIYMNCIMGLPQSISQKTVNMELP 275

>KLTH0H16170g Chr8 complement(1391996..1393855) [1860 bp, 619 aa]
          {ON} some similarities with uniprot|P52960
          Saccharomyces cerevisiae YOR363C PIP2 peroxisome
          induction pathway 2 (PIP2) transcriptional activator of
          peroxisome proliferation may form heterodimer with Oaf1
          to activate oleate-inducible gene expression activator
          of peroxisome proliferation
          Length = 619

 Score = 46.2 bits (108), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 17/33 (51%), Positives = 20/33 (60%)

Query: 55 RVAQACDRCRLKKTKCDGKIPQCSQCALVGFEC 87
          R    CD CR++K KCD   P CS+CA  G EC
Sbjct: 10 RRLHVCDACRIRKLKCDKAKPNCSRCAKHGLEC 42

>KLLA0C03201g Chr3 complement(286973..288925) [1953 bp, 650 aa] {ON}
           similar to uniprot|P39529 Saccharomyces cerevisiae
           YJL206C and some similarities with YIL130W
           uniprot|P40467 Saccharomyces cerevisiae YIL130W ASG1
           Proposed transcriptional activator member of the Gal4p
           family of zinc cluster proteins
          Length = 650

 Score = 45.8 bits (107), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 61/266 (22%), Positives = 105/266 (39%), Gaps = 60/266 (22%)

Query: 326 NESPDSTIPNSRSDDLLSWMEIQRLVDVYFECWSNTIPIF---SRKLFIKQMKAFKTEVD 382
           NE P + +P+SR   +L   +I   + +  + W +   +F    R  FIK +++  T V 
Sbjct: 137 NECPQTQVPSSRRKLILPPKQIA--LTLISKSWDSACLLFRFYHRPTFIKVVESLYT-VK 193

Query: 383 KFGDRLFEVYKTEQIKINFLKIFATVLAVMCQMALLSRLKQLEATTQELECKRTQNLIAH 442
            F       Y  +Q +  FL +  +V+AV                   L CK       H
Sbjct: 194 NFE------YSEKQKR--FLPLVYSVIAV-----------------GALFCKSYAETTDH 228

Query: 443 YNQLIEKIHLDSFFQD---------------MSTTTVQSLQLLSFISFYFLNVGDIPRLY 487
             Q++E      FFQD               +++  V+SLQ +  ++ +     ++   Y
Sbjct: 229 -KQMME------FFQDEGHKYFIEAKCLLDPINSQDVESLQAIFMLTIFLQCSANLSSGY 281

Query: 488 QLRGTVISMAQQLRLHRCPSAVLLSASGSTMQKFEQGERRLLFWAIYYLDVFYSLQLGVP 547
              G  +  A +   HR         S   +   EQ   + LFW IY  D++ +  LG+P
Sbjct: 282 TYIGIALRTAIKQNFHR-------KTSLQNLNLLEQETIKKLFWTIYKTDIYMNCILGLP 334

Query: 548 RLIKDHEIECALPVSEEEDSQLEGRV 573
             + +  I+   P   ++D  LE R+
Sbjct: 335 NSLDESLIDQEFPSDIDDDRILENRL 360

 Score = 34.7 bits (78), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 12/35 (34%), Positives = 21/35 (60%), Gaps = 1/35 (2%)

Query: 54 YRVAQACDRCRLKKTKCDGKIPQCSQCALVGFECK 88
          ++V  AC  C+ +K +CDG+ P C+ C     +C+
Sbjct: 30 HKVKHACSSCKERKVRCDGQSP-CASCINARVKCE 63

>SAKL0A02860g Chr1 complement(259388..261625) [2238 bp, 745 aa] {ON}
           similar to uniprot|P04386 Saccharomyces cerevisiae
           YPL248C GAL4 DNA-binding transcription factor required
           for the activation of the GAL genes in response to
           galactose repressed by Gal80p and activated by Gal3p
          Length = 745

 Score = 45.8 bits (107), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 18/45 (40%), Positives = 26/45 (57%)

Query: 56  VAQACDRCRLKKTKCDGKIPQCSQCALVGFECKISDRLNRKSFPR 100
           V QACD CR +K +C  ++P+CS+C    +EC  S +  R    R
Sbjct: 5   VQQACDSCRKRKLRCSKELPKCSKCLKHNWECCYSPKAVRSPLTR 49

>KLTH0E03256g Chr5 complement(294997..297021) [2025 bp, 674 aa] {ON}
           weakly similar to uniprot|P39529 Saccharomyces
           cerevisiae YJL206C Hypothetical ORF
          Length = 674

 Score = 45.8 bits (107), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 39/175 (22%), Positives = 80/175 (45%), Gaps = 13/175 (7%)

Query: 452 LDSFFQDMSTTTVQSLQLLSFISFYFLNVGDIPRLYQLRGTVISMAQQLRLHRCPSAVLL 511
           L  F + +    + S++ L  I+FY   +  +  +Y   G  +S A    +HR       
Sbjct: 267 LKYFHEPIEEPNLDSVRTLILIAFYSQGLNRMNSVYAYTGLALSTAVAQGIHR------- 319

Query: 512 SASGSTMQKFEQGERRLLFWAIYYLDVFYSLQLGVPRLIKDHEIECALPVSEEEDSQLEG 571
            A+     + EQ  R+ ++W  + +D  ++ +LG+P      +I+  LP  +E  S  +G
Sbjct: 320 QANNHQFPRAEQEARKKIWWTAFLMDTLWASRLGLPPHFNSCDIDIELP--DESMSTEDG 377

Query: 572 RVSDFSLAVIRYAKVLGNILDSIFKRNMMSEAATESMAFVHEKALDIWKNRL-PE 625
               + +A    A ++ +++  ++      E+  E++ F + K L+I+   L PE
Sbjct: 378 FDPKYLIANTHLALLVRSVMREVY--GATRESFVENV-FCNLKRLEIFMASLKPE 429

 Score = 34.7 bits (78), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 13/28 (46%), Positives = 16/28 (57%)

Query: 55 RVAQACDRCRLKKTKCDGKIPQCSQCAL 82
          R  +AC RC  +K KC G+ P C  C L
Sbjct: 12 RSKKACQRCSAQKVKCLGEKPPCRACVL 39

>KLLA0D12672g Chr4 complement(1076011..1078608) [2598 bp, 865 aa]
           {ON} uniprot|P08657 Kluyveromyces lactis LAC9 Lactose
           regulatory protein LAC9
          Length = 865

 Score = 45.8 bits (107), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 17/45 (37%), Positives = 23/45 (51%)

Query: 58  QACDRCRLKKTKCDGKIPQCSQCALVGFECKISDRLNRKSFPRGY 102
           QACD CR KK KC   +P C+ C     +C  S ++ R    R +
Sbjct: 93  QACDACRKKKWKCSKTVPTCTNCLKYNLDCVYSPQVVRTPLTRAH 137

>Ecym_7440 Chr7 complement(902108..904804) [2697 bp, 898 aa] {ON}
          similar to Ashbya gossypii AER183C
          Length = 898

 Score = 45.8 bits (107), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 19/42 (45%), Positives = 26/42 (61%), Gaps = 1/42 (2%)

Query: 55 RVAQACDRCRLKKTKCDGKIPQCSQCALVGFECKISDRLNRK 96
          RV++ACD CR KK KC+G+ P CS C     EC  +  + R+
Sbjct: 22 RVSKACDTCRAKKIKCNGEEP-CSNCGKHDLECAYTHVIKRR 62

>SAKL0H24860g Chr8 complement(2162455..2165370) [2916 bp, 971 aa]
           {ON} conserved hypothetical protein
          Length = 971

 Score = 45.8 bits (107), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 31/82 (37%), Positives = 40/82 (48%), Gaps = 15/82 (18%)

Query: 480 VGDIPRLYQLRGTVISMAQQLRLHRCPSAVLLSASGSTMQKFEQGERRLLFWAIYYLDVF 539
           +  +PRL          AQ++ L R P+    S  G T     Q  RR+LFW I+ LD  
Sbjct: 382 IAQLPRL----------AQRVMLTRDPT----SYHGITDPTLVQS-RRILFWQIFQLDTL 426

Query: 540 YSLQLGVPRLIKDHEIECALPV 561
            SL   +P LIK  E + ALPV
Sbjct: 427 TSLHNNLPPLIKLDEFDTALPV 448

>KLTH0E14454g Chr5 complement(1282704..1285412) [2709 bp, 902 aa]
          {ON} some similarities with uniprot|Q12180
          Saccharomyces cerevisiae YOL089C HAL9 Putative
          transcription factor containing a zinc finger;
          overexpression increases salt tolerance through
          increased expression of the ENA1(Na+/Li+ extrusion
          pump) gene while gene disruption decreases both salt
          tolerance and ENA1 expression
          Length = 902

 Score = 45.4 bits (106), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 21/45 (46%), Positives = 27/45 (60%), Gaps = 1/45 (2%)

Query: 55 RVAQACDRCRLKKTKCDGKIPQCSQCALVGFECKISDRLNRKSFP 99
          RV++ACD CR KK KCDG  P CS C  V  EC  +  + ++  P
Sbjct: 9  RVSKACDACRAKKIKCDGCDP-CSNCKKVSQECGYTYVVKKRQKP 52

 Score = 34.3 bits (77), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 26/85 (30%), Positives = 40/85 (47%), Gaps = 9/85 (10%)

Query: 472 FISFYFLNVGDIPRL-YQLRGTVISMAQQLRLHRCPSAVLLSASGSTMQKFEQGERRLLF 530
            +  + L     P+L Y    T I + Q++ LH   S    + SG +     +  RRL+ 
Sbjct: 376 LVYCWLLENSPTPQLAYLALSTAIRLGQEVGLHLRES--YFNTSGPS-----EALRRLVL 428

Query: 531 WA-IYYLDVFYSLQLGVPRLIKDHE 554
           W  +Y  DVF S++ G P LI D +
Sbjct: 429 WMNLYRYDVFLSIRTGKPALIHDGD 453

>TDEL0E00160 Chr5 (16083..17978) [1896 bp, 631 aa] {ON} 
          Length = 631

 Score = 45.1 bits (105), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 18/47 (38%), Positives = 26/47 (55%)

Query: 54  YRVAQACDRCRLKKTKCDGKIPQCSQCALVGFECKISDRLNRKSFPR 100
           + + +ACD CR KK KC    P+C +C   G++C  S R+ R    R
Sbjct: 2   FEMDRACDSCRHKKLKCSKTRPKCKKCLKNGWDCCYSPRIKRSPLTR 48

>Suva_7.268 Chr7 complement(460629..463631) [3003 bp, 1000 aa]
          {ON} YGL013C (REAL)
          Length = 1000

 Score = 45.1 bits (105), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 17/38 (44%), Positives = 25/38 (65%), Gaps = 1/38 (2%)

Query: 55 RVAQACDRCRLKKTKCDGKIPQCSQCALVGFECKISDR 92
          +V++ACD CR +K KC+GK P C+ C +   EC  + R
Sbjct: 38 KVSKACDNCRKRKIKCNGKFP-CASCEIYLCECTFTTR 74

 Score = 37.4 bits (85), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 34/144 (23%), Positives = 56/144 (38%), Gaps = 18/144 (12%)

Query: 433 CKRTQNLIA----HYNQLIEKIHLDSFFQDMSTTTVQSLQLLSFISFYFLNVGDIPRLYQ 488
           C+  + LIA    +YN  +        + D +       QLL F    F  + +I    +
Sbjct: 436 CQAVEALIALCYSYYNSTLYN------YVDFTCDVTHLEQLLYFSDLLFW-LAEIYGFEK 488

Query: 489 LRGTVISMAQQLRLHRCPSAVLLSASGSTMQKFEQGERRLLFWAIYYLDVFYSLQLGVPR 548
           +    +    ++ L R    V L  + +         RR L+W  YY +   + +LG P 
Sbjct: 489 VLNVAVHFVSRVGLSRWEFYVGLDEAFAE-------RRRSLWWKAYYFEKTLASKLGYPS 541

Query: 549 LIKDHEIECALPVSEEEDSQLEGR 572
            I D +I C LP    +   L+ R
Sbjct: 542 NIDDSKINCLLPKDFRDAGFLDNR 565

>AER370W Chr5 (1320487..1322892) [2406 bp, 801 aa] {ON} Syntenic
          homolog of Saccharomyces cerevisiae YIL130W
          Length = 801

 Score = 45.1 bits (105), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 17/33 (51%), Positives = 21/33 (63%), Gaps = 1/33 (3%)

Query: 55 RVAQACDRCRLKKTKCDGKIPQCSQCALVGFEC 87
          RV +ACD CR KK KCD + P C  C +  +EC
Sbjct: 13 RVTRACDECRKKKVKCDSRHP-CIHCTVYSYEC 44

>CAGL0A00451g Chr1 (47557..50880) [3324 bp, 1107 aa] {ON} similar
          to uniprot|P12383 Saccharomyces cerevisiae YGL013c PDR1
          transcription factor
          Length = 1107

 Score = 44.7 bits (104), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 17/37 (45%), Positives = 23/37 (62%), Gaps = 1/37 (2%)

Query: 55 RVAQACDRCRLKKTKCDGKIPQCSQCALVGFECKISD 91
          +V +ACD CR +K KC+G  P C  C + G EC  +D
Sbjct: 26 KVGKACDSCRRRKIKCNGLKP-CPSCTIYGCECTYTD 61

>Smik_11.240 Chr11 (395459..395932,395981..398437) [2931 bp, 976 aa]
           {ON} YKL015W (REAL)
          Length = 976

 Score = 44.7 bits (104), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 39/161 (24%), Positives = 72/161 (44%), Gaps = 24/161 (14%)

Query: 476 YFLNVGDIPRL-YQLRGTVISMAQQLRLHRCPSAVLLSASGSTMQKFEQGERRLLFWAIY 534
           +FL V D     Y   G  +     L LH       + +   T+ K+E    R L+W +Y
Sbjct: 466 FFLQVADYTLASYFYFGQALRTCLILGLH-------VDSQSDTLTKYEIEHHRRLWWTVY 518

Query: 535 YLDVFYSLQLGVPRLIKDHEIECALPVSEEEDSQLEGRVSDFSLAVIRYAKVLGN----- 589
             +   S + G+P    D+ I  ALP ++ +D  +EG+ + +   V R A+++ N     
Sbjct: 519 MFERMLSSKAGLPLSFTDYTISTALP-ADIDDETIEGKNNQY---VFRKAELISNCVTIV 574

Query: 590 -----ILDSIFKRNMMSEAATESMAFVHEKALDIWKNRLPE 625
                IL  +++R   +     ++  V ++ L+ W+N L +
Sbjct: 575 KINAQILSKLYQRQPETNIII-TLKVVIKQLLE-WRNNLSD 613

>TPHA0N00230 Chr14 (39855..43553) [3699 bp, 1232 aa] {ON} Anc_7.17
          YOR363C
          Length = 1232

 Score = 44.7 bits (104), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 15/33 (45%), Positives = 20/33 (60%)

Query: 55 RVAQACDRCRLKKTKCDGKIPQCSQCALVGFEC 87
          R++  C  CR  KTKCD K P C++C   G +C
Sbjct: 47 RISFVCQHCRKSKTKCDKKQPHCARCIKHGIQC 79

>Smik_2.438 Chr2 (786437..787846) [1410 bp, 469 aa] {ON} YBR297W
           (REAL)
          Length = 469

 Score = 44.3 bits (103), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 22/45 (48%), Positives = 27/45 (60%), Gaps = 2/45 (4%)

Query: 56  VAQACDRCRLKKTKCDGKIPQCSQCALVGFECKISDRLNRKSFPR 100
           V  ACD CR+++ KCDGK P CS+C    FEC     L RK  P+
Sbjct: 4   VKYACDFCRVRRVKCDGKKP-CSRCIQHDFECTYQQPL-RKRGPK 46

>KLTH0D02222g Chr4 (220570..223113) [2544 bp, 847 aa] {ON} weakly
          similar to uniprot|P52960 Saccharomyces cerevisiae
          YOR363C PIP2 peroxisome induction pathway 2 (PIP2)
          transcriptional activator of peroxisome proliferation
          may form heterodimer with Oaf1 to activate
          oleate-inducible gene expression activator of
          peroxisome proliferation
          Length = 847

 Score = 44.7 bits (104), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 18/47 (38%), Positives = 29/47 (61%), Gaps = 2/47 (4%)

Query: 55 RVAQACDRCRLKKTKCDGKIPQCSQCALVGFEC--KISDRLNRKSFP 99
          R++  C  CR +K KCD   P+C +CA +G EC   +S++++ K  P
Sbjct: 27 RLSFVCRNCRKRKIKCDKAQPKCGRCAKLGLECNYDLSEQISLKKTP 73

>Ecym_5397 Chr5 (805712..808192) [2481 bp, 826 aa] {ON} similar to
          Ashbya gossypii AER370W
          Length = 826

 Score = 44.3 bits (103), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 16/33 (48%), Positives = 21/33 (63%), Gaps = 1/33 (3%)

Query: 55 RVAQACDRCRLKKTKCDGKIPQCSQCALVGFEC 87
          R+ +ACD CR KK KCD + P C  C +  +EC
Sbjct: 17 RITRACDECRKKKVKCDNRHP-CIHCTVYSYEC 48

 Score = 34.7 bits (78), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 37/143 (25%), Positives = 59/143 (41%), Gaps = 16/143 (11%)

Query: 494 ISMAQQLR--LHRCPSAVLLSASGSTMQKFEQGERRLLFWAIYYLDVFYSLQLGVPRLIK 551
           ++M   LR  LHR     L   +  +    E   R+ +F+ IY +DV  +  LG+PR I 
Sbjct: 336 LAMKSALREGLHRN----LTPEASMSFSPIEIEMRKRVFYTIYRMDVMLNTMLGLPRSIS 391

Query: 552 DHEIECALPVSEE-----EDSQLEGRVSDF--SLAVIRYAKVLGNILDSI---FKRNMMS 601
             + +  LP++       E+  L  + SD   S  V      L  I+D I        + 
Sbjct: 392 KEDFDQELPLTISDSCITEEGILRNKGSDILGSTGVTNQHTKLVMIMDEIANTLYSPRLD 451

Query: 602 EAATESMAFVHEKALDIWKNRLP 624
              + S+    E  L  W ++LP
Sbjct: 452 NVVSHSVISDLELKLRAWLDQLP 474

>Kpol_467.1 s467 (471..4340) [3870 bp, 1289 aa] {ON} (471..4340)
           [3870 nt, 1290 aa]
          Length = 1289

 Score = 44.7 bits (104), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 62/272 (22%), Positives = 108/272 (39%), Gaps = 71/272 (26%)

