Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
CAGL0M03003g8.843ON55855825190.0
NCAS0A02540singletonON53949616400.0
NCAS0C004008.843ON51749516290.0
Suva_13.4678.843ON54348616160.0
KNAG0J002608.843ON55048615890.0
YMR279C8.843ON54048915840.0
Smik_13.4928.843ON54348915790.0
KAFR0B03930singletonON55549215500.0
NDAI0K004008.843ON55349215430.0
Skud_13.4518.843ON53948915300.0
YML116W (ATR1)8.843ON54250415250.0
KAFR0B039408.843ON54751114920.0
Smik_13.188.843ON54549514760.0
Suva_13.278.843ON55349314740.0
Skud_13.258.843ON53749614650.0
CAGL0B02343g8.843ON53750414600.0
NDAI0E002808.843ON54949314510.0
SAKL0D01386g8.843ON52150614260.0
NCAS0B002908.843ON54249414200.0
TDEL0B005508.843ON53749114060.0
Kwal_27.102458.843ON51548113970.0
KNAG0G034308.843ON54249013970.0
TBLA0D032708.843ON55048413830.0
KLTH0C03806g8.843ON52550113750.0
Kpol_541.168.843ON52848913640.0
TPHA0C047908.843ON55648612901e-172
TBLA0D03280singletonON58050012901e-172
KAFR0A028408.843ON52048912631e-169
TBLA0C01160singletonON60048110901e-142
Smik_15.560na 1ON5165137583e-93
YOR378Wna 1ON5155137425e-91
Skud_15.545na 1ON5164777365e-90
Suva_8.435na 1ON5155147347e-90
KLTH0C10560gna 1ON5154987331e-89
Kwal_23.6547na 1ON5114827061e-85
KLLA0B00352gna 1ON4984676875e-83
TDEL0G04950singletonON5124506842e-82
KNAG0D00130na 1ON5655024759e-52
SAKL0C06116gsingletonON1851253902e-43
KAFR0C04860na 1ON5344923604e-36
CAGL0L02519gna 1ON5294423411e-33
NCAS0A05720na 1ON5634993412e-33
NDAI0K02730singletonON6045262863e-26
Kwal_34.15746na 2ON5181241171e-05
SAKL0F00440gsingletonON5442371101e-04
KLLA0C18931gna 2ON5531111055e-04
CAGL0J01375g2.473ON5641361028e-04
NCAS0A078102.473ON568130990.002
Smik_13.2722.473ON56182940.010
KLTH0H16214gsingletonON551102930.012
TDEL0D06610singletonON49787910.018
YMR088C (VBA1)2.473ON562103910.020
Skud_13.2442.473ON562103900.024
TDEL0A024902.473ON55464890.032
KLLA0F13684g2.473ON57182880.049
Ecym_73992.473ON563161880.050
Suva_13.2652.473ON561103870.055
Suva_10.11singletonON540108870.062
AGR076C8.272ON68667860.082
Smik_6.24na 3ON544237850.10
YKR105C (VBA5)singletonON582145850.10
SAKL0E02992g2.473ON57064850.11
TBLA0A01270singletonON522143840.12
TBLA0F030408.272ON90654840.13
YPR198W (SGE1)singletonON54366840.15
Kpol_467.242.473ON37098830.17
NCAS0C03460na 4ON630131830.19
KLTH0D16962gsingletonON57186820.22
TDEL0F039908.272ON631133820.23
SAKL0A08228gsingletonON56985810.27
TDEL0G03260singletonON612101810.33
KLTH0C10142gsingletonON573147800.36
NDAI0H022002.473ON57182800.36
SAKL0C05588gsingletonON67784800.39
Skud_6.16na 3ON549235790.54
Kwal_14.1585na 5ON57084770.80
Skud_16.503singletonON54366770.91
KLLA0A11110g1.432ON55194770.94
ZYRO0G03234g2.473ON56277770.98
KAFR0C012503.124ON3069129771.1
KLTH0C10120gsingletonON65186761.1
Kwal_23.48242.242ON553120761.2
Kpol_416.5singletonON60783761.3
Ecym_42988.272ON67866751.8
KLLA0A04631g8.272ON579108742.1
KLTH0D05434g2.473ON576133732.4
Smik_11.368singletonON58069732.6
ZYRO0C01430g8.272ON590117732.6
TPHA0G031502.473ON60043732.7
SAKL0H16808g8.272ON65747733.0
SAKL0C11066gsingletonON58097723.3
Kwal_56.237548.272ON589137723.6
Suva_5.2na 6ON62799714.3
Kpol_281.31.432ON55696714.3
Kpol_543.448.272ON64347714.6
SAKL0A00726gsingletonON59870714.9
Skud_18.3singletonON59069715.4
TBLA0C01100na 7ON64995715.5
Skud_15.4748.783ON522140705.5
CAGL0B02079gna 4ON624139705.8
Smik_17.11singletonON54466705.9
Kwal_26.77552.473ON55991706.1
AEL042C1.432ON547150706.7
YOR306C (MCH5)8.783ON521141706.9
Smik_13.118.858ON58658698.1
SAKL0C02178gsingletonON56571698.2
Ecym_6024na 8ON48954698.4
Suva_13.208.858ON58458689.7
SAKL0E08756g2.242ON56565689.7
Ecym_45063.245ON648606810.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0M03003g
         (558 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0M03003g Chr13 complement(337942..339618) [1677 bp, 558 aa] ...   974   0.0  
NCAS0A02540 Chr1 complement(481807..483426) [1620 bp, 539 aa] {O...   636   0.0  
NCAS0C00400 Chr3 (61257..62810) [1554 bp, 517 aa] {ON} Anc_8.843      632   0.0  
Suva_13.467 Chr13 complement(807375..809006) [1632 bp, 543 aa] {...   627   0.0  
KNAG0J00260 Chr10 (37950..39602) [1653 bp, 550 aa] {ON} Anc_8.84...   616   0.0  
YMR279C Chr13 complement(824729..826351) [1623 bp, 540 aa] {ON} ...   614   0.0  
Smik_13.492 Chr13 complement(807726..809357) [1632 bp, 543 aa] {...   612   0.0  
KAFR0B03930 Chr2 complement(816351..818018) [1668 bp, 555 aa] {O...   601   0.0  
NDAI0K00400 Chr11 (90040..91701) [1662 bp, 553 aa] {ON}               598   0.0  
Skud_13.451 Chr13 complement(798006..799625) [1620 bp, 539 aa] {...   593   0.0  
YML116W Chr13 (38196..39824) [1629 bp, 542 aa] {ON}  ATR1Multidr...   592   0.0  
KAFR0B03940 Chr2 complement(820954..822597) [1644 bp, 547 aa] {O...   579   0.0  
Smik_13.18 Chr13 (34422..36059) [1638 bp, 545 aa] {ON} YML116W (...   573   0.0  
Suva_13.27 Chr13 (37895..39556) [1662 bp, 553 aa] {ON} YML116W (...   572   0.0  
Skud_13.25 Chr13 (37872..39485) [1614 bp, 537 aa] {ON} YML116W (...   568   0.0  
CAGL0B02343g Chr2 complement(222130..223743) [1614 bp, 537 aa] {...   566   0.0  
NDAI0E00280 Chr5 (37676..39325) [1650 bp, 549 aa] {ON} Anc_8.843      563   0.0  
SAKL0D01386g Chr4 (109619..111184) [1566 bp, 521 aa] {ON} unipro...   553   0.0  
NCAS0B00290 Chr2 (33760..35388) [1629 bp, 542 aa] {ON} Anc_8.843      551   0.0  
TDEL0B00550 Chr2 (105483..107096) [1614 bp, 537 aa] {ON} Anc_8.8...   546   0.0  
Kwal_27.10245 s27 (259090..260637) [1548 bp, 515 aa] {ON} YML116...   542   0.0  
KNAG0G03430 Chr7 complement(734828..736456) [1629 bp, 542 aa] {O...   542   0.0  
TBLA0D03270 Chr4 complement(813041..814693) [1653 bp, 550 aa] {O...   537   0.0  
KLTH0C03806g Chr3 (332195..333772) [1578 bp, 525 aa] {ON} simila...   534   0.0  
Kpol_541.16 s541 complement(43396..44982) [1587 bp, 528 aa] {ON}...   530   0.0  
TPHA0C04790 Chr3 complement(1033653..1035323) [1671 bp, 556 aa] ...   501   e-172
TBLA0D03280 Chr4 complement(815937..817679) [1743 bp, 580 aa] {O...   501   e-172
KAFR0A02840 Chr1 complement(588197..589759) [1563 bp, 520 aa] {O...   491   e-169
TBLA0C01160 Chr3 complement(246034..247836) [1803 bp, 600 aa] {O...   424   e-142
Smik_15.560 Chr15 (995453..997003) [1551 bp, 516 aa] {ON} YOR378...   296   3e-93
YOR378W Chr15 (1049511..1051058) [1548 bp, 515 aa] {ON} Putative...   290   5e-91
Skud_15.545 Chr15 (988549..990099) [1551 bp, 516 aa] {ON} YOR378...   288   5e-90
Suva_8.435 Chr8 (786917..788464) [1548 bp, 515 aa] {ON} YOR378W ...   287   7e-90
KLTH0C10560g Chr3 (875216..876763) [1548 bp, 515 aa] {ON} simila...   286   1e-89
Kwal_23.6547 s23 (1635677..1637212) [1536 bp, 511 aa] {ON} YOR37...   276   1e-85
KLLA0B00352g Chr2 (22476..23972) [1497 bp, 498 aa] {ON} highly s...   269   5e-83
TDEL0G04950 Chr7 complement(922428..923966) [1539 bp, 512 aa] {O...   268   2e-82
KNAG0D00130 Chr4 complement(6264..7961) [1698 bp, 565 aa] {ON}  ...   187   9e-52
SAKL0C06116g Chr3 complement(571813..572370) [558 bp, 185 aa] {O...   154   2e-43
KAFR0C04860 Chr3 (964552..966156) [1605 bp, 534 aa] {ON}  YOR378W     143   4e-36
CAGL0L02519g Chr12 complement(297555..299144) [1590 bp, 529 aa] ...   135   1e-33
NCAS0A05720 Chr1 (1117491..1119182) [1692 bp, 563 aa] {ON}            135   2e-33
NDAI0K02730 Chr11 complement(612590..614404) [1815 bp, 604 aa] {...   114   3e-26
Kwal_34.15746 s34 (37757..39313) [1557 bp, 518 aa] {ON} YGR224W ...    50   1e-05
SAKL0F00440g Chr6 complement(36452..38086) [1635 bp, 544 aa] {ON...    47   1e-04
KLLA0C18931g Chr3 (1680133..1681794) [1662 bp, 553 aa] {ON} unip...    45   5e-04
CAGL0J01375g Chr10 (127843..129537) [1695 bp, 564 aa] {ON} simil...    44   8e-04
NCAS0A07810 Chr1 complement(1554541..1556247) [1707 bp, 568 aa] ...    43   0.002
Smik_13.272 Chr13 complement(427283..428968) [1686 bp, 561 aa] {...    41   0.010
KLTH0H16214g Chr8 complement(1398230..1399885) [1656 bp, 551 aa]...    40   0.012
TDEL0D06610 Chr4 complement(1195341..1196834) [1494 bp, 497 aa] ...    40   0.018
YMR088C Chr13 complement(443414..445102) [1689 bp, 562 aa] {ON} ...    40   0.020
Skud_13.244 Chr13 complement(417271..418959) [1689 bp, 562 aa] {...    39   0.024
TDEL0A02490 Chr1 (446429..448093) [1665 bp, 554 aa] {ON} Anc_2.4...    39   0.032
KLLA0F13684g Chr6 complement(1267367..1269082) [1716 bp, 571 aa]...    39   0.049
Ecym_7399 Chr7 complement(820280..821971) [1692 bp, 563 aa] {ON}...    39   0.050
Suva_13.265 Chr13 complement(424929..426614) [1686 bp, 561 aa] {...    38   0.055
Suva_10.11 Chr10 (18934..20556) [1623 bp, 540 aa] {ON} YOR378W (...    38   0.062
AGR076C Chr7 complement(871564..873624) [2061 bp, 686 aa] {ON} S...    38   0.082
Smik_6.24 Chr6 (39520..41154) [1635 bp, 544 aa] {ON} YMR279C (REAL)    37   0.10 
YKR105C Chr11 complement(658716..660464) [1749 bp, 582 aa] {ON} ...    37   0.10 
SAKL0E02992g Chr5 complement(243652..245364) [1713 bp, 570 aa] {...    37   0.11 
TBLA0A01270 Chr1 complement(300796..302364) [1569 bp, 522 aa] {O...    37   0.12 
TBLA0F03040 Chr6 complement(735352..738072) [2721 bp, 906 aa] {O...    37   0.13 
YPR198W Chr16 (934034..935665) [1632 bp, 543 aa] {ON}  SGE1Plasm...    37   0.15 
Kpol_467.24 s467 (55523..56632) [1110 bp, 370 aa] {ON} (55523..5...    37   0.17 
NCAS0C03460 Chr3 complement(690089..691981) [1893 bp, 630 aa] {O...    37   0.19 
KLTH0D16962g Chr4 (1399514..1401229) [1716 bp, 571 aa] {ON} simi...    36   0.22 
TDEL0F03990 Chr6 (740471..742366) [1896 bp, 631 aa] {ON} Anc_8.2...    36   0.23 
SAKL0A08228g Chr1 complement(732518..734227) [1710 bp, 569 aa] {...    36   0.27 
TDEL0G03260 Chr7 (605429..607267) [1839 bp, 612 aa] {ON}               36   0.33 
KLTH0C10142g Chr3 (842371..844092) [1722 bp, 573 aa] {ON} simila...    35   0.36 
NDAI0H02200 Chr8 complement(536385..538100) [1716 bp, 571 aa] {O...    35   0.36 
SAKL0C05588g Chr3 (527748..529781) [2034 bp, 677 aa] {ON} simila...    35   0.39 
Skud_6.16 Chr6 (26284..27933) [1650 bp, 549 aa] {ON} YOR378W (REAL)    35   0.54 
Kwal_14.1585 s14 (377103..378815) [1713 bp, 570 aa] {ON} YMR088C...    34   0.80 
Skud_16.503 Chr16 (880571..882202) [1632 bp, 543 aa] {ON} YPR198...    34   0.91 
KLLA0A11110g Chr1 (964084..965739) [1656 bp, 551 aa] {ON} unipro...    34   0.94 
ZYRO0G03234g Chr7 (247798..249486) [1689 bp, 562 aa] {ON} simila...    34   0.98 
KAFR0C01250 Chr3 complement(250861..260070) [9210 bp, 3069 aa] {...    34   1.1  
KLTH0C10120g Chr3 (839780..841735) [1956 bp, 651 aa] {ON} simila...    34   1.1  
Kwal_23.4824 s23 (883258..884919) [1662 bp, 553 aa] {ON} YNL065W...    34   1.2  
Kpol_416.5 s416 (23208..25031) [1824 bp, 607 aa] {ON} (23208..25...    34   1.3  
Ecym_4298 Chr4 complement(636605..638641) [2037 bp, 678 aa] {ON}...    33   1.8  
KLLA0A04631g Chr1 complement(415070..416809) [1740 bp, 579 aa] {...    33   2.1  
KLTH0D05434g Chr4 (486319..488049) [1731 bp, 576 aa] {ON} simila...    33   2.4  
Smik_11.368 Chr11 complement(649880..651622) [1743 bp, 580 aa] {...    33   2.6  
ZYRO0C01430g Chr3 complement(101140..102912) [1773 bp, 590 aa] {...    33   2.6  
TPHA0G03150 Chr7 (670343..672145) [1803 bp, 600 aa] {ON} Anc_2.4...    33   2.7  
SAKL0H16808g Chr8 complement(1477137..1479110) [1974 bp, 657 aa]...    33   3.0  
SAKL0C11066g Chr3 complement(998593..1000335) [1743 bp, 580 aa] ...    32   3.3  
Kwal_56.23754 s56 complement(690851..692620) [1770 bp, 589 aa] {...    32   3.6  
Suva_5.2 Chr5 (3340..5223) [1884 bp, 627 aa] {ON} YEL065W (REAL)       32   4.3  
Kpol_281.3 s281 complement(9070..10740) [1671 bp, 556 aa] {ON} c...    32   4.3  
Kpol_543.44 s543 (96992..98923) [1932 bp, 643 aa] {ON} (96992..9...    32   4.6  
SAKL0A00726g Chr1 (82164..83960) [1797 bp, 598 aa] {ON} similar ...    32   4.9  
Skud_18.3 Chr18 complement(10782..12554) [1773 bp, 590 aa] {ON} ...    32   5.4  
TBLA0C01100 Chr3 (227542..229491) [1950 bp, 649 aa] {ON} Anc_1.432     32   5.5  
Skud_15.474 Chr15 complement(829767..831335) [1569 bp, 522 aa] {...    32   5.5  
CAGL0B02079g Chr2 complement(191736..193610) [1875 bp, 624 aa] {...    32   5.8  
Smik_17.11 Chr17 complement(8582..10216) [1635 bp, 544 aa] {ON} ...    32   5.9  
Kwal_26.7755 s26 (500034..501713) [1680 bp, 559 aa] {ON} YMR088C...    32   6.1  
AEL042C Chr5 complement(557191..558834) [1644 bp, 547 aa] {ON} S...    32   6.7  
YOR306C Chr15 complement(889867..891432) [1566 bp, 521 aa] {ON} ...    32   6.9  
Smik_13.11 Chr13 complement(20464..22224) [1761 bp, 586 aa] {ON}...    31   8.1  
SAKL0C02178g Chr3 complement(191542..193239) [1698 bp, 565 aa] {...    31   8.2  
Ecym_6024 Chr6 (43495..44964) [1470 bp, 489 aa] {ON} similar to ...    31   8.4  
Suva_13.20 Chr13 complement(24012..25766) [1755 bp, 584 aa] {ON}...    31   9.7  
SAKL0E08756g Chr5 complement(714902..716599) [1698 bp, 565 aa] {...    31   9.7  
Ecym_4506 Chr4 complement(1013521..1015467) [1947 bp, 648 aa] {O...    31   10.0 

>CAGL0M03003g Chr13 complement(337942..339618) [1677 bp, 558 aa]
           {ON} similar to uniprot|Q03263 Saccharomyces cerevisiae
           YMR279c or uniprot|P13090 Saccharomyces cerevisiae
           YML116w ATR1
          Length = 558

 Score =  974 bits (2519), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 491/558 (87%), Positives = 491/558 (87%)

Query: 1   MVLIVTHNMTSEKNNPKSEKTNYDGVVTKSIAFXXXXXXXXXXXXXXXXXQLSVTSKGCI 60
           MVLIVTHNMTSEKNNPKSEKTNYDGVVTKSIAF                 QLSVTSKGCI
Sbjct: 1   MVLIVTHNMTSEKNNPKSEKTNYDGVVTKSIAFDGCEECSSSDECQSNSDQLSVTSKGCI 60

Query: 61  CSVDDCHENDSPFQNPEYFETGFKEVMFIISCMVAQLLNQAGQTQSLSTMNVLADYFKSN 120
           CSVDDCHENDSPFQNPEYFETGFKEVMFIISCMVAQLLNQAGQTQSLSTMNVLADYFKSN
Sbjct: 61  CSVDDCHENDSPFQNPEYFETGFKEVMFIISCMVAQLLNQAGQTQSLSTMNVLADYFKSN 120

Query: 121 SSKQPWLMASFPLVSGSFILISGRLGDIYGLKKALSVGYIIMTLWSIICGLAKYTNSDAF 180
           SSKQPWLMASFPLVSGSFILISGRLGDIYGLKKALSVGYIIMTLWSIICGLAKYTNSDAF
Sbjct: 121 SSKQPWLMASFPLVSGSFILISGRLGDIYGLKKALSVGYIIMTLWSIICGLAKYTNSDAF 180

Query: 181 FIVCRSFQGLGIAFILPNIMGLVGNIYKVGTLRKNIVISCIGCMAPXXXXXXXXXXXXIV 240
           FIVCRSFQGLGIAFILPNIMGLVGNIYKVGTLRKNIVISCIGCMAP            IV
Sbjct: 181 FIVCRSFQGLGIAFILPNIMGLVGNIYKVGTLRKNIVISCIGCMAPAGAALGALFGGLIV 240

Query: 241 TEDAEQWPWVFYAFGIASFVNMLLALYSIXXXXXXXXXXXXMDWIXXXXXXXXXXXXNIV 300
           TEDAEQWPWVFYAFGIASFVNMLLALYSI            MDWI            NIV
Sbjct: 241 TEDAEQWPWVFYAFGIASFVNMLLALYSIPNNVPTNLNNLNMDWIGSLLGVSGLLLLNIV 300

Query: 301 WNQAPIVGWGEAYXXXXXXXXXXXXXXFVVYEIKYATSPLLPPSVLENKKILMILAALFF 360
           WNQAPIVGWGEAY              FVVYEIKYATSPLLPPSVLENKKILMILAALFF
Sbjct: 301 WNQAPIVGWGEAYIIVLLIISIILLLIFVVYEIKYATSPLLPPSVLENKKILMILAALFF 360

Query: 361 GWGSFGIWTYYYYAFQLNLRKYTPLWAGGTHFMFVIWGTVAAFVVALTIKKVGPAVLLCF 420
           GWGSFGIWTYYYYAFQLNLRKYTPLWAGGTHFMFVIWGTVAAFVVALTIKKVGPAVLLCF
Sbjct: 361 GWGSFGIWTYYYYAFQLNLRKYTPLWAGGTHFMFVIWGTVAAFVVALTIKKVGPAVLLCF 420

Query: 421 SMVAFDCGSIMLSVTPVHQTYWRMNVGMQIILSFGMDLSFPASSIILSDFLPMQYQGMAG 480
           SMVAFDCGSIMLSVTPVHQTYWRMNVGMQIILSFGMDLSFPASSIILSDFLPMQYQGMAG
Sbjct: 421 SMVAFDCGSIMLSVTPVHQTYWRMNVGMQIILSFGMDLSFPASSIILSDFLPMQYQGMAG 480

Query: 481 SLVNTVVNYSTSLCLGMGNTVEQQYNAHGADLLKGYRSALYLAIGLASAGVCVSLVFLVT 540
           SLVNTVVNYSTSLCLGMGNTVEQQYNAHGADLLKGYRSALYLAIGLASAGVCVSLVFLVT
Sbjct: 481 SLVNTVVNYSTSLCLGMGNTVEQQYNAHGADLLKGYRSALYLAIGLASAGVCVSLVFLVT 540

Query: 541 DIIAKRHRKRIESECESC 558
           DIIAKRHRKRIESECESC
Sbjct: 541 DIIAKRHRKRIESECESC 558

>NCAS0A02540 Chr1 complement(481807..483426) [1620 bp, 539 aa] {ON} 
          Length = 539

 Score =  636 bits (1640), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 305/496 (61%), Positives = 367/496 (73%)

Query: 62  SVDDCHENDSPFQNPEYFETGFKEVMFIISCMVAQLLNQAGQTQSLSTMNVLADYFKSNS 121
           S D   ++DSP+QNP YF + +KE  FI +CMVA LLNQAGQTQ LSTMNV+++ F S+S
Sbjct: 39  STDSVLDDDSPWQNPNYFSSKYKEYFFIFTCMVANLLNQAGQTQVLSTMNVISESFHSDS 98

Query: 122 SKQPWLMASFPLVSGSFILISGRLGDIYGLKKALSVGYIIMTLWSIICGLAKYTNSDAFF 181
            KQ WLMASFPLVSGSFILISGR+GDIYGLKK +  GYI M +WS++CG A +T++D FF
Sbjct: 99  GKQTWLMASFPLVSGSFILISGRIGDIYGLKKTMIGGYIFMIIWSLLCGFADFTHNDTFF 158

Query: 182 IVCRSFQGLGIAFILPNIMGLVGNIYKVGTLRKNIVISCIGCMAPXXXXXXXXXXXXIVT 241
           IVCR+FQGLGI+FILPN+MGL+GNIYKVGTLRKNIVIS IG  AP            IVT
Sbjct: 159 IVCRAFQGLGISFILPNVMGLIGNIYKVGTLRKNIVISMIGLTAPTGACMGALWGGLIVT 218

Query: 242 EDAEQWPWVFYAFGIASFVNMLLALYSIXXXXXXXXXXXXMDWIXXXXXXXXXXXXNIVW 301
           E+A+QWPW+FYA+ +   VN+++ALYS+            MDWI            N VW
Sbjct: 219 ENAKQWPWIFYAYALTGLVNLIMALYSVPNCIPTNVHNFAMDWIGSIIGVVGLILFNFVW 278

Query: 302 NQAPIVGWGEAYXXXXXXXXXXXXXXFVVYEIKYATSPLLPPSVLENKKILMILAALFFG 361
           NQ P+ GW +AY              FVVYE+KY  SPLLP  V +N +IL IL+ LF G
Sbjct: 279 NQGPVAGWDKAYIIVLLIISVLFLVAFVVYELKYPISPLLPVEVTKNGQILTILSILFLG 338

Query: 362 WGSFGIWTYYYYAFQLNLRKYTPLWAGGTHFMFVIWGTVAAFVVALTIKKVGPAVLLCFS 421
           WG+FGIWT+YY+AFQLNLR Y+P+W GGT+FMF+IWGT+AA +VA TIKKVGPA+LL FS
Sbjct: 339 WGAFGIWTFYYFAFQLNLRDYSPVWVGGTYFMFIIWGTIAALIVAFTIKKVGPAILLFFS 398

Query: 422 MVAFDCGSIMLSVTPVHQTYWRMNVGMQIILSFGMDLSFPASSIILSDFLPMQYQGMAGS 481
            + F  GS+MLSVTP+HQ YWRMN+GMQIIL FGMDLSFPASSIILSD LPMQYQGMAGS
Sbjct: 399 ALGFTMGSLMLSVTPIHQMYWRMNLGMQIILCFGMDLSFPASSIILSDHLPMQYQGMAGS 458

Query: 482 LVNTVVNYSTSLCLGMGNTVEQQYNAHGADLLKGYRSALYLAIGLASAGVCVSLVFLVTD 541
           LVNTV+NY+TSLCLGMG TVE+Q N  G DLLKGYRSALYLA+GL   G C++ + L   
Sbjct: 459 LVNTVINYATSLCLGMGTTVERQINKSGEDLLKGYRSALYLAVGLGGLGSCIAFINLCYT 518

Query: 542 IIAKRHRKRIESECES 557
           +  KR  +  + +  S
Sbjct: 519 LWMKRRDRLADLKSVS 534

>NCAS0C00400 Chr3 (61257..62810) [1554 bp, 517 aa] {ON} Anc_8.843
          Length = 517

 Score =  632 bits (1629), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 303/495 (61%), Positives = 363/495 (73%)

Query: 55  TSKGCICSVDDCHENDSPFQNPEYFETGFKEVMFIISCMVAQLLNQAGQTQSLSTMNVLA 114
           +S+    S D   EN +P+QN +YF++  KE  FI +CM A LLNQAGQTQ LSTMNV++
Sbjct: 10  SSQKKTLSCDSLLENSTPWQNEQYFQSHLKEYFFIFTCMFANLLNQAGQTQVLSTMNVIS 69

Query: 115 DYFKSNSSKQPWLMASFPLVSGSFILISGRLGDIYGLKKALSVGYIIMTLWSIICGLAKY 174
           + F S+   Q WLMASFPLVSGSFILISGR+GDIYGLKK +  GYI M +W+++CG A Y
Sbjct: 70  ESFHSDVGTQTWLMASFPLVSGSFILISGRIGDIYGLKKTMIGGYIFMIIWTLLCGFADY 129

Query: 175 TNSDAFFIVCRSFQGLGIAFILPNIMGLVGNIYKVGTLRKNIVISCIGCMAPXXXXXXXX 234
           T+SD FFIVCR+FQGLGI+FILPNIMGLVGNIYKVGTLRKNIVIS IG  AP        
Sbjct: 130 THSDTFFIVCRAFQGLGISFILPNIMGLVGNIYKVGTLRKNIVISLIGITAPTGACMGAL 189

Query: 235 XXXXIVTEDAEQWPWVFYAFGIASFVNMLLALYSIXXXXXXXXXXXXMDWIXXXXXXXXX 294
               I TE + QWPW+FYA+ +A+FVN+++A+YS+            MDW+         
Sbjct: 190 WGGLIATESSRQWPWIFYAYALAAFVNLIMAIYSVPENVPTNVHNFAMDWMGAIIGVVGL 249

Query: 295 XXXNIVWNQAPIVGWGEAYXXXXXXXXXXXXXXFVVYEIKYATSPLLPPSVLENKKILMI 354
              N VWNQ P+ GW + Y              F++YE+K+  SPLLP  V +N +IL I
Sbjct: 250 ILFNFVWNQGPVNGWAKPYIIVLLIISIIFLVAFIIYELKFPISPLLPREVTKNGQILTI 309

Query: 355 LAALFFGWGSFGIWTYYYYAFQLNLRKYTPLWAGGTHFMFVIWGTVAAFVVALTIKKVGP 414
           L  LF GWGSFGIWT+YYYAFQLNLR Y+PLWAG THFMF+IWG++AAF+V  TI +VGP
Sbjct: 310 LGILFLGWGSFGIWTFYYYAFQLNLRNYSPLWAGATHFMFIIWGSIAAFIVGFTINRVGP 369

Query: 415 AVLLCFSMVAFDCGSIMLSVTPVHQTYWRMNVGMQIILSFGMDLSFPASSIILSDFLPMQ 474
           AVLL FS + F  GS+MLSVTP+HQTYWRMNVGMQIILSFGMDLSFPASSIILSD LPMQ
Sbjct: 370 AVLLFFSALGFTMGSLMLSVTPIHQTYWRMNVGMQIILSFGMDLSFPASSIILSDHLPMQ 429

Query: 475 YQGMAGSLVNTVVNYSTSLCLGMGNTVEQQYNAHGADLLKGYRSALYLAIGLASAGVCVS 534
           YQGMAGSLVNT++NYSTSLCLGMG TVE+Q N  G +LL+GYRSALYLA+GL   G CV+
Sbjct: 430 YQGMAGSLVNTIINYSTSLCLGMGTTVERQINKTGEELLRGYRSALYLAVGLGGLGACVA 489

Query: 535 LVFLVTDIIAKRHRK 549
            + L  D+  KR  +
Sbjct: 490 FLNLCYDLWRKRKSR 504

>Suva_13.467 Chr13 complement(807375..809006) [1632 bp, 543 aa] {ON}
           YMR279C (REAL)
          Length = 543

 Score =  627 bits (1616), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 299/486 (61%), Positives = 364/486 (74%)

Query: 68  ENDSPFQNPEYFETGFKEVMFIISCMVAQLLNQAGQTQSLSTMNVLADYFKSNSSKQPWL 127
            NDSP+Q+P YF +  +E+MFI++CM+AQLLNQAGQT +L+ MNVL+  F S S KQ WL
Sbjct: 52  SNDSPWQDPTYFSSFGRELMFIVTCMLAQLLNQAGQTHALTIMNVLSKSFNSESDKQAWL 111

Query: 128 MASFPLVSGSFILISGRLGDIYGLKKALSVGYIIMTLWSIICGLAKYTNSDAFFIVCRSF 187
           MASFPLV+GSFILISGRLGDIYGLKK L +GY+ + +WS+ICGL+KY+N+DAFFI CR+F
Sbjct: 112 MASFPLVAGSFILISGRLGDIYGLKKMLMIGYVTIIVWSLICGLSKYSNNDAFFITCRAF 171

Query: 188 QGLGIAFILPNIMGLVGNIYKVGTLRKNIVISCIGCMAPXXXXXXXXXXXXIVTEDAEQW 247
           QGLGIAFILPN+MGLVG++YKVG+ RKN+VIS IG  AP            IV ED+EQW
Sbjct: 172 QGLGIAFILPNVMGLVGHVYKVGSTRKNLVISFIGACAPAGGMFGGLFGGLIVNEDSEQW 231

Query: 248 PWVFYAFGIASFVNMLLALYSIXXXXXXXXXXXXMDWIXXXXXXXXXXXXNIVWNQAPIV 307
           PWVFYAF IA F+NM+LA YSI            MDW             N VWNQAP  
Sbjct: 232 PWVFYAFAIAFFLNMILAWYSIPNNIPTNVHGFSMDWTGSVLAVIGLILFNFVWNQAPTA 291

Query: 308 GWGEAYXXXXXXXXXXXXXXFVVYEIKYATSPLLPPSVLENKKILMILAALFFGWGSFGI 367
           GWG AY              F VYE+KYA  PLLP +V +N+ ++MIL A+F GWGSFGI
Sbjct: 292 GWGTAYIIALLIISVFFLVAFFVYEVKYAKVPLLPHAVTKNRHMIMILLAVFLGWGSFGI 351

Query: 368 WTYYYYAFQLNLRKYTPLWAGGTHFMFVIWGTVAAFVVALTIKKVGPAVLLCFSMVAFDC 427
           WT+YY +FQLNLR Y+P+W GGT+F+FVI+GT+AAF+VAL+IK+VGPA LLCF++VAFD 
Sbjct: 352 WTFYYMSFQLNLRHYSPVWTGGTYFVFVIFGTIAAFMVALSIKRVGPAFLLCFALVAFDV 411

Query: 428 GSIMLSVTPVHQTYWRMNVGMQIILSFGMDLSFPASSIILSDFLPMQYQGMAGSLVNTVV 487
           GSIM SV PV Q++W++N GMQ IL FGMDLSFPASSIILSD LPM+YQGMAGSLVNTV+
Sbjct: 412 GSIMFSVLPVKQSFWKLNFGMQAILCFGMDLSFPASSIILSDGLPMEYQGMAGSLVNTVI 471

Query: 488 NYSTSLCLGMGNTVEQQYNAHGADLLKGYRSALYLAIGLASAGVCVSLVFLVTDIIAKRH 547
           NYS SLCLGMG TVE Q N +G DLLKGYR A+YL +GLAS GV +S  +++      R 
Sbjct: 472 NYSASLCLGMGATVEHQINKNGKDLLKGYRGAIYLGVGLASLGVLISFTYMLETFWNNRR 531

Query: 548 RKRIES 553
            ++ +S
Sbjct: 532 DRQKDS 537

>KNAG0J00260 Chr10 (37950..39602) [1653 bp, 550 aa] {ON} Anc_8.843
           YMR279C
          Length = 550

 Score =  616 bits (1589), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 297/486 (61%), Positives = 360/486 (74%)

Query: 53  SVTSKGCICSVDDCHENDSPFQNPEYFETGFKEVMFIISCMVAQLLNQAGQTQSLSTMNV 112
           S  S+   CS  +  +ND+P+QNP YF   ++E  FI +CM+AQLLNQAGQ Q+ + MN+
Sbjct: 42  STESEAEWCSESEFTDNDTPWQNPTYFANRWQEYAFISTCMLAQLLNQAGQAQATAPMNI 101

Query: 113 LADYFKSNSSKQPWLMASFPLVSGSFILISGRLGDIYGLKKALSVGYIIMTLWSIICGLA 172
           LAD F S++ KQ WLMASFPLVSGSFIL+SGR+GDIYGLKK L  GY+++ +WS+ICG A
Sbjct: 102 LADAFNSSAKKQTWLMASFPLVSGSFILVSGRIGDIYGLKKTLIGGYLVVLIWSLICGFA 161

Query: 173 KYTNSDAFFIVCRSFQGLGIAFILPNIMGLVGNIYKVGTLRKNIVISCIGCMAPXXXXXX 232
            YT++DAFFI+CR+FQGLGIAFILPN+MGL+GNIYK  TLRKN VIS +G  AP      
Sbjct: 162 NYTHNDAFFILCRAFQGLGIAFILPNVMGLIGNIYKANTLRKNFVISFVGMCAPIGAALG 221

Query: 233 XXXXXXIVTEDAEQWPWVFYAFGIASFVNMLLALYSIXXXXXXXXXXXXMDWIXXXXXXX 292
                 I  E+ +QWPW+FYA+ I   +NM++A+YSI            MDW        
Sbjct: 222 GVWSGLIAHENPKQWPWIFYAYAIVVAINMVMAIYSIPSTVPTNIHGFGMDWTGSAIGVV 281

Query: 293 XXXXXNIVWNQAPIVGWGEAYXXXXXXXXXXXXXXFVVYEIKYATSPLLPPSVLENKKIL 352
                N VWNQ PI GW + Y              F +YEIK+A SPLLPP V++N+ I 
Sbjct: 282 GMILFNFVWNQGPIDGWNKGYIIALLIVSVFLLIAFFIYEIKFAKSPLLPPEVIKNRHIG 341

Query: 353 MILAALFFGWGSFGIWTYYYYAFQLNLRKYTPLWAGGTHFMFVIWGTVAAFVVALTIKKV 412
           MIL A+F GWGSFGIWT+YYYAFQLNLR Y+ +WAGGT FMFVIWGT+AAF+VALTIK+V
Sbjct: 342 MILLAVFMGWGSFGIWTFYYYAFQLNLRHYSAVWAGGTFFMFVIWGTIAAFLVALTIKRV 401

Query: 413 GPAVLLCFSMVAFDCGSIMLSVTPVHQTYWRMNVGMQIILSFGMDLSFPASSIILSDFLP 472
           GP+VLLCFSM  F  G IMLSVTPVHQ+YW+MN+GMQIILSFGMDLSFPASSIILSDFLP
Sbjct: 402 GPSVLLCFSMTGFTVGCIMLSVTPVHQSYWKMNLGMQIILSFGMDLSFPASSIILSDFLP 461

Query: 473 MQYQGMAGSLVNTVVNYSTSLCLGMGNTVEQQYNAHGADLLKGYRSALYLAIGLASAGVC 532
            QYQGMAGSLVNT+VNYSTSLCLG+G+T E Q N +G D LKGYR+ALY+ IGL + G+ 
Sbjct: 462 SQYQGMAGSLVNTMVNYSTSLCLGVGSTAEAQVNKNGTDKLKGYRAALYVGIGLGACGML 521

Query: 533 VSLVFL 538
           V+  +L
Sbjct: 522 VAFCYL 527

>YMR279C Chr13 complement(824729..826351) [1623 bp, 540 aa] {ON}
           Putative boron transporter involved in boron efflux and
           resistance; overexpression mutant but not null mutant
           displays boron tolerance phenotype; identified as a
           heat-induced gene in a high-throughout screen; YMR279C
           is not an essential gene; paralog of the efflux pump
           ATR1
          Length = 540

 Score =  614 bits (1584), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 299/489 (61%), Positives = 364/489 (74%), Gaps = 1/489 (0%)

Query: 69  NDSPFQNPEYFETGFKEVMFIISCMVAQLLNQAGQTQSLSTMNVLADYFKSNSSKQPWLM 128
           NDSP+Q+P YF +  KE+MFI +CM+AQLLNQAGQT +L  MNVL+  F S ++ Q WLM
Sbjct: 53  NDSPWQDPTYFSSFGKELMFIATCMLAQLLNQAGQTHALCIMNVLSKSFNSEANNQAWLM 112

Query: 129 ASFPLVSGSFILISGRLGDIYGLKKALSVGYIIMTLWSIICGLAKYTNSDAFFIVCRSFQ 188
           ASFPL +GSFILISGRLGDIYGLKK L VGY+I+ +WSII GL+KY+NSDAFFI  R+FQ
Sbjct: 113 ASFPLAAGSFILISGRLGDIYGLKKMLIVGYVIVIVWSIISGLSKYSNSDAFFITSRAFQ 172

Query: 189 GLGIAFILPNIMGLVGNIYKVGTLRKNIVISCIGCMAPXXXXXXXXXXXXIVTEDAEQWP 248
           G+GIAFILPNIMGLVG++YKVG+ RKNIVIS IG  AP            IVTED  QWP
Sbjct: 173 GVGIAFILPNIMGLVGHVYKVGSFRKNIVISFIGACAPTGGMFGGLFGGLIVTEDPNQWP 232

Query: 249 WVFYAFGIASFVNMLLALYSIXXXXXXXXXXXXMDWIXXXXXXXXXXXXNIVWNQAPIVG 308
           WVFYAFGIA+F+++L+A YSI            MDW             N VWNQAPIVG
Sbjct: 233 WVFYAFGIATFLSLLMAWYSIPNNVPTNIHGLSMDWTGSALAIIGLILFNFVWNQAPIVG 292

Query: 309 WGEAYXXXXXXXXXXXXXXFVVYEIKYATSPLLPPSVLENKKILMILAALFFGWGSFGIW 368
           W + Y              F VYE KYA  PLLP ++ +N+ ++MIL A+F GWGSFGIW
Sbjct: 293 WDKPYIIVLLIISVIFLVAFFVYESKYAEVPLLPRAMTKNRHMIMILLAVFLGWGSFGIW 352

Query: 369 TYYYYAFQLNLRKYTPLWAGGTHFMFVIWGTVAAFVVALTIKKVGPAVLLCFSMVAFDCG 428
           T+YY +FQLNLR Y+P+W GGT+F+FVI+G++AAF VA +IK++GPA+LLCFS++AFD G
Sbjct: 353 TFYYVSFQLNLRHYSPVWTGGTYFVFVIFGSMAAFFVAFSIKRLGPALLLCFSLMAFDAG 412

Query: 429 SIMLSVTPVHQTYWRMNVGMQIILSFGMDLSFPASSIILSDFLPMQYQGMAGSLVNTVVN 488
           SIM SV PV Q+YW++N  MQ IL FGMDLSFPASSIILSD LPMQYQGMAGSLVNTV+N
Sbjct: 413 SIMFSVLPVEQSYWKLNFAMQAILCFGMDLSFPASSIILSDGLPMQYQGMAGSLVNTVIN 472

Query: 489 YSTSLCLGMGNTVEQQYNAHGADLLKGYRSALYLAIGLASAGVCVSLVFLVTDIIAKRHR 548
           YS SLCLGMG TVE Q N  G DLLKGYR+A+YL +GLAS GV +S+ +++ + +  RHR
Sbjct: 473 YSASLCLGMGGTVEHQINKSGNDLLKGYRAAVYLGVGLASLGVVISVTYMLEN-LWNRHR 531

Query: 549 KRIESECES 557
           K  +   E+
Sbjct: 532 KSEDRSLEA 540

>Smik_13.492 Chr13 complement(807726..809357) [1632 bp, 543 aa] {ON}
           YMR279C (REAL)
          Length = 543

 Score =  612 bits (1579), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 303/489 (61%), Positives = 369/489 (75%), Gaps = 3/489 (0%)

Query: 69  NDSPFQNPEYFETGFKEVMFIISCMVAQLLNQAGQTQSLSTMNVLADYFKSNSSKQPWLM 128
           NDSP+Q+P YF +  KE+MFI +CM+AQLLNQAGQT +L  MNVL+  F S S+ Q WLM
Sbjct: 53  NDSPWQDPIYFSSFGKELMFIATCMLAQLLNQAGQTHALCIMNVLSKSFNSESNNQAWLM 112

Query: 129 ASFPLVSGSFILISGRLGDIYGLKKALSVGYIIMTLWSIICGLAKYTNSDAFFIVCRSFQ 188
           ASFPL +GSFILISGRLGDIYGLKK L +GY+I+ +WSII GL+KY+NSDAFFI CR+FQ
Sbjct: 113 ASFPLAAGSFILISGRLGDIYGLKKMLLIGYVIIIIWSIISGLSKYSNSDAFFITCRAFQ 172

Query: 189 GLGIAFILPNIMGLVGNIYKVGTLRKNIVISCIGCMAPXXXXXXXXXXXXIVTEDAEQWP 248
           GLGIAFILPNIMGLVG++YKVG+LRKN+VIS IG  AP            IVTED EQWP
Sbjct: 173 GLGIAFILPNIMGLVGHVYKVGSLRKNLVISVIGACAPAGGMFGGVFGGLIVTEDPEQWP 232

Query: 249 WVFYAFGIASFVNMLLALYSIXXXXXXXXXXXXMDWIXXXXXXXXXXXXNIVWNQAPIVG 308
           WVFYAF IA+F+++L+A YSI            MDW             N VWNQAPI G
Sbjct: 233 WVFYAFSIATFISLLMAWYSIPNNVPTNVHGLSMDWTGSTLAVLGLILFNFVWNQAPIAG 292

Query: 309 WGEAYXXXXXXXXXXXXXXFVVYEIKYATSPLLPPSVLENKKILMILAALFFGWGSFGIW 368
           WGEAY              F VYEIKYA  PLLP +V +N+ ++MIL A+F GWGSFGIW
Sbjct: 293 WGEAYIIVLLILSVFFLIAFFVYEIKYAEVPLLPHAVTKNRHMIMILLAVFLGWGSFGIW 352

Query: 369 TYYYYAFQLNLRKYTPLWAGGTHFMFVIWGTVAAFVVALTIKKVGPAVLLCFSMVAFDCG 428
           T+YY +FQLNLR Y+P+W GGT+F+FVI+G++AAF VA +IK++GPA+LLCF+++AFD G
Sbjct: 353 TFYYVSFQLNLRHYSPVWTGGTYFVFVIFGSIAAFFVAFSIKRLGPAILLCFALMAFDAG 412

Query: 429 SIMLSVTPVHQTYWRMNVGMQIILSFGMDLSFPASSIILSDFLPMQYQGMAGSLVNTVVN 488
           SIM SV PV Q+YW++N  MQ IL FGMDLSFPASSIILSD LPMQYQGMAGSLVNTV+N
Sbjct: 413 SIMFSVLPVEQSYWKLNFAMQAILCFGMDLSFPASSIILSDGLPMQYQGMAGSLVNTVIN 472

Query: 489 YSTSLCLGMGNTVEQQYNAHGADLLKGYRSALYLAIGLASAGVCVSLVFLVTDIIAKR-- 546
           YS SLCLGMG TVE+Q N  G +LLKGYR+A+YL IGLAS G+ +S+ +++ +   K   
Sbjct: 473 YSASLCLGMGVTVERQINKSGQNLLKGYRAAIYLGIGLASLGLLISVTYMLENFWNKHKE 532

Query: 547 -HRKRIESE 554
             +KR+E+E
Sbjct: 533 SEKKRLEAE 541

>KAFR0B03930 Chr2 complement(816351..818018) [1668 bp, 555 aa] {ON} 
          Length = 555

 Score =  601 bits (1550), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 294/492 (59%), Positives = 361/492 (73%)

Query: 57  KGCICSVDDCHENDSPFQNPEYFETGFKEVMFIISCMVAQLLNQAGQTQSLSTMNVLADY 116
           +G     +   +N++P+QNP YF + +KE +FI++CM++ LLNQAGQTQ+ STMNV+   
Sbjct: 53  EGTSPDAEKFSDNNTPWQNPSYFSSRWKEYLFILTCMLSNLLNQAGQTQATSTMNVIGSA 112

Query: 117 FKSNSSKQPWLMASFPLVSGSFILISGRLGDIYGLKKALSVGYIIMTLWSIICGLAKYTN 176
           F ++SS + WLMASFPLVSGSFIL+SGR+GDIYGLK+ +  G I+M +WS+ICG A Y++
Sbjct: 113 FNADSSSKTWLMASFPLVSGSFILVSGRIGDIYGLKRTMIGGLIVMIIWSLICGFANYSS 172

Query: 177 SDAFFIVCRSFQGLGIAFILPNIMGLVGNIYKVGTLRKNIVISCIGCMAPXXXXXXXXXX 236
           S  FFI+CR+FQGLGIAF+LPN+MGLVGNIYKVG+LRKNIVISCIG  AP          
Sbjct: 173 SVTFFIICRAFQGLGIAFVLPNVMGLVGNIYKVGSLRKNIVISCIGMCAPTGAAFGAFWA 232

Query: 237 XXIVTEDAEQWPWVFYAFGIASFVNMLLALYSIXXXXXXXXXXXXMDWIXXXXXXXXXXX 296
             I T+  +QWPW+FYA+  A  +N++LA+YSI            MDW            
Sbjct: 233 GLIATKAEKQWPWIFYAYAFAGILNLVLAIYSIPDTVPVNVHGFSMDWTGSVVGVIGLIL 292

Query: 297 XNIVWNQAPIVGWGEAYXXXXXXXXXXXXXXFVVYEIKYATSPLLPPSVLENKKILMILA 356
            N VWN+APIVGW +AY              F +YEIK+A SPLLP +V  N  I+MIL+
Sbjct: 293 FNFVWNEAPIVGWEKAYIIVLLIFSLLIIVVFFIYEIKFAKSPLLPQAVTHNHNIIMILS 352

Query: 357 ALFFGWGSFGIWTYYYYAFQLNLRKYTPLWAGGTHFMFVIWGTVAAFVVALTIKKVGPAV 416
           A+F GWGSFGIWT+YYYAF LNLR YTPL AG +H MF++WGT+AAF VA TIK+VGP+V
Sbjct: 353 AMFMGWGSFGIWTFYYYAFLLNLRGYTPLEAGASHCMFILWGTIAAFTVAFTIKRVGPSV 412

Query: 417 LLCFSMVAFDCGSIMLSVTPVHQTYWRMNVGMQIILSFGMDLSFPASSIILSDFLPMQYQ 476
           LL  SMVAF  GSIMLS+TPVHQTYW+M  GMQIIL+FGMDLSFPASSIILSD LPM+YQ
Sbjct: 413 LLFCSMVAFTVGSIMLSITPVHQTYWKMTFGMQIILAFGMDLSFPASSIILSDALPMEYQ 472

Query: 477 GMAGSLVNTVVNYSTSLCLGMGNTVEQQYNAHGADLLKGYRSALYLAIGLASAGVCVSLV 536
           GMAGSLVNT+VNYSTSLCLGMG T E Q N +G DLLKGYR+ALY+ IGL   GV ++ +
Sbjct: 473 GMAGSLVNTIVNYSTSLCLGMGTTAEIQVNKNGTDLLKGYRAALYVGIGLGVVGVIIAAL 532

Query: 537 FLVTDIIAKRHR 548
           FL   +  KR R
Sbjct: 533 FLFESLRQKRGR 544

>NDAI0K00400 Chr11 (90040..91701) [1662 bp, 553 aa] {ON} 
          Length = 553

 Score =  598 bits (1543), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 296/492 (60%), Positives = 360/492 (73%), Gaps = 1/492 (0%)

Query: 67  HENDSPFQNPEYFETGFKEVMFIISCMVAQLLNQAGQTQSLSTMNVLADYFKSNSSKQPW 126
            EN+S +QNP+YF + FKE +F+ +CM+A LLNQAGQ+Q LS MNV++D F S++  Q W
Sbjct: 57  QENNSSWQNPDYFSSSFKEYIFVATCMIANLLNQAGQSQVLSAMNVISDSFHSSTGGQTW 116

Query: 127 LMASFPLVSGSFILISGRLGDIYGLKKALSVGYIIMTLWSIICGLAKYTNSDAFFIVCRS 186
           LMASFPLVSGSFILISGRLGDIYGLK+ +  G+I M +WS+ICG   Y +SD FFIV R+
Sbjct: 117 LMASFPLVSGSFILISGRLGDIYGLKRMMIGGFIFMIIWSLICGFTNYAHSDTFFIVARA 176

Query: 187 FQGLGIAFILPNIMGLVGNIYKVGTLRKNIVISCIGCMAPXXXXXXXXXXXXIVTEDAEQ 246
           FQGLGI+FILPN+MGLVGNIYKVGTLRKN+VIS IG MAP            IVTE+ +Q
Sbjct: 177 FQGLGISFILPNVMGLVGNIYKVGTLRKNVVISLIGIMAPTGSCFGALWGGLIVTENPKQ 236

Query: 247 WPWVFYAFGIASFVNMLLALYSIXXXXXXXXXXXXMDWIXXXXXXXXXXXXNIVWNQAPI 306
           WPW+FYA+ +A+ V +++  Y++            MDWI            N VWNQ PI
Sbjct: 237 WPWIFYAYAVAAAVCLVMGYYTVPDNIPTNVNGFTMDWIGSVLGVIGLILFNFVWNQGPI 296

Query: 307 VGWGEAYXXXXXXXXXXXXXXFVVYEIKYATSPLLPPSVLENKKILMILAALFFGWGSFG 366
           VGW +AY              F VYEIKYA  PLLP +V +N  IL IL  LF GWGSFG
Sbjct: 297 VGWEKAYIIVLLIVSVIFLIAFFVYEIKYAKVPLLPKAVTQNGHILTILTVLFLGWGSFG 356

Query: 367 IWTYYYYAFQLNLRKYTPLWAGGTHFMFVIWGTVAAFVVALTIKKVGPAVLLCFSMVAFD 426
           IWT+YY+AFQLNLR+Y+P+W+GGT F+F+I+GTVAA  VALTIKKVGPA+LL FS + F 
Sbjct: 357 IWTFYYFAFQLNLREYSPVWSGGTFFVFIIFGTVAATTVALTIKKVGPAILLFFSAIGFT 416

Query: 427 CGSIMLSVTPVHQTYWRMNVGMQIILSFGMDLSFPASSIILSDFLPMQYQGMAGSLVNTV 486
           CGSI++SVTPVHQTYWR   GMQIIL FGMDL FPASSIILSD+LPMQYQGMA SLVNT+
Sbjct: 417 CGSIIMSVTPVHQTYWRNTFGMQIILVFGMDLPFPASSIILSDYLPMQYQGMAVSLVNTI 476

Query: 487 VNYSTSLCLGMGNTVEQQYNAHGADLLKGYRSALYLAIGLASAGVCVSLVFLVTDIIAKR 546
           VNYSTSLCLGMG TVE+Q N  G DLLKGYR+ALY  +G+A  G C++ + +  DI +KR
Sbjct: 477 VNYSTSLCLGMGTTVERQINKSGDDLLKGYRAALYFGVGIAGLGACIAFLNVCHDIWSKR 536

Query: 547 HRKRIESECESC 558
           + K    + + C
Sbjct: 537 NAKD-PKDLQRC 547

>Skud_13.451 Chr13 complement(798006..799625) [1620 bp, 539 aa] {ON}
           YMR279C (REAL)
          Length = 539

 Score =  593 bits (1530), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 294/489 (60%), Positives = 364/489 (74%), Gaps = 3/489 (0%)

Query: 68  ENDSPFQNPEYFETGFKEVMFIISCMVAQLLNQAGQTQSLSTMNVLADYFKSNSSKQPWL 127
            NDSP+Q+P YF +  KE+MFI +CM+AQLLNQAGQT +L  MNVL+  F S S+ Q WL
Sbjct: 51  SNDSPWQDPTYFSSFGKELMFIGTCMLAQLLNQAGQTHALCIMNVLSKSFGSESNNQAWL 110

Query: 128 MASFPLVSGSFILISGRLGDIYGLKKALSVGYIIMTLWSIICGLAKYTNSDAFFIVCRSF 187
           MASFPL +GSFILISGRLGDIYGLKK L +GY+I+ +WSII GL+KY+N+D+FFI CR+F
Sbjct: 111 MASFPLAAGSFILISGRLGDIYGLKKMLMIGYVIIIVWSIISGLSKYSNNDSFFITCRAF 170

Query: 188 QGLGIAFILPNIMGLVGNIYKVGTLRKNIVISCIGCMAPXXXXXXXXXXXXIVTEDAEQW 247
           QG+GIAFILPNIMGLVG++YKVG+LRKN+VIS IG   P            IVTED  QW
Sbjct: 171 QGVGIAFILPNIMGLVGHVYKVGSLRKNLVISVIGACGPTGALFGGVFGGLIVTEDPNQW 230

Query: 248 PWVFYAFGIASFVNMLLALYSIXXXXXXXXXXXXMDWIXXXXXXXXXXXXNIVWNQAPIV 307
           PWVFYAFGIA+F++ML+A YSI            MDW             N VWN+API 
Sbjct: 231 PWVFYAFGIATFISMLMAWYSIPNNVPTNVHGLSMDWTGSVLAVIGLILFNFVWNEAPIA 290

Query: 308 GWGEAYXXXXXXXXXXXXXXFVVYEIKYATSPLLPPSVLENKKILMILAALFFGWGSFGI 367
           GW +AY              F VYEIKYA  PLLP +V +N+ ++MIL A+F GWGSFGI
Sbjct: 291 GWDKAYIIVLLVVSVFFLVAFFVYEIKYAEVPLLPHAVTKNRHMIMILLAVFVGWGSFGI 350

Query: 368 WTYYYYAFQLNLRKYTPLWAGGTHFMFVIWGTVAAFVVALTIKKVGPAVLLCFSMVAFDC 427
           WT+YY +FQLNLR Y+P+W GGT+F+F I+GT+AAF VA +IK++GPA+LLCF+++AFD 
Sbjct: 351 WTFYYVSFQLNLRHYSPVWTGGTYFVFAIFGTIAAFFVAFSIKRLGPALLLCFALMAFDA 410

Query: 428 GSIMLSVTPVHQTYWRMNVGMQIILSFGMDLSFPASSIILSDFLPMQYQGMAGSLVNTVV 487
           GSIM SV PV Q+YW++N  MQ +L FGMDLSFPASSIILSD LPMQYQGMAGSLVNTV+
Sbjct: 411 GSIMFSVLPVEQSYWKLNFAMQAVLCFGMDLSFPASSIILSDGLPMQYQGMAGSLVNTVI 470

Query: 488 NYSTSLCLGMGNTVEQQYNAHGADLLKGYRSALYLAIGLASAGVCVSLVFLVTDIIAKR- 546
           NYS SLCLGMG TVE Q N  G ++L+GYR+A+YL IGLAS GV +S+ +++  +  +R 
Sbjct: 471 NYSASLCLGMGATVEHQINKSGKNVLEGYRAAVYLGIGLASLGVLISVTYMLETVWNERK 530

Query: 547 --HRKRIES 553
              RK +E+
Sbjct: 531 KCQRKSLEA 539

>YML116W Chr13 (38196..39824) [1629 bp, 542 aa] {ON}  ATR1Multidrug
           efflux pump of the major facilitator superfamily,
           required for resistance to aminotriazole and
           4-nitroquinoline-N-oxide
          Length = 542

 Score =  592 bits (1525), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 285/504 (56%), Positives = 363/504 (72%), Gaps = 1/504 (0%)

Query: 53  SVTSKGCICSVDDCHENDSPFQNPEYFETGFKEVMFIISCMVAQLLNQAGQTQSLSTMNV 112
           S+T+     S D+  +++  +QNP YF+  ++E +FI +CM++QLLNQAG TQ+LS MN+
Sbjct: 36  SLTATAFTQSEDEMVDSNQKWQNPNYFKYAWQEYLFIFTCMISQLLNQAGTTQTLSIMNI 95

Query: 113 LADYFKSNSSKQPWLMASFPLVSGSFILISGRLGDIYGLKKALSVGYIIMTLWSIICGLA 172
           L+D F S  + + WLMASFPLVSGSFILISGRLGDIYGLKK L VGY+++ +WS+ICG+ 
Sbjct: 96  LSDSFGSEGNSKSWLMASFPLVSGSFILISGRLGDIYGLKKMLLVGYVLVIIWSLICGIT 155

Query: 173 KYTNSDAFFIVCRSFQGLGIAFILPNIMGLVGNIYKVGTLRKNIVISCIGCMAPXXXXXX 232
           KY+ SD FFI+ R+FQGLGIAF+LPN++G++GNIY  GT RKNIVIS +G MAP      
Sbjct: 156 KYSGSDTFFIISRAFQGLGIAFVLPNVLGIIGNIYVGGTFRKNIVISFVGAMAPIGATLG 215

Query: 233 XXXXXXIVTEDAEQWPWVFYAFGIASFVNMLLALYSIXXXXXXXXXXXXMDWIXXXXXXX 292
                 I TED +QWPW FYA+ IA+F+N +L++Y+I            MDWI       
Sbjct: 216 CLFAGLIGTEDPKQWPWAFYAYSIAAFINFVLSIYAIPSTIPTNIHHFSMDWIGSVLGVI 275

Query: 293 XXXXXNIVWNQAPIVGWGEAYXXXXXXXXXXXXXXFVVYEIKYATSPLLPPSVLENKKIL 352
                N VWNQAPI GW +AY              F++YEI++A +PLLP +V++++ ++
Sbjct: 276 GLILLNFVWNQAPISGWNQAYIIVILIISVIFLVVFIIYEIRFAKTPLLPRAVIKDRHMI 335

Query: 353 MILAALFFGWGSFGIWTYYYYAFQLNLRKYTPLWAGGTHFMFVIWGTVAAFVVALTIKKV 412
            I+ ALFFGWGSFGI+T+YY+ FQLN+R+YT LWAGGT+FMF+IWG +AA +V  TIK V
Sbjct: 336 QIMLALFFGWGSFGIFTFYYFQFQLNIRQYTALWAGGTYFMFLIWGIIAALLVGFTIKNV 395

Query: 413 GPAVLLCFSMVAFDCGSIMLSVTPVHQTYWRMNVGMQIILSFGMDLSFPASSIILSDFLP 472
            P+V L FSMVAF+ GSIM SVTPVH+TY+R  +G  IILSFGMDLSFPASSII SD LP
Sbjct: 396 SPSVFLFFSMVAFNVGSIMASVTPVHETYFRTQLGTMIILSFGMDLSFPASSIIFSDNLP 455

Query: 473 MQYQGMAGSLVNTVVNYSTSLCLGMGNTVEQQYNAHGADLLKGYRSALYLAIGLASAGVC 532
           M+YQGMAGSLVNTVVNYS SLCLGMG TVE Q N+ G  LLKGYR A YL IGLAS    
Sbjct: 456 MEYQGMAGSLVNTVVNYSMSLCLGMGATVETQVNSDGKHLLKGYRGAQYLGIGLASLACM 515

Query: 533 VSLVFLVTDII-AKRHRKRIESEC 555
           +S +++V   I  +R R   E +C
Sbjct: 516 ISGLYMVESFIKGRRARAAAEYDC 539

>KAFR0B03940 Chr2 complement(820954..822597) [1644 bp, 547 aa] {ON}
           Anc_8.843 YMR279C
          Length = 547

 Score =  579 bits (1492), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 280/511 (54%), Positives = 356/511 (69%), Gaps = 10/511 (1%)

Query: 51  QLSVTSKGCICSVDDCHE--NDSPFQNPEYFETGFKEVMFIISCMVAQLLNQAGQTQSLS 108
           Q+S+T        DD     N+S +Q+P YF++ ++E  FI +CM+A LLNQAGQTQ+LS
Sbjct: 44  QISITD-------DDVSSISNNSKWQDPTYFKSSWQEYTFIGTCMLANLLNQAGQTQTLS 96

Query: 109 TMNVLADYFKSNSSKQPWLMASFPLVSGSFILISGRLGDIYGLKKALSVGYIIMTLWSII 168
           TMNVLAD   S+ + + WLMASF L SGSFIL+SGR+GDIYGLK     G II  +WSI+
Sbjct: 97  TMNVLADSLNSDGAAKTWLMASFTLASGSFILVSGRIGDIYGLKATFIGGNIIFCIWSIL 156

Query: 169 CGLAKYTNSDAFFIVCRSFQGLGIAFILPNIMGLVGNIYKVGTLRKNIVISCIGCMAPXX 228
           CG++KYT +  FFI+CR+FQGLG+AF+LPN+MGLVGNIY VG++RKNIVIS IGCMAP  
Sbjct: 157 CGVSKYTENVTFFIICRAFQGLGVAFVLPNVMGLVGNIYNVGSMRKNIVISFIGCMAPVG 216

Query: 229 XXXXXXXXXXIVTEDAEQWPWVFYAFGIASFVNMLLALYSIXXXXXXXXXXXXMDWIXXX 288
                     IV  + +QWPW+F+A  IA F+N+++ +YSI            MDWI   
Sbjct: 217 QTFGGMWGGLIVDSNKDQWPWIFFATAIAVFINLIMGIYSIPNHVPTNIYNLKMDWIGSL 276

Query: 289 XXXXXXXXXNIVWNQAPIVGWGEAYXXXXXXXXXXXXXXFVVYEIKYATSPLLPPSVLEN 348
                    N VWNQAPI GW +AY              F +YE+K A SPLLPP V +N
Sbjct: 277 LGVIGLILMNFVWNQAPISGWSKAYIIVILIVAVFFLVAFFIYELKKAESPLLPPEVTKN 336

Query: 349 KKILMILAALFFGWGSFGIWTYYYYAFQLNLRKYTPLWAGGTHFMFVIWGTVAAFVVALT 408
           + I+ I+ +LF GWG+FGIWT+YYYAF LNLR ++PLWAG THF+F+I+G++ A  VA T
Sbjct: 337 RHIVTIIISLFLGWGAFGIWTFYYYAFNLNLRHFSPLWAGSTHFVFIIFGSLTAITVAFT 396

Query: 409 IKKVGPAVLLCFSMVAFDCGSIMLSVTPVHQTYWRMNVGMQIILSFGMDLSFPASSIILS 468
           I KVGP+VL C S + F CG+I+ SVT   QTYWR ++GMQIIL+ GMDLSFP SSIILS
Sbjct: 397 INKVGPSVLFCLSSIGFTCGNIIFSVTSPDQTYWRNSLGMQIILALGMDLSFPGSSIILS 456