Query: 351 VDVYFECWSNTIPIFSRKLFIKQMKAFKTEVDKFGDRLFEVYK-TEQIKINFLK----IF 405
           +D++F+C   TIPI   + F  Q+      +      L E  +   ++K+ F K      
Sbjct: 400 LDLFFDCMYPTIPILDEQNFRAQIGRIFYNMPSVSPELTESTRYGTKVKLRFSKSADYCN 459

Query: 406 ATVLAVMCQMALLS--------RLKQ-------LEATTQELECKRTQNLIAHYNQLIEKI 450
             +L ++ ++A LS         L Q           T      R  ++++ Y   +E I
Sbjct: 460 TGILLIILRLAWLSLPSNSCKTTLGQGTGLSLSSPVNTSSANRMRINSILSKYEPSVEAI 519

Query: 451 -----HLDSFFQDMSTT----TVQSLQLLSFISFYFLNVGDIPRL--------------- 486
                HL  F +  ST+    ++ ++Q   F   Y +  GD+P +               
Sbjct: 520 ELVKKHLIKFDELSSTSNSNVSLTTIQFAIFFKLYLMCCGDLPEVNLTSSPSLGAGQDNE 579

Query: 487 -YQ-LRGTVISMAQQLRLHRCP------------------SAV------LLSASGSTMQK 520
            +Q L  ++I MA    LHR P                  SAV      LL  + ++ ++
Sbjct: 580 SHQVLLSSIIQMAFSCGLHRDPDNFPQLNTFSNSDDTNAISAVTKHNSKLLKNAQNSSER 639

Query: 521 FEQGERRLLFWAIYYLDVFYSLQLGVPRLIKD 552
           F+   R+  ++ I  LDV  SL LG PR++++
Sbjct: 640 FKHAWRKT-WYHIISLDVQQSLSLGTPRILRN 670

 Score = 38.1 bits (87), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 13/30 (43%), Positives = 17/30 (56%)

Query: 55 RVAQACDRCRLKKTKCDGKIPQCSQCALVG 84
          R+  +C  CR +K KCD   P C+QC   G
Sbjct: 22 RIPLSCTICRKRKVKCDKTRPHCNQCTKTG 51

>KNAG0E00210 Chr5 (24545..27391) [2847 bp, 948 aa] {ON} Anc_7.17
          YOR363C
          Length = 948

 Score = 44.3 bits (103), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 15/33 (45%), Positives = 20/33 (60%)

Query: 55 RVAQACDRCRLKKTKCDGKIPQCSQCALVGFEC 87
          R++  C  CR  K KCD + PQC +C  +G EC
Sbjct: 24 RLSYVCKACRTAKAKCDKEKPQCGRCYKLGVEC 56

>Kwal_8.580 s8 (13266..15182) [1917 bp, 638 aa] {ON} [contig 311]
          FULL
          Length = 638

 Score = 43.9 bits (102), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 15/29 (51%), Positives = 20/29 (68%)

Query: 56 VAQACDRCRLKKTKCDGKIPQCSQCALVG 84
          V++ACD CRL+K KC G +P C  C+  G
Sbjct: 13 VSKACDNCRLRKAKCSGDLPVCRNCSTAG 41

>TBLA0C04050 Chr3 complement(980010..983633) [3624 bp, 1207 aa] {ON}
           Anc_4.113 YGL013C
          Length = 1207

 Score = 43.9 bits (102), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 49/206 (23%), Positives = 84/206 (40%), Gaps = 48/206 (23%)

Query: 385 GDRLFEVYKTEQIKINFLKIFATVLAVMCQMA-----LLSRLKQL----EATTQE----- 430
            D L   Y  E      LK+F+TVL ++ Q       +L R+  L    +A+T E     
Sbjct: 459 NDFLLSFYDNE------LKMFSTVLKMIYQATKSFNTVLRRITVLNPNKQASTDENNKDI 512

Query: 431 ---LECKRTQNLIAHYNQLIEKI-------------HLDSFFQDMSTTTVQSLQLLSFIS 474
              +      N IA+  Q+ E +             HLD  F      T++ L+LL    
Sbjct: 513 MGYIVSDNDINTIANLCQVEEILYSLCANYYNSTLYHLDDHFN-----TIEYLELLIVFL 567

Query: 475 FYFLNVGDIPRLYQLRGTVISMAQQLRLHRCPSAVLLSASGSTMQKFEQGERRLLFWAIY 534
              L   +     ++    I+ A Q+   R    V        +Q+++  +RR L+W +Y
Sbjct: 568 KQQLVASEFYGFERVLDVAINYAIQMGFSRWEFYV-------GLQEYQAEKRRQLWWKLY 620

Query: 535 YLDVFYSLQLGVPRLIKDHEIECALP 560
            ++  + ++ G P +I + +I C LP
Sbjct: 621 MIEKLHCMKRGFPSVINEDKINCLLP 646

 Score = 41.2 bits (95), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 16/36 (44%), Positives = 22/36 (61%), Gaps = 1/36 (2%)

Query: 55 RVAQACDRCRLKKTKCDGKIPQCSQCALVGFECKIS 90
          +V++ACD CR +K KC G+ P C+ C     EC  S
Sbjct: 12 KVSKACDNCRRRKIKCSGERP-CAGCKTYNCECIFS 46

>KLLA0A09119g Chr1 complement(797533..800781) [3249 bp, 1082 aa]
          {ON} weakly similar to uniprot|P12383 Saccharomyces
          cerevisiae YGL013C PDR1 Zinc cluster protein that is a
          master regulator involved in recruiting other zinc
          cluster proteins to pleiotropic drug response elements
          (PDREs) to fine tune the regulation of multidrug
          resistance genes
          Length = 1082

 Score = 43.9 bits (102), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 18/36 (50%), Positives = 22/36 (61%), Gaps = 1/36 (2%)

Query: 55 RVAQACDRCRLKKTKCDGKIPQCSQCALVGFECKIS 90
          +V++ACD CR KK KC G +P C  C   G EC  S
Sbjct: 50 KVSRACDSCRKKKIKCSGTLP-CKSCETYGCECVYS 84

>KAFR0F01040 Chr6 complement(195192..197696) [2505 bp, 834 aa] {ON}
           Anc_6.279 YPL248C
          Length = 834

 Score = 43.9 bits (102), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 23/47 (48%)

Query: 56  VAQACDRCRLKKTKCDGKIPQCSQCALVGFECKISDRLNRKSFPRGY 102
           + QACD CR+KK +C  + P C +C      C  S R  R    R +
Sbjct: 1   MEQACDICRVKKLRCSKEKPSCFKCLKNNLTCTYSPRAKRSPLTRAH 47

>YKL015W Chr11 (408544..411483) [2940 bp, 979 aa] {ON}
           PUT3Transcriptional activator of proline utilization
           genes, constitutively binds PUT1 and PUT2 promoter
           sequences as a dimer and undergoes a conformational
           change to form the active state; differentially
           phosphorylated in the presence of different nitrogen
           sources; has a Zn(2)-Cys(6) binuclear cluster domain
          Length = 979

 Score = 43.9 bits (102), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 36/157 (22%), Positives = 66/157 (42%), Gaps = 16/157 (10%)

Query: 476 YFLNVGDIPRL-YQLRGTVISMAQQLRLHRCPSAVLLSASGSTMQKFEQGERRLLFWAIY 534
           +FL V D     Y   G  +     L LH       + +   T+ ++E    R L+W +Y
Sbjct: 469 FFLQVADYTLASYFYFGQALRTCLILGLH-------VDSQSDTLSRYEIEHHRRLWWTVY 521

Query: 535 YLDVFYSLQLGVPRLIKDHEIECALPVS------EEEDSQLEGRVSDFSLAVIRYAKVLG 588
             +   S + G+P    D+ I  ALP        EE++S    R ++     +   K+  
Sbjct: 522 MFERMLSSKAGLPLSFTDYTISTALPADIDDETIEEKNSHYVFRKAELISNCVTIVKINA 581

Query: 589 NILDSIFKRNMMSEAATESMAFVHEKALDIWKNRLPE 625
            IL  +++R   +     ++  V ++ L+ W+N L +
Sbjct: 582 QILSKLYQRQPETNIII-TLKVVIKQLLE-WRNNLSD 616

>SAKL0C03938g Chr3 complement(377431..379773) [2343 bp, 780 aa]
          {ON} weakly similar to uniprot|P40467 Saccharomyces
          cerevisiae YIL130W ASG1 Proposed transcriptional
          activator member of the Gal4p family of zinc cluster
          proteins and to YJL206C uniprot|P39529 Saccharomyces
          cerevisiae YJL206C
          Length = 780

 Score = 43.5 bits (101), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 15/33 (45%), Positives = 22/33 (66%), Gaps = 1/33 (3%)

Query: 55 RVAQACDRCRLKKTKCDGKIPQCSQCALVGFEC 87
          RV++ACD CR +K +CDG+ P C  C +  + C
Sbjct: 27 RVSRACDVCRQRKVRCDGRQP-CIHCTVYSYNC 58

 Score = 40.0 bits (92), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 56/233 (24%), Positives = 100/233 (42%), Gaps = 32/233 (13%)

Query: 462 TTVQSLQLLSFISFYFLNVGDIPRLYQLRGTVISMAQQLRLHRCPSAVLLSASGSTMQKF 521
           T V ++Q +  ++ +      +   Y   G  +  A    LH       +S +G +  + 
Sbjct: 336 TDVYAIQTVFMLTIFLQCSAKLTTCYSYIGVALRAAITQGLH-----TKVSTAGKSPVEA 390

Query: 522 EQGERRLLFWAIYYLDVFYSLQLGVPRLIKDHEIECALPVSEEE--------DSQLEGRV 573
           E  +R  LFW IY +DV+ +  LG+PR I + +++  LP   ++        + Q  G++
Sbjct: 391 ETCKR--LFWTIYKMDVYMNCILGLPRSISEEDVDQDLPQDLDDDRITDLGIEPQPAGKI 448

Query: 574 SDFSL--AVIRYAKVLGNILDSIFKRNMMSEAATESMAFVH--EKALDIWKNRLPEKYGF 629
           S   +     +   ++ +I   +      +  AT  +  VH  E  L  W  +LP     
Sbjct: 449 SSCGMNNQHTKLIVIMNHIHCKLSPLKNDAPPATLLLESVHELENELQNWTLQLP----L 504

Query: 630 RLEANGLFNFDELTVVKNSEKDL-IEKSSILLFYFL-AKCMIHLPVIATRSAS 680
           +L  N        T +  +E DL ++ + +LL  FL AK M++ P I   S S
Sbjct: 505 QLRPN-------YTFLDQAEADLYLKPNKLLLLDFLHAKIMLYRPFIHYVSVS 550

>KAFR0E02330 Chr5 (468300..470414) [2115 bp, 704 aa] {ON} Anc_5.59
          YHR178W
          Length = 704

 Score = 43.5 bits (101), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 16/39 (41%), Positives = 21/39 (53%)

Query: 59 ACDRCRLKKTKCDGKIPQCSQCALVGFECKISDRLNRKS 97
          +C RCR  K KC  ++P C  C  VG EC    R  R++
Sbjct: 14 SCSRCRKLKKKCPREVPVCGHCVRVGAECSYPGRAARRT 52

>YBR297W Chr2 (800523..801929) [1407 bp, 468 aa] {ON}
           MAL33MAL-activator protein, part of complex locus MAL3;
           nonfunctional in genomic reference strain S288C
          Length = 468

 Score = 43.1 bits (100), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 22/47 (46%), Positives = 27/47 (57%), Gaps = 2/47 (4%)

Query: 56  VAQACDRCRLKKTKCDGKIPQCSQCALVGFECKISDRL-NRKSFPRG 101
           V  ACD CR+++ KCDGK P CS+C    F+C     L  R S P G
Sbjct: 4   VKYACDYCRVRRVKCDGKKP-CSRCIEHNFDCTYQQPLKKRGSKPIG 49

>ZYRO0E06270g Chr5 (475960..478698) [2739 bp, 912 aa] {ON} weakly
           similar to uniprot|P50104 Saccharomyces cerevisiae
           YMR019W STB4 Protein that binds Sin3p in a two- hybrid
           assay
          Length = 912

 Score = 43.1 bits (100), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 19/46 (41%), Positives = 26/46 (56%), Gaps = 1/46 (2%)

Query: 55  RVAQACDRCRLKKTKCDGKIPQCSQCALVGFECKISDRLNRKSFPR 100
           RV +AC+ C+ +K KCDG  P C+ C   G ECK      R+ + R
Sbjct: 12  RVRKACEICKRRKVKCDGSQP-CANCVKHGQECKYISGTVRRRYRR 56

>Kwal_14.778 s14 complement(40408..42405) [1998 bp, 665 aa] {ON}
           YKL015W (PUT3) - zinc-finger transcription factor of the
           Zn(2)-Cys(6) binuclear cluster domain type [contig 245]
           FULL
          Length = 665

 Score = 43.1 bits (100), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 35/142 (24%), Positives = 62/142 (43%), Gaps = 19/142 (13%)

Query: 462 TTVQSLQLLSFISFYFLNVGDIPRLYQLRGTVISMAQQLRLHRCPSAVLLSASGSTMQKF 521
           T+V  +Q L +++++ L++      + + G  I     L LH+  S+V            
Sbjct: 266 TSVSLVQSLLYMAYFALSLNRTTFAFVITGDAIRTMFTLGLHKSTSSV------------ 313

Query: 522 EQGERRLLFWAIYYLDVFYSLQLGVPRLIKDHEIECALPVSEEEDSQLEGRVSDFSLAV- 580
            +G R  +FW  +  D   +++ G P +I +  I   +P+  E D  L     D    V 
Sbjct: 314 -RGNR--VFWLCFIYDRLLAVRFGFPLMIDERSIN--VPIFSEVDESLTATSLDIYHFVS 368

Query: 581 -IRYAKVLGNILDSIFKRNMMS 601
            IR AK+   ++  I+ RN  S
Sbjct: 369 QIRLAKITTQVITKIYTRNPFS 390

>KLTH0E00440g Chr5 complement(42945..45011) [2067 bp, 688 aa] {ON}
           some similarities with uniprot|P25502 Saccharomyces
           cerevisiae YKL015W PUT3 Positive regulator of PUT
           (proline utilization) genes zinc-finger transcription
           factor of the Zn(2)-Cys(6) binuclear cluster domain type
          Length = 688

 Score = 43.1 bits (100), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 51/229 (22%), Positives = 94/229 (41%), Gaps = 40/229 (17%)

Query: 408 VLAVMCQMALLSRLKQLEATTQELECKRTQNLIAHYNQLIEKIHLDSFFQDMSTTTVQSL 467
           +L ++  +AL S   +  A ++ L  K  +  +  Y++L++         D + +T   L
Sbjct: 243 LLRLVAHLALGSLFDKENAESRSLGLKYHRTTLLLYSELVKT-------YDCAASTSLIL 295

Query: 468 QLLSFISFYFLNVGDIPRLYQLRGTVISMAQQLRLHRCPSAVLLSASGSTMQKFEQGERR 527
            LL +++++ L++      + + G+ I     L LH+    ++              E R
Sbjct: 296 SLL-YMAYFSLSLNKATSAFVMTGSAIRTMFTLGLHKRTKTIV--------------ENR 340

Query: 528 LLFWAIYYLDVFYSLQLGVPRLIKDHEIECALPVSEEEDSQLEGRVSDFSLAV--IRYAK 585
           + FW  +  D   +++ G P +I +  I   +P+  E D  L     D    V  +R AK
Sbjct: 341 V-FWLCFIYDRLLAVRFGFPLMIDERNIN--IPLLTEVDDNLTAVSLDIYHFVSQVRLAK 397

Query: 586 VLGNILDSIFKRNMMSEAATESMAFVHE-----KALDIWKNRLPEKYGF 629
           +   I+  I+ RN  S        F+H      K L  W   LP +  F
Sbjct: 398 ITTQIITKIYTRNPYS--------FLHNCHAVLKQLKNWFESLPAELKF 438

>KLTH0B10076g Chr2 (841024..843090) [2067 bp, 688 aa] {ON} some
           similarities with uniprot|P25502 Saccharomyces
           cerevisiae YKL015W PUT3 Positive regulator of PUT
           (proline utilization) genes zinc-finger transcription
           factor of the Zn(2)-Cys(6) binuclear cluster domain type
          Length = 688

 Score = 43.1 bits (100), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 51/229 (22%), Positives = 94/229 (41%), Gaps = 40/229 (17%)

Query: 408 VLAVMCQMALLSRLKQLEATTQELECKRTQNLIAHYNQLIEKIHLDSFFQDMSTTTVQSL 467
           +L ++  +AL S   +  A ++ L  K  +  +  Y++L++         D + +T   L
Sbjct: 243 LLRLVAHLALGSLFDKENAESRSLGLKYHRTTLLLYSELVKT-------YDCAASTSLIL 295

Query: 468 QLLSFISFYFLNVGDIPRLYQLRGTVISMAQQLRLHRCPSAVLLSASGSTMQKFEQGERR 527
            LL +++++ L++      + + G+ I     L LH+    ++              E R
Sbjct: 296 SLL-YMAYFSLSLNKATSAFVMTGSAIRTMFTLGLHKRTKTIV--------------ENR 340

Query: 528 LLFWAIYYLDVFYSLQLGVPRLIKDHEIECALPVSEEEDSQLEGRVSDFSLAV--IRYAK 585
           + FW  +  D   +++ G P +I +  I   +P+  E D  L     D    V  +R AK
Sbjct: 341 V-FWLCFIYDRLLAVRFGFPLMIDERNIN--IPLLTEVDDNLTAVSLDIYHFVSQVRLAK 397

Query: 586 VLGNILDSIFKRNMMSEAATESMAFVHE-----KALDIWKNRLPEKYGF 629
           +   I+  I+ RN  S        F+H      K L  W   LP +  F
Sbjct: 398 ITTQIITKIYTRNPYS--------FLHNCHAVLKQLKNWFESLPAELKF 438

>SAKL0A09856g Chr1 complement(867959..871021) [3063 bp, 1020 aa]
           {ON} some similarities with uniprot|P32862 Saccharomyces
           cerevisiae YKL038W RGT1 Glucose-responsive transcription
           factor that regulates expression of several glucose
           transporter (HXT) genes in response to glucose binds to
           promoters and acts both as a transcriptional activator
           and repressor
          Length = 1020

 Score = 43.1 bits (100), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 23/51 (45%), Positives = 30/51 (58%), Gaps = 4/51 (7%)

Query: 55  RVAQACDRCRLKKTKCD--GKIPQCSQCALVGFECKISDRLNRKSFP-RGY 102
           +V++ACD+CR KK KCD     P CS C  VG  C   +R+  K  P +GY
Sbjct: 31  KVSRACDQCRKKKIKCDVSEDNPVCSGCFKVGDRCTF-ERVPLKRGPSKGY 80

>CAGL0I07755g Chr9 complement(745585..748746) [3162 bp, 1053 aa]
           {ON} similar to uniprot|Q12180 Saccharomyces cerevisiae
           YOL089c HAL9
          Length = 1053

 Score = 42.7 bits (99), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 17/36 (47%), Positives = 23/36 (63%), Gaps = 3/36 (8%)

Query: 55  RVAQACDRCRLKKTKCDGKIP---QCSQCALVGFEC 87
           R A+AC+ CR +KTKCD   P   +CS C+  G +C
Sbjct: 173 RAAKACEYCRKRKTKCDEVSPYTNKCSNCSKAGVDC 208

>Skud_15.546 Chr15 (990335..991963) [1629 bp, 542 aa] {ON} YOR380W
           (REAL)
          Length = 542

 Score = 42.7 bits (99), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 19/46 (41%), Positives = 25/46 (54%), Gaps = 1/46 (2%)

Query: 55  RVAQACDRCRLKKTKCDGKIPQCSQCALVGFECKISDRLNRKSFPR 100
           RV +AC  CR +K KC+GK P C  C   G+ C  +D     + PR
Sbjct: 15  RVRKACVPCRERKRKCNGKSP-CEMCIAYGYACHYTDVDGSSTSPR 59

>KLLA0A02585g Chr1 complement(226562..227674) [1113 bp, 370 aa]
          {ON} conserved hypothetical protein
          Length = 370

 Score = 42.4 bits (98), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 17/26 (65%), Positives = 21/26 (80%), Gaps = 1/26 (3%)

Query: 55 RVAQACDRCRLKKTKCDGKIPQCSQC 80
          RV++ACD CR  KTKCDG+ P CS+C
Sbjct: 17 RVSKACDACRKSKTKCDGERP-CSRC 41

>Smik_1.13 Chr1 (31514..34654) [3141 bp, 1046 aa] {ON} YAL051W
          (REAL)
          Length = 1046

 Score = 42.7 bits (99), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 15/33 (45%), Positives = 21/33 (63%)

Query: 55 RVAQACDRCRLKKTKCDGKIPQCSQCALVGFEC 87
          R++  C  CR  KTKCD + P+CS+C   G +C
Sbjct: 61 RISFVCQACRKSKTKCDREKPECSRCIKHGLKC 93

>Smik_15.561 Chr15 (997239..998879) [1641 bp, 546 aa] {ON} YOR380W
          (REAL)
          Length = 546

 Score = 42.4 bits (98), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 21/47 (44%), Positives = 26/47 (55%), Gaps = 3/47 (6%)

Query: 55 RVAQACDRCRLKKTKCDGKIPQCSQCALVGFECKI--SDRLNRKSFP 99
          RV +AC  CR +K KC+GK P C  C   G+ C     DR +  SFP
Sbjct: 15 RVRKACVPCRERKRKCNGKSP-CEMCISYGYVCHYMDKDRSSSSSFP 60

>KLTH0H02684g Chr8 complement(235527..237776) [2250 bp, 749 aa] {ON}
           weakly similar to uniprot|P04386 Saccharomyces
           cerevisiae YPL248C GAL4 DNA-binding transcription factor
           required for the activation of the GAL genes in response
           to galactose repressed by Gal80p and activated by Gal3p
          Length = 749

 Score = 42.4 bits (98), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 18/45 (40%), Positives = 23/45 (51%)

Query: 58  QACDRCRLKKTKCDGKIPQCSQCALVGFECKISDRLNRKSFPRGY 102
           QACD CR KK KC  + P CS C    ++C  S +  R    R +
Sbjct: 9   QACDWCRRKKLKCSREHPICSNCFKHNWDCHYSPKKVRSPLTRAH 53

>KAFR0C04980 Chr3 (987900..990755) [2856 bp, 951 aa] {ON} Anc_7.17
           YOR363C
          Length = 951

 Score = 42.4 bits (98), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 17/41 (41%), Positives = 21/41 (51%)

Query: 55  RVAQACDRCRLKKTKCDGKIPQCSQCALVGFECKISDRLNR 95
           R++  C  CR  KTKCD + P CS+C     EC     L R
Sbjct: 60  RISFVCQACRKAKTKCDKEKPMCSRCRKQDLECVYDIELQR 100

>TDEL0C05680 Chr3 complement(1020646..1022721) [2076 bp, 691 aa]
           {ON} Anc_1.128 YJL206C
          Length = 691

 Score = 42.4 bits (98), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 18/30 (60%), Positives = 22/30 (73%), Gaps = 1/30 (3%)

Query: 55  RVAQACDRCRLKKTKCDGKIPQCSQCALVG 84
           RV++AC+ CR KK KCDG+ P C  C LVG
Sbjct: 125 RVSRACEFCRSKKKKCDGQQP-CDLCKLVG 153

 Score = 39.7 bits (91), Expect = 0.056,   Method: Compositional matrix adjust.
 Identities = 49/223 (21%), Positives = 100/223 (44%), Gaps = 31/223 (13%)

Query: 464 VQSLQLLSFISFYFLNVGDIPRLYQLRGTVISMAQQLRLHRCPSAVLLSASGSTMQKFEQ 523
           + ++Q +  ++ +     ++   Y   G  +  A    LHR  S +     G T    E 
Sbjct: 290 IYAMQTMFMLTMFLQCSANLKTCYSYIGIALRAAISEGLHRKNSLI-----GPT--PIED 342

Query: 524 GERRLLFWAIYYLDVFYSLQLGVPRLIKDHEIECALPVSEEED--------SQLEGRVSD 575
             ++ LFW++Y +D++ +  LG+PR + +  I   LP   +++        +Q  G++S 
Sbjct: 343 ETKKRLFWSVYKVDLYMNCILGLPRTLSESAINQELPRDVDDEKITTKGILAQDWGKISS 402

Query: 576 FSL--AVIRYAKVLGNILDSIFKRNMMSEAATESMAFVHEKALDIWKNRLPEKYGFRLEA 633
             +     +   V+  I +S++      +A   ++  + +K L+ W   LP     +L+ 
Sbjct: 403 CGMNNQHTKLMLVMARIHESLYPVLKWDQATYVNIINLQDK-LNEWFIELP----MQLKP 457

Query: 634 NGLFNFDELTVVKNSEKDLIEKSSILLF--YFLAKCMIHLPVI 674
           +  F F+E       E++   K + LL+  Y LAK +++ P I
Sbjct: 458 DYQF-FNE------EERNYYLKPNKLLYLDYLLAKIILYKPFI 493

>Smik_10.25 Chr10 complement(45977..48295) [2319 bp, 772 aa] {ON}
           YJL206C (REAL)
          Length = 772

 Score = 42.4 bits (98), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 59/265 (22%), Positives = 109/265 (41%), Gaps = 27/265 (10%)

Query: 304 FFYEVLKFDILGETETENGSNRNESPDSTIPNSRSDDLLSWMEIQ-RLVDVYFECWSNTI 362
           FF + +K  +L      N   R   P     + ++   L   EI  + +   ++C     
Sbjct: 154 FFLDTIKTYLLQGQLNVNHVIRQSLPKDAPWHMKTSVPLPPREIALKFIQKTWDCACVLF 213

Query: 363 PIFSRKLFIKQMKAFKTEVDKFGDRLFEVYKTEQIKINFLKIFATVLAVMCQMALLSRLK 422
             + R   I  + +   E +K G +    Y  EQ+K   L     + +V+   AL S+  
Sbjct: 214 RFYHRPTIISILDSI-YEAEKLGKK----YTPEQVKTQPL-----IYSVLAVGALFSK-- 261

Query: 423 QLEATTQELECKRTQNLIAHYNQLIE-KIHLDSFFQDMSTTTVQSLQLLSFISFYFLNVG 481
             E  +++    R       Y   +E K  LD  F ++  T + S+Q +  ++ +     
Sbjct: 262 --EDLSKDSRATREFYTDEGYRYFLEAKKSLD--FSNI--TDIYSIQAIFMMTIFLQCSA 315

Query: 482 DIPRLYQLRGTVISMAQQLRLHRCPSAVLLSASGSTMQKFEQGERRLLFWAIYYLDVFYS 541
           ++   Y   G  +  A +  LHR  S V     G T    E   ++ LFW++Y LD++ +
Sbjct: 316 NLKACYSFIGIALRAALKDGLHRKSSIV-----GPT--PIEDETKKRLFWSVYKLDLYMN 368

Query: 542 LQLGVPRLIKDHEIECALPVSEEED 566
             LG P  I + +I+   P+  +++
Sbjct: 369 CILGFPSGIDESDIDQEFPLDVDDE 393

 Score = 37.4 bits (85), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 19/43 (44%), Positives = 23/43 (53%), Gaps = 2/43 (4%)

Query: 55 RVAQACDRCRLKKTKCDGKIPQCSQCALVGFECKISDRLNRKS 97
          R  +AC  CR +K +C G+ P C  C    FECK  DR  R S
Sbjct: 53 RAHRACVACRKRKVRCSGQTP-CRLCQNNSFECKY-DRPPRNS 93

>KLLA0C18953g Chr3 (1682246..1684357) [2112 bp, 703 aa] {ON} some
           similarities with uniprot|P25502 Saccharomyces
           cerevisiae YKL015W PUT3 Positive regulator of PUT
           (proline utilization) genes zinc-finger transcription
           factor of the Zn(2)-Cys(6) binuclear cluster domain type
          Length = 703

 Score = 42.4 bits (98), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 47/203 (23%), Positives = 84/203 (41%), Gaps = 35/203 (17%)

Query: 435 RTQNLIAHYNQLIEKIHLDSFFQDMSTTTVQSL-QLLSFISFYFLNVGDIPRLYQLRGTV 493
           RT N  A++ + ++   L + F+        SL Q   +++++ L+V      Y + G  
Sbjct: 279 RTTNGFAYFEKSLQI--LGTLFKHFDQCIGPSLIQAFLYVAYFGLSVDKSAFAYVMVGNA 336

Query: 494 ISMAQQLRLHRCPSAVLLSASGSTMQKFEQGERRLLFWAIYYLDVFYSLQLGVPRLIKDH 553
           I +A  L +H+  +                 +   +FW  +  D   +++ G P LI  +
Sbjct: 337 IRIAFTLGIHKTSAT---------------PKNNRIFWLCFLYDRLLAIRFGFPLLI--N 379

Query: 554 EIECALPVSEEEDSQ-LEGRVSDFSL-AVIRYAKVLGNILDSIFKRNMMSEAATESMAFV 611
           EIE  +P     D+  L   +  +   A +  AK+  NI+  I+ +N        S +FV
Sbjct: 380 EIEIEIPSCSSFDTDFLSISLEKYHFEAQVSLAKITTNIIKRIYTKN--------SSSFV 431

Query: 612 HE-----KALDIWKNRLPEKYGF 629
           H      K L  W + LP +  F
Sbjct: 432 HNCHAVLKELKDWFDGLPSELKF 454

 Score = 34.7 bits (78), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 14/41 (34%), Positives = 23/41 (56%), Gaps = 3/41 (7%)

Query: 58 QACDRCRLKKTKCDGKIPQCSQCALVGFE--CKISDRLNRK 96
          +AC+ C+ +K +C G +P C  C  +G    C+   RL +K
Sbjct: 16 RACETCKRRKKRCSGGLP-CEYCVKIGNPQGCEYKTRLTKK 55

>AFL160C Chr6 complement(130842..132788) [1947 bp, 648 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPL248C
           (GAL4)
          Length = 648

 Score = 42.0 bits (97), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 24/47 (51%)

Query: 56  VAQACDRCRLKKTKCDGKIPQCSQCALVGFECKISDRLNRKSFPRGY 102
           V QACD CR +K KC    P+C++C      C  S ++ R    R +
Sbjct: 5   VIQACDSCRRRKMKCSKTFPKCAKCREDNRVCLYSPKIRRSPLTRAH 51

>CAGL0F02519g Chr6 (245120..247618) [2499 bp, 832 aa] {ON} weakly
           similar to uniprot|P39529 Saccharomyces cerevisiae
           YJL206c
          Length = 832

 Score = 42.0 bits (97), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 45/227 (19%), Positives = 94/227 (41%), Gaps = 27/227 (11%)

Query: 349 RLVDVYFECWSNTIPIFSRKLFIKQMKAFKTEVDKFGDRLFEVYKTEQIKINFLKIFATV 408
           +L+   ++C       + R   +K +++   +     D   + Y  EQ+K+  L +  +V
Sbjct: 231 KLIMKTWDCVCILFRFYHRPTIVKLLESLYED----NDSQNKTYNNEQLKV--LPLIYSV 284

Query: 409 LAVMCQMALLSR--LKQLEATTQELECKRTQNLIAHYNQLIEKIHLDSFFQDMSTTTVQS 466
           LAV    AL  +  +   + +T+E      Q       +LI+  + D  +         S
Sbjct: 285 LAVG---ALFCKDDVNGKDVSTREFYEDEGQKFFLEAKRLIDIANADDIY---------S 332

Query: 467 LQLLSFISFYFLNVGDIPRLYQLRGTVISMAQQLRLHRCPSAVLLSASGSTMQKFEQGER 526
           +Q +  ++ +      I   Y   G  +    +   HR  S +     G T    E   R
Sbjct: 333 IQTIFMMTLFLQCTAKIKICYSYVGIAMRALVKNGFHRTTSLI-----GPTPIIDET--R 385

Query: 527 RLLFWAIYYLDVFYSLQLGVPRLIKDHEIECALPVSEEEDSQLEGRV 573
           + LFW+++ +D++ +  +G+P  + D ++   LP   E+++  E  +
Sbjct: 386 KRLFWSVFKVDMYLNCIMGIPFGLSDSDVNQDLPADVEDENIREDGI 432

 Score = 37.4 bits (85), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 14/33 (42%), Positives = 20/33 (60%), Gaps = 1/33 (3%)

Query: 55 RVAQACDRCRLKKTKCDGKIPQCSQCALVGFEC 87
          R+++ACD C+ +KTKC G  P C  C     +C
Sbjct: 31 RLSRACDLCKKRKTKCQGGNP-CQSCRKANIQC 62

>KAFR0F03410 Chr6 complement(677156..680143) [2988 bp, 995 aa]
          {ON} Anc_4.113 YGL013C
          Length = 995

 Score = 42.0 bits (97), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 18/37 (48%), Positives = 22/37 (59%), Gaps = 1/37 (2%)

Query: 55 RVAQACDRCRLKKTKCDGKIPQCSQCALVGFECKISD 91
          +V QACD CR +K KC GK P CS C     +C  S+
Sbjct: 18 KVRQACDNCRKRKLKCTGKQP-CSTCEAYSCDCIYSE 53

 Score = 34.7 bits (78), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 14/48 (29%), Positives = 27/48 (56%)

Query: 525 ERRLLFWAIYYLDVFYSLQLGVPRLIKDHEIECALPVSEEEDSQLEGR 572
           +RR L+W +YY +   + + G+P  I ++ + C LP +  +   L+ R
Sbjct: 502 KRRTLWWKLYYYEKVIASKRGIPSRINENVMNCLLPKNFRDAGFLDNR 549

>TPHA0H01240 Chr8 (274496..277129) [2634 bp, 877 aa] {ON} Anc_5.59
           YHR178W
          Length = 877

 Score = 42.0 bits (97), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 16/39 (41%), Positives = 23/39 (58%)

Query: 59  ACDRCRLKKTKCDGKIPQCSQCALVGFECKISDRLNRKS 97
           +C RCR  K KC  ++P+CS C    + C+   RL R+S
Sbjct: 97  SCSRCRRLKKKCLRQMPKCSNCVASHYACEYIGRLPRRS 135

>KLTH0B00352g Chr2 complement(31952..34756) [2805 bp, 934 aa] {ON}
          weakly similar to uniprot|P25611 Saccharomyces
          cerevisiae YCR106W RDS1 Regulator of drug sensitivity
          transcriptional regulator
          Length = 934

 Score = 42.0 bits (97), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 15/33 (45%), Positives = 19/33 (57%)

Query: 55 RVAQACDRCRLKKTKCDGKIPQCSQCALVGFEC 87
          R +  C  CR +K KCD K P+CS+C   G  C
Sbjct: 14 RPSFVCQECRRRKIKCDKKRPRCSRCVDTGLPC 46

>Ecym_5017 Chr5 (36647..39583) [2937 bp, 978 aa] {ON} similar to
           Ashbya gossypii ADR403C
          Length = 978

 Score = 42.0 bits (97), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 19/46 (41%), Positives = 29/46 (63%), Gaps = 2/46 (4%)

Query: 55  RVAQACDRCRLKKTKCDGKIPQCSQCALVGFECKISDRLNRKSFPR 100
           R++  C  CR  KTKCD + P+CS+CA    +C + D + ++S PR
Sbjct: 27  RISFVCQACRKSKTKCDREKPRCSRCAKNNIKC-VYD-IEKQSAPR 70

>KAFR0I00230 Chr9 (48095..51232) [3138 bp, 1045 aa] {ON} Anc_7.17
          YOR363C
          Length = 1045

 Score = 42.0 bits (97), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 15/33 (45%), Positives = 20/33 (60%)

Query: 55 RVAQACDRCRLKKTKCDGKIPQCSQCALVGFEC 87
          R++  C  CR  KTKCD + P+CS+CA     C
Sbjct: 24 RISLVCQACRKSKTKCDREKPRCSRCAKNNLRC 56

>KLTH0D07260g Chr4 complement(635598..638537) [2940 bp, 979 aa] {ON}
           some similarities with uniprot|P32862 Saccharomyces
           cerevisiae YKL038W RGT1 Glucose-responsive transcription
           factor that regulates expression of several glucose
           transporter (HXT) genes in response to glucose binds to
           promoters and acts both as a transcriptional activator
           and repressor
          Length = 979

 Score = 42.0 bits (97), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 31/51 (60%), Gaps = 4/51 (7%)

Query: 55  RVAQACDRCRLKKTKCD--GKIPQCSQCALVGFECKISDRLNRKSFP-RGY 102
           + ++ACD+CR KKT+CD   + P CS C  +G  C   +R+  K  P +GY
Sbjct: 30  KTSRACDQCREKKTRCDFSDERPICSACQRMGKTCTF-ERVPMKRGPTKGY 79

>Suva_1.14 Chr1 (25653..28790) [3138 bp, 1045 aa] {ON} YAL051W
          (REAL)
          Length = 1045

 Score = 42.0 bits (97), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 14/33 (42%), Positives = 20/33 (60%)

Query: 55 RVAQACDRCRLKKTKCDGKIPQCSQCALVGFEC 87
          R++  C  CR  KTKCD + P+C +C   G +C
Sbjct: 61 RISFVCQACRKSKTKCDREKPECGRCTKHGLKC 93

>NDAI0G04140 Chr7 (994071..997076) [3006 bp, 1001 aa] {ON} Anc_3.109
           YBR150C
          Length = 1001

 Score = 42.0 bits (97), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 18/45 (40%), Positives = 26/45 (57%), Gaps = 3/45 (6%)