Query: 469 DFLPMQYQGMAGSLVNTVVNYSTSLCLGMGNTVEQQYNAHGADLLKGYRSALYLAIGLAS 528
           D LPMQYQGM+GSLVNT+ NY+TSLCLGMG T E QYN  G D+LKGYR+ALY+AIGL +
Sbjct: 457 DLLPMQYQGMSGSLVNTITNYATSLCLGMGTTAEVQYNNGGKDVLKGYRAALYVAIGLGA 516

Query: 529 AGVCVSLVFLVTDI-IAKRHRKRIESECESC 558
            G   S  ++  D+ I  R R++ E + + C
Sbjct: 517 LGFAFSFSYMAEDLWIRYRKRRQNEKKEDKC 547

>Smik_13.18 Chr13 (34422..36059) [1638 bp, 545 aa] {ON} YML116W
           (REAL)
          Length = 545

 Score =  573 bits (1476), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 281/495 (56%), Positives = 351/495 (70%), Gaps = 1/495 (0%)

Query: 64  DDCHENDSPFQNPEYFETGFKEVMFIISCMVAQLLNQAGQTQSLSTMNVLADYFKSNSSK 123
           D+  E +  +QNP+YF+  ++E +FI +CM++QLLNQAG TQ+LS MN+L+D F S  + 
Sbjct: 50  DEMVECNQKWQNPKYFKYAWQEYLFIFTCMISQLLNQAGTTQTLSIMNILSDSFGSEGNS 109

Query: 124 QPWLMASFPLVSGSFILISGRLGDIYGLKKALSVGYIIMTLWSIICGLAKYTNSDAFFIV 183
           + WLMASFPLVSGSFILISGRLGDIYGLKK L VGY+++ +WS+ICG+  Y+ SD FFI+
Sbjct: 110 KSWLMASFPLVSGSFILISGRLGDIYGLKKMLLVGYVLVIIWSLICGITNYSGSDTFFII 169

Query: 184 CRSFQGLGIAFILPNIMGLVGNIYKVGTLRKNIVISCIGCMAPXXXXXXXXXXXXIVTED 243
           CR+FQGLGIAF+LPN++G++GNIY  GT RKNIVIS +G MAP            I TE+
Sbjct: 170 CRAFQGLGIAFVLPNVLGIIGNIYVGGTFRKNIVISFVGAMAPIGATLGCLFAGLIGTEN 229

Query: 244 AEQWPWVFYAFGIASFVNMLLALYSIXXXXXXXXXXXXMDWIXXXXXXXXXXXXNIVWNQ 303
             QWPW FYAF IAS +N  L++Y+I            MDWI            N VWNQ
Sbjct: 230 PNQWPWAFYAFSIASLINFGLSIYAIPNNIPTNIHHFSMDWIGSVLGVIGLILLNFVWNQ 289

Query: 304 APIVGWGEAYXXXXXXXXXXXXXXFVVYEIKYATSPLLPPSVLENKKILMILAALFFGWG 363
           API GW +AY              F++YE+ +A SPLLP +V+++  ++ I+ ALFFGWG
Sbjct: 290 APISGWSQAYIIVILIISVIFLAVFIIYEMWFAKSPLLPHAVIKDYHMIQIMLALFFGWG 349

Query: 364 SFGIWTYYYYAFQLNLRKYTPLWAGGTHFMFVIWGTVAAFVVALTIKKVGPAVLLCFSMV 423
           SFGI+T+YY+ FQLN+R YT LWAGGT+FMF+IWG +AA +V  TIK V P+V L FSMV
Sbjct: 350 SFGIFTFYYFQFQLNIRHYTALWAGGTYFMFLIWGIIAALLVGFTIKNVSPSVYLFFSMV 409

Query: 424 AFDCGSIMLSVTPVHQTYWRMNVGMQIILSFGMDLSFPASSIILSDFLPMQYQGMAGSLV 483
           AF+ GSIM SVTPVH+TY+R  +G  IILSFGMDLSFPASSII SD LPM+YQGMAGSLV
Sbjct: 410 AFNVGSIMASVTPVHETYFRTQLGTMIILSFGMDLSFPASSIIFSDNLPMEYQGMAGSLV 469

Query: 484 NTVVNYSTSLCLGMGNTVEQQYNAHGADLLKGYRSALYLAIGLASAGVCVSLVFLVTDII 543
           NTVVNYS SLCLGMG TVE Q +  G  LLKGYR A YL IGLAS    +S +++V   I
Sbjct: 470 NTVVNYSMSLCLGMGATVETQLDPDGKHLLKGYRGAQYLGIGLASLACMISGLYMVESFI 529

Query: 544 AKRHRK-RIESECES 557
                K   E++C +
Sbjct: 530 NDHKAKAATENDCAT 544

>Suva_13.27 Chr13 (37895..39556) [1662 bp, 553 aa] {ON} YML116W
           (REAL)
          Length = 553

 Score =  572 bits (1474), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 275/493 (55%), Positives = 356/493 (72%), Gaps = 1/493 (0%)

Query: 62  SVDDCHENDSPFQNPEYFETGFKEVMFIISCMVAQLLNQAGQTQSLSTMNVLADYFKSNS 121
           S D+  +    +QNP YF+  ++E +FI +CM++QLLNQ+G TQ+LS MN+LAD F S++
Sbjct: 56  SEDEVMKTKQKWQNPNYFKYPWQEYLFIFTCMISQLLNQSGTTQTLSIMNILADSFGSDA 115

Query: 122 SKQPWLMASFPLVSGSFILISGRLGDIYGLKKALSVGYIIMTLWSIICGLAKYTNSDAFF 181
           + + WLMASFPLVSGSFILISGR+GDI+GLK  L +GY+++ +WS+ICGL KY+ SD FF
Sbjct: 116 NSRSWLMASFPLVSGSFILISGRMGDIFGLKNMLLIGYVMIIIWSLICGLTKYSGSDTFF 175

Query: 182 IVCRSFQGLGIAFILPNIMGLVGNIYKVGTLRKNIVISCIGCMAPXXXXXXXXXXXXIVT 241
           IV R+FQGLGIAF+LPN++G++GN+Y  GT RKNIVIS IG MAP            I T
Sbjct: 176 IVSRAFQGLGIAFVLPNVLGIIGNVYVGGTFRKNIVISFIGAMAPIGATLGCFFAGLIGT 235

Query: 242 EDAEQWPWVFYAFGIASFVNMLLALYSIXXXXXXXXXXXXMDWIXXXXXXXXXXXXNIVW 301
            +  QWPW FYA+ I + +N++L++Y+I            MDWI            N+VW
Sbjct: 236 MNPNQWPWAFYAYTITAVINLILSIYAIPNNIPTNVHRFSMDWIGSGLGVIGLVLLNLVW 295

Query: 302 NQAPIVGWGEAYXXXXXXXXXXXXXXFVVYEIKYATSPLLPPSVLENKKILMILAALFFG 361
           NQAPI GW +AY              F VYEI +A SPLLP +V++++ ++ I+ +LFFG
Sbjct: 296 NQAPISGWNQAYIIVLLIISVLFLVLFGVYEIHFAKSPLLPQAVMKDRHMIQIMLSLFFG 355

Query: 362 WGSFGIWTYYYYAFQLNLRKYTPLWAGGTHFMFVIWGTVAAFVVALTIKKVGPAVLLCFS 421
           WGSFGI+T+YY+ FQLN+R YTPLWAGG++FMF+IWG +AA +V  +IK+V P+V L F+
Sbjct: 356 WGSFGIFTFYYFQFQLNIRHYTPLWAGGSYFMFLIWGIIAALLVGFSIKRVSPSVFLFFA 415

Query: 422 MVAFDCGSIMLSVTPVHQTYWRMNVGMQIILSFGMDLSFPASSIILSDFLPMQYQGMAGS 481
           MVAF+ GSIM SVTPVH+TY+RM +G  IILSFGMDLSFPASSII SD+LPM+YQGMAGS
Sbjct: 416 MVAFNVGSIMASVTPVHETYFRMQMGTMIILSFGMDLSFPASSIIFSDYLPMEYQGMAGS 475

Query: 482 LVNTVVNYSTSLCLGMGNTVEQQYNAHGADLLKGYRSALYLAIGLASAGVCVSLVFLVTD 541
           LVNTVVNYS SLCLGMG TVE Q +  G  +LKGYR A YL IGLAS    +S +++V  
Sbjct: 476 LVNTVVNYSMSLCLGMGATVEMQLDPDGKHILKGYRGAQYLGIGLASLACIISGLYMVEC 535

Query: 542 IIAKRHRKRIESE 554
            I K HR +  +E
Sbjct: 536 YI-KDHRAKAVAE 547

>Skud_13.25 Chr13 (37872..39485) [1614 bp, 537 aa] {ON} YML116W
           (REAL)
          Length = 537

 Score =  568 bits (1465), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 274/496 (55%), Positives = 350/496 (70%), Gaps = 4/496 (0%)

Query: 62  SVDDCHE---NDSPFQNPEYFETGFKEVMFIISCMVAQLLNQAGQTQSLSTMNVLADYFK 118
           S D   E   +   +QNP YF+  + E +FI +CM++QLLNQAG TQ+LS MN++A+ F 
Sbjct: 43  STDHGEEMTVDKQRWQNPNYFKNSWHEYLFIFTCMISQLLNQAGTTQTLSIMNIIANSFG 102

Query: 119 SNSSKQPWLMASFPLVSGSFILISGRLGDIYGLKKALSVGYIIMTLWSIICGLAKYTNSD 178
           SN + + WLMASFPLVSGSFILISGRLGDIYGLKK L++GY+++ +WS+ICGL KY+ SD
Sbjct: 103 SNENSRTWLMASFPLVSGSFILISGRLGDIYGLKKMLTIGYVVIIIWSLICGLTKYSGSD 162

Query: 179 AFFIVCRSFQGLGIAFILPNIMGLVGNIYKVGTLRKNIVISCIGCMAPXXXXXXXXXXXX 238
            FFI+ R+FQGLGIAF+LPN++G++GNIY  GT RKNIVIS +G MAP            
Sbjct: 163 TFFIISRAFQGLGIAFVLPNVLGIIGNIYVSGTFRKNIVISLVGAMAPVGATLGCLFAGL 222

Query: 239 IVTEDAEQWPWVFYAFGIASFVNMLLALYSIXXXXXXXXXXXXMDWIXXXXXXXXXXXXN 298
           I T++ +QWPW FYA+ I S +N+ L++YSI            MDWI            N
Sbjct: 223 IGTKNPKQWPWAFYAYTITSIINLALSVYSIPNNIPTNIQHFSMDWIGSALGVIGLVLMN 282

Query: 299 IVWNQAPIVGWGEAYXXXXXXXXXXXXXXFVVYEIKYATSPLLPPSVLENKKILMILAAL 358
            VWNQAPI GW +AY              F++YE ++A SPLLP +VL+++ ++ I+ AL
Sbjct: 283 FVWNQAPISGWDQAYIIVLLVISVVFLVVFIIYENRFAKSPLLPRAVLKDRHMIQIMLAL 342

Query: 359 FFGWGSFGIWTYYYYAFQLNLRKYTPLWAGGTHFMFVIWGTVAAFVVALTIKKVGPAVLL 418
           FFGWGSFGI+T+YY+ FQLN+R Y+ +WAGGT+FMF+IWG +AA +V + IKKV P+V L
Sbjct: 343 FFGWGSFGIFTFYYFQFQLNIRHYSAVWAGGTYFMFLIWGIIAALLVGIYIKKVSPSVFL 402

Query: 419 CFSMVAFDCGSIMLSVTPVHQTYWRMNVGMQIILSFGMDLSFPASSIILSDFLPMQYQGM 478
             SM+AF+ GSIM SVTPVH+TY+R  +G  IILSFGMD SFPASSII SD LPM+YQGM
Sbjct: 403 FLSMMAFNIGSIMASVTPVHETYFRTQLGTMIILSFGMDFSFPASSIIFSDNLPMEYQGM 462

Query: 479 AGSLVNTVVNYSTSLCLGMGNTVEQQYNAHGADLLKGYRSALYLAIGLASAGVCVSLVFL 538
           AGSLVNTVVNYS SLCLGMG TVE   +  G  +LKGYR A YL IGLAS    +S +++
Sbjct: 463 AGSLVNTVVNYSMSLCLGMGATVETHVDPDGKHVLKGYRGAQYLGIGLASLACIISGLYM 522

Query: 539 VTDIIAKRHRKRIESE 554
           V  II K H+ +    
Sbjct: 523 VERII-KDHKAKARGR 537

>CAGL0B02343g Chr2 complement(222130..223743) [1614 bp, 537 aa] {ON}
           similar to uniprot|P13090 Saccharomyces cerevisiae
           YML116w ATR1 Aminotriazole resistance protein or
           uniprot|Q03263 Saccharomyces cerevisiae YMR279c
          Length = 537

 Score =  566 bits (1460), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 278/504 (55%), Positives = 352/504 (69%), Gaps = 4/504 (0%)

Query: 54  VTSKGCICSVDDCHENDSPFQNPEYFETGFKEVMFIISCMVAQLLNQAGQTQSLSTMNVL 113
           V  K C     D ++    +QNPEYF++  KE +F+ SC V+QLLNQAG  Q+   MN++
Sbjct: 34  VDEKQCDTQAIDGNQK---WQNPEYFDSTLKEYLFLCSCFVSQLLNQAGAIQTQPIMNIV 90

Query: 114 ADYFKSNSSKQPWLMASFPLVSGSFILISGRLGDIYGLKKALSVGYIIMTLWSIICGLAK 173
           AD   S + KQ WLMA+FPL+SGSFILISGR+GDIYGLKK L VGY+ + +WS+ICGL K
Sbjct: 91  ADSLDSQNGKQAWLMAAFPLISGSFILISGRIGDIYGLKKTLLVGYLFLIVWSLICGLTK 150

Query: 174 YTNSDAFFIVCRSFQGLGIAFILPNIMGLVGNIYKVGTLRKNIVISCIGCMAPXXXXXXX 233
           Y +SD+FFIV R+FQGLGI+ ILPNI+G+VG+IY  G+ RKN+VIS IGCMAP       
Sbjct: 151 YAHSDSFFIVSRAFQGLGISLILPNILGIVGSIYIAGSKRKNMVISLIGCMAPIGATLGA 210

Query: 234 XXXXXIVTEDAEQWPWVFYAFGIASFVNMLLALYSIXXXXXXXXXXXXMDWIXXXXXXXX 293
                I TEDA QWPW FY++ I + +N +L+++ I            MDWI        
Sbjct: 211 VFSGLIGTEDANQWPWAFYSYAITAAINFVLSIWLIPNTIPTNVHGHKMDWIGSGLGVVG 270

Query: 294 XXXXNIVWNQAPIVGWGEAYXXXXXXXXXXXXXXFVVYEIKYAT-SPLLPPSVLENKKIL 352
               N VWNQAPI GW  AY              F +YE+ +   +PLLP  VL++ K +
Sbjct: 271 LIMLNFVWNQAPIDGWDSAYLIVLLIISVLLLIAFFIYELHFVNGNPLLPKEVLKSPKTI 330

Query: 353 MILAALFFGWGSFGIWTYYYYAFQLNLRKYTPLWAGGTHFMFVIWGTVAAFVVALTIKKV 412
           ++L ALFFGWGSFGI+++YY+ FQLNLR YTPLWAGGT+FMF+IWG VAA VV  TIKKV
Sbjct: 331 IVLFALFFGWGSFGIFSFYYFTFQLNLRHYTPLWAGGTYFMFLIWGIVAALVVGFTIKKV 390

Query: 413 GPAVLLCFSMVAFDCGSIMLSVTPVHQTYWRMNVGMQIILSFGMDLSFPASSIILSDFLP 472
            P+++L  SMVAF+CGSI++SVTP+HQTY+R ++GM IILSFGMDLSFPASSI+LSD LP
Sbjct: 391 YPSIILFLSMVAFNCGSIIMSVTPIHQTYFRNHLGMMIILSFGMDLSFPASSILLSDKLP 450

Query: 473 MQYQGMAGSLVNTVVNYSTSLCLGMGNTVEQQYNAHGADLLKGYRSALYLAIGLASAGVC 532
           +QYQGMAGSLVNT+VNYS S CLG+   VEQ  N HG D+LKGYR A YL IGLAS    
Sbjct: 451 LQYQGMAGSLVNTMVNYSMSFCLGVAGVVEQHVNNHGKDVLKGYRGAFYLGIGLASMACI 510

Query: 533 VSLVFLVTDIIAKRHRKRIESECE 556
           +S   ++++II  R  ++  +  E
Sbjct: 511 ISGALMLSEIIQGRKNEKDSAVVE 534

>NDAI0E00280 Chr5 (37676..39325) [1650 bp, 549 aa] {ON} Anc_8.843
          Length = 549

 Score =  563 bits (1451), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 276/493 (55%), Positives = 349/493 (70%), Gaps = 1/493 (0%)

Query: 64  DDCHENDSPFQNPEYFETGFKEVMFIISCMVAQLLNQAGQTQSLSTMNVLADYFKSNSSK 123
           D+   + S +QNP+YF+  ++E +FI SCM++QLLNQA   Q+LS MN++ D FKS   K
Sbjct: 54  DNTIGDHSKWQNPDYFQNKWQEYLFIFSCMMSQLLNQAATPQTLSIMNIITDSFKSEGGK 113

Query: 124 QPWLMASFPLVSGSFILISGRLGDIYGLKKALSVGYIIMTLWSIICGLAKYTNSDAFFIV 183
           + WL+ASFPLVSGSFILISGR+GDIYGLKK L  GY+   +WS+I G   Y+++D FFI+
Sbjct: 114 ETWLIASFPLVSGSFILISGRIGDIYGLKKTLIGGYLFFIIWSLISGFTDYSHNDIFFII 173

Query: 184 CRSFQGLGIAFILPNIMGLVGNIYKVGTLRKNIVISCIGCMAPXXXXXXXXXXXXIVTED 243
            R+FQGLGIAFILPN+MG+VGNIYK  T RKNIVIS IG  AP            I TE+
Sbjct: 174 SRAFQGLGIAFILPNVMGIVGNIYKPDTQRKNIVISMIGASAPIGAFMGSLFAGLIGTEN 233

Query: 244 AEQWPWVFYAFGIASFVNMLLALYSIXXXXXXXXXXXXMDWIXXXXXXXXXXXXNIVWNQ 303
            +QWPW FYAF IAS +N+ +++YSI            MDWI            N VWNQ
Sbjct: 234 PKQWPWAFYAFAIASAINLAISIYSIPNNIPTNIHGFAMDWIGSIMAVIGLILLNFVWNQ 293

Query: 304 APIVGWGEAYXXXXXXXXXXXXXXFVVYEIKYATSPLLPPSVLENKKILMILAALFFGWG 363
            PIVGW +AY              F  YEIKYA SP+LP  V +N+ I+MILAALF GWG
Sbjct: 294 GPIVGWQKAYIIVLLIISIIALVLFFTYEIKYAKSPILPVEVTKNRHIIMILAALFLGWG 353

Query: 364 SFGIWTYYYYAFQLNLRKYTPLWAGGTHFMFVIWGTVAAFVVALTIKKVGPAVLLCFSMV 423
           SFGI+++YY++F LNLR Y+ LWAG T+FMF IWGTVAA +V   IK++  +V+L FSM+
Sbjct: 354 SFGIFSFYYFSFLLNLRHYSALWAGTTYFMFAIWGTVAAVIVGAFIKRISASVILFFSMI 413

Query: 424 AFDCGSIMLSVTPVHQTYWRMNVGMQIILSFGMDLSFPASSIILSDFLPMQYQGMAGSLV 483
           AF+ G IMLSVTPV QTY+RMN+G  IILSFGMD+SFPA++IILSD L MQYQGMAGSL 
Sbjct: 414 AFNIGLIMLSVTPVDQTYFRMNLGTMIILSFGMDMSFPAAAIILSDGLTMQYQGMAGSLA 473

Query: 484 NTVVNYSTSLCLGMGNTVEQQYNAHGADLLKGYRSALYLAIGLASAGVCVSLVFLVTDII 543
           NT+VNYS SLCLGMG TVE+Q N  G ++LKGYR+A YL +GLA  G+ +S +++   + 
Sbjct: 474 NTMVNYSMSLCLGMGTTVERQINKSGKEILKGYRAAEYLGVGLAGLGIVISGIYMAEVLW 533

Query: 544 AKRHRKRIESECE 556
           AKR ++R+ S  +
Sbjct: 534 AKR-KERLSSNRD 545

>SAKL0D01386g Chr4 (109619..111184) [1566 bp, 521 aa] {ON}
           uniprot|Q875S7 Saccharomyces kluyveri ATR1
          Length = 521

 Score =  553 bits (1426), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 277/506 (54%), Positives = 348/506 (68%), Gaps = 4/506 (0%)

Query: 51  QLSVTSKGCICSVDDCHENDSPF---QNPEYFETGFKEVMFIISCMVAQLLNQAGQTQSL 107
           +L   S        D   +D  +   Q+P YF   +KE +FI + M++QLLNQAG TQ+L
Sbjct: 16  ELGTQSATAFTEHSDVQVDDKKWPSIQDPTYFSAPWKEYLFIFASMMSQLLNQAGTTQTL 75

Query: 108 STMNVLADYFKSNSSKQPWLMASFPLVSGSFILISGRLGDIYGLKKALSVGYIIMTLWSI 167
           S +N+L+  F S++S+Q WLMASFPLVSGSFIL+SG++GDIYGLKK L VGY++  +WS+
Sbjct: 76  SLINILSKNFDSSTSQQTWLMASFPLVSGSFILVSGKIGDIYGLKKTLLVGYVVTIIWSL 135

Query: 168 ICGLAKYTNSDAFFIVCRSFQGLGIAFILPNIMGLVGNIYKVGTLRKNIVISCIGCMAPX 227
           ICGL  YT+S  FFI+ R+FQGLGIAFILPNIMG+VGNIY  GT RKN+VIS IG  AP 
Sbjct: 136 ICGLTSYTSSVEFFIISRAFQGLGIAFILPNIMGIVGNIYVAGTTRKNMVISLIGACAPI 195

Query: 228 XXXXXXXXXXXIVTEDAEQWPWVFYAFGIASFVNMLLALYSIXXXXXXXXXXXXMDWIXX 287
                      I T  +E+W W FYA+ I + +NM L+++ I            MDWI  
Sbjct: 196 GATMGVLFSGLIGTL-SERWAWTFYAYTITAAINMGLSIWVIPNTIPTNVRGSSMDWIGS 254

Query: 288 XXXXXXXXXXNIVWNQAPIVGWGEAYXXXXXXXXXXXXXXFVVYEIKYATSPLLPPSVLE 347
                     N VWNQ PIVGW  AY              F +YE KYA  PL+P   + 
Sbjct: 255 GIGLLGMILFNFVWNQGPIVGWDTAYIIVLLIVSVAAIVAFFLYETKYANDPLIPRPAMH 314

Query: 348 NKKILMILAALFFGWGSFGIWTYYYYAFQLNLRKYTPLWAGGTHFMFVIWGTVAAFVVAL 407
           N ++LM L A+FFGWGSFGIWT+YY+ F LNLR+YTPLWAGG++FMF+IWG +AA  V  
Sbjct: 315 NHRLLMTLLAVFFGWGSFGIWTFYYFCFVLNLREYTPLWAGGSYFMFLIWGIIAAISVGY 374

Query: 408 TIKKVGPAVLLCFSMVAFDCGSIMLSVTPVHQTYWRMNVGMQIILSFGMDLSFPASSIIL 467
           TIK++ P+++L  SM+AFDCG IMLSVTPV QTY+RM +GM IILSFGMDLSFPASSIIL
Sbjct: 375 TIKRIPPSLILFLSMLAFDCGCIMLSVTPVDQTYFRMILGMMIILSFGMDLSFPASSIIL 434

Query: 468 SDFLPMQYQGMAGSLVNTVVNYSTSLCLGMGNTVEQQYNAHGADLLKGYRSALYLAIGLA 527
           SD LPM+ QGMAGSLV+T++NYS S+CLG+  TVE Q N +G DLLKGYR+ALYL IGLA
Sbjct: 435 SDELPMENQGMAGSLVSTMINYSMSMCLGIAGTVEHQINKNGDDLLKGYRAALYLGIGLA 494

Query: 528 SAGVCVSLVFLVTDIIAKRHRKRIES 553
           S GV +S +F++ + +  R R   E 
Sbjct: 495 SLGVFISALFMLENYLRMRRRNVKEE 520

>NCAS0B00290 Chr2 (33760..35388) [1629 bp, 542 aa] {ON} Anc_8.843
          Length = 542

 Score =  551 bits (1420), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 282/494 (57%), Positives = 338/494 (68%)

Query: 56  SKGCICSVDDCHENDSPFQNPEYFETGFKEVMFIISCMVAQLLNQAGQTQSLSTMNVLAD 115
            K  I   +      S +QNP+YF+  ++E +FI SCM++QLLNQA   Q+LS MN++ D
Sbjct: 39  EKDVISQTETPQLEHSKWQNPDYFQNQWQEYLFIFSCMMSQLLNQAATPQTLSIMNIITD 98

Query: 116 YFKSNSSKQPWLMASFPLVSGSFILISGRLGDIYGLKKALSVGYIIMTLWSIICGLAKYT 175
            F S   K+ WL+ASFPLVSGSFILISGR+GDIYGLKK L  GYI   +WSII GL KY+
Sbjct: 99  SFNSEGGKETWLIASFPLVSGSFILISGRIGDIYGLKKTLVGGYIFFIIWSIISGLTKYS 158

Query: 176 NSDAFFIVCRSFQGLGIAFILPNIMGLVGNIYKVGTLRKNIVISCIGCMAPXXXXXXXXX 235
           +SD FFIV R+FQGL IAFILPN+MG+VGNIYK  + RKNIVIS IG  AP         
Sbjct: 159 HSDTFFIVSRAFQGLSIAFILPNVMGIVGNIYKPDSNRKNIVISMIGASAPIGAFFGSLF 218

Query: 236 XXXIVTEDAEQWPWVFYAFGIASFVNMLLALYSIXXXXXXXXXXXXMDWIXXXXXXXXXX 295
              I TED +QWPW FYAF IAS  N+ +++YSI            MDWI          
Sbjct: 219 AGLIGTEDPDQWPWAFYAFAIASAFNLAISIYSIPNSVPTNVHGFAMDWIGSVLAVIGLI 278

Query: 296 XXNIVWNQAPIVGWGEAYXXXXXXXXXXXXXXFVVYEIKYATSPLLPPSVLENKKILMIL 355
             N VWNQ PIVGW  AY              F  YE+KYA SPLLP  V +N+ I+MIL
Sbjct: 279 LLNFVWNQGPIVGWQTAYIIALLVVSVFFLALFFTYEVKYAESPLLPVEVTKNRHIIMIL 338

Query: 356 AALFFGWGSFGIWTYYYYAFQLNLRKYTPLWAGGTHFMFVIWGTVAAFVVALTIKKVGPA 415
           AALF GWGSFGI+++YY++F LNLR Y+ LWAG T+FMF IWGTVAA +V   IKK+  A
Sbjct: 339 AALFLGWGSFGIFSFYYFSFLLNLRHYSALWAGTTYFMFAIWGTVAAVIVGAFIKKISAA 398

Query: 416 VLLCFSMVAFDCGSIMLSVTPVHQTYWRMNVGMQIILSFGMDLSFPASSIILSDFLPMQY 475
            +L  SMVAF+ G IMLSVTPV QTY+RMN+G  IILSFGMD+SFPA++IILSD L MQY
Sbjct: 399 FILFMSMVAFNIGIIMLSVTPVDQTYFRMNLGTMIILSFGMDMSFPAAAIILSDGLTMQY 458

Query: 476 QGMAGSLVNTVVNYSTSLCLGMGNTVEQQYNAHGADLLKGYRSALYLAIGLASAGVCVSL 535
           QGMAGSL NT+VNYS SLCLGMG TVE+Q N  G DLLKGYR A YL IGLA  G+ ++ 
Sbjct: 459 QGMAGSLANTMVNYSMSLCLGMGTTVERQINKSGNDLLKGYRGAEYLGIGLAGLGIIITA 518

Query: 536 VFLVTDIIAKRHRK 549
           ++L   +  KR + 
Sbjct: 519 IYLGEILWGKRKQH 532

>TDEL0B00550 Chr2 (105483..107096) [1614 bp, 537 aa] {ON} Anc_8.843
           YMR279C
          Length = 537

 Score =  546 bits (1406), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 270/491 (54%), Positives = 341/491 (69%), Gaps = 1/491 (0%)

Query: 66  CHENDSPFQNPEYFETGFKEVMFIISCMVAQLLNQAGQTQSLSTMNVLADYFKSNSSKQP 125
             E +SP+Q+P YF+  + EV+F++SCM+ QLLNQAG T +LSTM VL     S+S+K  
Sbjct: 44  VEEPESPWQDPNYFKGKWDEVLFVLSCMMGQLLNQAGSTMTLSTMKVLERELDSSSAKSS 103

Query: 126 WLMASFPLVSGSFILISGRLGDIYGLKKALSVGYIIMTLWSIICGLAKYTNSDAFFIVCR 185
           WLMASFPLVSGSFILISGRLGDIYGLKK L +GYI +T+WS+ICGL+ ++++D FFI  R
Sbjct: 104 WLMASFPLVSGSFILISGRLGDIYGLKKMLLLGYIWLTIWSLICGLSSFSHNDTFFITSR 163

Query: 186 SFQGLGIAFILPNIMGLVGNIYKVGTLRKNIVISCIGCMAPXXXXXXXXXXXXIVTEDAE 245
           +FQGLGI+F+LPN++G+VGNIYK GT RKNIVIS IG  AP            +V     
Sbjct: 164 AFQGLGISFVLPNLLGIVGNIYKPGTRRKNIVISLIGMCAPIGATFGGLFAGVVVIRKDS 223

Query: 246 QWPWVFYAFGIASFVNMLLALYSIXXXXXXXXXXXXMDWIXXXXXXXXXXXXNIVWNQAP 305
            WPW FYA+ IA+F+  +++ + I            MDWI            N VWNQ+ 
Sbjct: 224 DWPWAFYAYTIAAFLTTIISYFVIPNSIPVNVNKFAMDWIGSALGVSGLVLFNFVWNQST 283

Query: 306 IVGWGEAYXXXXXXXXXXXXXXFVVYEIKYATSPLLPPSVLENKKILMILAALFFGWGSF 365
           +VGW   Y              F ++EIKYA  PLLP  V E++ I+MILA+L  GWGSF
Sbjct: 284 VVGWATGYIIALLIVSIFLIALFFIFEIKYAKVPLLPKEVTESRSIIMILASLMAGWGSF 343

Query: 366 GIWTYYYYAFQLNLRKYTPLWAGGTHFMFVIWGTVAAFVVALTIKKVGPAVLLCFSMVAF 425
           GIW +YY+ F L LR Y+P+WAGGT FM  I G +AA  V  +IK+VGPAVLL FSM+AF
Sbjct: 344 GIWIFYYFQFVLTLRNYSPVWAGGTFFMVSIVGCIAALTVGFSIKRVGPAVLLFFSMIAF 403

Query: 426 DCGSIMLSVTPVHQTYWRMNVGMQIILSFGMDLSFPASSIILSDFLPMQYQGMAGSLVNT 485
            CGSI+LSVTPVH+TY+R  +G  +ILSFGMDLSFPA+SIILSD L MQYQGMAGSLVNT
Sbjct: 404 TCGSIILSVTPVHETYFRSCLGAMVILSFGMDLSFPAASIILSDELSMQYQGMAGSLVNT 463

Query: 486 VVNYSTSLCLGMGNTVEQQYNAHGADLLKGYRSALYLAIGLASAGVCVSLVFLVTDIIAK 545
           VVNYS SL LG+G T+E+Q N  G  LL+G+R+ALY AIG+ S G+ +S VF++   +  
Sbjct: 464 VVNYSMSLFLGIGGTIERQINKSGDRLLEGFRAALYFAIGVGSLGILISGVFVLQKELM- 522

Query: 546 RHRKRIESECE 556
           R + R E+E E
Sbjct: 523 RSKSRKENELE 533

>Kwal_27.10245 s27 (259090..260637) [1548 bp, 515 aa] {ON} YML116W
           (ATR1) - predicted protein is very hydrophobic, has many
           membrane-spanning regions, several potential
           glycosylation sites, potential ATP-binding site [contig
           38] FULL
          Length = 515

 Score =  542 bits (1397), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 270/481 (56%), Positives = 339/481 (70%), Gaps = 2/481 (0%)

Query: 70  DSPFQNPEYFETGFKEVMFIISCMVAQLLNQAGQTQSLSTMNVLADYFKSNSSKQPWLMA 129
            S  QNP+YF+  +KE +F++S M++QLLNQA  TQ+    +VL+    +  S+QPWLMA
Sbjct: 35  KSRLQNPDYFDKPWKEYIFVLSSMLSQLLNQAATTQTNPLFDVLSKDLNAKVSQQPWLMA 94

Query: 130 SFPLVSGSFILISGRLGDIYGLKKALSVGYIIMTLWSIICGLAKYTNSDAFFIVCRSFQG 189
           SFPLVSGSFIL+SG++GDIYGLKK L  GY+++ +WS+ICGL+ Y ++  FF+V RSFQG
Sbjct: 95  SFPLVSGSFILVSGKVGDIYGLKKTLLGGYVVVVIWSLICGLSSYAHNVDFFVVARSFQG 154

Query: 190 LGIAFILPNIMGLVGNIYKVGTLRKNIVISCIGCMAPXXXXXXXXXXXXIVTEDAEQWPW 249
           LGIAF+LPN+MG+VGNIYK  T  KN+V S IG  AP            ++    + W W
Sbjct: 155 LGIAFVLPNVMGIVGNIYKPNTEAKNLVFSLIGACAPIGATLGCVFSG-LIGARTDLWGW 213

Query: 250 VFYAFGIASFVNMLLALYSIXXXXXXXXXXXXMDWIXXXXXXXXXXXXNIVWNQAPIVGW 309
            FYA+ I + +N L+AL+ I            MDWI            N VWNQAPI GW
Sbjct: 214 TFYAYAITAALNGLVALWIIPNNIPTNVNEYKMDWIGSAIGVFGLILFNFVWNQAPIAGW 273

Query: 310 GEAYXXXXXXXXXXXXXXFVVYEIKYATSPLLPPSVLENKKILMILAALFFGWGSFGIWT 369
           G AY              F+ YEI++A  PLLP SVL N+K++MIL++LFFGWGSFGIWT
Sbjct: 274 GSAYIIVLLIVAVVALIAFITYEIRFAKQPLLPHSVLFNRKLMMILSSLFFGWGSFGIWT 333

Query: 370 YYYYAFQLNLRKYTPLWAGGTHFMFVIWGTVAAFVVALTIKKVGPAVLLCFSMVAFDCGS 429
           +YY +F LNLR Y+PLWAGGT+FMF IWG VA+ +V  TI K GPAV+L  SMVAFDCG 
Sbjct: 334 FYYMSFMLNLRHYSPLWAGGTYFMFAIWGIVASLLVGYTIHKTGPAVILFLSMVAFDCGC 393

Query: 430 IMLSVTPVHQTYWRMNVGMQIILSFGMDLSFPASSIILSDFLPMQYQGMAGSLVNTVVNY 489
           IML+VTPVHQTY+RM +G+ IILSFGMDLSFPA+SIILSD LP QYQGMAGSLV+T+++Y
Sbjct: 394 IMLAVTPVHQTYFRMTLGIMIILSFGMDLSFPAASIILSDQLPSQYQGMAGSLVSTMISY 453

Query: 490 STSLCLGMGNTVEQQYNAHGADLLKGYRSALYLAIGLASAGVCVSLVFLVTDIIAKRHRK 549
           S SLCLG+  T E Q N +G DLLKGY++ALY+ IGLAS GV +S  F++ D    R RK
Sbjct: 454 SMSLCLGISGTAEHQVNKNGIDLLKGYQAALYVGIGLASLGVVISGAFMIEDWWTSR-RK 512

Query: 550 R 550
           R
Sbjct: 513 R 513

>KNAG0G03430 Chr7 complement(734828..736456) [1629 bp, 542 aa] {ON}
           Anc_8.843 YMR279C
          Length = 542

 Score =  542 bits (1397), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 272/490 (55%), Positives = 342/490 (69%), Gaps = 1/490 (0%)

Query: 68  ENDSPFQNPEYFETGFKEVMFIISCMVAQLLNQAGQTQSLSTMNVLADYFKSNSSKQPWL 127
           + +  +Q+  YF+  ++E +F+ +CM++QLLNQA   Q+LS MN+L   F SN+  Q WL
Sbjct: 51  DPNCKWQDTTYFQNRWQEYIFVGTCMMSQLLNQACIPQTLSLMNILTKSFHSNAKNQTWL 110

Query: 128 MASFPLVSGSFILISGRLGDIYGLKKALSVGYIIMTLWSIICGLAKYTNSDAFFIVCRSF 187
           MASFPLVSGSFILISGR+GDIYGLK +L  G I   +W++I G   YT+SD FFIV RSF
Sbjct: 111 MASFPLVSGSFILISGRVGDIYGLKWSLVGGNIFFIIWALISGFTNYTHSDTFFIVSRSF 170

Query: 188 QGLGIAFILPNIMGLVGNIYKVGTLRKNIVISCIGCMAPXXXXXXXXXXXXIVTEDAEQW 247
           QGLG+AFILPN+MG VGNIYK  T RKNIVIS IG  AP            I T++ + W
Sbjct: 171 QGLGVAFILPNVMGCVGNIYKPNTFRKNIVISLIGACAPVGAFMGAFFAGLIGTKNPDDW 230

Query: 248 PWVFYAFGIASFVNMLLALYSIXXXXXXXXXXXXMDWIXXXXXXXXXXXXNIVWNQAPIV 307
           PW FYA  IAS + +L ALYSI            MDWI            N VWNQ PI 
Sbjct: 231 PWSFYAMAIASTLTLLGALYSIPNHIPTNVHGFSMDWIGSGLAVVGLILLNFVWNQGPID 290

Query: 308 GWGEAYXXXXXXXXXXXXXXFVVYEIKYATSPLLPPSVLENKKILMILAALFFGWGSFGI 367
           GWG+AY              F +YE+ YA SPLLP  + +N+ ++MIL ALF GWGSFGI
Sbjct: 291 GWGKAYIIVLLIVSVFVLTLFFIYEVHYAASPLLPRVITQNRHMVMILMALFLGWGSFGI 350

Query: 368 WTYYYYAFQLNLRKYTPLWAGGTHFMFVIWGTVAAFVVALTIKKVGPAVLLCFSMVAFDC 427
           +++YY+AF LNLR Y+ +WAGGT+FMF IWG VA+ VV L+I+K+  +++L FSM+AFD 
Sbjct: 351 FSFYYFAFLLNLRHYSTVWAGGTYFMFAIWGVVASVVVGLSIRKISASIILFFSMIAFDV 410

Query: 428 GSIMLSVTPVHQTYWRMNVGMQIILSFGMDLSFPASSIILSDFLPMQYQGMAGSLVNTVV 487
           G IMLSVTPV QTY+RMN+G  IILSFGMD+SFPA++IILSD LP QYQGMAGSL NT+V
Sbjct: 411 GIIMLSVTPVKQTYFRMNLGTMIILSFGMDMSFPAAAIILSDSLPNQYQGMAGSLANTMV 470

Query: 488 NYSTSLCLGMGNTVEQQYNAHGADLLKGYRSALYLAIGLASAGVCVSLVFLVTDIIAKRH 547
           NYS SLCLGMG+TVE Q N +G DLLKGYR+A YL IG+AS  V +SL+++   +   R 
Sbjct: 471 NYSMSLCLGMGSTVESQINQNGKDLLKGYRAAEYLGIGIASLAVILSLIYMCERLWIDR- 529

Query: 548 RKRIESECES 557
           ++R+ES  E+
Sbjct: 530 KERMESTSET 539

>TBLA0D03270 Chr4 complement(813041..814693) [1653 bp, 550 aa] {ON}
           Anc_8.843 YMR279C
          Length = 550

 Score =  537 bits (1383), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 265/484 (54%), Positives = 336/484 (69%), Gaps = 2/484 (0%)

Query: 65  DCHEND--SPFQNPEYFETGFKEVMFIISCMVAQLLNQAGQTQSLSTMNVLADYFKSNSS 122
           D  +ND  S +QNP+YF+  ++E  FI S M+ QLL+QAG TQ+LS MNVLA    S SS
Sbjct: 52  DTADNDESSSYQNPDYFKNKYQEFGFIFSGMIGQLLSQAGLTQTLSIMNVLAKELDSTSS 111

Query: 123 KQPWLMASFPLVSGSFILISGRLGDIYGLKKALSVGYIIMTLWSIICGLAKYTNSDAFFI 182
           +Q WLM+SFPL  GSFIL+SGRLGDIYGLKK L  GYII T+WSIICGL+ Y ++DAFFI
Sbjct: 112 RQAWLMSSFPLALGSFILVSGRLGDIYGLKKILLGGYIITTVWSIICGLSSYAHNDAFFI 171

Query: 183 VCRSFQGLGIAFILPNIMGLVGNIYKVGTLRKNIVISCIGCMAPXXXXXXXXXXXXIVTE 242
             R+FQGLG+AF LPN++GL+G IY+ G  RKN++IS IG M+P             V  
Sbjct: 172 TARAFQGLGLAFALPNMIGLIGTIYRPGCFRKNMIISIIGAMSPTGATLGGLFAGLTVKY 231

Query: 243 DAEQWPWVFYAFGIASFVNMLLALYSIXXXXXXXXXXXXMDWIXXXXXXXXXXXXNIVWN 302
           D   WPW FYAFG+ SFVN++++ Y I            MDW+            N V+N
Sbjct: 232 DKSNWPWSFYAFGLISFVNLIISWYCIPNSIPTNIHGLKMDWLGSVLGVFGLIILNFVFN 291

Query: 303 QAPIVGWGEAYXXXXXXXXXXXXXXFVVYEIKYATSPLLPPSVLENKKILMILAALFFGW 362
           QAPIVGW  AY              FVVYE+KYA +PL+P ++  N+ +LMIL +LF GW
Sbjct: 292 QAPIVGWQSAYIIVLLVLSFCALVIFVVYEVKYAKTPLIPKAISSNRGMLMILFSLFCGW 351

Query: 363 GSFGIWTYYYYAFQLNLRKYTPLWAGGTHFMFVIWGTVAAFVVALTIKKVGPAVLLCFSM 422
           GSFGIWT+YY++F+LNLR Y+PLWAG ++F+FVI G+  A V  LTIKK+ P+VL C SM
Sbjct: 352 GSFGIWTFYYFSFELNLRHYSPLWAGSSYFIFVISGSTVAIVCGLTIKKIKPSVLFCCSM 411

Query: 423 VAFDCGSIMLSVTPVHQTYWRMNVGMQIILSFGMDLSFPASSIILSDFLPMQYQGMAGSL 482
           + F  G+I+ + TPV+QT++R  +G   +L  GMD SFPASSIILSD LPMQYQGMAGSL
Sbjct: 412 MGFLGGNIIFAATPVNQTFFRNMLGCMFLLPLGMDFSFPASSIILSDSLPMQYQGMAGSL 471

Query: 483 VNTVVNYSTSLCLGMGNTVEQQYNAHGADLLKGYRSALYLAIGLASAGVCVSLVFLVTDI 542
           VNTV+NYSTS+CLGM  TVE ++N+HG DLL GYR+A+Y AIGLA   VCVS  +++  +
Sbjct: 472 VNTVINYSTSICLGMAGTVEMKHNSHGKDLLNGYRAAIYFAIGLAGLAVCVSGGYMIECL 531

Query: 543 IAKR 546
              R
Sbjct: 532 WKDR 535

>KLTH0C03806g Chr3 (332195..333772) [1578 bp, 525 aa] {ON} similar
           to uniprot|P13090 Saccharomyces cerevisiae YML116W ATR1
           Multidrug efflux pump of the major facilitator
           superfamily required for resistance to aminotriazole and
           4-nitroquinoline-N-oxide
          Length = 525

 Score =  534 bits (1375), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 268/501 (53%), Positives = 343/501 (68%), Gaps = 7/501 (1%)

Query: 63  VDDCHEND------SPFQNPEYFETGFKEVMFIISCMVAQLLNQAGQTQSLSTMNVLADY 116
           VD+  ++D      S  QNP+YF+  +KE +F+IS M++QLLNQA   Q+    ++L++ 
Sbjct: 22  VDNHEDSDMLLASRSRLQNPDYFDKQWKEYLFVISSMLSQLLNQAAALQANPLFDLLSED 81

Query: 117 FKSNSSKQPWLMASFPLVSGSFILISGRLGDIYGLKKALSVGYIIMTLWSIICGLAKYTN 176
            K+ +S+Q WLMASFPLVSGSFIL+SG++GDIYGLKK L  GY ++ +WS+ICGL+ Y +
Sbjct: 82  LKAKASQQAWLMASFPLVSGSFILVSGKVGDIYGLKKTLLGGYAVVVIWSLICGLSSYAH 141

Query: 177 SDAFFIVCRSFQGLGIAFILPNIMGLVGNIYKVGTLRKNIVISCIGCMAPXXXXXXXXXX 236
           +  FFIV RSFQGLGIAF+LPN+ G+VGNIYK  T  KN+V S IG  AP          
Sbjct: 142 NVDFFIVARSFQGLGIAFVLPNVTGIVGNIYKPNTKAKNMVFSMIGACAPIGATLGCLFS 201

Query: 237 XXIVTEDAEQWPWVFYAFGIASFVNMLLALYSIXXXXXXXXXXXXMDWIXXXXXXXXXXX 296
             I TE +E W W FYA+ I + +N L+A Y I            MDW+           
Sbjct: 202 GLIGTE-SEAWAWTFYAYTIVAALNGLIAWYVIPDNIPTNVHKFKMDWLGSFLGVCGLIM 260

Query: 297 XNIVWNQAPIVGWGEAYXXXXXXXXXXXXXXFVVYEIKYATSPLLPPSVLENKKILMILA 356
            N VWNQAP  GW  AY              F+++E ++A  PLLP +VL N+K++MILA
Sbjct: 261 FNFVWNQAPTDGWDSAYIIVLLVISVILLLIFIIFEARFAKEPLLPRAVLFNRKLMMILA 320

Query: 357 ALFFGWGSFGIWTYYYYAFQLNLRKYTPLWAGGTHFMFVIWGTVAAFVVALTIKKVGPAV 416
           +LF GWGSFGIWTYYY AF LNLR YTPLWAGG++FMF I+GT+AAF+V  TI K GPA+
Sbjct: 321 SLFLGWGSFGIWTYYYMAFVLNLRHYTPLWAGGSYFMFAIFGTIAAFLVGHTIHKTGPAI 380

Query: 417 LLCFSMVAFDCGSIMLSVTPVHQTYWRMNVGMQIILSFGMDLSFPASSIILSDFLPMQYQ 476
           +L  S++AFD G IMLSVTPV QTY+RM++G  +ILSFGMDLSFPASSIILSD LP QYQ
Sbjct: 381 ILLASVIAFDVGCIMLSVTPVDQTYFRMSLGTMVILSFGMDLSFPASSIILSDQLPSQYQ 440

Query: 477 GMAGSLVNTVVNYSTSLCLGMGNTVEQQYNAHGADLLKGYRSALYLAIGLASAGVCVSLV 536
           GMAGSLVNT++NYS SLCLG+  T E+Q N  G DLLKGYR+ALY+ IGLAS G+ VS  
Sbjct: 441 GMAGSLVNTMINYSMSLCLGVSGTAERQVNKDGTDLLKGYRAALYVGIGLASVGIFVSGA 500

Query: 537 FLVTDIIAKRHRKRIESECES 557
           + + D   +R  + +  + + 
Sbjct: 501 YAIEDWWTRRRERSVRIKLDE 521

>Kpol_541.16 s541 complement(43396..44982) [1587 bp, 528 aa] {ON}
           complement(43396..44982) [1587 nt, 529 aa]
          Length = 528

 Score =  530 bits (1364), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 256/489 (52%), Positives = 335/489 (68%), Gaps = 1/489 (0%)

Query: 70  DSPFQNPEYFETGFKEVMFIISCMVAQLLNQAGQTQSLSTMNVLADYFKSNSSKQPWLMA 129
           +S  +NP+YF +  +E  FI SCM++QLLN AG TQ+LS MNVL     S+ S + WL+A
Sbjct: 39  NSSLRNPDYFNSTTQEYAFIFSCMLSQLLNLAGTTQTLSIMNVLTRQLHSSDSLKVWLVA 98

Query: 130 SFPLVSGSFILISGRLGDIYGLKKALSVGYIIMTLWSIICGLAKYTNSDAFFIVCRSFQG 189
           SFPLVSGSFIL+SGRLGDIYGLKK L +GY+I+ +WS+I GL+ Y++S  FFI+ R+FQG
Sbjct: 99  SFPLVSGSFILVSGRLGDIYGLKKMLILGYVILVIWSLITGLSGYSHSGIFFIIARAFQG 158

Query: 190 LGIAFILPNIMGLVGNIYKVGTLRKNIVISCIGCMAPXXXXXXXXXXXXIVTEDAEQWPW 249
           LGI+ +LPN++GL+G IYK GTL+KN+VIS +G M+P            + TE    WPW
Sbjct: 159 LGISLVLPNVLGLIGMIYKPGTLKKNMVISIVGAMSPIGATLGGLFSGLVATESEGSWPW 218

Query: 250 VFYAFGIASFVNMLLALYSIXXXXXXXXXXXXMDWIXXXXXXXXXXXXNIVWNQAPIVGW 309
            FYA+ +A+F+N  ++ YSI            MDWI            N VWNQAP  GW
Sbjct: 219 AFYAYTLAAFINTFISYYSIPNNIPTNVNRLSMDWIGSFTGVLGLILFNFVWNQAPADGW 278

Query: 310 GEAYXXXXXXXXXXXXXXFVVYEIKYATSPLLPPSVLENKKILMILAALFFGWGSFGIWT 369
             AY              F +YE++YA +PLLP  ++ N++++MIL A+ FGWGSFGIWT
Sbjct: 279 NSAYLIVLLVISVIALIAFGIYELRYAENPLLPSEIIRNRQLIMILTAMTFGWGSFGIWT 338

Query: 370 YYYYAFQLNLRKYTPLWAGGTHFMFVIWGTVAAFVVALTIKKVGPAVLLCFSMVAFDCGS 429
           +YY++F LNLR Y+PLWAGG++F+FVI GT+ A      +KK+ PAVLL FSMV F+ G 
Sbjct: 339 FYYFSFVLNLRNYSPLWAGGSYFIFVISGTITAISCGFLMKKIRPAVLLTFSMVGFNLGC 398

Query: 430 IMLSVTPVHQTYWRMNVGMQIILSFGMDLSFPASSIILSDFLPMQYQGMAGSLVNTVVNY 489
           I+ SVTPVHQTY+R  +G  IIL  GMDLSFPASSIILSD LP Q+QGMAGSLVNTV+NY
Sbjct: 399 IIFSVTPVHQTYFRNILGTMIILPLGMDLSFPASSIILSDNLPNQHQGMAGSLVNTVINY 458

Query: 490 STSLCLGMGNTVEQQYNAHGADLLKGYRSALYLAIGLASAGVCVSLVFLVTDIIAKRHRK 549
           S SL LG+  TVEQ  N +G DLL+GYR ALY  I  +   V ++ +++V + I   ++ 
Sbjct: 459 SNSLFLGIAGTVEQHCNKNGTDLLRGYRGALYFGIACSGVAVLIAGLYMV-ETIFDSYKD 517

Query: 550 RIESECESC 558
           R E +CE+C
Sbjct: 518 RKEKDCENC 526

>TPHA0C04790 Chr3 complement(1033653..1035323) [1671 bp, 556 aa]
           {ON} Anc_8.843 YMR279C
          Length = 556

 Score =  501 bits (1290), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 241/486 (49%), Positives = 320/486 (65%), Gaps = 1/486 (0%)

Query: 74  QNPEYFETGFKEVMFIISCMVAQLLNQAGQTQSLSTMNVLADYFKSNSSKQPWLMASFPL 133
           Q P+YF +   E  FI +C++ QLLNQAG TQS+S MN++A+ F S +SKQ WL ASFPL
Sbjct: 66  QKPQYFSSKLHEWAFIFTCLMGQLLNQAGTTQSMSIMNIIAEDFGSETSKQAWLFASFPL 125

Query: 134 VSGSFILISGRLGDIYGLKKALSVGYIIMTLWSIICGLAKYTNSDAFFIVCRSFQGLGIA 193
           VSGSFIL+ GR GDIYGLKK L +GY I+T+WSIICGL  YT+SD FFIV ++FQGLG++
Sbjct: 126 VSGSFILVGGRFGDIYGLKKMLLLGYAILTIWSIICGLTHYTHSDDFFIVAKAFQGLGVS 185

Query: 194 FILPNIMGLVGNIYKVGTLRKNIVISCIGCMAPXXXXXXXXXXXXIVTEDAEQWPWVFYA 253
           FILPNI+GLVG IY+ G+++KNI IS IG MAP            +V +D + WPW FYA
Sbjct: 186 FILPNIIGLVGTIYEPGSMKKNITISFIGAMAPLGATFGGLFSGIVVVKDDKNWPWTFYA 245

Query: 254 FGIASFVNMLLALYSIXXXXXXXXXXXXMDWIXXXXXXXXXXXXNIVWNQAPIVGWGEAY 313
           F I SF+  +   + +            MDWI            + VWNQAP+ GW +AY
Sbjct: 246 FAIVSFLVGVTCYFFVPDNVPTNTNNLKMDWIGSAVGVVGLLLFSFVWNQAPMDGWDKAY 305

Query: 314 XXXXXXXXXXXXXXFVVYEIKYATSPLLPPSVLENKKILMILAALFFGWGSFGIWTYYYY 373
                         F +YEI YA  PLLP ++  N+ I+MIL A+F GWG+FGIW++YY+
Sbjct: 306 IIVLLVISVILIIAFFIYEINYAEVPLLPKAITGNRHIIMILLAIFMGWGTFGIWSFYYF 365

Query: 374 AFQLNLRKYTPLWAGGTHFMFVIWGTVAAFVVALTIKKVGPAVLLCFSMVAFDCGSIMLS 433
           +F LNLR ++P+W GG +F F++ G   A  V   IK + P+++L  S+  F  G+++ +
Sbjct: 366 SFSLNLRHFSPVWTGGAYFAFILSGFTIASCVGFLIKIIRPSIILVISITGFTMGNLIFA 425

Query: 434 VTPVHQTYWRMNVGMQIILSFGMDLSFPASSIILSDFLPMQYQGMAGSLVNTVVNYSTSL 493
           VTP  QTYWR   GM ++L  GMDLSFPASSIILSD LP +YQGMAGSLVNT+VNYS S 
Sbjct: 426 VTPADQTYWRNTFGMMLLLPLGMDLSFPASSIILSDQLPPEYQGMAGSLVNTMVNYSQSF 485

Query: 494 CLGMGNTVEQQYNAHGADLLKGYRSALYLAIGLASAGVCV-SLVFLVTDIIAKRHRKRIE 552
           CLG+  TVE+Q N+ G DLLKGYR+A Y  +G+ + G+ + SL    T     + + ++ 
Sbjct: 486 CLGVATTVEKQINSSGDDLLKGYRAAFYTGVGIGTLGISIASLYMFETFWTDYKEKTKLA 545

Query: 553 SECESC 558
           ++ ES 
Sbjct: 546 NDIESS 551

>TBLA0D03280 Chr4 complement(815937..817679) [1743 bp, 580 aa] {ON} 
          Length = 580

 Score =  501 bits (1290), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 247/500 (49%), Positives = 337/500 (67%), Gaps = 7/500 (1%)

Query: 58  GCICSV-DDCHENDSPFQN------PEYFETGFKEVMFIISCMVAQLLNQAGQTQSLSTM 110
           G I SV +D   N    Q+      P+YF+    E +FIISCMV+Q ++QAG TQ+LS M
Sbjct: 64  GSISSVSNDSDINSENLQSENKVLSPKYFKNRTHEYLFIISCMVSQFMSQAGLTQALSIM 123

Query: 111 NVLADYFKSNSSKQPWLMASFPLVSGSFILISGRLGDIYGLKKALSVGYIIMTLWSIICG 170
           N+LA+   +  S+Q WLMASF L  GSFIL+SGRLGDIYGLKK L  GY I+T+WS+ICG
Sbjct: 124 NILAEELNAEKSRQAWLMASFTLSMGSFILVSGRLGDIYGLKKVLLGGYAILTIWSLICG 183

Query: 171 LAKYTNSDAFFIVCRSFQGLGIAFILPNIMGLVGNIYKVGTLRKNIVISCIGCMAPXXXX 230
            + Y+++DAFFI  R+FQGLG+AF+LPN +GL+G IY+ G+++KN++I  +G M+P    
Sbjct: 184 FSSYSHNDAFFITSRAFQGLGLAFVLPNSLGLIGVIYEPGSMKKNMIIGTLGAMSPIGAT 243

Query: 231 XXXXXXXXIVTEDAEQWPWVFYAFGIASFVNMLLALYSIXXXXXXXXXXXXMDWIXXXXX 290
                   I T+D +QWPW FY+FGI SF NM+L+ YSI            MDWI     
Sbjct: 244 LGGLFAGIIGTKDPKQWPWSFYSFGIVSFCNMILSWYSIPNNIPTNIYNLSMDWIGAILG 303

Query: 291 XXXXXXXNIVWNQAPIVGWGEAYXXXXXXXXXXXXXXFVVYEIKYATSPLLPPSVLENKK 350
                  N V+NQAPIVGW  AY              FVVYE+KYA +PL+P ++  N+ 
Sbjct: 304 IFGLLILNFVFNQAPIVGWQSAYIIVLLVLSFCALVIFVVYEVKYAKTPLIPKAISSNRG 363

Query: 351 ILMILAALFFGWGSFGIWTYYYYAFQLNLRKYTPLWAGGTHFMFVIWGTVAAFVVALTIK 410
           +LMIL ALF GWG+FG WT+YY++F LN+R YT  WAGG++F+F++ G   A +    +K
Sbjct: 364 MLMILFALFCGWGAFGTWTFYYFSFVLNVRGYTAAWAGGSYFIFIVSGCAIATLCGFMMK 423

Query: 411 KVGPAVLLCFSMVAFDCGSIMLSVTPVHQTYWRMNVGMQIILSFGMDLSFPASSIILSDF 470
           KV P+V+L  SM+ F  G +ML+VTP+HQ+Y++  +G+  +L  G+DLSFPA+SIILSD 
Sbjct: 424 KVPPSVILYISMIGFMGGCVMLTVTPIHQSYFQNILGIMFVLPIGIDLSFPAASIILSDA 483

Query: 471 LPMQYQGMAGSLVNTVVNYSTSLCLGMGNTVEQQYNAHGADLLKGYRSALYLAIGLASAG 530
           LP+QYQGMAGSLV T+ NYSTS+CLGM  +VE  +N +G ++LKGYR+A+  A  LA  G
Sbjct: 484 LPIQYQGMAGSLVYTITNYSTSICLGMAGSVEAYHNDNGQNILKGYRNAMIFADALAGLG 543

Query: 531 VCVSLVFLVTDIIAKRHRKR 550
           + VS +++V ++I  R   +
Sbjct: 544 IIVSGIYMVINLITIRENSK 563

>KAFR0A02840 Chr1 complement(588197..589759) [1563 bp, 520 aa] {ON}
           Anc_8.843 YMR279C
          Length = 520

 Score =  491 bits (1263), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 246/489 (50%), Positives = 327/489 (66%), Gaps = 1/489 (0%)

Query: 68  ENDSPFQNPEYFETGFKEVMFIISCMVAQLLNQAGQTQSLSTMNVLADYFKSNSSKQPWL 127
              S +Q+P YF+  F+E +F+ SCM  QLLNQA   Q+LS MNVL+D F S+ S Q WL
Sbjct: 32  REKSKWQDPGYFKNSFQEYLFVGSCMTTQLLNQATTPQTLSIMNVLSDSFNSSRSNQTWL 91

Query: 128 MASFPLVSGSFILISGRLGDIYGLKKALSVGYIIMTLWSIICGLAKYTNSDAFFIVCRSF 187
           +ASFPLV+GSFILISGR+GDIYGLKK L  GYI + +WS+ICG   Y+ SD F I+ R+F
Sbjct: 92  VASFPLVAGSFILISGRIGDIYGLKKTLIGGYIFLIIWSLICGFTYYSKSDTFLIIARAF 151

Query: 188 QGLGIAFILPNIMGLVGNIYKVGTLRKNIVISCIGCMAPXXXXXXXXXXXXIVTEDAEQW 247
           QGLGIAF LPN++G +GNIY VG+LRKN+VIS I   AP            IVTE   QW
Sbjct: 152 QGLGIAFTLPNVVGTIGNIYHVGSLRKNMVISLIAASAPVGAAIGGAFAGLIVTESPSQW 211

Query: 248 PWVFYAFGIASFVNMLLALYSIXXXXXXXXXXXXMDWIXXXXXXXXXXXXNIVWNQAPIV 307
           PW FYAF IA   N+L+++YSI            MDWI            N  WNQ PIV
Sbjct: 212 PWSFYAFAIACSFNLLISIYSIPSNIPTNVNGFKMDWIGSALIVTGLILFNFAWNQGPIV 271

Query: 308 GWGEAYXXXXXXXXXXXXXXFVVYEIKYATSPLLPPSVLENKKILMILAALFFGWGSFGI 367
           GW  AY              F+ YEI +A SPL+   +  ++ +++ +  LF GWGS+GI
Sbjct: 272 GWDIAYIIVLLIISVIFILAFLTYEINFAPSPLIAREITHSRNMIITIFTLFLGWGSYGI 331

Query: 368 WTYYYYAFQLNLRKYTPLWAGGTHFMFVIWGTVAAFVVALTIKKVGPAVLLCFSMVAFDC 427
           W++YY++F LNLR Y+P+WAGG++F+F I+G +A+  V ++IKK+   V+L FSMV F  
Sbjct: 332 WSFYYFSFVLNLRHYSPVWAGGSYFIFGIFGVLASAFVGISIKKITAPVILLFSMVLFCV 391

Query: 428 GSIMLSVTPVHQTYWRMNVGMQIILSFGMDLSFPASSIILSDFLPMQYQGMAGSLVNTVV 487
           G+ +LSV PV Q+Y+++ +    IL  G+D SFPA++IILSD LPM+YQGMAGSL  T+V
Sbjct: 392 GTTLLSVAPVDQSYFKLTLAGMAILGVGLDTSFPAATIILSDGLPMEYQGMAGSLALTMV 451

Query: 488 NYSTSLCLGMGNTVEQQYNAHGADLLKGYRSALYLAIGLASAGVCVSLVFLVTDIIAK-R 546
           NYS SLCLGMGNTVE+Q N  G D+LKGYRSA YL IGL+  G+ ++ + ++  ++AK R
Sbjct: 452 NYSMSLCLGMGNTVERQINKDGQDVLKGYRSAEYLGIGLSGLGLLLACILVIDKLVAKYR 511

Query: 547 HRKRIESEC 555
           ++  I++  
Sbjct: 512 NKNSIKNSA 520

>TBLA0C01160 Chr3 complement(246034..247836) [1803 bp, 600 aa] {ON} 
          Length = 600

 Score =  424 bits (1090), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 205/481 (42%), Positives = 298/481 (61%)

Query: 74  QNPEYFETGFKEVMFIISCMVAQLLNQAGQTQSLSTMNVLADYFKSNSSKQPWLMASFPL 133
           + P+ F+  F+E  F++  ++ Q L+Q G TQ LSTMN+LA+   +   +QPWLMA+FPL
Sbjct: 111 RRPDIFKNRFQEFGFVLVGVIGQFLSQVGLTQVLSTMNILAEELHTTKMRQPWLMAAFPL 170

Query: 134 VSGSFILISGRLGDIYGLKKALSVGYIIMTLWSIICGLAKYTNSDAFFIVCRSFQGLGIA 193
             G  ILISGRLGDI+GLKK L +GYII T+W++ICG + Y +SD  FIV R+FQGLG+A
Sbjct: 171 GLGCTILISGRLGDIFGLKKVLLLGYIITTIWTLICGFSSYAHSDDLFIVSRTFQGLGLA 230

Query: 194 FILPNIMGLVGNIYKVGTLRKNIVISCIGCMAPXXXXXXXXXXXXIVTEDAEQWPWVFYA 253
             LPN+  L+G IYK    +KN++   IG M+P             V  + + WPW FY+
Sbjct: 231 CALPNMFELIGIIYKPHCFKKNMIFCIIGAMSPIGATLGGIFAGLSVKYNIKNWPWSFYS 290

Query: 254 FGIASFVNMLLALYSIXXXXXXXXXXXXMDWIXXXXXXXXXXXXNIVWNQAPIVGWGEAY 313
           F I +F+N ++A + I            MDWI            N V+NQ PI GW  AY
Sbjct: 291 FAIVAFLNGIIAWFCIPNDIEKNPQGLKMDWIGSALGLFGLVVLNFVFNQTPIDGWSSAY 350

Query: 314 XXXXXXXXXXXXXXFVVYEIKYATSPLLPPSVLENKKILMILAALFFGWGSFGIWTYYYY 373
                         FV+YE+  A  PL+P  +  N ++++IL  LF GWG F IWT+YY+
Sbjct: 351 LIVLLVVSVVALILFVIYELTMANFPLIPKGIHSNYRLILILLTLFCGWGGFAIWTFYYF 410