Query: 55  RVAQACDRCRLKKTKCDG---KIPQCSQCALVGFECKISDRLNRK 96
           R ++ACD CR +K KCD    ++ +CS C     EC  S++  RK
Sbjct: 98  RASKACDLCRRRKIKCDAFDDRLKKCSNCIKYHSECTFSNQNKRK 142

>YJL206C Chr10 complement(47659..49935) [2277 bp, 758 aa] {ON}
           Putative protein of unknown function; similar to
           transcriptional regulators from the Zn[2]-Cys[6]
           binuclear cluster protein family; mRNA is weakly cell
           cycle regulated, peaking in S phase; induced rapidly
           upon MMS treatment
          Length = 758

 Score = 41.6 bits (96), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 43/176 (24%), Positives = 79/176 (44%), Gaps = 20/176 (11%)

Query: 462 TTVQSLQLLSFISFYFLNVGDIPRLYQLRGTVISMAQQLRLHRCPSAVLLSASGSTMQKF 521
           T + S+Q +  ++ +     ++   Y   G  +  A +  LHR  S V     G T  + 
Sbjct: 284 TDIYSIQAIFMMTIFLQCSANLKACYSFIGIALRAALKEGLHRRSSIV-----GPTPIQD 338

Query: 522 EQGERRLLFWAIYYLDVFYSLQLGVPRLIKDHEIECALP--VSEEEDSQLEGRVSDF--- 576
           E  +R  LFW++Y LD++ +  LG P  I + +I+   P  V +E  S +  +  D+   
Sbjct: 339 ETKKR--LFWSVYKLDLYMNCILGFPSGIDESDIDQEFPLDVDDENISTIGIKFQDWRTI 396

Query: 577 -SLAVIRYAKVLGNILDSIFK------RNMMSEAATESMAFVHEKALDIWKNRLPE 625
            S  +      L  I+  I+K      R  + E +   +  ++++ LD W  +LP+
Sbjct: 397 SSCGMNNKHTKLILIMSRIYKLMYSLRRKPLEEDSRTQIVSLNDQ-LDNWYAQLPD 451

 Score = 38.5 bits (88), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 19/43 (44%), Positives = 23/43 (53%), Gaps = 2/43 (4%)

Query: 55 RVAQACDRCRLKKTKCDGKIPQCSQCALVGFECKISDRLNRKS 97
          R  +AC  CR +K +C G IP C  C    +ECK  DR  R S
Sbjct: 42 RAHRACIACRKRKVRCSGNIP-CRLCQTNSYECKY-DRPPRNS 82

>Skud_10.10 Chr10 complement(21672..24173) [2502 bp, 833 aa] {ON}
           YJL206C (REAL)
          Length = 833

 Score = 41.6 bits (96), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 27/105 (25%), Positives = 51/105 (48%), Gaps = 7/105 (6%)

Query: 462 TTVQSLQLLSFISFYFLNVGDIPRLYQLRGTVISMAQQLRLHRCPSAVLLSASGSTMQKF 521
           T + S+Q +  ++ +     ++   Y   G  +  A +  LHR  S V     G T  + 
Sbjct: 272 TEIYSIQAIFMMTIFLQCSANLKACYSFIGIALRAALKEGLHRKSSIV-----GPTPIQD 326

Query: 522 EQGERRLLFWAIYYLDVFYSLQLGVPRLIKDHEIECALPVSEEED 566
           E  +R  LFW++Y LD++ +  LG P  I + +I+   P+  +++
Sbjct: 327 ETKKR--LFWSVYKLDLYMNCILGFPSGIDESDIDQEFPLDVDDE 369

 Score = 37.4 bits (85), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 19/43 (44%), Positives = 23/43 (53%), Gaps = 2/43 (4%)

Query: 55 RVAQACDRCRLKKTKCDGKIPQCSQCALVGFECKISDRLNRKS 97
          R  +AC  CR +K +C G+ P C  C    FECK  DR  R S
Sbjct: 29 RAHRACVACRKRKVRCSGQTP-CRLCQNNSFECKY-DRPPRNS 69

>Klac_YGOB_3960 Chr3 (291786..293297,293300..294220) [2433 bp, 810
          aa] {ON} ANNOTATED BY YGOB - Artificial frameshift
          joining KLLA0C03223g and KLLA0C03234g
          Length = 810

 Score = 41.6 bits (96), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 16/37 (43%), Positives = 19/37 (51%)

Query: 57 AQACDRCRLKKTKCDGKIPQCSQCALVGFECKISDRL 93
          AQ CDRCR  K KC G  P C  C +    C ++  L
Sbjct: 49 AQVCDRCRKLKKKCYGTGPSCVNCVVTNNPCTVTTTL 85

>Suva_16.25 Chr16 complement(31437..31868) [432 bp, 143 aa] {ON}
           YGR288W (REAL)
          Length = 143

 Score = 39.3 bits (90), Expect = 0.015,   Method: Composition-based stats.
 Identities = 20/45 (44%), Positives = 25/45 (55%), Gaps = 2/45 (4%)

Query: 56  VAQACDRCRLKKTKCDGKIPQCSQCALVGFECKISDRLNRKSFPR 100
           V QACD CR+++ KCDGK P C +C      C     L RK  P+
Sbjct: 37  VKQACDCCRVRRVKCDGKGP-CGRCLQRDLNCTYLQPL-RKRGPK 79

>Ecym_8404 Chr8 complement(834988..837645) [2658 bp, 885 aa] {ON}
           similar to Ashbya gossypii ACL058W
          Length = 885

 Score = 41.6 bits (96), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 26/70 (37%), Positives = 37/70 (52%), Gaps = 3/70 (4%)

Query: 492 TVISMAQQLRLHRCPSAVL--LSASGSTMQKFEQGERRLLFWAIYYLDVFYSLQLGVPRL 549
           ++ ++AQ  RL +     L  +S  G T Q   +  RR+LFW I+YLD   SL   +P L
Sbjct: 316 SITTVAQLFRLAQKIQLTLDPVSYHGMTDQALIRS-RRILFWQIFYLDTITSLHNNLPPL 374

Query: 550 IKDHEIECAL 559
           IK  E +  L
Sbjct: 375 IKPGEFDTVL 384

 Score = 34.3 bits (77), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 14/38 (36%), Positives = 20/38 (52%), Gaps = 2/38 (5%)

Query: 60 CDRCRLKKTKCDGKIPQCSQCALVGFECK--ISDRLNR 95
          C  C  +K KC  + P C  C    FEC   ++DR++R
Sbjct: 38 CMPCHKRKVKCSRERPSCDNCLRNSFECVYFVNDRVSR 75

>Skud_1.10 Chr1 (24510..27632) [3123 bp, 1040 aa] {ON} YAL051W
          (REAL)
          Length = 1040

 Score = 41.6 bits (96), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 14/33 (42%), Positives = 20/33 (60%)

Query: 55 RVAQACDRCRLKKTKCDGKIPQCSQCALVGFEC 87
          R++  C  CR  KTKCD + P+C +C   G +C
Sbjct: 61 RISFVCQACRKSKTKCDREKPECGRCIKHGLKC 93

>TBLA0A01210 Chr1 (276151..280419) [4269 bp, 1422 aa] {ON} Anc_1.380
           YLR256W
          Length = 1422

 Score = 41.6 bits (96), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 14/30 (46%), Positives = 18/30 (60%)

Query: 55  RVAQACDRCRLKKTKCDGKIPQCSQCALVG 84
           R+  +C  CR +K KCD K P C+QC   G
Sbjct: 113 RIPLSCTICRKRKVKCDKKRPHCNQCTKTG 142

>Kwal_34.15751 s34 (40148..42034) [1887 bp, 628 aa] {ON} [contig
          274] FULL
          Length = 628

 Score = 41.2 bits (95), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 13/33 (39%), Positives = 21/33 (63%)

Query: 55 RVAQACDRCRLKKTKCDGKIPQCSQCALVGFEC 87
          R++  CD CR++K KC+ + P CS+C     +C
Sbjct: 10 RISHVCDACRIRKLKCNKQKPSCSRCVKHDLQC 42

>Skud_11.214 Chr11 (389377..389855,389895..392361) [2946 bp, 981 aa]
           {ON} YKL015W (REAL)
          Length = 981

 Score = 41.2 bits (95), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 35/157 (22%), Positives = 61/157 (38%), Gaps = 16/157 (10%)

Query: 476 YFLNVGDIPRL-YQLRGTVISMAQQLRLHRCPSAVLLSASGSTMQKFEQGERRLLFWAIY 534
           +FL V D     Y   G  +     L LH       + +   T+ ++E    R L+W +Y
Sbjct: 468 FFLQVADYTLASYFYFGQGLRTCLILGLH-------VDSQSDTLSRYEIEHHRRLWWTVY 520

Query: 535 YLDVFYSLQLGVPRLIKDHEIECALPVS------EEEDSQLEGRVSDFSLAVIRYAKVLG 588
             +   S + G+P    D+ I  ALP        E +D+    R ++     +   K+  
Sbjct: 521 MFERMLSSKAGLPLSFTDYTISTALPADIDDEKPEHKDNHYVFRRAELISNCVTIVKINA 580

Query: 589 NILDSIFKRNMMSEAATESMAFVHEKALDIWKNRLPE 625
            IL  +++R   +         +  K L  W+N L +
Sbjct: 581 QILSKLYQRQPETNIIITLKVVI--KQLLQWRNNLSD 615

>ZYRO0C00726g Chr3 (53977..57084) [3108 bp, 1035 aa] {ON} similar
          to uniprot|P39720 Saccharomyces cerevisiae YAL051W OAF1
          Oleate-activated transcription factor acts alone and as
          a heterodimer with Pip2p activates genes involved in
          beta-oxidation of fatty acids and peroxisome
          organization and biogenesis
          Length = 1035

 Score = 41.6 bits (96), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 14/33 (42%), Positives = 19/33 (57%)

Query: 55 RVAQACDRCRLKKTKCDGKIPQCSQCALVGFEC 87
          R++  C  CR  KTKCD + P+C +C   G  C
Sbjct: 55 RISFVCKACRRSKTKCDREKPKCGRCVQHGIAC 87

>Skud_2.427 Chr2 (769889..771295) [1407 bp, 468 aa] {ON} YGR288W
          (REAL)
          Length = 468

 Score = 40.8 bits (94), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 17/38 (44%), Positives = 23/38 (60%), Gaps = 1/38 (2%)

Query: 59 ACDRCRLKKTKCDGKIPQCSQCALVGFECKISDRLNRK 96
          ACD CR+++ KCDGK P C +C    FEC     L ++
Sbjct: 7  ACDYCRVRRVKCDGKKP-CRRCLQHNFECTHQQPLKKR 43

>CAGL0M12298g Chr13 complement(1227303..1230287) [2985 bp, 994 aa]
           {ON} similar to uniprot|P39720 Saccharomyces cerevisiae
           YAL051w OAF1 peroxisome proliferating transcription
           factor or uniprot|P52960 Saccharomyces cerevisiae
           YOR363c PIP2
          Length = 994

 Score = 41.2 bits (95), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 17/46 (36%), Positives = 28/46 (60%), Gaps = 2/46 (4%)

Query: 55  RVAQACDRCRLKKTKCDGKIPQCSQCALVGFECKISDRLNRKSFPR 100
           R++  C  CR  KT+CD + P C++C  +  EC + D + ++S PR
Sbjct: 22  RISFVCQACRRSKTRCDKEKPICTRCKKLKLEC-VYD-MAKQSAPR 65

>TBLA0A05860 Chr1 (1449582..1452014) [2433 bp, 810 aa] {ON} 
          Length = 810

 Score = 41.2 bits (95), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 19/46 (41%), Positives = 22/46 (47%)

Query: 55  RVAQACDRCRLKKTKCDGKIPQCSQCALVGFECKISDRLNRKSFPR 100
           R  Q CDRCR  K KC G   QC+ C L    C     L R+  P+
Sbjct: 38  RRDQVCDRCRKLKKKCYGLGRQCNNCQLSNNPCTTMATLKRRRKPK 83

>NCAS0A03580 Chr1 complement(712039..715380) [3342 bp, 1113 aa]
          {ON} 
          Length = 1113

 Score = 41.2 bits (95), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 17/37 (45%), Positives = 21/37 (56%), Gaps = 1/37 (2%)

Query: 55 RVAQACDRCRLKKTKCDGKIPQCSQCALVGFECKISD 91
          +V++AC  CR +K KC G  P CS CA    EC   D
Sbjct: 32 KVSKACANCRRRKIKCTGTYP-CSNCAAYQCECIFDD 67

 Score = 33.1 bits (74), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 14/34 (41%), Positives = 21/34 (61%)

Query: 526 RRLLFWAIYYLDVFYSLQLGVPRLIKDHEIECAL 559
           +RLL+W +Y  + FYSL+ G    I D ++ C L
Sbjct: 592 KRLLWWRLYRCEKFYSLRTGELSSINDEKMNCLL 625

>SAKL0D14520g Chr4 complement(1192788..1195739) [2952 bp, 983 aa]
          {ON} similar to uniprot|P39720 Saccharomyces cerevisiae
          YAL051W OAF1 Oleate-activated transcription factor acts
          alone and as a heterodimer with Pip2p activates genes
          involved in beta-oxidation of fatty acids and
          peroxisome organization and biogenesis
          Length = 983

 Score = 41.2 bits (95), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 15/33 (45%), Positives = 20/33 (60%)

Query: 55 RVAQACDRCRLKKTKCDGKIPQCSQCALVGFEC 87
          R++  C  CR  KTKCD + P C++C   G EC
Sbjct: 23 RISFVCKACRKSKTKCDREKPSCTRCIKNGIEC 55

>TBLA0A00730 Chr1 (156043..159156) [3114 bp, 1037 aa] {ON} Anc_2.654
           YKL015W
          Length = 1037

 Score = 41.2 bits (95), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 34/166 (20%), Positives = 72/166 (43%), Gaps = 21/166 (12%)

Query: 470 LSFISFYFLNVGDIPRL-YQLRGTVISMAQQLRLHRCPSAVLLSASGSTMQKFEQGERRL 528
           ++ +  ++L V D     Y   G  +     L +H       + A   T+ + E   RR 
Sbjct: 589 VTLLYAFYLQVADCTATSYFFLGEALRACLLLGMH-------VDAQSDTLSRCEVEHRRR 641

Query: 529 LFWAIYYLDVFYSLQLGVPRLIKDHEIECALP--VSEEEDSQLEGRVSDFSLAV-----I 581
           L+W +Y  +   S + G+P    D+ I   LP  ++  +D+ +  +   +  A      +
Sbjct: 642 LWWTVYMFERMLSSKAGLPLSFTDNTISTELPSNINCAQDNDILAKYYYYVEAAYIGESV 701

Query: 582 RYAKVLGNILDSIFKRNMMSEAATESMAFVHE--KALDIWKNRLPE 625
           +  ++ G IL  +++R    + ++  +  + +  K L  WK+ +PE
Sbjct: 702 KIVQINGQILSKLYQR----QPSSNILPILKDILKQLLNWKSNVPE 743

 Score = 36.2 bits (82), Expect = 0.70,   Method: Compositional matrix adjust.
 Identities = 14/37 (37%), Positives = 20/37 (54%), Gaps = 1/37 (2%)

Query: 55 RVAQACDRCRLKKTKCDGKIPQCSQCALVGFECKISD 91
          ++ +AC RCR +  KC G  P C +C      CK S+
Sbjct: 54 KITRACIRCRERHIKCPGNDP-CQKCLEANHICKFSE 89

>TDEL0H04340 Chr8 complement(746566..749535) [2970 bp, 989 aa]
          {ON} Anc_7.17 YOR363C
          Length = 989

 Score = 41.2 bits (95), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 14/33 (42%), Positives = 20/33 (60%)

Query: 55 RVAQACDRCRLKKTKCDGKIPQCSQCALVGFEC 87
          R++  C  CR  KTKCD + P+C +C   G +C
Sbjct: 40 RISFVCQACRRSKTKCDREKPRCGRCQQHGLQC 72

>SAKL0B04620g Chr2 complement(406622..407710) [1089 bp, 362 aa]
          {ON} conserved hypothetical protein
          Length = 362

 Score = 40.8 bits (94), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 16/26 (61%), Positives = 20/26 (76%), Gaps = 1/26 (3%)

Query: 55 RVAQACDRCRLKKTKCDGKIPQCSQC 80
          RV++ACD CR  KTKCDG+ P C +C
Sbjct: 6  RVSKACDTCRKSKTKCDGERP-CQRC 30

>Kwal_47.17506 s47 (431921..434695) [2775 bp, 924 aa] {ON} YGL013C
           (PDR1) - zinc-finger transcription factor of the
           Zn(2)-Cys(6) binuclear cluster domain type [contig 207]
           FULL
          Length = 924

 Score = 41.2 bits (95), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 33/133 (24%), Positives = 53/133 (39%), Gaps = 24/133 (18%)

Query: 480 VGDIPRLYQLRGTVISMAQQLRLHRCPSAVLLSASGSTMQKFEQGERRLLFWAIYYLDVF 539
           +G+    YQL       AQ L +HR    V        M +    +RR L+W  Y+ D  
Sbjct: 429 IGEYHLFYQLLSLATGYAQNLGIHRWEFYV-------GMDEEMAEKRRCLWWKCYFWDKL 481

Query: 540 YSLQLGVPRLIKDHEIECALP--------VSEEE--------DSQLEGRVSDFSLA-VIR 582
           +S+  G   +I +  + C LP        +  EE        +  LEG   D  L  V+ 
Sbjct: 482 FSIHTGKQAIICEAFVNCLLPKYFQQLGILDAEEFLAKVTTMNENLEGSGKDLILYFVVA 541

Query: 583 YAKVLGNILDSIF 595
            + ++G+  D + 
Sbjct: 542 LSLIVGDFFDGVL 554

 Score = 34.7 bits (78), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 15/36 (41%), Positives = 20/36 (55%), Gaps = 1/36 (2%)

Query: 55 RVAQACDRCRLKKTKCDGKIPQCSQCALVGFECKIS 90
          +V++AC+ CR +K KC G  P C  C     EC  S
Sbjct: 14 KVSRACNNCRRRKIKCTGAQP-CLNCQTYRCECTYS 48

>KLLA0F09559g Chr6 complement(876719..878695) [1977 bp, 658 aa] {ON}
           some similarities with uniprot|P35995 Saccharomyces
           cerevisiae YKL222c
          Length = 658

 Score = 41.2 bits (95), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 17/41 (41%), Positives = 24/41 (58%), Gaps = 1/41 (2%)

Query: 55  RVAQACDRCRLKKTKCDGKIPQCSQCALVGF-ECKISDRLN 94
           +V ++C  CR +K KCD K P C+ C + G  EC  +D  N
Sbjct: 85  KVIKSCTFCRKRKLKCDRKRPMCTGCKMRGLSECVYTDGYN 125

>YAL051W Chr1 (48564..51707) [3144 bp, 1047 aa] {ON}
          OAF1Oleate-activated transcription factor, acts alone
          and as a heterodimer with Pip2p; activates genes
          involved in beta-oxidation of fatty acids and
          peroxisome organization and biogenesis
          Length = 1047

 Score = 41.2 bits (95), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 14/33 (42%), Positives = 19/33 (57%)

Query: 55 RVAQACDRCRLKKTKCDGKIPQCSQCALVGFEC 87
          R+   C  CR  KTKCD + P+C +C   G +C
Sbjct: 61 RILFVCQACRKSKTKCDREKPECGRCVKHGLKC 93

>TBLA0A09760 Chr1 complement(2398683..2403275) [4593 bp, 1530 aa]
          {ON} Anc_6.75 YLR278C
          Length = 1530

 Score = 41.2 bits (95), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 14/43 (32%), Positives = 24/43 (55%)

Query: 57 AQACDRCRLKKTKCDGKIPQCSQCALVGFECKISDRLNRKSFP 99
          +++C  CR +K +CD K+P C+ C   G +C    R +  + P
Sbjct: 38 SKSCLLCRRRKQRCDHKLPSCTACLKAGVKCVQPARYSNNAAP 80

>KNAG0I00560 Chr9 complement(93785..95776) [1992 bp, 663 aa] {ON}
          Anc_1.128 YJL206C
          Length = 663

 Score = 40.8 bits (94), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 17/33 (51%), Positives = 21/33 (63%), Gaps = 1/33 (3%)

Query: 55 RVAQACDRCRLKKTKCDGKIPQCSQCALVGFEC 87
          RV  AC  CR KK KCDG++P CS C    ++C
Sbjct: 30 RVRTACSMCRRKKRKCDGRVP-CSFCTKNHYQC 61

 Score = 34.3 bits (77), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 25/103 (24%), Positives = 50/103 (48%), Gaps = 7/103 (6%)

Query: 464 VQSLQLLSFISFYFLNVGDIPRLYQLRGTVISMAQQLRLHRCPSAVLLSASGSTMQKFEQ 523
           ++++Q +  +S Y     D+   + L G  +  + +   H   S V     G T+ + E 
Sbjct: 266 LRTIQTVFMMSLYLQFCADLSAAHNLIGIALRSSIREGYHLKSSLV-----GPTVIEDEV 320

Query: 524 GERRLLFWAIYYLDVFYSLQLGVPRLIKDHEIECALPVSEEED 566
            +R  LFW+IY ++ + +  LG P  + D  I+  +P+  ++D
Sbjct: 321 KKR--LFWSIYKMNAYLTSLLGFPTTLSDTLIDQEIPLDIDDD 361

>NCAS0I00270 Chr9 complement(33129..35963) [2835 bp, 944 aa] {ON}
          Anc_7.17 YAL051W
          Length = 944

 Score = 41.2 bits (95), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 15/34 (44%), Positives = 20/34 (58%)

Query: 54 YRVAQACDRCRLKKTKCDGKIPQCSQCALVGFEC 87
          YR++  C  CR  K KCD + P CS+C+    EC
Sbjct: 34 YRLSFVCQGCRRSKVKCDQEKPVCSRCSKHDLEC 67

>SAKL0D01100g Chr4 complement(81235..84057) [2823 bp, 940 aa] {ON}
          weakly similar to uniprot|P33200 Saccharomyces
          cerevisiae YBL005W PDR3 Transcriptional activator of
          the pleiotropic drug resistance network regulates
          expression of ATP-binding cassette (ABC) transporters
          through binding to cis-acting sites known as PDREs (PDR
          responsive elements)
          Length = 940

 Score = 40.8 bits (94), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 19/45 (42%), Positives = 24/45 (53%), Gaps = 1/45 (2%)

Query: 55 RVAQACDRCRLKKTKCDGKIPQCSQCALVGFECKISDRLNRKSFP 99
          +V++ACD CR +K KC GK P CS C      C+ S R      P
Sbjct: 23 KVSRACDNCRRRKIKCTGKQP-CSNCQAYQCHCEYSIRRGNGIIP 66

>ACL058W Chr3 (261723..264176) [2454 bp, 817 aa] {ON} NOHBY305; No
           homolog in Saccharomyces cerevisiae
          Length = 817

 Score = 40.8 bits (94), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 31/109 (28%), Positives = 59/109 (54%), Gaps = 8/109 (7%)

Query: 496 MAQQLRLHRCPSAVLLSASGSTMQKFEQGERRLLFWAIYYLDVFYSLQLGVPRLIKDHEI 555
           +AQ+L+L   P  V  S   + +Q      RR++FW I+ LD   SLQ  +P L++ +E 
Sbjct: 279 LAQRLQLTADPEYVPGSREMADVQF-----RRIIFWQIFQLDTLTSLQNRLPPLLRYNEC 333

Query: 556 ECALPVSEEEDSQLEGRVSDFSLAVIRYAKVLGNI--LDSIFKRNMMSE 602
           E +LP   +E  +L   +  F  A  ++  ++ ++  +D+   R+++S+
Sbjct: 334 ETSLPSEFDEGGKLNPNLC-FLNAKYQFVILVNDVCRMDAALSRSVLSD 381

>YKL038W Chr11 (365605..369117) [3513 bp, 1170 aa] {ON}
           RGT1Glucose-responsive transcription factor that
           regulates expression of several glucose transporter
           (HXT) genes in response to glucose; binds to promoters
           and acts both as a transcriptional activator and
           repressor
          Length = 1170

 Score = 40.8 bits (94), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 22/51 (43%), Positives = 29/51 (56%), Gaps = 4/51 (7%)

Query: 55  RVAQACDRCRLKKTKCDGKIPQ--CSQCALVGFECKISDRLNRKSFP-RGY 102
           + ++ACD+CR KK KCD K  +  CS C   G  C   DR+  K  P +GY
Sbjct: 42  KASRACDQCRKKKIKCDYKDEKGVCSNCQRNGDRCSF-DRVPLKRGPSKGY 91

>Suva_6.285 Chr6 (499581..501941) [2361 bp, 786 aa] {ON} YJL206C
           (REAL)
          Length = 786

 Score = 40.8 bits (94), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 30/119 (25%), Positives = 56/119 (47%), Gaps = 9/119 (7%)

Query: 462 TTVQSLQLLSFISFYFLNVGDIPRLYQLRGTVISMAQQLRLHRCPSAVLLSASGSTMQKF 521
           T + S+Q +  ++ +     ++   Y   G  +  A +  LHR  S      +G T  + 
Sbjct: 305 TDIYSIQAIFMMTIFLQCSANLKACYSFIGIALRAALKEGLHRKSSI-----TGPTAIQD 359

Query: 522 EQGERRLLFWAIYYLDVFYSLQLGVPRLIKDHEIECALP--VSEEEDSQLEGRVSDFSL 578
           E  +R  LFW++Y LD++ +  LG P  I + +I+   P  V +E  S +  +  D+ +
Sbjct: 360 ETKKR--LFWSVYKLDLYMNCILGFPSGIDESDIDQEFPLDVDDENISTMGIKFQDWRM 416

>KLLA0F02750g Chr6 complement(250368..253814) [3447 bp, 1148 aa]
          {ON} some similarities with uniprot|Q12180
          Saccharomyces cerevisiae YOL089C HAL9 Putative
          transcription factor containing a zinc finger
          overexpression increases salt tolerance through
          increased expression of the ENA1 (Na /Li extrusion
          pump) gene while gene disruption decreases both salt
          tolerance and ENA1 expression
          Length = 1148

 Score = 40.8 bits (94), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 17/36 (47%), Positives = 21/36 (58%), Gaps = 3/36 (8%)

Query: 55 RVAQACDRCRLKKTKCDGKIP---QCSQCALVGFEC 87
          RV++ACDRCR +K KCD   P   +CS C      C
Sbjct: 29 RVSKACDRCRRRKIKCDDLDPVSGKCSNCIKYKVPC 64

>NDAI0D03550 Chr4 complement(843265..846621) [3357 bp, 1118 aa]
          {ON} Anc_4.113
          Length = 1118

 Score = 40.8 bits (94), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 18/42 (42%), Positives = 23/42 (54%), Gaps = 1/42 (2%)

Query: 55 RVAQACDRCRLKKTKCDGKIPQCSQCALVGFECKISDRLNRK 96
          +V +ACD CR +K KC GK P C+ C      C  S +  RK
Sbjct: 58 KVTKACDNCRRRKIKCTGKTP-CATCEAYQCLCIYSTQRGRK 98

>SAKL0B06732g Chr2 complement(578508..581144) [2637 bp, 878 aa]
          {ON} some similarities with uniprot|Q12180
          Saccharomyces cerevisiae YOL089C HAL9 Putative
          transcription factor containing a zinc finger
          overexpression increases salt tolerance through
          increased expression of the ENA1 (Na /Li extrusion
          pump) gene while gene disruption decreases both salt
          tolerance and ENA1 expression
          Length = 878

 Score = 40.8 bits (94), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 17/42 (40%), Positives = 25/42 (59%), Gaps = 1/42 (2%)

Query: 55 RVAQACDRCRLKKTKCDGKIPQCSQCALVGFECKISDRLNRK 96
          RV++ACD CR KK KC+G+   CS C   G  C  +  + ++
Sbjct: 11 RVSKACDSCRSKKIKCNGE-QTCSNCLKYGCPCTYTHTIKKR 51

 Score = 35.4 bits (80), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 30/120 (25%), Positives = 55/120 (45%), Gaps = 22/120 (18%)

Query: 444 NQLIEKIHLDSFFQDMSTTTV----QSLQLLSFISFYFLNVGDIPR-LYQLRGTVISMAQ 498
           N L++ ++   F+Q +    V    + +Q + F+  Y +    +P+ +Y +  T I +AQ
Sbjct: 339 NMLLKTVY---FYQQIFIKPVDDPIKCIQAVFFLCVY-MEASPVPQSIYMILATAIRLAQ 394

Query: 499 QLRLHRCPSAVLLSASGSTMQKFEQGE-RRLL--FWAIYYLDVFYSLQLGVPRLIKDHEI 555
            + LHR             +   E  E RR L  +W  Y  D + +L+ G P LI + ++
Sbjct: 395 DIGLHR----------RENLLGLEPKELRRHLTTWWFCYKYDRYITLRAGKPSLIHEKDV 444

>KLLA0C04620g Chr3 complement(422705..426514) [3810 bp, 1269 aa]
          {ON} similar to uniprot|Q74ZB9 Ashbya gossypii AGR280C
          AGR280Cp and some similarites with YLR278C
          uniprot|Q05854 Saccharomyces cerevisiae YLR278C Protein
          of unknown function localizes to the nucleus potential
          Cdc28p substrate
          Length = 1269

 Score = 40.8 bits (94), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 14/31 (45%), Positives = 20/31 (64%)

Query: 57 AQACDRCRLKKTKCDGKIPQCSQCALVGFEC 87
          ++AC  C+ +K KCD KIP C+ C   G +C
Sbjct: 38 SRACLLCQRRKQKCDHKIPSCTACLKAGVKC 68

>CAGL0D02904g Chr4 complement(302952..305615) [2664 bp, 887 aa] {ON}
           similar to uniprot|P07272 Saccharomyces cerevisiae
           YLR014c PPR1 transcription factor regulating pyrimidine
           pathway
          Length = 887

 Score = 40.8 bits (94), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 17/48 (35%), Positives = 20/48 (41%)

Query: 55  RVAQACDRCRLKKTKCDGKIPQCSQCALVGFECKISDRLNRKSFPRGY 102
           +   AC  CR KK KCD   P C  C      C   D +  +  PR Y
Sbjct: 20  KFPNACKLCRRKKVKCDQGYPSCKGCLRNNVPCVSVDPVTGQDIPRSY 67

 Score = 40.0 bits (92), Expect = 0.046,   Method: Compositional matrix adjust.
 Identities = 29/120 (24%), Positives = 50/120 (41%), Gaps = 9/120 (7%)

Query: 460 STTTVQSLQLLSFISFYFLNVGDIPRLYQLRGTVISMAQQLRLHRCPSAVLLSASGSTMQ 519
           ST  +++L     ++ Y +   ++P ++   G+V+ +   L LH             T  
Sbjct: 407 STDRLEALMGTLLLAIYSIMRPNVPGVWYTMGSVLRLTVDLGLHS-------EKINMTYD 459

Query: 520 KFEQGERRLLFWAIYYLDVFYSLQLGVPRLIKDHEIECALP--VSEEEDSQLEGRVSDFS 577
            F +  RR LFW +Y LD       G P  I +  I    P  + + E +   G + D+S
Sbjct: 460 PFTREIRRRLFWCVYSLDRQVCSYFGRPFGIPEDTITTGYPSLLPDSEITPAYGTIEDYS 519

>TPHA0A06090 Chr1 complement(1372559..1375102) [2544 bp, 847 aa]
          {ON} 
          Length = 847

 Score = 40.4 bits (93), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 15/33 (45%), Positives = 17/33 (51%)

Query: 55 RVAQACDRCRLKKTKCDGKIPQCSQCALVGFEC 87
          R+   C  CR KK KCD K P C +C   G  C
Sbjct: 9  RLNNGCWTCRTKKVKCDSKKPFCDKCKDSGLHC 41

>NDAI0F00110 Chr6 (10745..12271) [1527 bp, 508 aa] {ON} 
          Length = 508

 Score = 40.4 bits (93), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 14/33 (42%), Positives = 19/33 (57%)

Query: 55 RVAQACDRCRLKKTKCDGKIPQCSQCALVGFEC 87
          R    C  CR +K KCD + P+C +C  +G EC
Sbjct: 15 RSYSGCWTCRARKVKCDTQRPKCCRCKQLGIEC 47

>ZYRO0G00308g Chr7 (20674..22623) [1950 bp, 649 aa] {ON} similar to
           gnl|GLV|KLLA0C18953g Kluyveromyces lactis KLLA0C18953g
           and some similarites with YKL015W uniprot|P25502
           Saccharomyces cerevisiae YKL015W PUT3 Positive regulator
           of PUT (proline utilization) genes zinc- finger
           transcription factor of the Zn(2)-Cys(6) binuclear
           cluster domain type
          Length = 649

 Score = 40.4 bits (93), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 41/165 (24%), Positives = 68/165 (41%), Gaps = 23/165 (13%)

Query: 461 TTTVQSLQLLSFISFYFLNVGDIPRLYQLRGTVISMAQQLRLHRCPSAVLLSASGSTMQK 520
           T+ VQS     + ++Y L++      Y   G+ I M   L LH+              + 
Sbjct: 266 TSLVQSFL---YAAYYALSLDKSDFAYLTIGSAIRMTFTLGLHK--------------KT 308

Query: 521 FEQGERRLLFWAIYYLDVFYSLQLGVPRLIKDHEIECALPVSEEEDSQLEGRVSDFSL-A 579
               E R+ FW  +  D   S++ G+P +I + +I+  L ++E E    +G        +
Sbjct: 309 LTFTENRV-FWLCFVYDRLVSVRFGLPLMINEMDIDVPL-LTESERPNQQGLFEAHHFNS 366

Query: 580 VIRYAKVLGNILDSIFKRNMMSEAATESMAFVHEKALDIWKNRLP 624
            +R AK+   I+  I+ RN  S      M     K L  W + LP
Sbjct: 367 QVRLAKITTQIVRKIYTRNSFSFVQNCYMVL---KELKHWLDTLP 408

>TDEL0D05150 Chr4 (932888..935878) [2991 bp, 996 aa] {ON} Anc_3.109
           YOL089C
          Length = 996

 Score = 40.4 bits (93), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 19/41 (46%), Positives = 21/41 (51%), Gaps = 3/41 (7%)

Query: 55  RVAQACDRCRLKKTKCDGKIPQ---CSQCALVGFECKISDR 92
           RVA+ACD CR +K KCD   PQ   CS C      C    R
Sbjct: 113 RVARACDHCRRRKIKCDPVNPQTNKCSNCTKYDANCTFRVR 153

>Smik_17.27 Chr17 complement(29476..31542) [2067 bp, 688 aa] {ON}
          YKL222C (REAL)
          Length = 688

 Score = 40.4 bits (93), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 16/33 (48%), Positives = 19/33 (57%)

Query: 55 RVAQACDRCRLKKTKCDGKIPQCSQCALVGFEC 87
          +  +AC  CR KK KCD   PQC QC +   EC
Sbjct: 11 KAIKACLNCRRKKQKCDQARPQCYQCRIRKTEC 43

>SAKL0D14542g Chr4 complement(1195951..1198791) [2841 bp, 946 aa]
          {ON} similar to gnl|GLV|KLLA0A03421g Kluyveromyces
          lactis KLLA0A03421g and weakly similar to YAL051W
          uniprot|P39720 Saccharomyces cerevisiae YAL051W OAF1
          Oleate- activated transcription factor acts alone and
          as a heterodimer with Pip2p activates genes involved in
          beta- oxidation of fatty acids and peroxisome
          organization and biogenesis
          Length = 946

 Score = 40.4 bits (93), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 14/33 (42%), Positives = 21/33 (63%)

Query: 55 RVAQACDRCRLKKTKCDGKIPQCSQCALVGFEC 87
          +++  C  CR  KTKCD + P CS+C  +G +C
Sbjct: 24 KLSFVCQSCRKSKTKCDKQKPSCSRCLRLGHQC 56

>ZYRO0E00572g Chr5 (35940..38456) [2517 bp, 838 aa] {ON} similar to
           uniprot|P25502 Saccharomyces cerevisiae YKL015W PUT3
           Positive regulator of PUT (proline utilization) genes
           zinc-finger transcription factor of the Zn(2)-Cys(6)
           binuclear cluster domain type
          Length = 838

 Score = 40.4 bits (93), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 41/174 (23%), Positives = 73/174 (41%), Gaps = 21/174 (12%)

Query: 460 STTTVQSLQLLSFISFYFLNVGDIPRLYQLRGTVISMAQQLRLHRC-PSAVLLSASGSTM 518
           S T    ++++   +FY L V D         +     Q LR   C  S + + A    +
Sbjct: 381 SVTKEGGIEVMLLYAFY-LQVADCTV-----ASYFYFGQALR--ACLISGMHVDAQRDNL 432

Query: 519 QKFEQGERRLLFWAIYYLDVFYSLQLGVPRLIKDHEIECALPVSEEEDSQLEG------R 572
            +FE   RR L+W +Y  +   S + G+P    D+ I   LP   +      G       
Sbjct: 433 TRFELEHRRRLWWTVYMFERMLSSKAGLPLSFTDNTISTELPGDFDMSKPPPGCEHYIFP 492

Query: 573 VSDFSLAVIRYAKVLGNILDSIFKR--NMMSEAATESMAFVHEKALDIWKNRLP 624
            +++ +  ++  ++   IL+ +++R  N    AA +S+     K L  W+N LP
Sbjct: 493 EAEYIINCVKIVRINAQILNKLYQRQPNTNILAALKSVV----KQLLQWRNNLP 542

 Score = 35.0 bits (79), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 15/34 (44%), Positives = 18/34 (52%), Gaps = 1/34 (2%)