Query: 374 AFQLNLRKYTPLWAGGTHFMFVIWGTVAAFVVALTIKKVGPAVLLCFSMVAFDCGSIMLS 433
           AFQLNLR Y+PLWA  ++F+ +I GT+   +  L ++++ P +LL FSM+ F  G+I+ +
Sbjct: 411 AFQLNLRHYSPLWASSSNFVLIISGTIYTIICCLAVQRMKPPILLFFSMLGFLGGNILFA 470

Query: 434 VTPVHQTYWRMNVGMQIILSFGMDLSFPASSIILSDFLPMQYQGMAGSLVNTVVNYSTSL 493
           VTP+HQT++R   G   +   GM  SFP++S++ ++ LP  Y+ MAGSLVN  +NY+TS+
Sbjct: 471 VTPIHQTFFRNMFGSMFLFPLGMVFSFPSASMMTAETLPTHYKSMAGSLVNVAINYATSI 530

Query: 494 CLGMGNTVEQQYNAHGADLLKGYRSALYLAIGLASAGVCVSLVFLVTDIIAKRHRKRIES 553
           C+GM  +    +N HG DLL G+R+A YLAIGL+   V +S ++++  I   R++K  E+
Sbjct: 531 CVGMAGSANVNHNNHGQDLLHGFRAASYLAIGLSGFSVFLSGLYMIGSIWTDRNQKMKEN 590

Query: 554 E 554
           +
Sbjct: 591 K 591

>Smik_15.560 Chr15 (995453..997003) [1551 bp, 516 aa] {ON} YOR378W
           (REAL)
          Length = 516

 Score =  296 bits (758), Expect = 3e-93,   Method: Compositional matrix adjust.
 Identities = 176/513 (34%), Positives = 266/513 (51%), Gaps = 20/513 (3%)

Query: 54  VTSKGCICSVDDCHENDSPFQNP-----EYFETGFKEVMFIISCMVAQLLNQAGQTQSLS 108
           VT +    +V+   ++D    +      E  E+   E  F+     AQL+ QAG  QSL+
Sbjct: 7   VTEENLDMNVETLKKDDEVLSDEFDVQEEKPESLLWESAFVGVLCSAQLMTQAGLGQSLA 66

Query: 109 TMNVLADYF-KSNSSKQPWLMASFPLVSGSFILISGRLGDIYGLKKALSVGYIIMTLWSI 167
            ++++ D F  +N  +  W  +++ L  G+FILI+GRLGDI+G KK   +G+    LWS+
Sbjct: 67  PLHIIGDSFGTANPGQLSWFASAYSLTVGTFILIAGRLGDIFGHKKFFVLGFFWYALWSL 126

Query: 168 ICGLAKYTNSDAFFIVCRSFQGLGIAFILPNIMGLVGNIYKVGTLRKNIVISCIGCMAPX 227
           + G + Y+N   FF  CR+FQG+G AF+LPN + ++G  YK G  RKN+V S  G  AP 
Sbjct: 127 LAGFSVYSN-QIFFDCCRAFQGMGPAFLLPNAIAILGRTYKPGR-RKNMVFSLFGASAPG 184

Query: 228 XXXXXXXXXXXIVTEDAEQWPWVFYAFGIASFVNMLLALYSIXXX------XXXXXXXXX 281
                      +       WPW ++  GIA F+  +   Y I                  
Sbjct: 185 GFVLGAVFSSML--GQLAWWPWAYWLMGIACFLLAVAGYYLIPHTPMPNRDVASFKLLER 242

Query: 282 MDWIXXXXXXXXXXXXNIVWNQAPIVGWGEAYXXXXXXXXXXXXXXFVVYEIKYATSPLL 341
           +D+             N  WNQ P+VGW   Y              F   E + A  PLL
Sbjct: 243 IDFAGSVTGVVGLILFNFAWNQGPVVGWQTPYTYALLIVGTVFLIIFAFIESR-AAFPLL 301

Query: 342 PPSVLENKKILMILAALFFGWGSFGIWTYYYYAFQLNLRKYTPLWAGGTHFMFVIWGTVA 401
           P + L +     +L+ +  GW SFGIW +Y + F  + R  TPL +        I G  A
Sbjct: 302 PFAALSSDTAF-VLSCIAAGWASFGIWIFYTWQFMEDSRGQTPLLSSAQFSPVAISGFCA 360

Query: 402 AFVVALTIKKVGPAVLLCFSMVAFDCGSIMLSVTPVHQTYWRMNVGMQIILSFGMDLSFP 461
           A +    +    P+ ++ F+M AF  G+I+++  PVHQTYW       I++ +GMD+SFP
Sbjct: 361 ALMTGFLLSHTPPSTVMFFAMTAFTVGTILIATAPVHQTYWAQTFVSIIVMPWGMDMSFP 420

Query: 462 ASSIILSDFLPMQYQGMAGSLVNTVVNYSTSLCLGMGNTVEQQYNAHGADLLKGYRSALY 521
           A++I+LSD +P ++QG+A SLVNTVVNYS S+ LG+  T+E   N  GA++LKGYR + Y
Sbjct: 421 AATIMLSDSMPHEHQGLAASLVNTVVNYSISIGLGIAGTIESNVNDGGANVLKGYRCSWY 480

Query: 522 LAIGLASAGVCVSLVFLVTDIIAKRHRKRIESE 554
           L IGL+  G+ V+  + V+  +  + +KR+  +
Sbjct: 481 LGIGLSGFGIFVAATYAVSTFM--KSKKRVSEK 511

>YOR378W Chr15 (1049511..1051058) [1548 bp, 515 aa] {ON} Putative
           paralog of ATR1, but not required for boron tolerance;
           member of the DHA2 family of drug:H+ antiporters;
           YOR378W is not an essential gene
          Length = 515

 Score =  290 bits (742), Expect = 5e-91,   Method: Compositional matrix adjust.
 Identities = 176/513 (34%), Positives = 264/513 (51%), Gaps = 19/513 (3%)

Query: 53  SVTSKGCICSVDDCHEND---SPFQ-NPEYFETGFKEVMFIISCMVAQLLNQAGQTQSLS 108
           SVT K    + +   + D   S F    E  ++   E  F+     AQL+ QAG  QSL+
Sbjct: 6   SVTQKNLDTNAEALKKEDKVLSEFDIQDERPKSLLWESAFVGVLCSAQLMTQAGLGQSLA 65

Query: 109 TMNVLADYF-KSNSSKQPWLMASFPLVSGSFILISGRLGDIYGLKKALSVGYIIMTLWSI 167
            ++++ + F  +N+ +  W  +++ L  G+FILI+GRLGDI+G KK   +G+    LWS+
Sbjct: 66  PLHIIGNSFGTTNAGQLSWFASAYSLTVGTFILIAGRLGDIFGHKKFFVLGFFWYALWSL 125

Query: 168 ICGLAKYTNSDAFFIVCRSFQGLGIAFILPNIMGLVGNIYKVGTLRKNIVISCIGCMAPX 227
           + G + Y+N   FF  CR+FQG+G AF+LPN + ++G  YK G  RKN+V S  G  AP 
Sbjct: 126 LAGFSVYSN-QIFFDCCRAFQGMGPAFLLPNAIAILGRTYKPGR-RKNMVFSLFGASAPG 183

Query: 228 XXXXXXXXXXXIVTEDAEQWPWVFYAFGIASFVNMLLALYSI------XXXXXXXXXXXX 281
                      +       WPW ++  GIA FV  +   + I                  
Sbjct: 184 GFFLGAVFSSML--GQLAWWPWAYWIMGIACFVLAVAGYFVIPHTPMPSRDASSFKLLER 241

Query: 282 MDWIXXXXXXXXXXXXNIVWNQAPIVGWGEAYXXXXXXXXXXXXXXFVVYEIKYATSPLL 341
           +D+             N  WNQ P+VGW   Y              F   E + A  PLL
Sbjct: 242 IDFAGSVTGVVGLILFNFAWNQGPVVGWQTPYTYALLIVGTFFLVIFAYIESR-AAFPLL 300

Query: 342 PPSVLENKKILMILAALFFGWGSFGIWTYYYYAFQLNLRKYTPLWAGGTHFMFVIWGTVA 401
           P + L +     +L+ +  GW SFGIW +Y + F  + R  TPL +        I G  A
Sbjct: 301 PFAALSSDTAF-VLSCIAAGWASFGIWIFYTWQFMEDSRGQTPLLSSAQFSPVAISGFCA 359

Query: 402 AFVVALTIKKVGPAVLLCFSMVAFDCGSIMLSVTPVHQTYWRMNVGMQIILSFGMDLSFP 461
           A      +    P+ ++ F+M AF  G+I+++  PVHQTYW       I++ +GMD+SFP
Sbjct: 360 AVTTGFLLSHTPPSTVMLFAMTAFTVGTILIATAPVHQTYWAQTFVSIIVMPWGMDMSFP 419

Query: 462 ASSIILSDFLPMQYQGMAGSLVNTVVNYSTSLCLGMGNTVEQQYNAHGADLLKGYRSALY 521
           A++I+LSD +P ++QG+A SLVNTVVNYS S+ LG+  T+E + N  GA  LKGYR + Y
Sbjct: 420 AATIMLSDSMPHEHQGLAASLVNTVVNYSISIGLGIAGTIESRVNDGGAKPLKGYRCSWY 479

Query: 522 LAIGLASAGVCVSLVFLVTDIIAKRHRKRIESE 554
           + IGL+  G+ V+  +  +  +  + +KRI  +
Sbjct: 480 MGIGLSGLGIFVAATYAWSTFM--KSKKRISEK 510

>Skud_15.545 Chr15 (988549..990099) [1551 bp, 516 aa] {ON} YOR378W
           (REAL)
          Length = 516

 Score =  288 bits (736), Expect = 5e-90,   Method: Compositional matrix adjust.
 Identities = 166/477 (34%), Positives = 248/477 (51%), Gaps = 15/477 (3%)

Query: 85  EVMFIISCMVAQLLNQAGQTQSLSTMNVLADYF-KSNSSKQPWLMASFPLVSGSFILISG 143
           E  F+     AQL+ QAG  QSL+ ++++   F  +N  +  W  +++ L  G+FILI+G
Sbjct: 43  ETAFVGVLCSAQLMTQAGLGQSLAPLHIIGKSFGTTNPGQLSWFASAYSLTVGTFILIAG 102

Query: 144 RLGDIYGLKKALSVGYIIMTLWSIICGLAKYTNSDAFFIVCRSFQGLGIAFILPNIMGLV 203
           RLGDI+G KK   +G+    LWS++ G + Y+N   FF  CR+FQG+G AF+LPN + ++
Sbjct: 103 RLGDIFGHKKFFVLGFFWYALWSLLAGFSVYSN-KIFFDCCRAFQGMGPAFLLPNAIAIL 161

Query: 204 GNIYKVGTLRKNIVISCIGCMAPXXXXXXXXXXXXIVTEDAEQWPWVFYAFGIASFVNML 263
           G  YK G  RKN+V S  G  AP            +       WPW ++  GIA F   +
Sbjct: 162 GRTYKSGK-RKNMVFSLFGACAPGGFVLGAVFSSLL--GQLAWWPWAYWIMGIACFFLAI 218

Query: 264 LALYSIXXXXXXXXXXXX------MDWIXXXXXXXXXXXXNIVWNQAPIVGWGEAYXXXX 317
              + I                  +D+             N  WNQ P+VGW   Y    
Sbjct: 219 AGYFIIPHTAMPSRHASSFKLLERVDFAGSVTGVIGLILFNFAWNQGPVVGWQTPYTYIL 278

Query: 318 XXXXXXXXXXFVVYEIKYATSPLLPPSVLENKKILMILAALFFGWGSFGIWTYYYYAFQL 377
                     F   E + A  PLLP + L +     +L+ +  GW SFGIW +Y + F  
Sbjct: 279 LIVGTVFLAIFAFIESR-AAFPLLPFAALSSDTAF-VLSCIAAGWASFGIWIFYTWQFME 336

Query: 378 NLRKYTPLWAGGTHFMFVIWGTVAAFVVALTIKKVGPAVLLCFSMVAFDCGSIMLSVTPV 437
           + R  TPL +        + G  AA      + +  P+ ++ F+M AF  G+I+++  PV
Sbjct: 337 DSRGQTPLLSSAQFSPVAVSGFCAALTTGYLLSRTPPSTVMLFAMTAFTAGTILIATAPV 396

Query: 438 HQTYWRMNVGMQIILSFGMDLSFPASSIILSDFLPMQYQGMAGSLVNTVVNYSTSLCLGM 497
           HQTYW       I++ +GMD+SFPA++I+LSD +P ++QG+A SLVNTVVNYS S+ LG+
Sbjct: 397 HQTYWAQTFVSIIVMPWGMDMSFPAATIMLSDSMPHEHQGLAASLVNTVVNYSISIGLGI 456

Query: 498 GNTVEQQYNAHGADLLKGYRSALYLAIGLASAGVCVSLVFLVTDIIAKRHRKRIESE 554
             T+E   N  GA  LKGYR + Y+ IGL+  G+ V+ ++  +    K+ +KR   +
Sbjct: 457 AGTIESNVNDGGAKPLKGYRCSWYMGIGLSGLGIFVAAIYAWSTF--KKSKKRTSEK 511

>Suva_8.435 Chr8 (786917..788464) [1548 bp, 515 aa] {ON} YOR378W
           (REAL)
          Length = 515

 Score =  287 bits (734), Expect = 7e-90,   Method: Compositional matrix adjust.
 Identities = 175/514 (34%), Positives = 259/514 (50%), Gaps = 19/514 (3%)

Query: 53  SVTSKGCICSVDDCHENDSPFQNPEYFETGFK-----EVMFIISCMVAQLLNQAGQTQSL 107
           SVT K    S +    +D    N    +         E  F+     AQL+ QAG  QS+
Sbjct: 6   SVTQKNLETSAETTKTDDEVLLNQFELQDETPGSLVWEAAFVGVLCSAQLMTQAGLGQSI 65

Query: 108 STMNVLADYF-KSNSSKQPWLMASFPLVSGSFILISGRLGDIYGLKKALSVGYIIMTLWS 166
           + ++++ D F  +N  +  W  +S+ L  G+FILI+GRLGDI+G +K   +G+    LWS
Sbjct: 66  APLHIIGDSFGTTNPGQLSWFASSYSLTVGTFILIAGRLGDIFGHRKFFILGFFWYALWS 125

Query: 167 IICGLAKYTNSDAFFIVCRSFQGLGIAFILPNIMGLVGNIYKVGTLRKNIVISCIGCMAP 226
           ++ G + Y+N   FF  CR+FQG+G AF+LPN + ++G  YK G  RKN+V S  G  AP
Sbjct: 126 LLAGFSVYSN-KIFFDCCRAFQGMGPAFLLPNAIAILGRTYKPGK-RKNMVFSLFGASAP 183

Query: 227 XXXXXXXXXXXXIVTEDAEQWPWVFYAFGIASFVNMLLALYSIXXXXXXXX------XXX 280
                       +       WPW ++  GIA F+  +   + I                 
Sbjct: 184 GGFVLGAVFSSML--GQLAWWPWAYWIMGIACFLLAVAGYFVIPHVQMPSRDSPSFNMLE 241

Query: 281 XMDWIXXXXXXXXXXXXNIVWNQAPIVGWGEAYXXXXXXXXXXXXXXFVVYEIKYATSPL 340
            +D+             N  WNQ P+VGW   Y              FV  E + A  PL
Sbjct: 242 RVDFAGSVTGVIGLILFNFAWNQGPVVGWETPYTYVLLIVGTVFLGVFVFIESR-AAYPL 300

Query: 341 LPPSVLENKKILMILAALFFGWGSFGIWTYYYYAFQLNLRKYTPLWAGGTHFMFVIWGTV 400
           LP + L +     +L  +  GW SFGIW +Y + F    RK +PL +        I G  
Sbjct: 301 LPFAALSSDAAF-VLGCIAAGWSSFGIWIFYTWQFMEESRKQSPLLSSAQFAPVAISGFC 359

Query: 401 AAFVVALTIKKVGPAVLLCFSMVAFDCGSIMLSVTPVHQTYWRMNVGMQIILSFGMDLSF 460
           AA      +     + ++ F+M AF  G I+++  PVHQTYW       I++ +GMD+SF
Sbjct: 360 AAVTTGFLLSHTPASTVMLFAMTAFTVGIILIATAPVHQTYWAQTFVSIIVMPWGMDMSF 419

Query: 461 PASSIILSDFLPMQYQGMAGSLVNTVVNYSTSLCLGMGNTVEQQYNAHGADLLKGYRSAL 520
           PA++I+LS+ +P ++QG+A SLVNTVVNYS S+ LG+  T+E Q N  GA+ LKGYR + 
Sbjct: 420 PAATIMLSNSMPHEHQGLAASLVNTVVNYSISIGLGIAGTIESQVNDGGANALKGYRCSW 479

Query: 521 YLAIGLASAGVCVSLVFLVTDIIAKRHRKRIESE 554
           Y+ IGL+  G+ V+ V+  +  + K  +K  E +
Sbjct: 480 YMGIGLSGLGIFVAAVYASSTFL-KSKKKASEKQ 512

>KLTH0C10560g Chr3 (875216..876763) [1548 bp, 515 aa] {ON} similar
           to uniprot|Q08902 Saccharomyces cerevisiae YOR378W
           Hypothetical ORF
          Length = 515

 Score =  286 bits (733), Expect = 1e-89,   Method: Compositional matrix adjust.
 Identities = 170/498 (34%), Positives = 254/498 (51%), Gaps = 16/498 (3%)

Query: 64  DDCHENDSPFQNP-EYFETGFKEVMFIISCMVAQLLNQAGQTQSLSTMNVLADYFKSNSS 122
           D   E   P  N  +  E+   E  F+     AQL+ QAG  QS++ ++++ D F + + 
Sbjct: 23  DQGQELSQPHHNGIQKPESLLGEAAFVGVICGAQLMTQAGLGQSIAPLHIIGDSFGTRNP 82

Query: 123 KQ-PWLMASFPLVSGSFILISGRLGDIYGLKKALSVGYIIMTLWSIICGLAKYTNSDAFF 181
            Q  W  A++ L  G+FILI+GRLGD+YG KK   +G+    LWS++ G + Y+N   FF
Sbjct: 83  GQLSWFAAAYSLTVGTFILIAGRLGDVYGHKKFFIIGFFWYALWSLLAGFSVYSN-QIFF 141

Query: 182 IVCRSFQGLGIAFILPNIMGLVGNIYKVGTLRKNIVISCIGCMAPXXXXXXXXXXXXIVT 241
             CR+FQG+G A +LPN + ++G  Y  G  RK +++S  G  AP             + 
Sbjct: 142 DCCRAFQGIGPALLLPNAIAILGRTYVPGR-RKAMILSLFGATAPAGFVLGAVFSS--IF 198

Query: 242 EDAEQWPWVFYAFGIASFV-----NMLLALYSIXXXXXXXXXXXXMDWIXXXXXXXXXXX 296
                WPW ++A GI  F       +++    +            +D             
Sbjct: 199 GQLTWWPWAYWAMGIVCFFLAVAGILVIPRMPLPELDTSVSTYQRLDIPGSVTGVIGLVL 258

Query: 297 XNIVWNQAPIVGWGEAYXXXXXXXXXXXXXXFVVYEIKYATSPLLPPSVLENKKILMILA 356
            N  WNQ P+VGW   Y              F   E + A  PLLP S L +     +L 
Sbjct: 259 LNFAWNQGPVVGWQTPYTYSLLIVSAVFLCVFAFIESR-APHPLLPLSALSSDAAF-VLG 316

Query: 357 ALFFGWGSFGIWTYYYYAFQLNLRKYTPLWAGGTHFMFVIWGTVAAFVVALTIKKVGPAV 416
            +  GW SFGIW YY++ F   LR ++PL          I G  AA      I +V  ++
Sbjct: 317 CVGAGWSSFGIWIYYFWLFLEELRGHSPLLTSAQFAPVAISGLCAALTTGFVITRVRASL 376

Query: 417 LLCFSMVAFDCGSIMLSVTPVHQTYWRMNVGMQIILSFGMDLSFPASSIILSDFLPMQYQ 476
           ++ F+M AF  G I+++  PV Q YW       I++ +GMD+SFPA++I+LSD +P ++Q
Sbjct: 377 VMLFAMTAFTVGGILIATAPVKQVYWAQAFVSIIVMPWGMDMSFPAATIMLSDSMPHEHQ 436

Query: 477 GMAGSLVNTVVNYSTSLCLGMGNTVEQQYNAHGADLLKGYRSALYLAIGLASAGVCVSLV 536
           G+A SLVN VVNYS S+ LG+  TVE + N  GA+LLKGYR A Y+ IGL+  G+ ++ +
Sbjct: 437 GLAASLVNVVVNYSISIGLGLAGTVEGRVNNGGANLLKGYRGAWYMGIGLSGFGILIAFM 496

Query: 537 FLVTDIIAKRHRKRIESE 554
           +   +    +  K++ SE
Sbjct: 497 Y---EYHTFKKSKKMPSE 511

>Kwal_23.6547 s23 (1635677..1637212) [1536 bp, 511 aa] {ON} YOR378W
           - Hypothetical ORF [contig 358] FULL
          Length = 511

 Score =  276 bits (706), Expect = 1e-85,   Method: Compositional matrix adjust.
 Identities = 166/482 (34%), Positives = 253/482 (52%), Gaps = 18/482 (3%)

Query: 84  KEVMF--IISCMVAQLLNQAGQTQSLSTMNVLADYFK-SNSSKQPWLMASFPLVSGSFIL 140
           +E +F  I+SC  AQL+ QAG  QS++ + ++ + F  SN  +  W  A++ L  G+FIL
Sbjct: 38  REALFVGILSC--AQLMTQAGLAQSIAPVRIIGNSFGISNPGQLSWFSAAYSLTVGTFIL 95

Query: 141 ISGRLGDIYGLKKALSVGYIIMTLWSIICGLAKYTNSDAFFIVCRSFQGLGIAFILPNIM 200
           I+GRLGD++G KK   VG++  +LWS++ G + Y+N   FF  CR+ QG+G AF+LPN +
Sbjct: 96  IAGRLGDLFGHKKLFVVGFLWYSLWSLLAGFSVYSN-QIFFDCCRALQGIGPAFLLPNSI 154

Query: 201 GLVGNIYKVGTLRKNIVISCIGCMAPXXXXXXXXXXXXIVTEDAEQWPWVFYAFGIASFV 260
            ++G  Y  G  RK +V S  G  AP             +      WPW ++A G A  V
Sbjct: 155 AILGRTYTPGK-RKQMVFSIFGATAPGGFVLGSVFSS--IFSQLAWWPWAYWAMGTACLV 211

Query: 261 NMLLALYSIXXX-----XXXXXXXXXMDWIXXXXXXXXXXXXNIVWNQAPIVGWGEAYXX 315
             +  +  I                 +D              N  WNQ P+VGW   Y  
Sbjct: 212 LGVAGIIVIPQAPPPKIDISAGILERIDAAGATTGILGLALVNFAWNQGPVVGWQTPYTY 271

Query: 316 XXXXXXXXXXXXFVVYEIKYATSPLLPPSVLENKKILMILAALFFGWGSFGIWTYYYYAF 375
                       F + E + A  PLLP + L +  +  +L  +  GW SFGIW +Y++ F
Sbjct: 272 ALLIVGFVFLLVFSLIESR-ARFPLLPFAAL-STDLAYVLGCIAAGWSSFGIWIFYFWQF 329

Query: 376 QLNLRKYTPLWAGGTHFMFVIWGTVAAFVVALTIKKVGPAVLLCFSMVAFDCGSIMLSVT 435
             + R  +PL          I G  AA      +  V    ++  +M+AF  G ++++  
Sbjct: 330 LEDSRSQSPLLTSAQFVPVAISGLCAALTTGYILSHVPACAVMLIAMIAFTVGGVLVATA 389

Query: 436 PVHQTYWRMNVGMQIILSFGMDLSFPASSIILSDFLPMQYQGMAGSLVNTVVNYSTSLCL 495
           P++QTYW       II+ +GMD+SFPA++I++S+ +P ++QG+A SLVNTVVNYS SL L
Sbjct: 390 PINQTYWAQTFVSLIIMPWGMDMSFPAATIMISNAMPHEHQGLAASLVNTVVNYSISLAL 449

Query: 496 GMGNTVEQQYNAHGADLLKGYRSALYLAIGLASAGVCVSLVFLVTDIIAKRHRKRIESEC 555
           G   T+E + N  GA+ L+GYR A Y+ IGL+  GV V++V+  + +  K+ ++   SE 
Sbjct: 450 GFAGTIETRVNNKGANRLEGYRGAWYMGIGLSGLGVLVAIVYAWSTL--KKFKEEQLSEK 507

Query: 556 ES 557
            S
Sbjct: 508 SS 509

>KLLA0B00352g Chr2 (22476..23972) [1497 bp, 498 aa] {ON} highly
           similar to uniprot|Q08902 Saccharomyces cerevisiae
           YOR378W
          Length = 498

 Score =  269 bits (687), Expect = 5e-83,   Method: Compositional matrix adjust.
 Identities = 158/467 (33%), Positives = 234/467 (50%), Gaps = 13/467 (2%)

Query: 63  VDDCHENDSPF-QNPEYFETGFKEVMFIISCMVAQLLNQAGQTQSLSTMNVLADYFK-SN 120
           ++   E DS   QN   + +  KE   I+    AQL+ QAG  QS+  + ++ D F   N
Sbjct: 6   LNSHEEQDSLLLQNSREWTSLLKEGFAIMVLCSAQLMTQAGLAQSIVPLQIIGDSFGIKN 65

Query: 121 SSKQPWLMASFPLVSGSFILISGRLGDIYGLKKALSVGYIIMTLWSIICGLAKYTNSDAF 180
             +  W  ++F L  G+FILI+GRLGD +G KK   +G++   LWSI+ G + Y+N   F
Sbjct: 66  PGQLSWFASAFSLTVGTFILIAGRLGDTFGHKKFFVMGFLWYALWSILAGFSVYSN-QIF 124

Query: 181 FIVCRSFQGLGIAFILPNIMGLVGNIYKVGTLRKNIVISCIGCMAPXXXXXXXXXXXXIV 240
           F  CR+FQG+G AF LPN + ++   Y+ G  ++N++ S  G  AP            + 
Sbjct: 125 FDCCRAFQGIGPAFTLPNAIAIIARTYRPGR-KQNMIFSLFGACAPSGFVVGAVFSSLL- 182

Query: 241 TEDAEQWPWVFYAFGIASFV-----NMLLALYSIXXXXXXXXXXXXMDWIXXXXXXXXXX 295
             +   WPW ++  GI  F+      +++  +              +D            
Sbjct: 183 -SEFAWWPWAYWIMGITCFLLGVAGYLVIPHHPPIHPDEKCSLVERIDVAGSVTGVVGLI 241

Query: 296 XXNIVWNQAPIVGWGEAYXXXXXXXXXXXXXXFVVYEIKYATSPLLPPSVLENKKILMIL 355
             N  WNQ P+VGW  +Y              F   E + A  PLLP   L +  I  ++
Sbjct: 242 LFNFAWNQGPVVGWETSYTYALLIVGSAFLAAFGFIESR-AKHPLLPVRKLSSDTIF-VM 299

Query: 356 AALFFGWGSFGIWTYYYYAFQLNLRKYTPLWAGGTHFMFVIWGTVAAFVVALTIKKVGPA 415
             +  GW SFGIW YY +    NLR   PL +        I G  AA      + +  P+
Sbjct: 300 GCIAAGWSSFGIWVYYTWQLMANLRDQPPLLSSAQFVPVAISGLCAAMSTEFLLTRTSPS 359

Query: 416 VLLCFSMVAFDCGSIMLSVTPVHQTYWRMNVGMQIILSFGMDLSFPASSIILSDFLPMQY 475
            ++  +M+AF  GSI+++  PV QTYW       I++ +GMD+SFPA++IILS  +P  +
Sbjct: 360 TVMIIAMIAFTVGSILVATVPVSQTYWAQTFVSIIVMPWGMDMSFPAATIILSTAMPASH 419

Query: 476 QGMAGSLVNTVVNYSTSLCLGMGNTVEQQYNAHGADLLKGYRSALYL 522
           QG+A SLVNT++NYS S+ LG   T+E Q +    DLLKGYR A Y+
Sbjct: 420 QGLAASLVNTIINYSISIGLGFAGTIESQISDGEDDLLKGYRGAYYM 466

>TDEL0G04950 Chr7 complement(922428..923966) [1539 bp, 512 aa] {ON} 
          Length = 512

 Score =  268 bits (684), Expect = 2e-82,   Method: Compositional matrix adjust.
 Identities = 159/450 (35%), Positives = 249/450 (55%), Gaps = 9/450 (2%)

Query: 84  KEVMFIISCMVAQLLNQAGQTQSLSTMNVLADYFKSNSSKQPWLMASFPLVSGSFILISG 143
           KE  F+ + ++AQ  NQAG T  L  +NVL+D F        +L+ S+P+V GSF+LI G
Sbjct: 49  KEYAFVFTGVMAQAFNQAGGTMILPLVNVLSDSFHGK-----FLLNSYPMVCGSFMLIGG 103

Query: 144 RLGDIYGLKKALSVGYIIMTLWSIICGLAKYTNSDAFFIVCRSFQGLGIAFILPNIMGLV 203
           RLG+++G K+ L  GYII+ L S++ GL++Y+ S  F+++CR+FQG+G+A ILPN     
Sbjct: 104 RLGEVHGYKETLLGGYIILILSSLLGGLSRYSKSSIFYVICRAFQGVGMALILPNFSAAY 163

Query: 204 GNIYK--VGTLRKNIVISCIGCMAPXXXXXXXXXXXXIVTEDAEQWPWVFYAFGIASFVN 261
              Y+      RK I+ + IGC A              VT     W W +Y + IA+ + 
Sbjct: 164 DYRYQSQAKAHRKTILSTIIGCGASTGAFLGTFLSGICVTRSESNWSWAYYTYTIAATLT 223

Query: 262 MLLALYSIXXXXXXXXXXXXMDWIXXXXXXXXXXXXNIVWNQAPIVGWGEAYXXXXXXXX 321
           + L+ YS+                            N+  N A +     ++        
Sbjct: 224 LALSYYSVPDNITKKNKPCLNGLGWFSNRSCGLLMLNVACNLAAVASSNWSHIIVLLVVF 283

Query: 322 XXXXXXFVVYEIKYATSPLLPPSVLENKKILMILAALFFGWGSFGIWTYYYYAFQLNLRK 381
                 F+V+E+K++  P+    +  N  + ++LA++FFGWG++GIW+ Y++ F LNLR 
Sbjct: 284 VCLLLLFLVFELKFSEDPVFSKELFTNASVSLVLASIFFGWGTYGIWSGYFFRFLLNLRN 343

Query: 382 YTPLWAGGTHFMFVIWGTVAAFVVALTIKKVGPAVLLCFSMVAFDCGSIMLSVTPVHQTY 441
           Y+PL AG T+   VI G VA   +++ +K+ GP + L FS + F C  I+LSVTP+HQ+Y
Sbjct: 344 YSPLAAGSTYLTLVIGGYVAEIGISMLVKRTGPKLFLLFSSLGFTCSIIILSVTPIHQSY 403

Query: 442 WRMNVGMQIILSFGMDLSFPASSIILSDFLPMQYQGMAGSLVNTVVNYSTSLCLGMGNTV 501
           +R  +G  I L+ G+D SFP+S+IIL + LP +Y  M   L N + NY+ S   G+ N+ 
Sbjct: 404 FRSTLGSMIFLALGLDFSFPSSAIILQNELPSKYHEMTAVLTNGIFNYAISFWPGICNSA 463

Query: 502 EQQYNAHGADLLKGYRSALYLAIGLASAGV 531
            +  ++   +L+K YR   Y AIGL++ G+
Sbjct: 464 LRSLSS--IELIKYYRYVYYFAIGLSAIGL 491

>KNAG0D00130 Chr4 complement(6264..7961) [1698 bp, 565 aa] {ON}
           YOR378W
          Length = 565

 Score =  187 bits (475), Expect = 9e-52,   Method: Compositional matrix adjust.
 Identities = 138/502 (27%), Positives = 235/502 (46%), Gaps = 20/502 (3%)

Query: 67  HENDSPFQNPEYF--ETGFKEVMFIISCMVAQLLNQAGQTQSLSTMNVLADYFK-SNSSK 123
            E+D P    E     +   E++F++    +Q+L  AG  Q +  M+V+ ++FK ++ S 
Sbjct: 58  EEHDPPCTGEEATLNMSLLHEIIFVLLVSSSQVLGLAGAVQGIPQMDVIVEWFKLTHPSD 117