Query: 55 RVAQACDRCRLKKTKCDGKIPQCSQCALVGFECK 88
          R   AC RCR K  KC G  P CS+C+     C+
Sbjct: 37 RSTLACVRCRRKHVKCPGGDP-CSKCSAARIACE 69

>YOR380W Chr15 (1051290..1052930) [1641 bp, 546 aa] {ON}
          RDR1Transcriptional repressor involved in the control
          of multidrug resistance; negatively regulates
          expression of the PDR5 gene; member of the Gal4p family
          of zinc cluster proteins
          Length = 546

 Score = 40.4 bits (93), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 17/37 (45%), Positives = 21/37 (56%), Gaps = 1/37 (2%)

Query: 55 RVAQACDRCRLKKTKCDGKIPQCSQCALVGFECKISD 91
          RV +AC  CR +K KC+GK P C  C   G+ C   D
Sbjct: 15 RVRKACVPCRERKRKCNGKSP-CEMCVAYGYVCHYID 50

>SAKL0H01958g Chr8 complement(193079..195055) [1977 bp, 658 aa]
          {ON} similar to uniprot|P38699 Saccharomyces cerevisiae
          YHR178W STB5 binds Sin3p in two-hybrid assay Zinc
          finger (6-Cys)
          Length = 658

 Score = 40.4 bits (93), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 15/39 (38%), Positives = 21/39 (53%)

Query: 59 ACDRCRLKKTKCDGKIPQCSQCALVGFECKISDRLNRKS 97
          +C RCR  K KC  ++P C  C+  G EC    R  R++
Sbjct: 23 SCSRCRRLKKKCSKELPACRNCSRAGEECTYPGRAARRT 61

 Score = 36.6 bits (83), Expect = 0.47,   Method: Compositional matrix adjust.
 Identities = 52/225 (23%), Positives = 91/225 (40%), Gaps = 33/225 (14%)

Query: 349 RLVDVYFECWSNTIPIFSRKLFIKQMKAFKTEVDKFGDRLFEVYKTEQIKINFLKIFATV 408
           R +  YF+    + P+ ++  F+ ++   + + +    R  E +          K++  V
Sbjct: 223 RFIAAYFKHNHRSYPLINKIEFLNKVSTIR-DFNLMDGRYEEAF--------IFKLY-MV 272

Query: 409 LAVMCQMALLSRLKQLEATTQELECKRTQNLIAHYNQLIEKIHLDSFFQDMSTTTVQSLQ 468
           +A+ C     + L++     QE E      L  H++ L  K     F + M    V++++
Sbjct: 273 MAIGC-----TTLQRAGILNQEEE------LSEHFSYLAMK----KFCKVMHAQNVETIK 317

Query: 469 LLSFISFY-FLNVGDIPRLYQLRGTVISMAQQLRLHRCPSAVLLSASGSTMQKFEQGERR 527
            L  +  Y F     +   + + G ++ +A  L L+R     L     STM   E   R 
Sbjct: 318 CLLLLGIYSFFEPKGVSS-WTISGLMMRLAIGLGLNR----ALTKKKMSTMSVIEVEMRY 372

Query: 528 LLFWAIYYLDVFYSLQLGVPRLIKDHEIECALPVS--EEEDSQLE 570
             FW+ Y  +   S  LG    I D +I   LP S  EEE   +E
Sbjct: 373 RAFWSFYCFERLVSSSLGRISAIDDDDISIPLPRSLYEEEKEDIE 417

>SAKL0B01870g Chr2 (185897..188926) [3030 bp, 1009 aa] {ON} weakly
           similar to uniprot|P39720 Saccharomyces cerevisiae
           YAL051W OAF1 Oleate-activated transcription factor acts
           alone and as a heterodimer with Pip2p activates genes
           involved in beta-oxidation of fatty acids and peroxisome
           organization and biogenesis
          Length = 1009

 Score = 40.4 bits (93), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 15/34 (44%), Positives = 21/34 (61%)

Query: 55  RVAQACDRCRLKKTKCDGKIPQCSQCALVGFECK 88
           +V+ AC+ C +KK KCD   P C+ C   G +CK
Sbjct: 71  KVSPACEACNVKKIKCDRGFPVCNTCLKRGTQCK 104

>ADR403C Chr4 complement(1429115..1432027) [2913 bp, 970 aa] {ON}
          Syntenic homolog of Saccharomyces cerevisiae YAL051W
          (OAF1) and YOR363C (PIP2); Tandem gene triplication in
          this genome
          Length = 970

 Score = 40.4 bits (93), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 15/33 (45%), Positives = 21/33 (63%)

Query: 55 RVAQACDRCRLKKTKCDGKIPQCSQCALVGFEC 87
          R++  C  CR  KTKCD + P+CS+CA    +C
Sbjct: 27 RISFVCQACRKSKTKCDREKPRCSRCAKNNVKC 59

>Ecym_3112 Chr3 (203876..207310) [3435 bp, 1144 aa] {ON} similar to
           Ashbya gossypii AGR280C
          Length = 1144

 Score = 40.4 bits (93), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 28/108 (25%), Positives = 52/108 (48%), Gaps = 13/108 (12%)

Query: 465 QSLQLLSFISFYFLNVGDIPRLYQLRGTVISMAQ-QLRLHRCPSAVLLSASGSTMQKFEQ 523
           Q L++L+ + FY +        Y +   VI++++ +L LH+  S+            F  
Sbjct: 392 QQLEILTLLVFYVIRRDKDSVGYDIIKDVINISKNKLYLHKRTSS----------DNFAS 441

Query: 524 GERRLLFWAIYYLDVFYSLQLGVPRLIKDHEIECALPVSEEEDSQLEG 571
            ++  LFW++Y L+    + +G P  I + EIE  LP+  E   + +G
Sbjct: 442 RKKLRLFWSVYLLERMICVSIGKPYTISESEIE--LPIFSETTVKADG 487

 Score = 38.5 bits (88), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 13/31 (41%), Positives = 19/31 (61%)

Query: 57 AQACDRCRLKKTKCDGKIPQCSQCALVGFEC 87
          +++C  C+ +K KCD KIP C+ C   G  C
Sbjct: 38 SRSCLLCQRRKQKCDHKIPSCTACLKAGVRC 68

>TBLA0E00700 Chr5 complement(138121..141945) [3825 bp, 1274 aa] {ON}
           Anc_7.17 YOR363C
          Length = 1274

 Score = 40.4 bits (93), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 14/33 (42%), Positives = 19/33 (57%)

Query: 55  RVAQACDRCRLKKTKCDGKIPQCSQCALVGFEC 87
           R++  C  CR  KTKC+   P CS+C  +G  C
Sbjct: 69  RISFVCQSCRKSKTKCNKDKPSCSRCKKLGIFC 101

>Suva_8.436 Chr8 (788699..790336) [1638 bp, 545 aa] {ON} YOR380W
          (REAL)
          Length = 545

 Score = 40.0 bits (92), Expect = 0.038,   Method: Compositional matrix adjust.
 Identities = 16/37 (43%), Positives = 22/37 (59%), Gaps = 1/37 (2%)

Query: 55 RVAQACDRCRLKKTKCDGKIPQCSQCALVGFECKISD 91
          RV +AC  CR +K KC+GK P C  C   G+ C  ++
Sbjct: 15 RVRKACVPCRERKRKCNGKSP-CEMCVAYGYVCHYTE 50

>YGR288W Chr7 (1070293..1071714) [1422 bp, 473 aa] {ON}
          MAL13MAL-activator protein, part of complex locus MAL1;
          nonfunctional in genomic reference strain S288C
          Length = 473

 Score = 40.0 bits (92), Expect = 0.038,   Method: Compositional matrix adjust.
 Identities = 16/30 (53%), Positives = 20/30 (66%), Gaps = 1/30 (3%)

Query: 58 QACDRCRLKKTKCDGKIPQCSQCALVGFEC 87
          QACD CR+++ KCDGK P CS C     +C
Sbjct: 11 QACDCCRIRRVKCDGKRP-CSSCLQNSLDC 39

>Kpol_1061.42 s1061 complement(116430..119819) [3390 bp, 1129 aa]
          {ON} complement(116430..119819) [3390 nt, 1130 aa]
          Length = 1129

 Score = 40.0 bits (92), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 19/44 (43%), Positives = 25/44 (56%), Gaps = 3/44 (6%)

Query: 55 RVAQACDRCRLKKTKCDGKIPQCSQCALVGFECKI--SDRLNRK 96
          +V++AC+ CR +K KC G  P CS C     EC    SD +N K
Sbjct: 35 KVSRACEGCRRRKIKCSGNWP-CSSCITYDCECIFTSSDSINSK 77

>NCAS0D02960 Chr4 complement(563406..566924) [3519 bp, 1172 aa]
          {ON} Anc_6.75 YLR278C
          Length = 1172

 Score = 40.0 bits (92), Expect = 0.042,   Method: Compositional matrix adjust.
 Identities = 15/38 (39%), Positives = 20/38 (52%)

Query: 59 ACDRCRLKKTKCDGKIPQCSQCALVGFECKISDRLNRK 96
          AC  CR +K KCD ++P C+ C     +C    R N K
Sbjct: 40 ACLLCRRRKQKCDHQLPSCTACLKAAVKCVQPSRYNEK 77

>TBLA0C06230 Chr3 (1509702..1512089) [2388 bp, 795 aa] {ON}
          Anc_6.60 YLR266C
          Length = 795

 Score = 40.0 bits (92), Expect = 0.046,   Method: Compositional matrix adjust.
 Identities = 14/40 (35%), Positives = 23/40 (57%)

Query: 55 RVAQACDRCRLKKTKCDGKIPQCSQCALVGFECKISDRLN 94
          ++ +AC  CR +K KCD   P+C QC+     C  +++ N
Sbjct: 9  KIIKACVFCRKRKLKCDLTKPKCKQCSSRNLNCIYTNQYN 48

>KAFR0A02130 Chr1 (447063..449186) [2124 bp, 707 aa] {ON}
          Anc_2.565 YMR019W
          Length = 707

 Score = 40.0 bits (92), Expect = 0.046,   Method: Compositional matrix adjust.
 Identities = 17/38 (44%), Positives = 21/38 (55%), Gaps = 1/38 (2%)

Query: 55 RVAQACDRCRLKKTKCDGKIPQCSQCALVGFECKISDR 92
          RV +ACD C+ +K KCDG  P CS C     +C    R
Sbjct: 11 RVQKACDICKRRKVKCDGLSP-CSNCIRHNVDCTYDYR 47

>SAKL0D00264g Chr4 complement(24754..27300) [2547 bp, 848 aa] {ON}
          similar to uniprot|P05085 Saccharomyces cerevisiae
          YML099C ARG81 Zinc-finger transcription factor of the
          Zn(2)-Cys(6) binuclear cluster domain type involved in
          the regulation of arginine-responsive genes acts with
          Arg80p and Arg82p
          Length = 848

 Score = 40.0 bits (92), Expect = 0.046,   Method: Compositional matrix adjust.
 Identities = 18/41 (43%), Positives = 20/41 (48%)

Query: 59 ACDRCRLKKTKCDGKIPQCSQCALVGFECKISDRLNRKSFP 99
           C  CR +K KCD   P C +C   GFEC   D   R S P
Sbjct: 19 GCWTCRSRKVKCDLGRPSCKRCERSGFECGGYDIKLRWSKP 59

>TPHA0B03630 Chr2 (844571..848860) [4290 bp, 1429 aa] {ON}
          Anc_1.380 YLR256W
          Length = 1429

 Score = 40.0 bits (92), Expect = 0.047,   Method: Compositional matrix adjust.
 Identities = 13/32 (40%), Positives = 18/32 (56%)

Query: 55 RVAQACDRCRLKKTKCDGKIPQCSQCALVGFE 86
          R+  +C  CR +K KCD   P C+QC   G +
Sbjct: 40 RIPLSCTICRKRKVKCDKTHPHCNQCVKTGVQ 71

>Suva_15.77 Chr15 complement(123654..126743) [3090 bp, 1029 aa] {ON}
           YOL089C (REAL)
          Length = 1029

 Score = 40.0 bits (92), Expect = 0.047,   Method: Compositional matrix adjust.
 Identities = 17/41 (41%), Positives = 21/41 (51%), Gaps = 3/41 (7%)

Query: 55  RVAQACDRCRLKKTKCDGKIPQ---CSQCALVGFECKISDR 92
           RV++ACD CR +K +CD   PQ   CS C      C    R
Sbjct: 128 RVSKACDHCRKRKIRCDEVDPQTNKCSNCVKFQSACTFKHR 168

 Score = 35.8 bits (81), Expect = 0.96,   Method: Compositional matrix adjust.
 Identities = 33/139 (23%), Positives = 66/139 (47%), Gaps = 19/139 (13%)

Query: 420 RLKQLEATTQELECKRTQNLIAHYNQLIEKIHLDSFFQDMST--TTVQSLQLLSFISFYF 477
           R  + + T+QEL  K+ +N +A  N +        ++  +ST  +  ++LQ L  ++ Y 
Sbjct: 431 RKDRYDPTSQEL--KKIEN-VALLNAMY-------YYHKLSTICSGTRTLQALLLLNRYC 480

Query: 478 LNVGDIPRLYQLRGTVISMAQQLRLHRCPSAVLLSASGSTMQKFEQGERRLLFWAIYYLD 537
               D      + GT I +A  + L+R       ++S  ++   E  +RR ++W  +  D
Sbjct: 481 QVTYDTELANSILGTAIRLAVDMELNR-------NSSYKSLDFEEAIKRRSMWWHCFCTD 533

Query: 538 VFYSLQLGVPRLIKDHEIE 556
             YSL L  P ++ + +++
Sbjct: 534 KLYSLMLSRPPIVGEQDMD 552

>TPHA0N00440 Chr14 complement(82249..84522) [2274 bp, 757 aa] {ON}
          Anc_7.56 YOR337W
          Length = 757

 Score = 40.0 bits (92), Expect = 0.047,   Method: Compositional matrix adjust.
 Identities = 16/39 (41%), Positives = 24/39 (61%), Gaps = 1/39 (2%)

Query: 59 ACDRCRLKKTKCDGKIPQCSQCALVGFECKISDRLNRKS 97
          AC  CR ++ KCD + P C  C+ +G EC I++   RK+
Sbjct: 50 ACSNCRKRRKKCDVEYP-CGGCSRLGLECNINEEDLRKT 87

>CAGL0F09229g Chr6 complement(908186..910693) [2508 bp, 835 aa]
          {ON} weakly similar to uniprot|P39961 Saccharomyces
          cerevisiae YER184c
          Length = 835

 Score = 40.0 bits (92), Expect = 0.048,   Method: Compositional matrix adjust.
 Identities = 17/33 (51%), Positives = 19/33 (57%), Gaps = 1/33 (3%)

Query: 55 RVAQACDRCRLKKTKCDGKIPQCSQCALVGFEC 87
          RV +ACD CR +K KCDG  P CS C      C
Sbjct: 16 RVIRACDVCRKRKVKCDGDQP-CSSCMTASTVC 47

 Score = 37.7 bits (86), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 15/34 (44%), Positives = 21/34 (61%)

Query: 527 RLLFWAIYYLDVFYSLQLGVPRLIKDHEIECALP 560
           RL++W  Y+ D ++SL  G   LI D +I C LP
Sbjct: 382 RLIWWECYWWDKWFSLSAGKSPLIDDAKITCLLP 415

>YLR278C Chr12 complement(699999..704024) [4026 bp, 1341 aa] {ON}
          Zinc-cluster protein; GFP-fusion protein localizes to
          the nucleus; mutant shows moderate growth defect on
          caffeine; has a prion-domain like fragment that
          increases frequency of [URE3]; YLR278C is not an
          essential gene
          Length = 1341

 Score = 40.0 bits (92), Expect = 0.049,   Method: Compositional matrix adjust.
 Identities = 12/31 (38%), Positives = 20/31 (64%)

Query: 57 AQACDRCRLKKTKCDGKIPQCSQCALVGFEC 87
          +++C  CR +K +CD K+P C+ C   G +C
Sbjct: 38 SRSCLLCRRRKQRCDHKLPSCTACLKAGIKC 68

>Skud_12.361 Chr12 complement(641047..645075) [4029 bp, 1342 aa]
          {ON} YLR278C (REAL)
          Length = 1342

 Score = 40.0 bits (92), Expect = 0.050,   Method: Compositional matrix adjust.
 Identities = 12/31 (38%), Positives = 20/31 (64%)

Query: 57 AQACDRCRLKKTKCDGKIPQCSQCALVGFEC 87
          +++C  CR +K +CD K+P C+ C   G +C
Sbjct: 38 SRSCLLCRRRKQRCDHKLPSCTACLKAGIKC 68

>CAGL0J07150g Chr10 complement(688858..691926) [3069 bp, 1022 aa]
          {ON} similar to uniprot|P39720 Saccharomyces cerevisiae
          YAL051w OAF1 peroxisome proliferating transcription
          factor or uniprot|P52960 Saccharomyces cerevisiae
          YOR363c PIP2
          Length = 1022

 Score = 40.0 bits (92), Expect = 0.051,   Method: Compositional matrix adjust.
 Identities = 15/33 (45%), Positives = 19/33 (57%)

Query: 55 RVAQACDRCRLKKTKCDGKIPQCSQCALVGFEC 87
          R++  C  CR  KTKCD + P CS+C   G  C
Sbjct: 18 RLSFVCQGCRKAKTKCDKEKPACSRCLKHGIRC 50

>SAKL0F00418g Chr6 (34751..36430) [1680 bp, 559 aa] {ON} conserved
          hypothetical protein
          Length = 559

 Score = 39.7 bits (91), Expect = 0.052,   Method: Compositional matrix adjust.
 Identities = 20/45 (44%), Positives = 24/45 (53%), Gaps = 7/45 (15%)

Query: 59 ACDRCRLKKTKCDGKIPQCSQCALVGFEC-------KISDRLNRK 96
          +C +CR KK KC  +IP+C  C   G  C       K S RLNRK
Sbjct: 15 SCLQCRTKKIKCGREIPKCHGCEKKGCLCEYPETNRKTSTRLNRK 59

>SAKL0H00682g Chr8 complement(81989..84757) [2769 bp, 922 aa] {ON}
           weakly similar to uniprot|P39720 Saccharomyces
           cerevisiae YAL051W OAF1 Oleate-activated transcription
           factor acts alone and as a heterodimer with Pip2p
           activates genes involved in beta-oxidation of fatty
           acids and peroxisome organization and biogenesis
          Length = 922

 Score = 39.7 bits (91), Expect = 0.052,   Method: Compositional matrix adjust.
 Identities = 19/46 (41%), Positives = 26/46 (56%), Gaps = 2/46 (4%)

Query: 55  RVAQACDRCRLKKTKCDGKIPQCSQCALVGFECKISDRLNRKSFPR 100
           R++  C  CR +K KCD + P C QCA  G  C + D + R+  PR
Sbjct: 20  RLSFVCLECRRRKIKCDKQRPCCIQCAEQGLTC-VYD-IERQPAPR 63

>Smik_12.357 Chr12 complement(638342..642208) [3867 bp, 1288 aa]
          {ON} YLR278C (REAL)
          Length = 1288

 Score = 40.0 bits (92), Expect = 0.052,   Method: Compositional matrix adjust.
 Identities = 12/31 (38%), Positives = 20/31 (64%)

Query: 57 AQACDRCRLKKTKCDGKIPQCSQCALVGFEC 87
          +++C  CR +K +CD K+P C+ C   G +C
Sbjct: 38 SRSCLLCRRRKQRCDHKLPSCTACLKAGIKC 68

>KLLA0F22990g Chr6 (2134385..2138146) [3762 bp, 1253 aa] {ON}
          uniprot|Q6DR96 Kluyveromyces lactis HAP1
          Length = 1253

 Score = 40.0 bits (92), Expect = 0.053,   Method: Compositional matrix adjust.
 Identities = 15/30 (50%), Positives = 17/30 (56%)

Query: 55 RVAQACDRCRLKKTKCDGKIPQCSQCALVG 84
          RV  +C  CR +K KCD   PQC QC   G
Sbjct: 20 RVPLSCTICRKRKVKCDKGRPQCQQCVKTG 49

>KLLA0D10153g Chr4 (858016..859983) [1968 bp, 655 aa] {ON} some
          similarities with uniprot|P35995 Saccharomyces
          cerevisiae YKL222C Hypothetical ORF
          Length = 655

 Score = 39.7 bits (91), Expect = 0.053,   Method: Compositional matrix adjust.
 Identities = 14/30 (46%), Positives = 19/30 (63%)

Query: 58 QACDRCRLKKTKCDGKIPQCSQCALVGFEC 87
          ++C  C+ +K KCD K P CS C   G+EC
Sbjct: 10 RSCLMCQRRKKKCDRKAPSCSACLKKGYEC 39

>Suva_10.376 Chr10 complement(660780..664688) [3909 bp, 1302 aa]
          {ON} YLR278C (REAL)
          Length = 1302

 Score = 39.7 bits (91), Expect = 0.054,   Method: Compositional matrix adjust.
 Identities = 12/31 (38%), Positives = 20/31 (64%)

Query: 57 AQACDRCRLKKTKCDGKIPQCSQCALVGFEC 87
          +++C  CR +K +CD K+P C+ C   G +C
Sbjct: 38 SRSCLLCRRRKQRCDHKLPSCTACLKAGIKC 68

>ZYRO0G22550g Chr7 complement(1856064..1858238) [2175 bp, 724 aa]
          {ON} weakly similar to uniprot|P39961 Saccharomyces
          cerevisiae YER184C Hypothetical ORF
          Length = 724

 Score = 39.7 bits (91), Expect = 0.054,   Method: Compositional matrix adjust.
 Identities = 18/45 (40%), Positives = 24/45 (53%), Gaps = 1/45 (2%)

Query: 55 RVAQACDRCRLKKTKCDGKIPQCSQCALVGFECKISDRLNRKSFP 99
          +V +AC  CR +K +CDG +P CS C  +  EC   D    K  P
Sbjct: 8  KVKRACQICRRRKIRCDGYLP-CSSCVSLKKECNYHDSAGIKKPP 51

 Score = 34.3 bits (77), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 14/45 (31%), Positives = 25/45 (55%)

Query: 516 STMQKFEQGERRLLFWAIYYLDVFYSLQLGVPRLIKDHEIECALP 560
            T+ + +   RR ++W  ++ D +YSL  G P LI ++ + C  P
Sbjct: 338 CTLNEHQAEHRRKIWWKCFWWDRWYSLISGKPFLIDENCVLCLFP 382

>SAKL0F16522g Chr6 (1361716..1363842) [2127 bp, 708 aa] {ON} some
           similarities with uniprot|P25502 Saccharomyces
           cerevisiae YKL015W PUT3 Positive regulator of PUT
           (proline utilization) genes zinc-finger transcription
           factor of the Zn(2)-Cys(6) binuclear cluster domain type
          Length = 708

 Score = 39.7 bits (91), Expect = 0.056,   Method: Compositional matrix adjust.
 Identities = 36/170 (21%), Positives = 68/170 (40%), Gaps = 30/170 (17%)

Query: 461 TTTVQSLQLLSFISFYFLNVGDIPRLYQLRGTVISMAQQLRLHRCPSAVLLSASGSTMQK 520
            T   ++Q   ++++Y L++      Y + G  I M   L  H+               K
Sbjct: 305 VTNESTIQSFLYLAYYSLSLDKRRLAYIMVGNAIRMVFMLGFHK---------------K 349

Query: 521 FEQGERRLLFWAIYYLDVFYSLQLGVPRLIKDHEIECALPVSEEEDSQLEG-RVSDFSLA 579
               ++  +FW  +  D   S++ G P +I + +I   L   +  D QL    +  F+ +
Sbjct: 350 TTTTKQNRIFWMCFIYDRLISVRFGFPLMINEADINVPLFNEKSSDLQLTSLDIYHFN-S 408

Query: 580 VIRYAKVLGNILDSIFKRNMMSEAATESMAFVHE-----KALDIWKNRLP 624
            ++ A++   I+  I+ RN        S AF+       + L  W + LP
Sbjct: 409 QVKLARITTQIIRKIYTRN--------SFAFIQSCHTVLRQLKTWYDDLP 450

>KAFR0C03230 Chr3 complement(655300..656520) [1221 bp, 406 aa] {ON}
           Anc_8.109 YGL162W
          Length = 406

 Score = 39.3 bits (90), Expect = 0.056,   Method: Compositional matrix adjust.
 Identities = 14/20 (70%), Positives = 16/20 (80%)

Query: 55  RVAQACDRCRLKKTKCDGKI 74
           RV  +CD+CRLKK KCD KI
Sbjct: 244 RVGPSCDKCRLKKIKCDAKI 263

>KNAG0E04150 Chr5 complement(823063..826473) [3411 bp, 1136 aa] {ON}
           
          Length = 1136

 Score = 39.7 bits (91), Expect = 0.057,   Method: Compositional matrix adjust.
 Identities = 16/46 (34%), Positives = 25/46 (54%), Gaps = 2/46 (4%)

Query: 55  RVAQACDRCRLKKTKCDGKIPQCSQCALVGFECKISDRLNRKSFPR 100
           R++  C  CR  K KCD + P+C++C   G +C   +   R+  PR
Sbjct: 45  RISFVCQNCRKSKMKCDREKPECTRCLKQGIKCVYDEE--RQPRPR 88

>NDAI0A03420 Chr1 complement(782010..785336) [3327 bp, 1108 aa]
          {ON} 
          Length = 1108

 Score = 39.7 bits (91), Expect = 0.057,   Method: Compositional matrix adjust.
 Identities = 16/33 (48%), Positives = 19/33 (57%), Gaps = 1/33 (3%)

Query: 55 RVAQACDRCRLKKTKCDGKIPQCSQCALVGFEC 87
          +V +AC  CR +K KC G  P CS CA    EC
Sbjct: 12 KVVKACLNCRRRKIKCTGTFP-CSNCAAYQCEC 43

>SAKL0C09944g Chr3 complement(899127..902312) [3186 bp, 1061 aa]
           {ON} weakly similar to uniprot|Q12180 Saccharomyces
           cerevisiae YOL089C HAL9 Putative transcription factor
           containing a zinc finger overexpression increases salt
           tolerance through increased expression of the ENA1 (Na
           /Li extrusion pump) gene while gene disruption decreases
           both salt tolerance and ENA1 expression
          Length = 1061

 Score = 39.7 bits (91), Expect = 0.058,   Method: Compositional matrix adjust.
 Identities = 17/36 (47%), Positives = 21/36 (58%), Gaps = 3/36 (8%)

Query: 55  RVAQACDRCRLKKTKCDGKIP---QCSQCALVGFEC 87
           RV++ACD CR +K KCD   P   +CS C     EC
Sbjct: 134 RVSKACDHCRKRKIKCDDVKPRTGKCSNCTKFNAEC 169

 Score = 37.7 bits (86), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 22/69 (31%), Positives = 33/69 (47%), Gaps = 7/69 (10%)

Query: 487 YQLRGTVISMAQQLRLHRCPSAVLLSASGSTMQKFEQGERRLLFWAIYYLDVFYSLQLGV 546
           Y +  T +  AQ + LH   +   LS         E  +RR+L+W  Y  D F SL+L  
Sbjct: 518 YSIFATAVRFAQDMSLHNLDTYKRLSYK-------ECLKRRILWWHCYTTDKFLSLKLCK 570

Query: 547 PRLIKDHEI 555
           P LI + ++
Sbjct: 571 PSLINERDM 579

>Ecym_4286 Chr4 (613587..615470) [1884 bp, 627 aa] {ON} similar to
           Ashbya gossypii AGR061C
          Length = 627

 Score = 39.3 bits (90), Expect = 0.064,   Method: Compositional matrix adjust.
 Identities = 18/49 (36%), Positives = 26/49 (53%), Gaps = 2/49 (4%)

Query: 55  RVAQACDRCRLKKTKCDGKIPQCSQCALVGFEC-KISDRLNRKSFPRGY 102
           ++  AC  CR ++ KCD ++P C  C   G EC  I   L +K +  GY
Sbjct: 9   KLKLACQSCRKRRRKCDLQMP-CLNCQKFGVECLPIDQDLRKKRYTTGY 56

 Score = 34.3 bits (77), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 52/242 (21%), Positives = 105/242 (43%), Gaps = 37/242 (15%)

Query: 411 VMCQMALLSRLKQLEATTQELECKRTQNLIAHYN----QLIEKI-HLDS--FFQDMSTTT 463
           V    AL SRL Q   ++ +L  K T+    +YN    +++ K+ HL++  +    S+++
Sbjct: 239 VFAIAALGSRLSQ---SSDDLYAKSTE----YYNLSKLKVLNKVFHLEANTYIGSYSSSS 291

Query: 464 -VQSLQLLSFISFYFLNVGDIPRLYQLRGTVISMAQQLRLHRCPSAVLLSASGSTMQKFE 522
            +  +Q L  ++FY +  G+ P  +   G    +A ++ LH  P A   S     +   +
Sbjct: 292 KLAIVQTLLCLAFYDIGNGENPLAWYESGLAFRIAHEIGLHLNPEA-WDSVYADKLSHLD 350

Query: 523 QGERRLLFWAIYYLDVFYSLQLGVPRLIKDHEIECA---LPVSEE--------EDSQLEG 571
              R  ++W  Y  D   ++  G     + H +  +   +P ++E        ED Q E 
Sbjct: 351 IEVRSRIYWGCYIADHLIAVLFG-----RSHTLRLSNSTIPETDELPNIETGIEDYQYEP 405

Query: 572 RVSDFSLAVIRYAKVLGNILDSIFKRNMMSEAATESMAFVHEKALDI----WKNRLPEKY 627
            VS      ++   VL  I + +F   +  +A + +    + +  ++    W+  LPE++
Sbjct: 406 GVSLHMAKPLKKLIVLSRITE-VFASKIFIKAGSMAQRSEYLRKFNLEFYNWRMNLPEEF 464

Query: 628 GF 629
            +
Sbjct: 465 RW 466

>Suva_11.213 Chr11 (392506..392993,393045..395514) [2958 bp, 985 aa]
           {ON} YKL015W (REAL)
          Length = 985

 Score = 39.7 bits (91), Expect = 0.066,   Method: Compositional matrix adjust.
 Identities = 34/157 (21%), Positives = 60/157 (38%), Gaps = 16/157 (10%)

Query: 476 YFLNVGDIPRL-YQLRGTVISMAQQLRLHRCPSAVLLSASGSTMQKFEQGERRLLFWAIY 534
           +FL V D     Y   G  +     L LH       + +   T+ +FE    R L+W +Y
Sbjct: 471 FFLQVADYTLASYFYFGQALRTCLILGLH-------VDSQSDTLSRFEIEHHRRLWWTVY 523

Query: 535 YLDVFYSLQLGVPRLIKDHEIECALPV------SEEEDSQLEGRVSDFSLAVIRYAKVLG 588
             +   S + G+P    D+ I   LP       S  +++    R ++     +   K+  
Sbjct: 524 MFERMLSSKAGLPLSFTDYTISTELPADIDDKSSRSKNNHYVFRKAELISNCVTIVKINA 583

Query: 589 NILDSIFKRNMMSEAATESMAFVHEKALDIWKNRLPE 625
            IL  +++R   +         +  K L  W+N L +
Sbjct: 584 QILSKLYQRQPETNIMITLKVVI--KQLLQWRNNLSD 618

>NDAI0D03540 Chr4 complement(838966..842289) [3324 bp, 1107 aa]
          {ON} 
          Length = 1107

 Score = 39.7 bits (91), Expect = 0.067,   Method: Compositional matrix adjust.
 Identities = 18/42 (42%), Positives = 23/42 (54%), Gaps = 1/42 (2%)

Query: 55 RVAQACDRCRLKKTKCDGKIPQCSQCALVGFECKISDRLNRK 96
          +V++ACD CR +K KC GK+P C  C      C  S    RK
Sbjct: 39 KVSKACDNCRKRKIKCTGKMP-CPTCEAYQCPCIYSAPKPRK 79

>KNAG0M00970 Chr13 (169393..172926) [3534 bp, 1177 aa] {ON}
          Anc_6.75 YLR278C
          Length = 1177

 Score = 39.7 bits (91), Expect = 0.068,   Method: Compositional matrix adjust.
 Identities = 14/38 (36%), Positives = 22/38 (57%)

Query: 57 AQACDRCRLKKTKCDGKIPQCSQCALVGFECKISDRLN 94
          +++C  CR +K +CD K+P C+ C   G +C    R N
Sbjct: 38 SRSCLLCRRRKQRCDHKLPSCTTCLKAGVKCVQPVRYN 75

>NDAI0H01990 Chr8 complement(481983..485468) [3486 bp, 1161 aa]
          {ON} Anc_7.17
          Length = 1161

 Score = 39.3 bits (90), Expect = 0.070,   Method: Compositional matrix adjust.
 Identities = 13/33 (39%), Positives = 19/33 (57%)

Query: 55 RVAQACDRCRLKKTKCDGKIPQCSQCALVGFEC 87
          R++  C  CR  KTKCD + P C++C     +C
Sbjct: 64 RISFVCQECRKAKTKCDKEKPYCTRCVKQNIKC 96

>TPHA0A04540 Chr1 (1031790..1035326) [3537 bp, 1178 aa] {ON}
           Anc_3.109 YOL089C
          Length = 1178

 Score = 39.3 bits (90), Expect = 0.070,   Method: Compositional matrix adjust.
 Identities = 17/37 (45%), Positives = 21/37 (56%), Gaps = 4/37 (10%)

Query: 55  RVAQACDRCRLKKTKCDGK----IPQCSQCALVGFEC 87
           RV++ACD CR +K KCD K      +CS C     EC
Sbjct: 248 RVSRACDHCRKRKIKCDEKRDPNTNKCSNCIKYNSEC 284

>Skud_7.627 Chr7 (1048240..1049664) [1425 bp, 474 aa] {ON} YBR297W
          (REAL)
          Length = 474

 Score = 39.3 bits (90), Expect = 0.070,   Method: Compositional matrix adjust.
 Identities = 16/30 (53%), Positives = 20/30 (66%), Gaps = 1/30 (3%)

Query: 58 QACDRCRLKKTKCDGKIPQCSQCALVGFEC 87
          QACD CR+++ KCDGK P CS C     +C
Sbjct: 11 QACDCCRVRRVKCDGKGP-CSSCLQHNLDC 39

>ZYRO0A13596g Chr1 complement(1080653..1082599) [1947 bp, 648 aa]
          {ON} similar to gnl|GLV|KLLA0D10153g Kluyveromyces
          lactis KLLA0D10153g and weakly similar to
          uniprot|P35995 Saccharomyces cerevisiae YKL222C
          Hypothetical ORF
          Length = 648

 Score = 39.3 bits (90), Expect = 0.071,   Method: Compositional matrix adjust.
 Identities = 12/31 (38%), Positives = 20/31 (64%)

Query: 57 AQACDRCRLKKTKCDGKIPQCSQCALVGFEC 87
          ++ C  C+ KK +CD K+P C+ C+  G+ C
Sbjct: 8  SKTCTNCQRKKVRCDRKVPACTACSERGYNC 38

>KAFR0G02450 Chr7 (508147..511353) [3207 bp, 1068 aa] {ON}
          Anc_6.75 YLR278C
          Length = 1068

 Score = 39.3 bits (90), Expect = 0.071,   Method: Compositional matrix adjust.
 Identities = 12/31 (38%), Positives = 20/31 (64%)

Query: 57 AQACDRCRLKKTKCDGKIPQCSQCALVGFEC 87
          +++C  CR +K +CD K+P C+ C   G +C
Sbjct: 38 SKSCLLCRRRKQRCDHKLPSCTACLKAGVKC 68

>KLLA0A03421g Chr1 (308414..311056) [2643 bp, 880 aa] {ON} weakly
           similar to uniprot|P39720 Saccharomyces cerevisiae
           YAL051W OAF1 Oleate-activated transcription factor acts
           alone and as a heterodimer with Pip2p activates genes
           involved in beta-oxidation of fatty acids and peroxisome
           organization and biogenesis
          Length = 880

 Score = 39.3 bits (90), Expect = 0.074,   Method: Compositional matrix adjust.
 Identities = 19/47 (40%), Positives = 26/47 (55%), Gaps = 2/47 (4%)

Query: 54  YRVAQACDRCRLKKTKCDGKIPQCSQCALVGFECKISDRLNRKSFPR 100
           Y+++  C  CR  KTKCD K P C++C  +   C I D L  +  PR
Sbjct: 15  YKLSFVCQLCRKSKTKCDRKKPSCARCQRLNKPC-IYD-LEYQPLPR 59

>AER183C Chr5 complement(975879..978518) [2640 bp, 879 aa] {ON}
           Non-syntenic homolog of Saccharomyces cerevisiae YOL089C
           (HAL9)
          Length = 879

 Score = 39.3 bits (90), Expect = 0.078,   Method: Compositional matrix adjust.
 Identities = 16/42 (38%), Positives = 24/42 (57%), Gaps = 1/42 (2%)

Query: 55  RVAQACDRCRLKKTKCDGKIPQCSQCALVGFECKISDRLNRK 96
           RV++ACD CR KK +C+G+ P C  C      C  +  + R+
Sbjct: 76  RVSKACDICRAKKIRCNGEEP-CVNCEKFNLGCTYTHVIKRR 116

>Kpol_538.42 s538 complement(89752..93018) [3267 bp, 1088 aa] {ON}
          complement(89752..93018) [3267 nt, 1089 aa]
          Length = 1088