Query: 124 QPWLMASFPLVSGSFILISGRLGDIYGLKKALSVGYIIMTLWSIICGLAKYTNSDAFFIV 183
             W    +    GSF+LI+G++GD+ G K    +GY  + LWS++ G ++Y  S  FF  
Sbjct: 118 SGWCNGGYATTYGSFVLIAGKMGDMNGHKSMFLIGYAWLALWSLLTGFSRYCPSSHFFFF 177

Query: 184 CRSFQGLGIAFILPNIMGLVGNIYKVGTLRKNIVISCIGCMAPXXXXXXXXXXXXIVTED 243
           CR+ QG+G AF   + + ++G  Y     RKN + S  G                + T+ 
Sbjct: 178 CRAAQGIGAAFTFTSALSILGKSYP-PCKRKNFIFSFFGACG-SFGVVLGMVFSALFTQL 235

Query: 244 AEQWPWVFYAFGIASFVNMLLALYSIXXXXXXXXXXXXM---DWIXXXXXXXXXXXXNIV 300
           A  W W +++  IA  V ++L+++ I            +   D++            ++ 
Sbjct: 236 A-HWSWAYWSMAIACVVIIILSIFFIPGDVVEKHETSNVFYFDYLGAFLFVTGLVLFSVA 294

Query: 301 WNQAPIVGWGEAYXXXXXXXXXXXXXXFVVYEIKYATSPLLPPSVLENKKILMILAALFF 360
           WNQAP  G+G  Y               +  E K    PLLP + + +   L +L A+FF
Sbjct: 295 WNQAPTYGFGRTYVYVLLIVSVVILALAMYVETK-VDDPLLPWTHI-SANTLKVLLAIFF 352

Query: 361 GWGSFGIWTYYYYAFQLNLRKYTPLWAGGTHFMFVIWGTVAAFVVALTIK-KVGPAVLLC 419
            + SF +W  Y + F L  +  T L A        + G  AA   AL +   V   + + 
Sbjct: 353 AYASFTMWAAYTFRFNLMAKGDTLLLAAAKMTPMAVSGVFAALFSALLLNIHVQVQIRML 412

Query: 420 FSMVAFDCGSIMLSVTPVHQTYWRMNVGMQIILSFGMDLSFPASSIILSDFLPMQYQGMA 479
            S++AF    I+++     QTYW       I++SFG+D+SFP+++++LS+ +P +++G+ 
Sbjct: 413 ISLLAFLVPPILMATMGAGQTYWGEVFVTTIVISFGLDISFPSATLLLSNRIPDKFKGLG 472

Query: 480 GSLVNTVVNYSTSLCLGMGNTVEQ----QYNAH-GADLLKGYRSALYLAIGLASAGVCVS 534
            SLV  V+NY+T+L      +V +       AH G    K      Y+ IG A  G  V+
Sbjct: 473 ASLVGAVLNYATALGPPTAASVLRYQCPDCMAHKGNAFTKTINIIGYVGIGTAGLGTLVA 532

Query: 535 LVFLVTD---IIAKRHRKRIES 553
           +  ++T+   +  K+   R  S
Sbjct: 533 IFGVITEYPKVAGKKGEDRKHS 554

>SAKL0C06116g Chr3 complement(571813..572370) [558 bp, 185 aa] {ON}
           some similarities with uniprot|P13090 Saccharomyces
           cerevisiae YML116W ATR1 Multidrug efflux pump of the
           major facilitator superfamily required for resistance to
           aminotriazole and 4-nitroquinoline-N-oxide
          Length = 185

 Score =  154 bits (390), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 71/125 (56%), Positives = 98/125 (78%)

Query: 93  MVAQLLNQAGQTQSLSTMNVLADYFKSNSSKQPWLMASFPLVSGSFILISGRLGDIYGLK 152
           M++QLLNQ G TQ+L  +NVL+  F+S++++Q  L+AS PLVSGSFIL+SG++GDIYGLK
Sbjct: 1   MMSQLLNQVGTTQTLPLINVLSRGFESSTAEQTRLVASIPLVSGSFILVSGKVGDIYGLK 60

Query: 153 KALSVGYIIMTLWSIICGLAKYTNSDAFFIVCRSFQGLGIAFILPNIMGLVGNIYKVGTL 212
             L  GY  + +WS ICGL +Y  S  FF++ R+FQGLG+AF+LPN+MG V N+Y  G++
Sbjct: 61  NTLLFGYATVIVWSFICGLTRYAGSVQFFVIARAFQGLGLAFVLPNVMGTVSNVYIAGSI 120

Query: 213 RKNIV 217
           RKN+V
Sbjct: 121 RKNMV 125

>KAFR0C04860 Chr3 (964552..966156) [1605 bp, 534 aa] {ON}  YOR378W
          Length = 534

 Score =  143 bits (360), Expect = 4e-36,   Method: Compositional matrix adjust.
 Identities = 129/492 (26%), Positives = 220/492 (44%), Gaps = 26/492 (5%)

Query: 83  FKEVMFIISCMVAQLLNQAGQTQSLSTMNVLADYFKSNSSKQ---PWLMASFPLVSGSFI 139
           FKE++ ++     Q ++  G  Q +  M  +A  F     +     W  A++   + +F+
Sbjct: 46  FKEIIIVLLISSGQFISLLGAVQGIPQMASIASTFSLRPDQNLELGWCNAAYATTATTFV 105

Query: 140 LISGRLGDIYGLKKALSVGYIIMTLWSIICGLAKYTNSDA-FFIVCRSFQGLGIAFILPN 198
           +I+G+LGDI G K     GY  +TLWS++ G +KY  ++A FF  CR  QG+G AF+ P 
Sbjct: 106 IIAGKLGDINGHKNMFIFGYAWLTLWSLLTGFSKYAKANAVFFYFCRGAQGIGSAFLTPT 165

Query: 199 IMGLVGNIYKVGTLRKNIVISCIGCMAPXXXXXXXXXXXXIVTEDAEQWPWVFYAFGIAS 258
            + L+G  Y     RKN V S  G   P                    W W +++  +  
Sbjct: 166 GLALLGKHYP-PCKRKNYVFSFYGACGPFGIVAGSVFSALFT--QLTTWAWTYWSMAVTC 222

Query: 259 FVNMLLALYSI---XXXXXXXXXXXXMDWIXXXXXXXXXXXXNIVWNQAPIVGWGEAYXX 315
            +  +L+   I                D++            ++VWNQAP+  +   Y  
Sbjct: 223 LIITILSYIFIPKDNTPKRERSAFYSFDYVGGFCGITGMILFSVVWNQAPLSHFKAPYVY 282

Query: 316 XXXXXXXXXXXXFVVYEIKYATSPLLP-PSVLENKKILMILAALFFGWGSFGIWTYYYYA 374
                        ++ + +    PL+P  S+  N  ++  L  +FFG+  F IW +Y + 
Sbjct: 283 SLLIVSVVFMTMALIIDSR-VKDPLIPWKSMCSN--VIKALIVVFFGFLGFTIWLFYSWR 339

Query: 375 FQLNLRKYTPLWAGGTHFMFVIWGTVAA-FVVALTIKKVGPAVLLCFSMVAFDCGSIMLS 433
           F L  +  + L A        I G  AA F V L  KKV   + L  ++ AF   +I++S
Sbjct: 340 FYLVAKNDSLLLAAAKFIPLGISGIFAACFSVLLLNKKVPVQLRLLTAVCAFLICAILIS 399

Query: 434 VTPVHQTYWRMNVGMQIILSFGMDLSFPASSIILSDFLPMQYQGMAGSLVNTVVNYSTSL 493
              + +TYW       +I++ G+D++FP+++++LS+ +  + QG+A +L  T +NY T+L
Sbjct: 400 TMTLQETYWGNAFVATVIIAIGLDVAFPSATLLLSNGVLNEQQGLAAALAATALNYGTAL 459

Query: 494 CLGMGNTV-----EQQYNAHGADLLKGYRSALYLAIGLASAGVCVSLVFLVTDIIAK--- 545
             G+   +     +          +     A Y+AIG A   V V++   +T+   +   
Sbjct: 460 GPGVATLIITYQCDDCLARSDGRFVHAVHIAGYVAIGTAGIAVVVAIFGSITEYYKERMD 519

Query: 546 --RHRKR-IESE 554
             R +KR I SE
Sbjct: 520 DLREKKRPISSE 531

>CAGL0L02519g Chr12 complement(297555..299144) [1590 bp, 529 aa]
           {ON} similar to uniprot|Q08902 Saccharomyces cerevisiae
           YOR378w
          Length = 529

 Score =  135 bits (341), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 108/442 (24%), Positives = 195/442 (44%), Gaps = 21/442 (4%)

Query: 64  DDCHENDSPFQNPEYFETGFKEVMFIISCMVAQLLNQAGQTQSLSTMNVLADYFKSNSSK 123
           +   E D+  + P+   T  +E+  +I  + +QL+   G  Q +     L + ++   +K
Sbjct: 20  EKLTEVDTSIRLPK---TWIREIFLVIILISSQLVTLIGAVQGVPIAAYLRERYRIEPAK 76

Query: 124 QP---WLMASFPLVSGSFILISGRLGDIYGLKKALSVGYIIMTLWSIICGLAKYTNSD-A 179
                W  AS+ L S   +LI+G+LGD+ G K+ +  G+I +T+WS+I G + Y   + A
Sbjct: 77  GGLVGWANASYMLGSAVMVLIAGKLGDLNGHKRMVVFGWIWLTIWSLITGFSYYDRGNQA 136

Query: 180 FFIVCRSFQGLGIAFILPNIMGLVGNIYKVGTLRKNIVISCIGCMAPXXXXXXXXXXXXI 239
           F+   R+ QG+G  FI+PN + ++G  Y    L+K I+ S  G M               
Sbjct: 137 FYYTARALQGIGSGFIVPNSLAIMGRTYFEPGLKKTIIFSIFGMMTSTGFVIGTTFSSLF 196

Query: 240 VTEDAEQWPWVFYAFGIASFVNMLLALY-----SIXXXXXXXXXXXXMDWIXXXXXXXXX 294
                 +W W ++A      +  + A+      +I             D++         
Sbjct: 197 --AQLTKWAWNYWALACVCVLYTVGAILFIPPDNIVHKPNSKPLYKRFDYLGAITGVSGL 254

Query: 295 XXXNIVWNQAPIVGWG--EAYXXXXXXXXXXXXXXFVVYEIKYATSPLLPPSVLENKKIL 352
              ++ + QA  +GW     Y              FV + +     PL+P   L    ++
Sbjct: 255 VLFDVAFTQASALGWSPPHTYITLIIGVILILIAMFVDWRVD---DPLVPLQHLR-ADVV 310

Query: 353 MILAALFFGWGSFGIWTYYYYAFQLNLRKYTPLWAGGTHFMFVIWGTVAA-FVVALTIKK 411
           +IL  ++FG+ SF IW  +++ F   +   +PL          I    AA F V      
Sbjct: 311 VILICVYFGFLSFVIWANWFWQFYELVHNDSPLRIAAKLVPLAIGSIPAAIFTVTCLQLN 370

Query: 412 VGPAVLLCFSMVAFDCGSIMLSVTPVHQTYWRMNVGMQIILSFGMDLSFPASSIILSDFL 471
           +    ++  SMV F   +I+++    + TYW       II  F +D++ P ++++ SD +
Sbjct: 371 IKAPTMMVISMVCFLVPNILMATVTPNTTYWAQPFVSSIIAPFAVDITVPTATLLFSDSV 430

Query: 472 PMQYQGMAGSLVNTVVNYSTSL 493
             + QG+A SL+ TV++Y+ S+
Sbjct: 431 RKESQGIAASLIITVISYAISI 452

>NCAS0A05720 Chr1 (1117491..1119182) [1692 bp, 563 aa] {ON} 
          Length = 563

 Score =  135 bits (341), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 124/499 (24%), Positives = 210/499 (42%), Gaps = 35/499 (7%)

Query: 75  NPEYFETGFKEVMFIISCMVAQLLNQAGQTQSLSTMNVLADYFK---SNSSKQPWLMASF 131
           NP    +  +E MFI+    +Q ++ A  +Q++  M+ +  +F+     S +  W  A+F
Sbjct: 61  NPPPGPSRLRECMFIVIIASSQFISLAAASQAILQMDAITAWFQLPADRSLEAGWANAAF 120

Query: 132 PLVSGSFILISGRLGDIYGLKKALSVGYIIMTLWSIICGLAKYT--NSDAFFIVCRSFQG 189
            +  G+FI+ +G+L D+ G K     GY   TLWS++ G+++Y       FF   R  QG
Sbjct: 121 AITCGTFIIPAGKLCDLIGSKTVFIFGYAWYTLWSLLVGISRYAPKGQATFFFFGRGCQG 180

Query: 190 LGIAFILPNIMGLVGNIYKVGTLRKNIVISCIGCMAPXXXXXXXXXXXXIVTEDAEQWPW 249
           +G A + P+ + L+G  Y   + +KNIV S  G   P            I T+ A  W W
Sbjct: 181 IGAAALFPSSLALLGKYYP-PSCKKNIVFSLYGFCVPLGVVVGGVFSA-IFTQLA-HWSW 237

Query: 250 VFYAFGIASFVNMLLALYSIXXXXXXXXXXXX----------MDWIXXXXXXXXXXXXNI 299
            +++  I S    L++ + I                       D++             +
Sbjct: 238 NYWSMAIVSAFFTLISCFYIPPDEIIKSEEQKKKRAWFHLPKFDYLGTFLYVASLLLFAV 297

Query: 300 VWNQAPIVGWGEAYXXXXXXXXXXXXXXFVVYEIKYATSPLLPPSVLENKKILMILAALF 359
            WNQA    +                   V+ E  Y   P++P   +  + I  +L  +F
Sbjct: 298 CWNQATGFKFKSVQVYVTLIVSLVCFVAMVIVEF-YVDDPIIPARKIHPQTIKALLV-VF 355

Query: 360 FGWGSFGIWTYYYYAFQLNLRKYTPLWAGGTHFMFVIWGTVAAFVVALTIKKVGPA-VLL 418
           F + SF IW +Y + +   +R  T L          I G +AA    L I    P  + L
Sbjct: 356 FSYLSFTIWLFYLWKYFTVVRNDTVLLGAAKFVPLSIAGFIAALFSILLISTAVPVQIRL 415

Query: 419 CFSMVAFDCGSIMLSVTPVHQTYWRMNVGMQIILSFGMDLSFPASSIILSDFLPMQYQGM 478
                +F    I+       ++YW       II+S G+D+SFP+++++LS+ +P + +G+
Sbjct: 416 LAGACSFLLAHILFITLSRTESYWARPFLTIIIISIGLDISFPSATLLLSNGVPQELRGI 475

Query: 479 AGSLVNTVVNYSTSLCLGMGNTVEQQYNAHGAD----------LLKGYRSALYLAIGLAS 528
           + +LV T +NY T    G+G  + Q    +  D           +K    A  + IG + 
Sbjct: 476 SAALVGTALNYGT----GIGPPIAQTIIGYQCDKCMASGDMDQFVKAIHIAAAVGIGASG 531

Query: 529 AGVCVSLVFLVTDIIAKRH 547
             V V L   VT+   + H
Sbjct: 532 IAVVVGLYGTVTEYSWETH 550

>NDAI0K02730 Chr11 complement(612590..614404) [1815 bp, 604 aa] {ON}
           
          Length = 604

 Score =  114 bits (286), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 109/526 (20%), Positives = 217/526 (41%), Gaps = 71/526 (13%)

Query: 83  FKEVMFIISCMVAQLLNQAGQTQSLSTMNVLADYFK---SNSSKQPWLMASFPLVSGSFI 139
             +++FI     +Q +  A  +Q++  M+ L+ +FK   +++ +  W+ ASF +  G+FI
Sbjct: 69  LNDIIFIFLICSSQFITLASASQAILQMDSLSVWFKIPPTSTLQLGWVNASFAMTCGAFI 128

Query: 140 LISGRLGDIYGLKKALSVGYIIMTLWSIICGLAKYTNSDAFFI-VCRSFQGLGIAFILPN 198
           +++G+L DI   +     GY+  +LW++I G A Y   +  F+ +CR  QG+G A + P+
Sbjct: 129 ILAGKLCDILNPRIIFISGYVWFSLWTLITGFASYVPKNMIFLYICRGCQGIGGALLFPS 188

Query: 199 IMGLVGNIYKVGTL---------------------------------------------- 212
            + L+   Y V                                                 
Sbjct: 189 ALILLNQYYTVPEPSPSQSQSKSPTTSAPSPSHDIEKNLSSDDDNDGDSSIADDSDIICT 248

Query: 213 RKNIVISCIGCMAPXXXXXXXXXXXXIVTEDAEQWPWVFYAFGIASFVNMLLALYSIXXX 272
            K+I  S  G  AP            I T+ A  WPW +++  I + +  +L+ + +   
Sbjct: 249 SKSIAFSLYGACAPLGIVIGGIFSA-IFTQLAT-WPWNYWSMSIVTTLLSILSYFYVVVP 306

Query: 273 XXXXXXXXX---------MDWIXXXXXXXXXXXXNIVWNQAPIVGWGEAYXXXXXXXXXX 323
                              D++             + W+QA +  +   +          
Sbjct: 307 IPVEKLDSNPNSLKNWKNFDFLGVILGISALILFGVSWDQATMYKFKTIHVYLTLLFSLV 366

Query: 324 XXXXFVVYEIKYATSPLLPPSVLENKKILMILAALFFGWGSFGIWTYYYYAFQLNLRKYT 383
                +++E  Y  +P++P   +    I  +L  +FF + SF  W +Y +     ++  +
Sbjct: 367 SFIAMIIWE-YYFNNPIIPIRQIHPGTIKALLV-VFFSYISFTQWLFYTWKLFTEVKDNS 424

Query: 384 PLWAGGTHFMFVIWGTVAA-FVVALTIKKVGPAVLLCFSMVAFDCGSIMLSVTPVHQTYW 442
           P+          + G ++A F + L +K+V   + L     +F    I+L    +  +YW
Sbjct: 425 PILGSVKFIPLSVAGIISATFSILLIVKRVPVQIRLLAGASSFLLSHILLLTCKLDSSYW 484

Query: 443 RMNVGMQIILSFGMDLSFPASSIILSDFLPMQYQGMAGSLVNTVVNYSTSLCLGMGNTVE 502
                  I +S G+D+SFP+++++L++ +P + QG+  +LV +V+NY T++   +  T+ 
Sbjct: 485 TYQFFSIISISIGLDISFPSATLLLTNGIPPEIQGICAALVGSVLNYGTAIGPPIAQTII 544

Query: 503 Q------QYNAHGAD-LLKGYRSALYLAIGLASAGVCVSLVFLVTD 541
           Q        + H     LKG   A  + +G +   V + +   +T+
Sbjct: 545 QYQCESCMSDPHDKKAFLKGIHIAGAVGVGCSGIAVLIGIYGTITE 590

>Kwal_34.15746 s34 (37757..39313) [1557 bp, 518 aa] {ON} YGR224W
           (AZR1) - MFS-MDR [contig 274] FULL
          Length = 518

 Score = 49.7 bits (117), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 36/124 (29%), Positives = 58/124 (46%), Gaps = 8/124 (6%)

Query: 74  QNPEYFETGFKEVMFIISCMVAQLLNQAGQTQSLSTMNVLADYFKSNSSKQPWLMASFPL 133
           QN  Y + G    +    C    LLN AG    +S +  L + +K   +   W + S+ +
Sbjct: 20  QNSRY-QLGINITLIFFGCTF-DLLNVAG---VISVIEDLGETYKLGYTGASWALTSYAI 74

Query: 134 VSGSFILISGRLGDIYGLKKALSVGYIIMTLWSIICGLAKYTNSDAFFIVCRSFQGLGIA 193
               FI   GRLGDI G     ++   + TL+S++C + +   + A F   R+ QG+  A
Sbjct: 75  TFAGFIAFMGRLGDIVGNSVLFTISCFLFTLFSLLCAVVRDFPTFAVF---RALQGISAA 131

Query: 194 FILP 197
            I+P
Sbjct: 132 GIVP 135

 Score = 32.3 bits (72), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 30/165 (18%), Positives = 71/165 (43%), Gaps = 8/165 (4%)

Query: 379 LRKYTPLWAGGTHFMFVIWGTVAAFVVALTIKKVGPAVLLCFSMVAFDCGSIMLSV--TP 436
           + K +PL AG      ++   +     A+   ++ P V +    +   CGSI+L    T 
Sbjct: 345 VEKNSPLIAGVRLIPLIVSMVIGNTTCAIRSLQLRPKVGVVLGFLFMLCGSIILIQLHTI 404

Query: 437 VHQTYWRMNVGMQIILSFGMDLSFPASSIILSDFLPMQYQGMAGSLVNTVVNYSTSLCLG 496
            +  +W++    QI +  G  + +P +  ++    P   +G+A  +  T   +   +   
Sbjct: 405 ENGIFWKLFFCSQISVGLGAAIFYPYALKLVVGGAPDGAKGIASGMTQTFAQFGVEVTFS 464

Query: 497 -----MGNTVEQQYNAHGADLLKG-YRSALYLAIGLASAGVCVSL 535
                +GN  + +   +  +  K  +++  Y ++ +A+ G+ ++L
Sbjct: 465 VMVSVLGNITDVKETLNSQETFKDRFQNCAYFSVAVAALGLILTL 509

>SAKL0F00440g Chr6 complement(36452..38086) [1635 bp, 544 aa] {ON}
           conserved hypothetical protein
          Length = 544

 Score = 47.0 bits (110), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 53/237 (22%), Positives = 94/237 (39%), Gaps = 13/237 (5%)

Query: 330 VYEIKYATSPLLPPSVLENKKILMILAALFFGWGSFGIWTYYYYAFQLNLRKYTPLWAGG 389
           VY        L+P  VL  K  + I  A+F  +G      Y    +   + K +PL A  
Sbjct: 293 VYNYFRTIQVLIPKDVLMMKNFIPITVAVFANYGCLFSNLYIVNQYCQYVSKNSPLLAAV 352

Query: 390 THFMFVIWGTVAAFVVALTIKKVGPAVLLCFSMVAFDCGSIMLSVTPVH----QTYWRMN 445
                V+   +   V+A+    + P   +         GSI+L    +H      YW++ 
Sbjct: 353 KLLPLVVSMLIPNVVIAIKSDLISPRKAVVLGFFIMFIGSIIL--IQLHLITDNLYWKIF 410

Query: 446 VGMQIILSFGMDLSFPASSIILSDFLPMQYQGMAGSLVNTVVNYSTSLCLG-----MGNT 500
              Q +++FG  + FP S  IL  F P +Y+G+A  ++ T   +   +        +GN 
Sbjct: 411 FCSQSLIAFGAAIFFPYSLNILIGFAPDEYKGIASGVMQTFGQFGVEVTFSVMTSILGNI 470

Query: 501 VEQQYNAHGADLLKG-YRSALYLAIGLASAGVCVSLVFLVTDIIAKRHRKRIESECE 556
            E    +  A + K  +++  Y  +  +  G+ +S  F V +         + + CE
Sbjct: 471 NELSGKSGSAGIYKTRFQNCTYFTLASSVVGL-ISTAFFVKENKPTDDTGSLSTICE 526

 Score = 40.4 bits (93), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 35/133 (26%), Positives = 60/133 (45%), Gaps = 8/133 (6%)

Query: 71  SPFQNPEYFETGFKEVMFIISCMVAQLLNQAGQTQSLSTMNVLADYFKSNSSKQPWLMAS 130
           S FQN   F      V+ ++SC    L+N    T  LS    + + ++   +   W + +
Sbjct: 14  SNFQNIS-FHRYINLVLIMVSCAF-DLINV---TAVLSATRDIENTYQIEFTTASWALTA 68

Query: 131 FPLVSGSFILISGRLGDIYGLKKALSVGYIIMTLWSIICGLAKYTNSDAFFIVCRSFQGL 190
           + +    FI   GR+GDI G          + ++ S+IC +    N+   F V R+ QG+
Sbjct: 69  YAITFAGFIAFLGRVGDIIGNSVLFVSSCFLFSILSLICAVV---NNFGTFAVFRALQGI 125

Query: 191 GIAFILPNIMGLV 203
             A I+P+   L+
Sbjct: 126 AAAGIVPSGYALI 138

>KLLA0C18931g Chr3 (1680133..1681794) [1662 bp, 553 aa] {ON}
           uniprot|Q874B4 Kluyveromyces lactis KLLA0C18931g Drug
           efflux permease KNQ1
          Length = 553

 Score = 45.1 bits (105), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 35/111 (31%), Positives = 58/111 (52%), Gaps = 5/111 (4%)

Query: 117 FKSNSSKQPWLMASFPLVSGSFILISGRLGDIYGLKKALSVGYIIMTLWSIICGLAKYTN 176
           F  + ++  W + S+ +    FI   GR+GDI G    + V  +I  ++S++C  A   N
Sbjct: 53  FNVSHTQSGWALTSYVITFAGFIAFFGRVGDIVGNGIMMCVFSVIFGIFSLLC--AVVPN 110

Query: 177 SDAFFIVCRSFQGLGIAFILPNIMGLVGNIYKVGTLRK--NIVISCIGCMA 225
             A F V R+FQG+  A I+P    LV  +++   L++  +I+ S I  MA
Sbjct: 111 FIA-FTVFRAFQGMAGAGIVPCAYALVNKMFQGPNLQRYFSILSSVISAMA 160

 Score = 32.0 bits (71), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 21/68 (30%), Positives = 34/68 (50%), Gaps = 1/68 (1%)

Query: 472 PMQYQGMAGSLVNTVVNYSTSLCLGMGNTVEQQYNAHGADLLKGYRSALYLAIGLASAGV 531
           P QY+ +AG +V T   +   + L +  ++        ADL   +++A Y+ I  A+   
Sbjct: 432 PDQYKALAGGIVQTSGQFGNEVSLSIVISLLGNQTTDKADLRDRFQNASYIVITAATIST 491

Query: 532 CVSLVFLV 539
            VSL FLV
Sbjct: 492 LVSL-FLV 498

>CAGL0J01375g Chr10 (127843..129537) [1695 bp, 564 aa] {ON} similar
           to uniprot|Q04301 Saccharomyces cerevisiae YMR088c
          Length = 564

 Score = 43.9 bits (102), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 33/136 (24%), Positives = 60/136 (44%), Gaps = 4/136 (2%)

Query: 56  SKGCICSVDDCHENDSPFQNPEYFETGFKEVMFIISCMVAQLLNQAGQTQSLSTMNVLAD 115
           + G +    D  E D+  Q          ++  ++S  +   L+    T   + MN +A+
Sbjct: 7   TTGLLEQTPDTTEQDALEQEYHEHNLSLPKLPIVLSLWLGSFLSSLDGTIVANIMNRVAE 66

Query: 116 YFKSNSSKQPWLMASFPLVSGSFILISGRLGDIYGLKKALSVGYIIMTLWSIICGLAKYT 175
            F+ +  KQ W+  S+ L + +F  + G+L D+ G K A+   +    L    C L  + 
Sbjct: 67  EFQESDKKQ-WIATSYLLTNTAFQPLYGKLSDLTGRKFAVLTAHFFFGLG---CLLTCFA 122

Query: 176 NSDAFFIVCRSFQGLG 191
           NS   F + R+  G+G
Sbjct: 123 NSVTQFAIARAICGVG 138

>NCAS0A07810 Chr1 complement(1554541..1556247) [1707 bp, 568 aa]
           {ON} Anc_2.473
          Length = 568

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 31/130 (23%), Positives = 59/130 (45%), Gaps = 4/130 (3%)

Query: 62  SVDDCHENDSPFQNPEYFETGFKEVMFIISCMVAQLLNQAGQTQSLSTMNVLADYFKSNS 121
           S++D  E++   +    +     +   ++S  +   L+    T   + MN +A+ F+ + 
Sbjct: 16  SIEDGEEDNGLEEQYHEYNLSLPKFPILLSLWLGSFLSSLDSTIVANIMNKVAEEFEESD 75

Query: 122 SKQPWLMASFPLVSGSFILISGRLGDIYGLKKALSVGYIIMTLWSIICGLAKYTNSDAFF 181
            KQ W+  SF L + +F  + G+L DI G K A+   +    L    C L  +  +   F
Sbjct: 76  KKQ-WIATSFLLTNTAFQPLYGKLSDITGRKFAVLTSHFFFGLG---CFLTCFAQNITQF 131

Query: 182 IVCRSFQGLG 191
            + R+  G+G
Sbjct: 132 SIARAICGIG 141

>Smik_13.272 Chr13 complement(427283..428968) [1686 bp, 561 aa] {ON}
           YMR088C (REAL)
          Length = 561

 Score = 40.8 bits (94), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 27/82 (32%), Positives = 43/82 (52%), Gaps = 4/82 (4%)

Query: 110 MNVLADYFKSNSSKQPWLMASFPLVSGSFILISGRLGDIYGLKKALSVGYIIMTLWSIIC 169
           MN +A+ F S SS++ W+  SF L + +F  + G+L DI G K AL   +     + I C
Sbjct: 60  MNRVAEEF-SESSRKQWIATSFLLTNTAFQPLYGKLSDITGRKSALLTAHF---FFGIGC 115

Query: 170 GLAKYTNSDAFFIVCRSFQGLG 191
            L  +  +   F + R+  G+G
Sbjct: 116 LLTCFARNVTEFSIARAICGIG 137

>KLTH0H16214g Chr8 complement(1398230..1399885) [1656 bp, 551 aa]
           {ON} conserved hypothetical protein
          Length = 551

 Score = 40.4 bits (93), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 30/102 (29%), Positives = 48/102 (47%), Gaps = 6/102 (5%)

Query: 96  QLLNQAGQTQSLSTMNVLADYFKSNSSKQPWLMASFPLVSGSFILISGRLGDIYGLKKAL 155
            LLN AG    +S +  L + +    +   W + S+ +     I   GRLGDI G     
Sbjct: 44  DLLNVAG---VISVIEDLGETYGLEYTTASWALTSYAITFAGLIAFMGRLGDIIGNSVLF 100

Query: 156 SVGYIIMTLWSIICGLAKYTNSDAFFIVCRSFQGLGIAFILP 197
           ++     +L+ ++C  A  TN  A F V R+ QG+  A ++P
Sbjct: 101 TISGFFFSLFCLLC--AVVTNFPA-FAVLRALQGIAAAGLVP 139

 Score = 35.0 bits (79), Expect = 0.58,   Method: Compositional matrix adjust.
 Identities = 32/166 (19%), Positives = 70/166 (42%), Gaps = 8/166 (4%)

Query: 381 KYTPLWAGGTHFMFVIWGTVAAFVVALTIKKVGPAVLLCFSMVAFDCGSIML-SVTPVHQ 439
           K +PL AG      +I   +   + A    K+ P + +    ++  CGSI+L  +  V +
Sbjct: 351 KNSPLLAGVKLVPLIITMVIGNTICASKSVKLRPRIGVALGFLSMVCGSIILIQLHLVEE 410

Query: 440 T-YWRMNVGMQIILSFGMDLSFPASSIILSDFLPMQYQGMAGSLVNTVVNYSTSLCLG-- 496
             YW++    QI++ FG  + +P +  ++    P   +G+A  +  T       +     
Sbjct: 411 NLYWKIMFCSQILVGFGAAIFYPYALKLVVGDAPSGAKGIASGVTQTFAQLGIEMTFSVM 470

Query: 497 ---MGNTVEQQYNAHGADLLK-GYRSALYLAIGLASAGVCVSLVFL 538
              +GN  + +      +  + G++   Y  +   + G+ ++  F+
Sbjct: 471 VSVLGNITQVKSRPDSFERFRDGFQKCTYFTLASGAFGLVLTTFFV 516

>TDEL0D06610 Chr4 complement(1195341..1196834) [1494 bp, 497 aa]
           {ON}  possible pseudogene; N added at two sites to avoid
           frameshifts
          Length = 497

 Score = 39.7 bits (91), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 26/87 (29%), Positives = 44/87 (50%), Gaps = 3/87 (3%)

Query: 107 LSTMNVLADYFKSNSSKQPWLMASFPLVSGSFILISGRLGDIYGLKKALSVGYIIMTLWS 166
           +S ++ L+  +  + +   W + S+ +    FI   GRLGDI G  +  +V      + S
Sbjct: 49  ISLIDELSTKYSISYTTASWSLTSYAVTFAGFIAFMGRLGDIVGNSRLFTVSCGCFAILS 108

Query: 167 IICGLAKYTNSDAFFIVCRSFQGLGIA 193
           ++CGL    N +A F V R+ QG+  A
Sbjct: 109 LLCGLMP--NFEA-FAVMRALQGIAAA 132