 Score = 39.3 bits (90), Expect = 0.080,   Method: Compositional matrix adjust.
 Identities = 14/42 (33%), Positives = 22/42 (52%)

Query: 55 RVAQACDRCRLKKTKCDGKIPQCSQCALVGFECKISDRLNRK 96
          R++  C +CR  KT+CD + P C++C      C     L +K
Sbjct: 34 RISFVCQQCRKAKTRCDKEQPNCTRCIKNNLNCIYDIELQKK 75

>KLTH0E06666g Chr5 (611348..614188) [2841 bp, 946 aa] {ON} conserved
           hypothetical protein
          Length = 946

 Score = 39.3 bits (90), Expect = 0.082,   Method: Compositional matrix adjust.
 Identities = 56/237 (23%), Positives = 88/237 (37%), Gaps = 38/237 (16%)

Query: 330 DSTIPNSRSDDLLSWMEI-QRLVDVYFECWSNT----IPIFSRKLFIKQMKAFKTEVDKF 384
           DS  P S  + L  ++   QR V++ FE + NT    IP+     F+   + F  EVD+ 
Sbjct: 188 DSPRPLSGENSLPMYLPTRQRAVEL-FEVYRNTVHPIIPLLDFSKFMSDQETFWNEVDQ- 245

Query: 385 GDRLFEVYKTEQIKINFLKIFATVLAVMCQMALLSRLKQLEATTQELECKRTQNLIAHYN 444
                     E    +FL I   VL                + +Q  +C     L     
Sbjct: 246 ---------GESGNTDFLLILFPVLYA-------------ASKSQFHQCNDNDALFQEMA 283

Query: 445 QLIEKIHLDSFFQDMSTTTVQSLQLLSFISFYFLNVGDIPRLYQLRGTVISMAQQLRLHR 504
             +E  ++     D        +   S +    +    +  + QL      +AQ+  L R
Sbjct: 284 SFLEATNVLYGIHDFPNNFTMQMITGSVLINSIIENPSVTTIAQLS----RLAQRAMLSR 339

Query: 505 CPSAVLLSASGSTMQKFEQGERRLLFWAIYYLDVFYSLQLGVPRLIKDHEIECALPV 561
            P++         +Q      RR+LFW I+ LD   SL   +P LIK  + + ALP 
Sbjct: 340 DPASYHQITDLGLIQC-----RRILFWQIFQLDTMTSLYDNLPPLIKVDDFDTALPA 391

 Score = 33.9 bits (76), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 15/47 (31%), Positives = 25/47 (53%), Gaps = 2/47 (4%)

Query: 55 RVAQACDRCRLKKTKCDGKIPQCSQCALVGFECK--ISDRLNRKSFP 99
          R   +C  C  +K KC  + P CS+C    ++C   ++DR++R   P
Sbjct: 30 RKILSCVPCHKRKIKCTREQPSCSKCLKRNWDCSYFLNDRVSRGGQP 76

>TBLA0B07920 Chr2 complement(1877300..1879603) [2304 bp, 767 aa]
          {ON} Anc_5.59 YHR178W
          Length = 767

 Score = 38.9 bits (89), Expect = 0.087,   Method: Compositional matrix adjust.
 Identities = 16/39 (41%), Positives = 20/39 (51%)

Query: 59 ACDRCRLKKTKCDGKIPQCSQCALVGFECKISDRLNRKS 97
          +C RCR  K KC    P CS CA V   C+   R  R++
Sbjct: 8  SCTRCRRLKKKCSKDAPTCSSCAKVNESCEYPGRAPRRT 46

 Score = 37.0 bits (84), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 60/250 (24%), Positives = 97/250 (38%), Gaps = 49/250 (19%)

Query: 349 RLVDVYFECWSNTIPIFSRKLFIKQMKAFKTEVDKFGDRLFEVYKTEQIKINFLKIFATV 408
           + +  YF+    T P+  ++ F+  +    + V  F D + E   T   K+N       +
Sbjct: 323 KFIAAYFQHNHRTFPMIDKRAFLGTV----STVRDFND-MSEFDDTFAFKLNM------I 371

Query: 409 LAVMCQMALLSRLKQLEATTQELECKRTQNLIAHYNQLIEKIHLDSFFQDMSTTTVQSLQ 468
           +A+ C    L R   L         K+  +   H+   +         +  +  T++ L 
Sbjct: 372 MAIGC--TTLHRAGLL---------KKEHDFREHF-AFVAMSKFSKVLRLQNMETIKCLL 419

Query: 469 LLSFISFYFLNVGDIPR---LYQLRGTVISMAQQLRLHRCPSAVLLSASGSTMQKFEQGE 525
           LL   SF+       PR    + + G  + +   L L+R   A+ LS     MQK    E
Sbjct: 420 LLGIYSFFE------PRGVSSWTISGLTMRLTISLGLNR---ALPLSK----MQKVSAIE 466

Query: 526 ---RRLLFWAIYYLDVFYSLQLGVPRLIKDHEIECALP--VSEEEDSQLEGRVSDFSLAV 580
              R  +FW+ Y  +   +  LG    I+D EI   LP  + EEE   +E      +L  
Sbjct: 467 VELRSRVFWSAYCYERLVATSLGRISAIEDEEISVPLPHALYEEEKDDIE-----VTLMT 521

Query: 581 IRYAKVLGNI 590
           I   KV G I
Sbjct: 522 ISLRKVSGRI 531

>TBLA0G00490 Chr7 (99344..102100) [2757 bp, 918 aa] {ON} 
          Length = 918

 Score = 38.9 bits (89), Expect = 0.089,   Method: Compositional matrix adjust.
 Identities = 17/38 (44%), Positives = 21/38 (55%), Gaps = 1/38 (2%)

Query: 58 QACDRCRLKKTKCDGKIPQCSQCALVGF-ECKISDRLN 94
          ++C  CR +K KCD   P CS C    F EC  SD +N
Sbjct: 33 KSCSFCRRRKLKCDKSKPLCSTCRARNFTECIYSDAIN 70

>CAGL0K05841g Chr11 (573144..577262) [4119 bp, 1372 aa] {ON}
          similar to uniprot|P12351 Saccharomyces cerevisiae
          YLR256w HAP1 transcription factor
          Length = 1372

 Score = 39.3 bits (90), Expect = 0.089,   Method: Compositional matrix adjust.
 Identities = 14/30 (46%), Positives = 17/30 (56%)

Query: 55 RVAQACDRCRLKKTKCDGKIPQCSQCALVG 84
          RV  +C  CR +K KCD   P C+QC   G
Sbjct: 66 RVPLSCTICRRRKVKCDKSRPNCTQCVKTG 95

>Skud_7.638 Chr7 (1060062..1061483) [1422 bp, 473 aa] {ON} YFL052W
          (REAL)
          Length = 473

 Score = 38.9 bits (89), Expect = 0.090,   Method: Compositional matrix adjust.
 Identities = 16/39 (41%), Positives = 24/39 (61%), Gaps = 1/39 (2%)

Query: 58 QACDRCRLKKTKCDGKIPQCSQCALVGFECKISDRLNRK 96
          QACD CR+++ KCDGK P C++C     +C     L ++
Sbjct: 11 QACDCCRVRRVKCDGKKP-CNRCLQHDLKCTYLQPLRKR 48

>Skud_15.64 Chr15 complement(109746..112844) [3099 bp, 1032 aa] {ON}
           YOL089C (REAL)
          Length = 1032

 Score = 38.9 bits (89), Expect = 0.090,   Method: Compositional matrix adjust.
 Identities = 17/41 (41%), Positives = 21/41 (51%), Gaps = 3/41 (7%)

Query: 55  RVAQACDRCRLKKTKCDGKIPQ---CSQCALVGFECKISDR 92
           RV++ACD CR +K +CD   PQ   CS C      C    R
Sbjct: 131 RVSKACDHCRKRKIRCDEVDPQTDKCSNCVKFQSVCTFKHR 171

 Score = 36.6 bits (83), Expect = 0.52,   Method: Compositional matrix adjust.
 Identities = 25/104 (24%), Positives = 49/104 (47%), Gaps = 9/104 (8%)

Query: 455 FFQDMST--TTVQSLQLLSFISFYFLNVGDIPRLYQLRGTVISMAQQLRLHRCPSAVLLS 512
           ++  +ST  +  ++LQ L  ++ YF    D      + GT I +A  + L+R        
Sbjct: 461 YYHKLSTICSGTRTLQALLLLNRYFQVTYDTELANCILGTAIRLAVDMELNR-------K 513

Query: 513 ASGSTMQKFEQGERRLLFWAIYYLDVFYSLQLGVPRLIKDHEIE 556
           +S  ++   E   RR ++W  +  D  YSL L  P ++ + +++
Sbjct: 514 SSYKSLDFEEAIRRRSMWWHCFCTDKLYSLMLSRPPIVGEQDMD 557

>TBLA0B04800 Chr2 complement(1127000..1129333) [2334 bp, 777 aa]
          {ON} 
          Length = 777

 Score = 38.9 bits (89), Expect = 0.092,   Method: Compositional matrix adjust.
 Identities = 11/26 (42%), Positives = 19/26 (73%)

Query: 55 RVAQACDRCRLKKTKCDGKIPQCSQC 80
          R+++ C+ CR++K KCD + P C +C
Sbjct: 10 RISRVCNSCRIQKLKCDRERPSCKRC 35

>CAGL0F07865g Chr6 complement(768270..770804) [2535 bp, 844 aa]
          {ON} similar to uniprot|Q12151 Saccharomyces cerevisiae
          YDR213w UPC2
          Length = 844

 Score = 38.9 bits (89), Expect = 0.094,   Method: Compositional matrix adjust.
 Identities = 11/29 (37%), Positives = 16/29 (55%)

Query: 59 ACDRCRLKKTKCDGKIPQCSQCALVGFEC 87
           CD C+ ++ KCD   P C +C  +  EC
Sbjct: 53 GCDHCKRRRVKCDEGKPMCDKCVKMKLEC 81

>ZYRO0D06688g Chr4 (577455..577507,577577..579311) [1788 bp, 595 aa]
           {ON} similar to uniprot|P43634 Saccharomyces cerevisiae
           YLR098C CHA4 Zinc-finger protein with Zn[2]-Cys[6]
           fungal- type binuclear cluster domain DNA-binding
           transcriptional activator or CHA1
          Length = 595

 Score = 38.9 bits (89), Expect = 0.100,   Method: Compositional matrix adjust.
 Identities = 18/45 (40%), Positives = 24/45 (53%), Gaps = 2/45 (4%)

Query: 59  ACDRCRLKKTKCDGKIPQCSQCALVGFECKISDR-LNRKSFPRGY 102
           AC  CR ++ KC+ +IP CS C   G EC   D+ L R  +   Y
Sbjct: 18  ACQNCRKRRRKCNSEIP-CSNCVKYGIECVPVDQDLRRTRYTASY 61

>TPHA0F02630 Chr6 complement(583511..587299) [3789 bp, 1262 aa]
          {ON} Anc_6.75 YLR278C
          Length = 1262

 Score = 38.9 bits (89), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 13/36 (36%), Positives = 21/36 (58%)

Query: 57 AQACDRCRLKKTKCDGKIPQCSQCALVGFECKISDR 92
          +++C  CR +K KCD  +P C+ C   G +C   +R
Sbjct: 38 SKSCLLCRRRKQKCDHNLPSCTSCLKAGVKCVQPER 73

 Score = 36.2 bits (82), Expect = 0.62,   Method: Compositional matrix adjust.
 Identities = 23/81 (28%), Positives = 41/81 (50%), Gaps = 15/81 (18%)

Query: 486 LYQLRGTVISMAQQLRLHRC-PSAVLLSASGSTMQKFEQGERRLLFWAIYYLDVFYSLQL 544
           LYQ+   V+ ++++L L++  P   L+             E+  LFW +Y L+    + +
Sbjct: 469 LYQIIKDVMDLSRKLELNKMHPGDQLIK------------EKFRLFWCVYLLERMICVAV 516

Query: 545 GVPRLIKDHEIECALPVSEEE 565
           G P  I + EI+  LP+ +EE
Sbjct: 517 GCPFTISEREID--LPLFDEE 535

>KLLA0F19602g Chr6 complement(1814949..1816760) [1812 bp, 603 aa]
          {ON} similar to uniprot|P43634 Saccharomyces cerevisiae
          YLR098C CHA4 Zinc-finger protein with Zn[2]-Cys[6]
          fungal- type binuclear cluster domain DNA-binding
          transcriptional activator or CHA1 and some similarities
          to YOR337W uniprot|P47988 Saccharomyces cerevisiae
          YOR337W TEA1 Mutants are defective in Ty1
          Enhancer-mediated Activation Ty1 enhancer activator
          Length = 603

 Score = 38.5 bits (88), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 15/29 (51%), Positives = 18/29 (62%), Gaps = 1/29 (3%)

Query: 59 ACDRCRLKKTKCDGKIPQCSQCALVGFEC 87
          AC  CR+K+ KCD + P CS C   G EC
Sbjct: 16 ACQNCRIKRRKCDMERP-CSNCLKYGIEC 43

>Skud_11.190 Chr11 (345221..348736) [3516 bp, 1171 aa] {ON} YKL038W
           (REAL)
          Length = 1171

 Score = 38.9 bits (89), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 29/51 (56%), Gaps = 4/51 (7%)

Query: 55  RVAQACDRCRLKKTKCDGKIPQ--CSQCALVGFECKISDRLNRKSFP-RGY 102
           + ++ACD+CR KK KCD K  +  CS C   G  C   +R+  K  P +GY
Sbjct: 42  KASRACDQCRKKKIKCDYKDERGVCSNCQRNGDRCSF-ERVPLKRGPSKGY 91

>TBLA0G01130 Chr7 (287952..291350) [3399 bp, 1132 aa] {ON}
          Anc_8.879 YML099C
          Length = 1132

 Score = 38.9 bits (89), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 13/34 (38%), Positives = 18/34 (52%)

Query: 55 RVAQACDRCRLKKTKCDGKIPQCSQCALVGFECK 88
          R    C  CR +K KCD + PQC +C     +C+
Sbjct: 11 RTYSGCWTCRSRKIKCDQQKPQCKRCLKANLKCE 44

>Kpol_1009.5 s1009 complement(10170..13706) [3537 bp, 1178 aa]
          {ON} complement(10170..13706) [3537 nt, 1179 aa]
          Length = 1178

 Score = 38.9 bits (89), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 12/31 (38%), Positives = 19/31 (61%)

Query: 57 AQACDRCRLKKTKCDGKIPQCSQCALVGFEC 87
          +++C  CR +K +CD K+P C+ C   G  C
Sbjct: 38 SKSCLFCRRRKQRCDHKLPSCTACLKAGVRC 68

>Suva_11.187 Chr11 (348570..352085) [3516 bp, 1171 aa] {ON} YKL038W
           (REAL)
          Length = 1171

 Score = 38.9 bits (89), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 29/51 (56%), Gaps = 4/51 (7%)

Query: 55  RVAQACDRCRLKKTKCDGKIPQ--CSQCALVGFECKISDRLNRKSFP-RGY 102
           + ++ACD+CR KK KCD K  +  CS C   G  C   +R+  K  P +GY
Sbjct: 42  KASRACDQCRKKKIKCDYKDEKGLCSNCQRNGDRCSF-ERVPLKRGPSKGY 91

>ZYRO0A03058g Chr1 (247954..250164) [2211 bp, 736 aa] {ON} similar
           to uniprot|P40971 Saccharomyces cerevisiae YDR034C LYS14
           Transcriptional activator involved in regulation of
           genes of the lysine biosynthesis pathway requires
           2-aminoadipate semialdehyde as co-inducer
          Length = 736

 Score = 38.5 bits (88), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 17/43 (39%), Positives = 23/43 (53%), Gaps = 1/43 (2%)

Query: 59  ACDRCRLKKTKCDGKIPQCSQCALVGFEC-KISDRLNRKSFPR 100
            C  C+ ++ KCD   P C QCA +  EC  I +  N+K  PR
Sbjct: 119 GCTECKRRRMKCDETKPTCWQCARLNRECVYILNAKNKKRKPR 161

>NCAS0A07610 Chr1 complement(1512914..1515982) [3069 bp, 1022 aa]
          {ON} Anc_7.17
          Length = 1022

 Score = 38.9 bits (89), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 13/33 (39%), Positives = 18/33 (54%)

Query: 55 RVAQACDRCRLKKTKCDGKIPQCSQCALVGFEC 87
          R++  C  CR  KTKCD + P C++C      C
Sbjct: 41 RISFVCQECRKAKTKCDKEKPACTRCVKQNLAC 73

>Kpol_260.2 s260 complement(3488..5758) [2271 bp, 756 aa] {ON}
          complement(3488..5758) [2271 nt, 757 aa]
          Length = 756

 Score = 38.5 bits (88), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 16/41 (39%), Positives = 20/41 (48%)

Query: 57 AQACDRCRLKKTKCDGKIPQCSQCALVGFECKISDRLNRKS 97
          A +C RCR  K KC  + P C+ C   G  C    R  R+S
Sbjct: 40 AYSCSRCRKLKRKCQKQRPSCANCMNAGATCNYPGRAPRRS 80

>KLLA0F10373g Chr6 (957948..958994) [1047 bp, 348 aa] {ON} some
          similarities with uniprot|P38141 Saccharomyces
          cerevisiae YBR240C THI2 Zinc finger protein of the
          Zn(II)2Cys6 type probable transcriptional activator of
          thiamine biosynthetic genes
          Length = 348

 Score = 38.1 bits (87), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 17/35 (48%), Positives = 18/35 (51%)

Query: 59 ACDRCRLKKTKCDGKIPQCSQCALVGFECKISDRL 93
           C  CR KK KCD + P CS C   G EC    RL
Sbjct: 9  GCWACRFKKRKCDERKPICSLCLKHGVECCYDVRL 43

>Suva_2.51 Chr2 complement(93709..97176) [3468 bp, 1155 aa] {ON}
          YBL066C (REAL)
          Length = 1155

 Score = 38.5 bits (88), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 16/46 (34%), Positives = 23/46 (50%), Gaps = 3/46 (6%)

Query: 54 YRVAQACDRCRLKKTKCDGK--IPQ-CSQCALVGFECKISDRLNRK 96
          +R   +C  CR  K KCD     P  CS+C  +G  C+I+ +   K
Sbjct: 52 HRPVTSCTHCRQHKIKCDASQNFPHPCSRCEKIGLHCEINPQFRPK 97

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.314    0.129    0.362 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 125,403,140
Number of extensions: 5709205
Number of successful extensions: 28234
Number of sequences better than 10.0: 1403
Number of HSP's gapped: 28880
Number of HSP's successfully gapped: 1721
Length of query: 1254
Length of database: 53,481,399
Length adjustment: 121
Effective length of query: 1133
Effective length of database: 39,606,813
Effective search space: 44874519129
Effective search space used: 44874519129
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 72 (32.3 bits)