>YMR088C Chr13 complement(443414..445102) [1689 bp, 562 aa] {ON}
           VBA1Permease of basic amino acids in the vacuolar
           membrane
          Length = 562

 Score = 39.7 bits (91), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 31/103 (30%), Positives = 48/103 (46%), Gaps = 4/103 (3%)

Query: 89  IISCMVAQLLNQAGQTQSLSTMNVLADYFKSNSSKQPWLMASFPLVSGSFILISGRLGDI 148
           + S  +   L+    T   + MN +A+ F S SSK+ W+  SF L + +F  + G+L DI
Sbjct: 39  LFSLWLGSFLSSLDSTIVANIMNRVAEEF-SESSKKQWIATSFLLTNTAFQPLYGKLSDI 97

Query: 149 YGLKKALSVGYIIMTLWSIICGLAKYTNSDAFFIVCRSFQGLG 191
            G K AL        L    C L  +  +   F + R+  G+G
Sbjct: 98  TGRKSALLTAQFFFGLG---CLLTCFARNVTEFSIARAICGIG 137

>Skud_13.244 Chr13 complement(417271..418959) [1689 bp, 562 aa] {ON}
           YMR088C (REAL)
          Length = 562

 Score = 39.3 bits (90), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 30/103 (29%), Positives = 49/103 (47%), Gaps = 4/103 (3%)

Query: 89  IISCMVAQLLNQAGQTQSLSTMNVLADYFKSNSSKQPWLMASFPLVSGSFILISGRLGDI 148
           + S  +   L+    T   + MN +A+ F S SS++ W+  SF L + +F  + G+L DI
Sbjct: 39  LFSLWLGSFLSSLDSTIVANIMNRVAEDF-SESSRKQWIATSFLLTNTAFQPLYGKLSDI 97

Query: 149 YGLKKALSVGYIIMTLWSIICGLAKYTNSDAFFIVCRSFQGLG 191
            G K AL +      L    C L  +  +   F + R+  G+G
Sbjct: 98  TGRKSALLIAQFFFGLG---CLLTCFARNVTEFSIARAICGIG 137

>TDEL0A02490 Chr1 (446429..448093) [1665 bp, 554 aa] {ON} Anc_2.473
           YMR088C
          Length = 554

 Score = 38.9 bits (89), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 22/64 (34%), Positives = 37/64 (57%), Gaps = 1/64 (1%)

Query: 110 MNVLADYFKSNSSKQPWLMASFPLVSGSFILISGRLGDIYGLKKALSVGYIIMTLWSIIC 169
           MN +A+ F S S K+ W+  SF L + +F  + G+L D+ G K AL + Y  + +  ++ 
Sbjct: 59  MNRVAEEF-SESDKKQWIATSFLLTNTAFQPLYGKLSDVTGRKFALLMAYFFLVIGCLLT 117

Query: 170 GLAK 173
            LA+
Sbjct: 118 CLAR 121

>KLLA0F13684g Chr6 complement(1267367..1269082) [1716 bp, 571 aa]
           {ON} similar to uniprot|Q04301 Saccharomyces cerevisiae
           YMR088C VBA1 Permease of basic amino acids in the
           vacuolar membrane
          Length = 571

 Score = 38.5 bits (88), Expect = 0.049,   Method: Compositional matrix adjust.
 Identities = 24/82 (29%), Positives = 44/82 (53%), Gaps = 4/82 (4%)

Query: 110 MNVLADYFKSNSSKQPWLMASFPLVSGSFILISGRLGDIYGLKKALSVGYIIMTLWSIIC 169
           MN +A+ F+ +  KQ W++ SF L + +F  + G+L D+ G K AL V +   + + + C
Sbjct: 64  MNKVAEEFEESDKKQ-WIVTSFLLTNTAFQPLYGKLSDLAGRKTALMVAH---SFFLVGC 119

Query: 170 GLAKYTNSDAFFIVCRSFQGLG 191
                + +   F + R+  G+G
Sbjct: 120 LFTALSRNLVEFSIARAVCGMG 141

>Ecym_7399 Chr7 complement(820280..821971) [1692 bp, 563 aa] {ON}
           similar to Ashbya gossypii ABL040W
          Length = 563

 Score = 38.5 bits (88), Expect = 0.050,   Method: Compositional matrix adjust.
 Identities = 41/161 (25%), Positives = 69/161 (42%), Gaps = 19/161 (11%)

Query: 53  SVTSKGCICSVDDCHENDSPFQNPEYFETGFKEVM----FIISCMVAQLLNQAGQTQSLS 108
           S T +G  C + D  E               +EVM     ++S  +A  L    +T   +
Sbjct: 21  SYTEEGQDCKIFDSDEFGK-----------LQEVMPRLPMLLSLWMANFLASMDRTIIAN 69

Query: 109 TMNVLADYFKSNSSKQPWLMASFPLVSGSFILISGRLGDIYGLKKALSVGYIIMTLWSII 168
            MN + + FK +   Q W+  SF L S  F  I G+L D+ G +  L + Y   +L+ + 
Sbjct: 70  IMNSVTEEFKESHRIQ-WVATSFLLTSTVFQPIYGKLSDVTGRRFVLVLAY---SLFLLG 125

Query: 169 CGLAKYTNSDAFFIVCRSFQGLGIAFILPNIMGLVGNIYKV 209
           C +  Y  +   F   R+  G+G   I    +  +G+++ V
Sbjct: 126 CLVTAYARNIWEFAFGRAICGIGAGGIPTMCVITMGDMFSV 166

>Suva_13.265 Chr13 complement(424929..426614) [1686 bp, 561 aa] {ON}
           YMR088C (REAL)
          Length = 561

 Score = 38.1 bits (87), Expect = 0.055,   Method: Compositional matrix adjust.
 Identities = 29/103 (28%), Positives = 48/103 (46%), Gaps = 4/103 (3%)

Query: 89  IISCMVAQLLNQAGQTQSLSTMNVLADYFKSNSSKQPWLMASFPLVSGSFILISGRLGDI 148
           + S  +   L+    T   + MN +A+ F S SSK+ W+  SF L + +F  + G+L DI
Sbjct: 39  LFSLWLGSFLSSLDSTIVANIMNRVAEEF-SESSKKQWIATSFLLTNTAFQPLYGKLSDI 97

Query: 149 YGLKKALSVGYIIMTLWSIICGLAKYTNSDAFFIVCRSFQGLG 191
            G + AL        L  ++   A+       F + R+  G+G
Sbjct: 98  IGRRPALLTAQFFFGLGCLMTCFARNVTE---FSIARAVCGIG 137

>Suva_10.11 Chr10 (18934..20556) [1623 bp, 540 aa] {ON} YOR378W
           (REAL)
          Length = 540

 Score = 38.1 bits (87), Expect = 0.062,   Method: Compositional matrix adjust.
 Identities = 32/108 (29%), Positives = 50/108 (46%), Gaps = 6/108 (5%)

Query: 96  QLLNQAGQTQSLSTMNVLADYFKSNSSKQPWLMASFPLVSGSFILISGRLGDIYGLKKAL 155
            LLN A     +S ++ LA  +  + +   W + S+ +    FI   GRLGDI G     
Sbjct: 41  DLLNVASM---ISLIDDLAQKYDISYTTASWSLTSYAVTFAGFIAFMGRLGDIVGNSILF 97

Query: 156 SVGYIIMTLWSIICGLAKYTNSDAFFIVCRSFQGLGIAFILPNIMGLV 203
           +V      + S++C  A   N  A F V R+ QG+  A ++P    L+
Sbjct: 98  TVSCFFFAILSLLC--AVMPNFPA-FAVFRAIQGISAAGLVPCAYALI 142

 Score = 36.2 bits (82), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 50/239 (20%), Positives = 97/239 (40%), Gaps = 25/239 (10%)

Query: 340 LLPPSVLENKKILMILAALFFGWGSFGIWTYYYYAFQLNLRKYTPLWAGGTHFMFVIWGT 399
           L+P  VL  K  + I+ A            Y    +     K +PL+AG      +I   
Sbjct: 303 LIPVDVLFMKNFIPIVLAFALNNACLFSCIYIIDQYSQYEEKNSPLYAGVKLVPLIICMV 362

Query: 400 VAAFVVALTIKKVGP--AVLLCFSMVAFDCGSIMLSVTPVH----QTYWRMNVGMQIILS 453
           +   + A    K+ P   V+L FS+     GSI+L  T +H      +W++    Q ++ 
Sbjct: 363 IGNGLCAFESTKLKPKVGVVLGFSLAL--AGSIIL--TQLHLIKEDMFWKIFFSSQALVG 418

Query: 454 FGMDLSFPASSIILSDFLPMQYQGMAGSLVNTV----VNYSTSLCLGMGNTVEQQYNAHG 509
           FG+ + +P +  I     P + +G+A  +  T     +  + S+   +   ++      G
Sbjct: 419 FGVAIFYPYALQIAVGGAPDRSKGIASGVAQTFGQLGIEITFSVMASVLGNIDGIRGKSG 478

Query: 510 A--DLLKGYRSALYLAIGLASAGVCVSLVFL---------VTDIIAKRHRKRIESECES 557
           A      G+++  Y  + + + G  V+L  L         ++D+ +   R ++E + E 
Sbjct: 479 ASQKFRTGFQNCTYFTVAVGALGFLVTLFGLKDTRPPTDDISDVESSIQRTKVEMDQEK 537

>AGR076C Chr7 complement(871564..873624) [2061 bp, 686 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR119W
          Length = 686

 Score = 37.7 bits (86), Expect = 0.082,   Method: Compositional matrix adjust.
 Identities = 19/67 (28%), Positives = 37/67 (55%), Gaps = 3/67 (4%)

Query: 110 MNVLADYFKSNSSKQP---WLMASFPLVSGSFILISGRLGDIYGLKKALSVGYIIMTLWS 166
           +  L D+  S  ++ P   W+  ++ L S +F  + G+L DI+G +  L    ++  L +
Sbjct: 160 VTTLLDHIASEFNELPRISWIATAYLLSSATFQPLYGKLSDIFGRRPLLVFSNLVFCLGA 219

Query: 167 IICGLAK 173
           +ICG++K
Sbjct: 220 LICGMSK 226

 Score = 32.3 bits (72), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 19/55 (34%), Positives = 30/55 (54%), Gaps = 3/55 (5%)

Query: 328 FVVYEIKYATSPLLPPSVLENKKILMILAALFF---GWGSFGIWTYYYYAFQLNL 379
           F+ +E+  AT P+LP   LEN+ +L    + +F   G  + G +   YYA  LN+
Sbjct: 385 FIYHELYVATDPILPIRFLENRSVLAASLSNWFCMMGMMTTGFYIPVYYASVLNM 439

>Smik_6.24 Chr6 (39520..41154) [1635 bp, 544 aa] {ON} YMR279C (REAL)
          Length = 544

 Score = 37.4 bits (85), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 48/237 (20%), Positives = 90/237 (37%), Gaps = 21/237 (8%)

Query: 340 LLPPSVLENKKILMILAALFFGWGSFGIWTYYYYAFQLNLRKYTPLWAGGTHFMFVIWGT 399
           L+P  VL  K  + I+ A            Y    +     K +PL AG      +I   
Sbjct: 303 LIPVDVLFMKNFIPIVLAFALNNACLFSCLYIIDQYSQYAEKDSPLLAGVKLVPLIICMV 362

Query: 400 VAAFVVALTIKKVGPAVLLCFSMVAFDCGSIMLSVTPVH----QTYWRMNVGMQIILSFG 455
           V   + A    K+ P V +         GSI+L    +H      +W++    Q ++ FG
Sbjct: 363 VGNALCAFESTKLKPRVGVALGFSLALAGSIIL--IQLHLIKDNVFWKIFFSSQALVGFG 420

Query: 456 MDLSFPASSIILSDFLPMQYQGMAGSLVNTVVNYSTSLCLGMGNTVEQQYNAHGA--DLL 513
           + + +P +  I     P Q +G+A  +  T       +   +  +V    N      D +
Sbjct: 421 VAIFYPYALQIAVGGAPDQSKGIASGVAQTFGQLGIEITFSVMASVLGDINEMKGKEDAI 480

Query: 514 KGYRSAL----YLAIGLASAGVCVSLVFL---------VTDIIAKRHRKRIESECES 557
           + +R+      Y  + + + G  V+ + +         ++D+ +  HR +IE + E 
Sbjct: 481 QNFRTGFQNCSYFTVAVGALGFLVTAICIRDIHTPNDDISDLESSIHRTKIEMDQEK 537

 Score = 35.0 bits (79), Expect = 0.54,   Method: Compositional matrix adjust.
 Identities = 31/108 (28%), Positives = 50/108 (46%), Gaps = 6/108 (5%)

Query: 96  QLLNQAGQTQSLSTMNVLADYFKSNSSKQPWLMASFPLVSGSFILISGRLGDIYGLKKAL 155
            LLN A     +S ++ LA  +  + +   W + S+ +    FI   GRLGDI G     
Sbjct: 41  DLLNVASM---ISLIDDLAKKYNISYTTASWSLTSYAVTFAGFIACMGRLGDIVGNSVLF 97

Query: 156 SVGYIIMTLWSIICGLAKYTNSDAFFIVCRSFQGLGIAFILPNIMGLV 203
           ++      + S++C  A   N  A F V R+ QG+  A ++P    L+
Sbjct: 98  TISCSCFAILSLLC--AVMPNFPA-FAVFRAIQGICAAGLVPCAYALI 142

>YKR105C Chr11 complement(658716..660464) [1749 bp, 582 aa] {ON}
           VBA5Putative transporter of the Major Facilitator
           Superfamily (MFS); proposed role as a basic amino acid
           permease based on phylogeny
          Length = 582

 Score = 37.4 bits (85), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 38/145 (26%), Positives = 56/145 (38%), Gaps = 8/145 (5%)

Query: 108 STMNVLADYFKSNSSKQPWLMASFPLVSGSFILISGRLGDIYGLKKALSVGYIIMTLWSI 167
           + ++V+A+ F  N SK  WL+  + L +    LI GR   I G + +L +  +I    S+
Sbjct: 59  TIIDVVAEQF-GNYSKTGWLVTGYSLPNAILSLIWGRFASIIGFQHSLILAILIFEAGSL 117

Query: 168 ICGLAKYTNSDAFFIVCRSFQGLGIAFILPNIMGLVGNIYKVGTLRKNIVISCIGCMAPX 227
           I  LA   N   F  V     G G+       +  V     VG   + +VIS + C    
Sbjct: 118 IAALASSMNMLIFGRVVAGVGGSGL-----QTLCFVIGCTMVGERSRPLVISILSCAFAV 172

Query: 228 XXXXXXXXXXXIVTEDAEQWPWVFY 252
                        T     W W FY
Sbjct: 173 AAIVGPIIGGAFTTH--VTWRWCFY 195

>SAKL0E02992g Chr5 complement(243652..245364) [1713 bp, 570 aa] {ON}
           similar to uniprot|Q04301 Saccharomyces cerevisiae
           YMR088C VBA1 Permease of basic amino acids in the
           vacuolar membrane
          Length = 570

 Score = 37.4 bits (85), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 22/64 (34%), Positives = 35/64 (54%), Gaps = 1/64 (1%)

Query: 110 MNVLADYFKSNSSKQPWLMASFPLVSGSFILISGRLGDIYGLKKALSVGYIIMTLWSIIC 169
           MN +A+ F+ +  KQ W+  SF L + +F  + G+L DI G K AL V +    L  ++ 
Sbjct: 75  MNRVAEEFQESDKKQ-WIATSFLLTNTAFQPLYGKLSDITGRKFALLVAHTFFCLGCLLT 133

Query: 170 GLAK 173
             A+
Sbjct: 134 CFAR 137

>TBLA0A01270 Chr1 complement(300796..302364) [1569 bp, 522 aa] {ON} 
          Length = 522

 Score = 37.0 bits (84), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 40/143 (27%), Positives = 62/143 (43%), Gaps = 17/143 (11%)

Query: 63  VDDCHENDS-PFQNPEYFETGFKEVMFIISCMVA-----QLLNQAGQTQSLSTMNVLADY 116
           + +  + D+  F N EY E G +  + ++ C         LLN  G  ++    N L++ 
Sbjct: 84  ISNIEKQDTIDFTNIEYPEGGLRSWLVVLGCFCGLFTCLGLLNAIGIVETYIQENQLSN- 142

Query: 117 FKSNSSKQPWLMASFPLVSGSFILISGRLGDIYGLKKALSVGYIIMTLWSIICGLAKYTN 176
              +SS   W+ +    V+ S  + SG   D  G K  + VG I+      +CGL    N
Sbjct: 143 --ESSSSIGWIFSLLLFVNFSSCIFSGTYFDRNGFKIPVIVGTILH-----VCGLVAMAN 195

Query: 177 SDAF--FIVCRSFQ-GLGIAFIL 196
           S     FI+  S   GLG  FI+
Sbjct: 196 STKLWQFILSLSIAVGLGNGFIM 218

>TBLA0F03040 Chr6 complement(735352..738072) [2721 bp, 906 aa] {ON}
           Anc_8.272 YDR119W
          Length = 906

 Score = 37.0 bits (84), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 20/54 (37%), Positives = 28/54 (51%)

Query: 123 KQPWLMASFPLVSGSFILISGRLGDIYGLKKALSVGYIIMTLWSIICGLAKYTN 176
           K PW+  S+ L S  F  + G+L DI+G K  L    +I     IICG++   N
Sbjct: 433 KVPWVATSYLLSSAVFQPLYGKLSDIFGRKALLIFSNLIFFFGCIICGMSNSLN 486

>YPR198W Chr16 (934034..935665) [1632 bp, 543 aa] {ON}  SGE1Plasma
           membrane multidrug transporter of the major facilitator
           superfamily, acts as an extrusion permease; partial
           multicopy suppressor of gal11 mutations
          Length = 543

 Score = 37.0 bits (84), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 23/66 (34%), Positives = 35/66 (53%), Gaps = 3/66 (4%)

Query: 126 WLMASFPLVSGSFILISGRLGDIYGLKKALSVGYIIMTLWSIICGLAKYTNSDAFFIVCR 185
           WL+  + L +  F+L+ GRL +I G K+ L +  I+  + S+I  L   +NS A  I  R
Sbjct: 47  WLVTGYALSNAVFMLLWGRLAEILGTKECLMISVIVFEIGSLISAL---SNSMATLISGR 103

Query: 186 SFQGLG 191
              G G
Sbjct: 104 VVAGFG 109

>Kpol_467.24 s467 (55523..56632) [1110 bp, 370 aa] {ON}
           (55523..56632) [1110 nt, 370 aa]
          Length = 370

 Score = 36.6 bits (83), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 26/98 (26%), Positives = 48/98 (48%), Gaps = 4/98 (4%)

Query: 89  IISCMVAQLLNQAGQTQSLSTMNVLADYFKSNSSKQPWLMASFPLVSGSFILISGRLGDI 148
           ++S  +   L+    T   + MN +A+ F+ +  KQ W+  SF L + +F  + G+L DI
Sbjct: 37  LVSLWLGSFLSSIDSTIVANIMNKVAEEFQESQEKQ-WIATSFLLTNTAFQPLYGKLSDI 95

Query: 149 YGLKKALSVGYIIMTLWSIICGLAKYTNSDAFFIVCRS 186
            G K AL      ++ + + C L   + +   F + R+
Sbjct: 96  TGRKFALLTA---LSFFGLGCFLTSLSTNIKQFAIARA 130

>NCAS0C03460 Chr3 complement(690089..691981) [1893 bp, 630 aa] {ON} 
          Length = 630

 Score = 36.6 bits (83), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 34/131 (25%), Positives = 52/131 (39%), Gaps = 7/131 (5%)

Query: 122 SKQPWLMASFPLVSGSFILISGRLGDIYGLKKALSVGYIIMTLWSIICGLAKYTNSDAFF 181
           SK  W+ A + L +    L+ GR+  I G K  +    II  + S+I G+A   NS    
Sbjct: 113 SKTGWIFAGYSLPNALLALLWGRIASIIGFKSCMLAAIIIFEIGSLISGVA---NSMNML 169

Query: 182 IVCRSFQGLGIAFILPNIMGLVGNIYKVGTLRKNIVISCIGCMAPXXXXXXXXXXXXIVT 241
           I  R   G+G + I      +  N+  V   R+ ++I+C+                   T
Sbjct: 170 IGGRVIAGVGGSGIQSLAFVIGSNL--VDERRRGLIIACMSSAFAVASVIGPFLGGAFTT 227

Query: 242 EDAEQWPWVFY 252
                W W FY
Sbjct: 228 H--ATWRWCFY 236

>KLTH0D16962g Chr4 (1399514..1401229) [1716 bp, 571 aa] {ON} similar
           to uniprot|P33335 Saccharomyces cerevisiae YPR198W SGE1
           Member of drug-resistance protein family multicopy
           suppressor of gal11 null mutation
          Length = 571

 Score = 36.2 bits (82), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 28/86 (32%), Positives = 41/86 (47%), Gaps = 10/86 (11%)

Query: 126 WLMASFPLVSGSFILISGRLGDIYGLKKALSVGYIIMTLWSIICGLAKYTNSDAFFIVCR 185
           WLMA + L +  F+L+ GR+  + GLK +L    +I    S++ G A   NS    I  R
Sbjct: 46  WLMAGYNLPNALFMLLWGRIASLVGLKCSLMASIVIFEAGSLMAGAA---NSMGMLIGAR 102

Query: 186 SFQGLGIAFILPNIMGLVGNIYKVGT 211
              G G +       G+   +Y VGT
Sbjct: 103 VISGFGGS-------GIESLVYGVGT 121

>TDEL0F03990 Chr6 (740471..742366) [1896 bp, 631 aa] {ON} Anc_8.272
           YDR119W
          Length = 631

 Score = 36.2 bits (82), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 33/133 (24%), Positives = 62/133 (46%), Gaps = 7/133 (5%)

Query: 62  SVDDCHENDSPFQNPEYFE---TGFKEVMFIISCMVAQLLNQAGQTQSLSTMNVLADYFK 118
           S+ D H+ D+  + P       +G +  + ++S  +   L     T   +T   +A  F 
Sbjct: 84  SITDPHDGDNKSERPVSTAEEISGARLRVIMLSMYLGIFLAAIDNTIVSTTSAHVASEF- 142

Query: 119 SNSSKQPWLMASFPLVSGSFILISGRLGDIYGLKKALSVGYIIMTLWSIICGLAKYTNSD 178
           +  SK  W+  S+ L S +F  + G++ DI+G K  L    +   +  ++CGL+K   S 
Sbjct: 143 NQLSKVSWIATSYLLSSATFQPLYGKVSDIFGRKCLLVFTNVAFLIGCLMCGLSK---SF 199

Query: 179 AFFIVCRSFQGLG 191
            + ++ R   G+G
Sbjct: 200 WWLVIARFVAGVG 212

>SAKL0A08228g Chr1 complement(732518..734227) [1710 bp, 569 aa] {ON}
           similar to uniprot|P33335 Saccharomyces cerevisiae
           YPR198W SGE1 Member of drug-resistance protein family
           multicopy suppressor of gal11 null mutation
          Length = 569

 Score = 35.8 bits (81), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 27/85 (31%), Positives = 42/85 (49%), Gaps = 4/85 (4%)

Query: 107 LSTMNVLADYFKSNSSKQPWLMASFPLVSGSFILISGRLGDIYGLKKALSVGYIIMTLWS 166
           ++ +N +AD F +  SK  WL+  + L +  F L+ GR   I+G K  L V  II  + S
Sbjct: 41  VTILNTIADKFNA-YSKIGWLITGYSLSNALFTLLWGRFAVIFGSKTTLMVSIIIFEIGS 99

Query: 167 IICGLAKYTNSDAFFIVCRSFQGLG 191
           ++  +   +NS    I  R   G G
Sbjct: 100 LVIAV---SNSMDMIIGGRVIAGCG 121

>TDEL0G03260 Chr7 (605429..607267) [1839 bp, 612 aa] {ON} 
          Length = 612

 Score = 35.8 bits (81), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 29/101 (28%), Positives = 48/101 (47%), Gaps = 5/101 (4%)

Query: 122 SKQPWLMASFPLVSGSFILISGRLGDIYGLKKALSVGYIIMTLWSIICGLAKYTNSDAFF 181
           SK  W+ A + L S    LI GR+  + G K ++    II  + S++  LA   NS    
Sbjct: 90  SKTGWIYAGYSLPSALLTLIWGRIAAVCGFKSSMLTAIIIFEVGSLVAALA---NSMDML 146

Query: 182 IVCRSFQGLGIAFILPNIMGLVGNIYKVGTLRKNIVISCIG 222
           I  R   GLG + I      ++  +  V   ++ ++I+C+G
Sbjct: 147 IGGRVIAGLGGSGIQTLCFVIISTL--VEESKRGLLIACMG 185

>KLTH0C10142g Chr3 (842371..844092) [1722 bp, 573 aa] {ON} similar
           to uniprot|P33335 Saccharomyces cerevisiae YPR198W SGE1
           Member of drug-resistance protein family multicopy
           suppressor of gal11 null mutation
          Length = 573

 Score = 35.4 bits (80), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 38/147 (25%), Positives = 64/147 (43%), Gaps = 18/147 (12%)

Query: 111 NVLADYFKSNSSKQPWLMASFPLVSGSFILISGRLGDIYGLKKALSVGYIIMTLWSIICG 170
             + + FK + ++  WL+  + L +  F L+ GRL  I GLK +L+   +I  + S+I  
Sbjct: 32  ETIGEKFK-DYARIGWLVTGYALPNALFTLLWGRLASILGLKTSLTFSIVIFEIGSLIVA 90

Query: 171 LAKYTNSDAFFIVCRSFQGLGIAFILPNIMGLVGNIYKVGT-----LRKNIVISCIGCMA 225
           +   +NS    I  R   G G +       G+   ++ VGT       + +VI+ +G +A
Sbjct: 91  V---SNSMGMIIGGRVVAGCGGS-------GIQSLVFVVGTSLVEERNRGMVITVLG-LA 139

Query: 226 PXXXXXXXXXXXXIVTEDAEQWPWVFY 252
                          TE+   W W FY
Sbjct: 140 FAVAFAVGPVIGGAFTENVS-WRWCFY 165

>NDAI0H02200 Chr8 complement(536385..538100) [1716 bp, 571 aa] {ON} 
           YGR224W
          Length = 571

 Score = 35.4 bits (80), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 25/82 (30%), Positives = 40/82 (48%), Gaps = 4/82 (4%)

Query: 110 MNVLADYFKSNSSKQPWLMASFPLVSGSFILISGRLGDIYGLKKALSVGYIIMTLWSIIC 169
           MN +A+ F  +  KQ W+  SF L + +F  + G+L DI G K A+   +    L    C
Sbjct: 67  MNRVAEEFAESDKKQ-WIATSFLLTNTAFQPLYGKLSDITGRKFAVLTAHFFFGLG---C 122

Query: 170 GLAKYTNSDAFFIVCRSFQGLG 191
            L  +  +   F + R+  G+G
Sbjct: 123 LLTCFAQNVTQFSIARAICGMG 144

>SAKL0C05588g Chr3 (527748..529781) [2034 bp, 677 aa] {ON} similar
           to uniprot|P36172 Saccharomyces cerevisiae YKR105C
           Hypothetical ORF
          Length = 677

 Score = 35.4 bits (80), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 25/84 (29%), Positives = 42/84 (50%), Gaps = 4/84 (4%)

Query: 108 STMNVLADYFKSNSSKQPWLMASFPLVSGSFILISGRLGDIYGLKKALSVGYIIMTLWSI 167
           +++ V+A+ FK + SK  W+++ + L      L+ GR   I G K +L V  +I    S+
Sbjct: 140 ASIEVIAEQFK-DYSKSGWIVSGYSLTEALLTLLWGRFATIIGFKSSLLVSILIFEAGSL 198

Query: 168 ICGLAKYTNSDAFFIVCRSFQGLG 191
           I  +   +NS    I  R   G+G
Sbjct: 199 ISAI---SNSMNMLIGGRVVAGIG 219

>Skud_6.16 Chr6 (26284..27933) [1650 bp, 549 aa] {ON} YOR378W (REAL)
          Length = 549

 Score = 35.0 bits (79), Expect = 0.54,   Method: Compositional matrix adjust.
 Identities = 43/235 (18%), Positives = 91/235 (38%), Gaps = 17/235 (7%)

Query: 340 LLPPSVLENKKILMILAALFFGWGSFGIWTYYYYAFQLNLRKYTPLWAGGTHFMFVIWGT 399
           L+P  VL  K  + I+ A            Y    +     + +PL AG      +I   
Sbjct: 303 LIPIDVLFMKNFIPIVLAFALNNACLFSCLYIIDQYSQYAERNSPLLAGVKLVPLIICMV 362

Query: 400 VAAFVVALTIKKVGPAVLLCFSMVAFDCGSIMLSVTPV--HQTYWRMNVGMQIILSFGMD 457
           +   + A    K+ P V +         GSI+L    +     +W++    Q ++ FG+ 
Sbjct: 363 IGNALCAFESTKLRPRVGVAIGFFLALAGSIILIQLHLVKEDLFWKIFFSAQALVGFGVA 422

Query: 458 LSFPASSIILSDFLPMQYQGMAGSLVNTVVNYSTSLCLG-----MGNTVEQQYNAHGADL 512
           + +P +  I     P + +G+A  +  T       +        +GN  E +  ++    
Sbjct: 423 IFYPYALQIAVGGAPDESRGIASGVAQTFGQLGIEITFSVMASVLGNINEMKGKSNAIQK 482

Query: 513 LK-GYRSALYLAIGLASAGVCVSLVFL---------VTDIIAKRHRKRIESECES 557
            + G+++  Y  + + + G  V+ + +         ++D+ +  HR ++E + E 
Sbjct: 483 FRTGFQNCSYFTVAVGALGFLVTAICIRDIPPLNDDMSDLESSVHRTKVEFDREK 537

 Score = 34.7 bits (78), Expect = 0.62,   Method: Compositional matrix adjust.
 Identities = 31/108 (28%), Positives = 50/108 (46%), Gaps = 6/108 (5%)

Query: 96  QLLNQAGQTQSLSTMNVLADYFKSNSSKQPWLMASFPLVSGSFILISGRLGDIYGLKKAL 155
            LLN A     +S ++ LA  +  + +   W + S+ +    FI   GRLGDI G     
Sbjct: 41  DLLNVASM---ISLIDDLAKTYNISYTTASWSLTSYAVTFAGFIACMGRLGDIIGNSVLF 97

Query: 156 SVGYIIMTLWSIICGLAKYTNSDAFFIVCRSFQGLGIAFILPNIMGLV 203
           ++      + S++C  A   N  A F V R+ QG+  A ++P    L+
Sbjct: 98  TISCSCFAVLSLLC--AVMPNFPA-FAVFRAIQGICAAGLVPCAYALI 142

>Kwal_14.1585 s14 (377103..378815) [1713 bp, 570 aa] {ON} YMR088C -
           Hypothetical ORF [contig 239] FULL
          Length = 570

 Score = 34.3 bits (77), Expect = 0.80,   Method: Compositional matrix adjust.
 Identities = 22/84 (26%), Positives = 43/84 (51%), Gaps = 4/84 (4%)

Query: 108 STMNVLADYFKSNSSKQPWLMASFPLVSGSFILISGRLGDIYGLKKALSVGYIIMTLWSI 167
           +TMN +A  F+  +S   W+  ++ L + S   + G+  D+ G KK L    ++  +  +
Sbjct: 73  TTMNEVASIFQ-EASLVTWVATAYMLTTCSVQPLYGKTSDLLGRKKCLLFAEVVFIIGLV 131

Query: 168 ICGLAKYTNSDAFFIVCRSFQGLG 191
           +CG+A+     A   + R+  G+G
Sbjct: 132 LCGMARTVKELA---IARAICGIG 152

>Skud_16.503 Chr16 (880571..882202) [1632 bp, 543 aa] {ON} YPR198W
           (REAL)
          Length = 543

 Score = 34.3 bits (77), Expect = 0.91,   Method: Compositional matrix adjust.
 Identities = 22/66 (33%), Positives = 33/66 (50%), Gaps = 3/66 (4%)

Query: 126 WLMASFPLVSGSFILISGRLGDIYGLKKALSVGYIIMTLWSIICGLAKYTNSDAFFIVCR 185
           WL+  + L +  F+L+ GRL +I G  + L +  II  + S+I  L   +NS    I  R
Sbjct: 47  WLVTGYALTNAVFMLLWGRLAEILGTNECLMISVIIFEVGSLISAL---SNSMGTLISGR 103

Query: 186 SFQGLG 191
              G G
Sbjct: 104 LIAGFG 109

>KLLA0A11110g Chr1 (964084..965739) [1656 bp, 551 aa] {ON}
           uniprot|P49374 Kluyveromyces lactis KLLA0A11110g HGT1
           High-affinity glucose transporter
          Length = 551

 Score = 34.3 bits (77), Expect = 0.94,   Method: Compositional matrix adjust.
 Identities = 32/94 (34%), Positives = 43/94 (45%), Gaps = 9/94 (9%)

Query: 106 SLSTM---NVLADYFKSNSSKQPWLMASFPLVSGSFI--LISGRLGDIYGLKKALSVGYI 160
           S+S+M   +V  DYF SN     +   +  +  GSF+  LIS    D +G K +L   +I
Sbjct: 48  SMSSMIGTDVYKDYF-SNPDSLTYGGITASMAGGSFLGSLISPNFSDAFGRKVSL---HI 103

Query: 161 IMTLWSIICGLAKYTNSDAFFIVCRSFQGLGIAF 194
              LW I   L       A  IV R   G+GI F
Sbjct: 104 CAALWIIGAILQCAAQDQAMLIVGRVISGMGIGF 137

>ZYRO0G03234g Chr7 (247798..249486) [1689 bp, 562 aa] {ON} similar
           to uniprot|Q04301 Saccharomyces cerevisiae YMR088C VBA1
           Permease of basic amino acids in the vacuolar membrane
          Length = 562

 Score = 34.3 bits (77), Expect = 0.98,   Method: Compositional matrix adjust.
 Identities = 24/77 (31%), Positives = 38/77 (49%), Gaps = 4/77 (5%)

Query: 110 MNVLADYFKSNSSKQPWLMASFPLVSGSFILISGRLGDIYGLKKALSVGYIIMTLWSIIC 169
           MN +A+ F+ +  KQ W+  SF L + +F  + G+L DI G + AL   +    L    C
Sbjct: 57  MNRVAEEFEESDKKQ-WIATSFLLTNTAFQPLYGKLSDITGRRFALLTAHFFFGLG---C 112

Query: 170 GLAKYTNSDAFFIVCRS 186
            L  +  S   F + R+
Sbjct: 113 LLTCFAQSVEQFALARA 129

>KAFR0C01250 Chr3 complement(250861..260070) [9210 bp, 3069 aa] {ON}
            Anc_3.124 YBR140C
          Length = 3069

 Score = 34.3 bits (77), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 34/129 (26%), Positives = 56/129 (43%), Gaps = 21/129 (16%)

Query: 83   FKEVMFIISCMVAQLLNQAGQTQSLSTMNVLADYFKSNSSKQPWL--------MASFPLV 134
            FKE        V +LL Q GQ + +   N L ++ +SNS K P L          ++  +
Sbjct: 1968 FKETFL----FVDRLLGQLGQPKKVYN-NELPEFIRSNSEKYPRLYEFMSRLAFKNYKEI 2022

Query: 135  SGSFILISGRLGD------IYGLKKALSVGYIIMT-LWSIICGLAKYTNSDAFFIV-CRS 186
            +G + ++   L         + L+K  S GY I T L+ ++    +   S  +FI+ C  
Sbjct: 2023 AGEYSVVRESLSADGLPVVTFTLRKLHSTGYDIETALFKLLQVYMRIWTSKHYFILDCTE 2082

Query: 187  FQGLGIAFI 195
            F   GI  +
Sbjct: 2083 FDKSGIDLV 2091

>KLTH0C10120g Chr3 (839780..841735) [1956 bp, 651 aa] {ON} similar
           to uniprot|P33335 Saccharomyces cerevisiae YPR198W SGE1
           Member of drug-resistance protein family multicopy
           suppressor of gal11 null mutation
          Length = 651

 Score = 33.9 bits (76), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 27/86 (31%), Positives = 40/86 (46%), Gaps = 10/86 (11%)

Query: 126 WLMASFPLVSGSFILISGRLGDIYGLKKALSVGYIIMTLWSIICGLAKYTNSDAFFIVCR 185
           WL+  + L S  F L+ GR+  + GLK  L +  +I  + S+I   A  +NS    I  R
Sbjct: 82  WLVTGYSLSSALFTLLWGRMASLLGLKTCLMLSVLIFEIGSLI---AAVSNSMGMLIAGR 138

Query: 186 SFQGLGIAFILPNIMGLVGNIYKVGT 211
              G G +       G+   +Y VGT
Sbjct: 139 VVAGAGGS-------GIQSLVYIVGT 157

>Kwal_23.4824 s23 (883258..884919) [1662 bp, 553 aa] {ON} YNL065W
           (AQR1) - multidrug resistance transporter [contig 5]
           FULL
          Length = 553

 Score = 33.9 bits (76), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 37/120 (30%), Positives = 54/120 (45%), Gaps = 10/120 (8%)

Query: 92  CMVAQLLNQAGQTQSLST------MNVLADYFKSNSSKQPWLMASFPLVSGSFILISGRL 145
           CMVA LL  AG   SL +      +  L   F  +       +  + +  G    ISG L
Sbjct: 87  CMVA-LLTSAGFWSSLGSPIYYPALKQLEKQFSVSEELVNITVVVYLIFQGVAPTISGGL 145

Query: 146 GDIYGLKKALSVGYIIMTLWSIICGLAKYTNSDAFFIVCRSFQGLGIAFILPNIMGLVGN 205
            D+YG +  + +G +I    SI  GLA  +NS    +  R  Q  GI+ I+    G+VG+
Sbjct: 146 ADVYGRRPVILIGMLIYVCASI--GLA-CSNSYGVIVFLRCLQSAGISPIIAINSGVVGD 202

>Kpol_416.5 s416 (23208..25031) [1824 bp, 607 aa] {ON}
           (23208..25031) [1824 nt, 608 aa]
          Length = 607

 Score = 33.9 bits (76), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 26/83 (31%), Positives = 42/83 (50%), Gaps = 4/83 (4%)

Query: 328 FVVYEIKYATSPLLPPSVLENKKILMILAALFFGWGSFGIWTYYYYAFQLNLRKYTPLWA 387
           F+V+EIK+A  PL P   L+N+ I+  L  + F   ++ + + Y Y   L     +   A
Sbjct: 321 FLVWEIKFARYPLTPKDALKNRGIVSALVLVLFLQFAYQMQSTYLYTVLLVAVDESKKSA 380

Query: 388 GGTHFMF----VIWGTVAAFVVA 406
              + +F    VI G ++ FVVA
Sbjct: 381 TRINKLFSFVSVITGFLSGFVVA 403

>Ecym_4298 Chr4 complement(636605..638641) [2037 bp, 678 aa] {ON}
           similar to Ashbya gossypii AGR076C
          Length = 678

 Score = 33.5 bits (75), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 21/66 (31%), Positives = 33/66 (50%), Gaps = 3/66 (4%)

Query: 110 MNVLADYFKSNSSKQP---WLMASFPLVSGSFILISGRLGDIYGLKKALSVGYIIMTLWS 166
           ++ L DY  S     P   W+ AS+ L +  F  + G+L DI+G K  L    ++  L  
Sbjct: 172 LSTLLDYIASEFEALPYISWIAASYLLSACIFQPLYGKLSDIFGRKAILLFSNLMFGLGC 231

Query: 167 IICGLA 172
           ++CG A
Sbjct: 232 LVCGTA 237

>KLLA0A04631g Chr1 complement(415070..416809) [1740 bp, 579 aa] {ON}
           weakly similar to uniprot|Q04602 Saccharomyces
           cerevisiae YDR119W Uncharacterized transporter
          Length = 579

 Score = 33.1 bits (74), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 25/108 (23%), Positives = 48/108 (44%), Gaps = 2/108 (1%)

Query: 67  HENDSPFQNPEYFETGFKEVMFIISCM-VAQLLNQAGQTQSLSTMNVLADYFKSNSSKQP 125
              D   +  +  E     +  IIS M +   L     T   + ++ +A  F +  S   
Sbjct: 41  ESEDEAREGLQVSEMSRARLHIIISSMCLGSFLAALDNTIVTTLLSHIASEF-NELSHIS 99

Query: 126 WLMASFPLVSGSFILISGRLGDIYGLKKALSVGYIIMTLWSIICGLAK 173
           W+  ++ L S +F  + G++ DI+G +  + +  +   L  +ICGL+K
Sbjct: 100 WIATAYLLSSATFQPLYGKISDIFGRRPLIIISNLFFILGCLICGLSK 147

>KLTH0D05434g Chr4 (486319..488049) [1731 bp, 576 aa] {ON} similar
           to uniprot|Q04301 Saccharomyces cerevisiae YMR088C VBA1
           Permease of basic amino acids in the vacuolar membrane
          Length = 576

 Score = 32.7 bits (73), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 34/133 (25%), Positives = 59/133 (44%), Gaps = 8/133 (6%)

Query: 62  SVDDCHENDSPFQNPEYFET--GFKEVMFIISCMVAQLLNQAGQTQSLSTMNVLADYFKS 119
           S+ + +E D   +  EY E      ++  ++S  +   L     T   + MN +A+ F+ 
Sbjct: 15  SISEENECDVGLER-EYHEHNLALPKIPILVSLWLGSFLVALDGTIVANVMNRIAEEFQE 73

Query: 120 NSSKQPWLMASFPLVSGSFILISGRLGDI-YGLKKALSVGYIIMTLWSIICGLAKYTNSD 178
           +  KQ W+  SF L + +F  + G+L D+  G K A  +      L  II   A+     
Sbjct: 74  SDKKQ-WIATSFLLTNTAFQPLYGKLSDVATGRKLATLIAQFFFFLGLIISCFAQNVTQ- 131

Query: 179 AFFIVCRSFQGLG 191
             F + R+  G+G
Sbjct: 132 --FAIGRAVCGIG 142

>Smik_11.368 Chr11 complement(649880..651622) [1743 bp, 580 aa] {ON}
           YKR105C (REAL)
          Length = 580

 Score = 32.7 bits (73), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 20/69 (28%), Positives = 35/69 (50%), Gaps = 1/69 (1%)

Query: 108 STMNVLADYFKSNSSKQPWLMASFPLVSGSFILISGRLGDIYGLKKALSVGYIIMTLWSI 167
           + ++V+A+ F  N SK  WL+  + L +    L+ GR   I G + +L +  +I    S+
Sbjct: 57  TIIDVVAEQF-GNYSKTGWLVTGYSLPNAILSLVWGRFASIIGFQHSLILAVLIFEAGSL 115

Query: 168 ICGLAKYTN 176
           +  LA   N
Sbjct: 116 VAALANSMN 124

>ZYRO0C01430g Chr3 complement(101140..102912) [1773 bp, 590 aa] {ON}
           weakly similar to uniprot|Q04602 Saccharomyces
           cerevisiae YDR119W Uncharacterized transporter
          Length = 590

 Score = 32.7 bits (73), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 29/117 (24%), Positives = 52/117 (44%), Gaps = 6/117 (5%)

Query: 55  TSKGCICSVDDCHENDSPFQNPEYFETGFKEVMFIISCMVAQLLNQAGQTQSLSTMNVLA 114
           T  G I + DD  +  +    P       K ++  +S  +   L  A  T   + M  +A
Sbjct: 53  TDYGSIDNEDDSRDGVASSPVPPD-----KLLVITLSMYLGIFLAAADGTLVSTIMAHIA 107

Query: 115 DYFKSNSSKQPWLMASFPLVSGSFILISGRLGDIYGLKKALSVGYIIMTLWSIICGL 171
             F +   +  W+  ++ L S +F  + G+L DI+G K  L +  I+  +  ++CGL
Sbjct: 108 SEF-NELPRISWIATAYLLSSATFQPLYGKLSDIFGRKPLLMLNNIVFLVGCLMCGL 163

>TPHA0G03150 Chr7 (670343..672145) [1803 bp, 600 aa] {ON} Anc_2.473
           YMR088C
          Length = 600

 Score = 32.7 bits (73), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 17/43 (39%), Positives = 27/43 (62%), Gaps = 1/43 (2%)

Query: 110 MNVLADYFKSNSSKQPWLMASFPLVSGSFILISGRLGDIYGLK 152
           MN +A+ F +++ KQ W+  S+ L + +F  + GRL DI G K
Sbjct: 90  MNRVAEDFNASNQKQ-WIATSYLLTNTAFQPLYGRLSDIIGRK 131

>SAKL0H16808g Chr8 complement(1477137..1479110) [1974 bp, 657 aa]
           {ON} weakly similar to uniprot|Q04602 Saccharomyces
           cerevisiae YDR119W Uncharacterized transporter
          Length = 657

 Score = 32.7 bits (73), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 15/47 (31%), Positives = 27/47 (57%)

Query: 126 WLMASFPLVSGSFILISGRLGDIYGLKKALSVGYIIMTLWSIICGLA 172
           W+  ++ L S +F  + G++ DI+G K  L    ++  L  +ICGL+
Sbjct: 168 WIATAYLLSSATFQPLYGKISDIFGRKPLLIFSNVMFALGCLICGLS 214

>SAKL0C11066g Chr3 complement(998593..1000335) [1743 bp, 580 aa]
           {ON} similar to uniprot|P30605 Saccharomyces cerevisiae
           YDR497C
          Length = 580

 Score = 32.3 bits (72), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 26/97 (26%), Positives = 49/97 (50%), Gaps = 12/97 (12%)

Query: 421 SMVAFDCGSIMLSVTPVHQTYWRMNVGMQIILSFGMDLSFPASSIILSDFLPMQYQGMAG 480
           S V F  G+I+ + T   +++W+M  G ++++ FG+ +    S + +S+  P +Y+G   
Sbjct: 154 SNVMFLIGAILQACT---RSFWQMAAG-RLLMGFGIGIGSLLSPLFISEIAPSEYRGRL- 208

Query: 481 SLVNTVVNYSTSLCLGMGNTVEQQYNAHGADLLKGYR 517
               TVVN   S C+  G  +     A  + +  G+R
Sbjct: 209 ----TVVN---SACITGGQLIAYGIGAGTSKIDNGWR 238

>Kwal_56.23754 s56 complement(690851..692620) [1770 bp, 589 aa] {ON}
           YBR293W - Hypothetical ORF [contig 173] FULL
          Length = 589

 Score = 32.3 bits (72), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 32/137 (23%), Positives = 58/137 (42%), Gaps = 11/137 (8%)

Query: 62  SVDD-------CHENDSPFQNPEYFETGFKEVMFIISCMVAQLLNQAGQTQSLSTMNVLA 114
           +VDD       C     P + PE+  +  +  + +IS  +   L     T   + +  + 
Sbjct: 51  AVDDRTATSARCDLTFPPSETPEFALSSSRIRIIMISMFLGIFLAALDGTIVSTLLTRIG 110

Query: 115 DYFKSNSSKQPWLMASFPLVSGSFILISGRLGDIYGLKKALSVGYIIMTLWSIICGLAKY 174
             F S   K  W+  S+ L S +   + G+L D  G K  L    ++ ++  +ICG+   
Sbjct: 111 SEFNS-LDKVSWIATSYLLSSSTCQPLYGKLSDQLGRKPLLVFSNVVFSIGCLICGM--- 166

Query: 175 TNSDAFFIVCRSFQGLG 191
           + S  + +V R   G+G
Sbjct: 167 STSIWWVVVGRFVSGIG 183

>Suva_5.2 Chr5 (3340..5223) [1884 bp, 627 aa] {ON} YEL065W (REAL)
          Length = 627

 Score = 32.0 bits (71), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 26/99 (26%), Positives = 53/99 (53%), Gaps = 7/99 (7%)

Query: 328 FVVYEIKYATSPLLPPSVLENKKILMILAALF---FGWGSFG--IWTYYYYAFQLNLRKY 382
           ++V+E+KY+  PL P  +++++ +L  L   F   F W   G  ++T    A   +++  
Sbjct: 332 YMVWEVKYSRHPLTPWDLIKDRGVLFALFIAFFINFNWYMQGDYMYTVLVVAVHESIKSA 391

Query: 383 TPLWAGGTHFMFVIWGTVAAFVVALTIKKVGPAVLLCFS 421
           T + A  + F+ VI GT+  F++ + +++  P +L   S
Sbjct: 392 TRITALYS-FVSVIVGTILGFIL-IKVRRTKPFILFGIS 428

>Kpol_281.3 s281 complement(9070..10740) [1671 bp, 556 aa] {ON}
           complement(9070..10740) [1671 nt, 557 aa]
          Length = 556

 Score = 32.0 bits (71), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 29/96 (30%), Positives = 49/96 (51%), Gaps = 11/96 (11%)

Query: 105 QSLSTM---NVLADYFKS-NSSKQPWLMASFPLVSGSFI--LISGRLGDIYGLKKALSVG 158
            S+S+M   +    YF S +++KQ  + +S  + +GSF+  L+S    D++G + +L   
Sbjct: 48  SSMSSMIGTDAYKQYFGSPDATKQGGITSS--MAAGSFVGSLLSPLFSDVFGRRVSL--- 102

Query: 159 YIIMTLWSIICGLAKYTNSDAFFIVCRSFQGLGIAF 194
           +I  T W I   L   +   A  +V R   G+GI F
Sbjct: 103 HICSTFWLIGATLQCASQDLAMLVVGRLVSGIGIGF 138

>Kpol_543.44 s543 (96992..98923) [1932 bp, 643 aa] {ON}
           (96992..98923) [1932 nt, 644 aa]
          Length = 643

 Score = 32.0 bits (71), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 27/47 (57%)

Query: 126 WLMASFPLVSGSFILISGRLGDIYGLKKALSVGYIIMTLWSIICGLA 172
           W+  ++ L S +F  I G++ DI+G K  L    I   + S+ICGL+
Sbjct: 160 WVATAYLLSSATFQPIYGKISDIFGRKVVLIFCNITFFVGSLICGLS 206

>SAKL0A00726g Chr1 (82164..83960) [1797 bp, 598 aa] {ON} similar to
           uniprot|P36172 Saccharomyces cerevisiae YKR105C
           Hypothetical ORF
          Length = 598

 Score = 32.0 bits (71), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 22/70 (31%), Positives = 33/70 (47%), Gaps = 3/70 (4%)

Query: 122 SKQPWLMASFPLVSGSFILISGRLGDIYGLKKALSVGYIIMTLWSIICGLAKYTNSDAFF 181
           SK  WL+  + L +    L+ GR   I G K ++ +  II  + S++  LA   NS    
Sbjct: 78  SKSGWLVTGYSLPTALLSLVWGRAASIIGFKSSMLLSIIIFEVGSLVSALA---NSMNML 134

Query: 182 IVCRSFQGLG 191
           I  R   G+G
Sbjct: 135 IGGRVISGVG 144

>Skud_18.3 Chr18 complement(10782..12554) [1773 bp, 590 aa] {ON}
           YCL069W (REAL)
          Length = 590

 Score = 32.0 bits (71), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 20/69 (28%), Positives = 34/69 (49%), Gaps = 1/69 (1%)

Query: 108 STMNVLADYFKSNSSKQPWLMASFPLVSGSFILISGRLGDIYGLKKALSVGYIIMTLWSI 167
           + ++V+A  F  N SK  WL+  + L +    L+ GR   I G + +L +  +I    S+
Sbjct: 67  TIIDVVAKQF-GNYSKTGWLVTGYSLPNAVLSLLWGRFASIIGFQHSLILAVLIFEAGSL 125

Query: 168 ICGLAKYTN 176
           +  LA   N
Sbjct: 126 VAALANSMN 134

>TBLA0C01100 Chr3 (227542..229491) [1950 bp, 649 aa] {ON} Anc_1.432
          Length = 649

 Score = 32.0 bits (71), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 27/95 (28%), Positives = 41/95 (43%), Gaps = 15/95 (15%)

Query: 140 LISGRLGDIYGLKKALSVGYIIMTLWSIICGLAKYTNSDAFFIVCRSFQGLGIAFIL--- 196
           L+S  + D  G K +L V  I   LW I CG+   +   A  +V R   G+GI F +   
Sbjct: 83  LLSPSVSDALGRKCSLHVSCI---LWCIGCGIQSGSTGVAMLVVGRVIAGVGIGFGVAAA 139

Query: 197 ---------PNIMGLVGNIYKVGTLRKNIVISCIG 222
                    P + G V  I+++      +V+  IG
Sbjct: 140 PMYCVELAPPRVRGTVVGIFQLAVTAGILVLFFIG 174

>Skud_15.474 Chr15 complement(829767..831335) [1569 bp, 522 aa] {ON}
           YOR306C (REAL)
          Length = 522

 Score = 31.6 bits (70), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 37/140 (26%), Positives = 54/140 (38%), Gaps = 16/140 (11%)

Query: 65  DCHENDSPFQNPEYFETGFKEVMFIISCMVA-----QLLNQAGQTQSLSTMNVLADYFKS 119
           D  E DS  +   + E G K  +    C +       LLN  G  +S    N LA+    
Sbjct: 87  DSEEGDSNGEAENFPEGGLKAWVVTFGCFLGLIACFGLLNSTGVIESHLQDNQLAN---E 143

Query: 120 NSSKQPWLMASFPLVSGSFILISGRLGDIYGLKKALSVGYIIMTLWSIICGLAKYTNSDA 179
           + S   WL + F  V  +  +ISG   D  G +  + VG +       + GL    NS  
Sbjct: 144 SVSTIGWLFSLFLFVCFASCIISGTYFDRNGFRTIMIVGTVFH-----VAGLFATANSTK 198

Query: 180 FFIVCRSFQ---GLGIAFIL 196
           ++    SF    G G   +L
Sbjct: 199 YWHFILSFAIVCGFGNGIVL 218

>CAGL0B02079g Chr2 complement(191736..193610) [1875 bp, 624 aa] {ON}
           similar to uniprot|P50080 Saccharomyces cerevisiae
           YGR224w AZR1 or uniprot|P36172 Saccharomyces cerevisiae
           YKR105c
          Length = 624

 Score = 31.6 bits (70), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 34/139 (24%), Positives = 57/139 (41%), Gaps = 7/139 (5%)

Query: 56  SKGCICSVDDCHENDSPFQNPEY---FETGFKEVMFIISCMVAQLLNQAGQTQSLSTMNV 112
           ++G   SV      + P +   +   F TG  E+   +  +V  L   A    ++ST+  
Sbjct: 10  TRGDASSVSTGSVKEEPVRTNAFGQRFPTGV-ELWAPLGSLVLCLFLAALDVMTVSTIIE 68

Query: 113 LADYFKSNSSKQPWLMASFPLVSGSFILISGRLGDIYGLKKALSVGYIIMTLWSIICGLA 172
                  + SK  WL   + L +   +LI GR+  + G K +     +I  + S++  LA
Sbjct: 69  EVSQKFGDYSKVGWLFTGYSLPNALLVLIWGRIATLVGFKTSTLAAIVIFEVGSLVSALA 128

Query: 173 KYTNSDAFFIVCRSFQGLG 191
              NS    I  R   G+G
Sbjct: 129 ---NSMDMLIGGRVIAGIG 144

>Smik_17.11 Chr17 complement(8582..10216) [1635 bp, 544 aa] {ON}
           YPR198W (REAL)
          Length = 544

 Score = 31.6 bits (70), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 20/66 (30%), Positives = 33/66 (50%), Gaps = 3/66 (4%)

Query: 126 WLMASFPLVSGSFILISGRLGDIYGLKKALSVGYIIMTLWSIICGLAKYTNSDAFFIVCR 185
           WL+  + L +  F+L+ GRL +I G  + L +  +I  + S+I  L   +N+    I  R
Sbjct: 47  WLVTGYALSNAVFMLLWGRLAEILGTTECLMISVVIFEIGSLISAL---SNTMGTLIGGR 103

Query: 186 SFQGLG 191
              G G
Sbjct: 104 VIAGFG 109

>Kwal_26.7755 s26 (500034..501713) [1680 bp, 559 aa] {ON} YMR088C -
           1:1 [contig 55] FULL
          Length = 559

 Score = 31.6 bits (70), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 23/91 (25%), Positives = 39/91 (42%), Gaps = 3/91 (3%)

Query: 65  DCHENDSPFQNPEYFETGFK--EVMFIISCMVAQLLNQAGQTQSLSTMNVLADYFKSNSS 122
           D   N       EY E      +   ++S  +   L     T   + MN +A+ F+ +  
Sbjct: 17  DEDNNVHSILEKEYHEQNLNLPKTPILVSLWLGSFLVALDGTIVANVMNRIAEEFQESDK 76

Query: 123 KQPWLMASFPLVSGSFILISGRLGDIYGLKK 153
           KQ W+  SF L + +F  + G+L D+   +K
Sbjct: 77  KQ-WIATSFLLTNTAFQPLYGKLSDVATGRK 106

>AEL042C Chr5 complement(557191..558834) [1644 bp, 547 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOL156W
           (HXT11)
          Length = 547

 Score = 31.6 bits (70), Expect = 6.7,   Method: Compositional matrix adjust.
 Identities = 35/150 (23%), Positives = 62/150 (41%), Gaps = 21/150 (14%)

Query: 89  IISCMVAQLLN-QAGQTQSLSTMNVLADYFKS-NSSKQPWLMASFPLVSGSFI--LISGR 144
           +++C+   +         S+       DYFK  N   Q  + AS  + +GS +  ++S  
Sbjct: 33  VVACISGMMFGFDISSMSSMQDFEPYKDYFKHPNELTQGGITAS--MAAGSLLGSILSPG 90

Query: 145 LGDIYGLKKALSVGYIIMTLWSIICGLAKYTNSDAFFIVCRSFQGLGIAF---------- 194
           + D +G + +L   ++  +LW I   L     + A   V R   GLG+ F          
Sbjct: 91  ISDAFGRRVSL---HMCSSLWIIGAVLQTAAQNQAMLFVGRIVAGLGVGFGSSVAPVYTA 147

Query: 195 --ILPNIMGLVGNIYKVGTLRKNIVISCIG 222
               P I G VG ++++      +V+  IG
Sbjct: 148 EVSPPKIRGAVGGLFQLSVTVGILVMFLIG 177

>YOR306C Chr15 complement(889867..891432) [1566 bp, 521 aa] {ON}
           MCH5Plasma membrane riboflavin transporter; facilitates
           the uptake of vitamin B2; required for FAD-dependent
           processes; sequence similarity to mammalian
           monocarboxylate permeases, however mutants are not
           deficient in monocarboxylate transport
          Length = 521

 Score = 31.6 bits (70), Expect = 6.9,   Method: Compositional matrix adjust.
 Identities = 37/141 (26%), Positives = 54/141 (38%), Gaps = 16/141 (11%)

Query: 64  DDCHENDSPFQNPEYFETGFKEVMFIISCMVA-----QLLNQAGQTQSLSTMNVLADYFK 118
           D   E DS  +   + E GFK  +    C +       LLN  G  +S    N L+    
Sbjct: 85  DSDKEEDSNEEIESFPEGGFKAWVVTFGCFLGLIACFGLLNSTGVIESHLQDNQLS---S 141

Query: 119 SNSSKQPWLMASFPLVSGSFILISGRLGDIYGLKKALSVGYIIMTLWSIICGLAKYTNSD 178
            + S   WL + F  V  +  +ISG   D  G +  + VG +       + GL    NS 
Sbjct: 142 ESVSTIGWLFSLFLFVCSASCIISGTYFDRNGFRTIMIVGTVFH-----VAGLFATANST 196

Query: 179 AFFIVCRSFQ---GLGIAFIL 196
            ++    SF    G G   +L
Sbjct: 197 KYWHFILSFAIVCGFGNGIVL 217

>Smik_13.11 Chr13 complement(20464..22224) [1761 bp, 586 aa] {ON}
           YML123C (REAL)
          Length = 586

 Score = 31.2 bits (69), Expect = 8.1,   Method: Compositional matrix adjust.
 Identities = 19/58 (32%), Positives = 29/58 (50%), Gaps = 7/58 (12%)

Query: 147 DIYGLKKALSVGYIIMTLWSIICGLAKYTNSD----AFFIVCRSFQGLG---IAFILP 197
           DI G K     G+II+T+   + G A +  SD      +++C+ FQ  G     FI+P
Sbjct: 413 DIIGRKPIQLAGFIILTILFCVIGFAYHKISDHGLLGLYVICQFFQNFGPNTTTFIVP 470

>SAKL0C02178g Chr3 complement(191542..193239) [1698 bp, 565 aa] {ON}
           weakly similar to uniprot|Q04301 Saccharomyces
           cerevisiae YMR088C VBA1 Permease of basic amino acids in
           the vacuolar membrane
          Length = 565

 Score = 31.2 bits (69), Expect = 8.2,   Method: Compositional matrix adjust.
 Identities = 21/71 (29%), Positives = 35/71 (49%), Gaps = 1/71 (1%)

Query: 121 SSKQPWLMASFPLVSGSFILISGRLGDIYGLKKALSVGYIIMTLWSIICGLAKYTNSDAF 180
           SS+  W+  ++ L   +F  + G+L DI+G K  L +  +   L   ICG + +TN+   
Sbjct: 75  SSQMSWIATAYLLSCSAFQPLYGKLSDIFGRKILLILSNLTFALGCAICG-SPWTNNVWV 133

Query: 181 FIVCRSFQGLG 191
               R   G+G
Sbjct: 134 LSTGRFVAGIG 144

>Ecym_6024 Chr6 (43495..44964) [1470 bp, 489 aa] {ON} similar to
           Ashbya gossypii AAR192C
          Length = 489

 Score = 31.2 bits (69), Expect = 8.4,   Method: Compositional matrix adjust.
 Identities = 19/54 (35%), Positives = 27/54 (50%), Gaps = 3/54 (5%)

Query: 140 LISGRLGDIYGLKKALSVGYIIMTLWSIICGLAKYTNSDAFFIVCRSFQGLGIA 193
           +I G +GD YG K +  V   IM    II G A    S  +F+ CR+  G+ + 
Sbjct: 98  VIFGYVGDRYGQKTSFLVNLSIMMALQIIIGFA---TSFRYFLACRALFGIALG 148

>Suva_13.20 Chr13 complement(24012..25766) [1755 bp, 584 aa] {ON}
           YML123C (REAL)
          Length = 584

 Score = 30.8 bits (68), Expect = 9.7,   Method: Compositional matrix adjust.
 Identities = 19/58 (32%), Positives = 29/58 (50%), Gaps = 7/58 (12%)

Query: 147 DIYGLKKALSVGYIIMTLWSIICGLAKYTNSD----AFFIVCRSFQGLG---IAFILP 197
           DI G K     G+II+T+   + G A +   D    A +++C+ FQ  G     FI+P
Sbjct: 413 DIIGRKPIQLAGFIILTILFCVIGFAYHKIGDHGLLALYVICQFFQNFGPNTTTFIVP 470

>SAKL0E08756g Chr5 complement(714902..716599) [1698 bp, 565 aa] {ON}
           similar to uniprot|P53943 Saccharomyces cerevisiae
           YNL065W AQR1 Plasma membrane transporter of the major
           facilitator superfamily that confers resistance to
           short- chain monocarboxylic acids and quinidine
          Length = 565

 Score = 30.8 bits (68), Expect = 9.7,   Method: Compositional matrix adjust.
 Identities = 23/65 (35%), Positives = 35/65 (53%), Gaps = 3/65 (4%)

Query: 141 ISGRLGDIYGLKKALSVGYIIMTLWSIICGLAKYTNSDAFFIVCRSFQGLGIAFILPNIM 200
           ISG L D+YG +  +  G +I  + SI  GLA  +NS    +  R  Q  GI+ ++    
Sbjct: 152 ISGGLADVYGRRPIILAGMLIYVVASI--GLA-CSNSYGVIVFLRCVQSAGISPLIAISS 208

Query: 201 GLVGN 205
           G+VG+
Sbjct: 209 GVVGD 213

>Ecym_4506 Chr4 complement(1013521..1015467) [1947 bp, 648 aa] {ON}
           similar to Ashbya gossypii ACL172C
          Length = 648

 Score = 30.8 bits (68), Expect = 10.0,   Method: Compositional matrix adjust.
 Identities = 15/60 (25%), Positives = 25/60 (41%)

Query: 390 THFMFVIWGTVAAFVVALTIKKVGPAVLLCFSMVAFDCGSIMLSVTPVHQTYWRMNVGMQ 449
            + + ++   VA FV    + K+GP   L    +    G + L +      YWR N  +Q
Sbjct: 582 NNLVRMLLAAVAVFVTEPMLNKIGPGWALTILEIIISVGGLSLIILKSRSDYWRANYDLQ 641

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.326    0.138    0.435 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 48,059,128
Number of extensions: 1702346
Number of successful extensions: 5458
Number of sequences better than 10.0: 173
Number of HSP's gapped: 5508
Number of HSP's successfully gapped: 188
Length of query: 558
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 443
Effective length of database: 40,294,809
Effective search space: 17850600387
Effective search space used: 17850600387
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 68 (30.8 bits)