Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
CAGL0M02981g8.840ON61761733310.0
Smik_13.4918.840ON62261620400.0
Suva_13.4668.840ON62261520320.0
KNAG0J002708.840ON62561420310.0
YMR278W (PGM3)8.840ON62261620260.0
NCAS0C004108.840ON62561920110.0
NDAI0K004108.840ON62661819840.0
Skud_13.4508.840ON62261519570.0
SAKL0D01474g8.840ON62462419360.0
KAFR0B039208.840ON62461619270.0
TPHA0I002508.840ON62961919190.0
TDEL0B005708.840ON63061519020.0
Kpol_1068.88.840ON63262119010.0
ZYRO0G14190g8.840ON61061518970.0
Kwal_27.102588.840ON62062218740.0
TBLA0B032508.840ON64363618480.0
KLTH0C03872g8.840ON62162518450.0
ABL126W8.840ON62462517870.0
KLLA0D01573g8.840ON60762717320.0
Ecym_46118.840ON63062317130.0
TBLA0G009806.11ON558961135e-05
CAGL0K03421g2.445ON5685541010.001
KNAG0E023902.445ON569552980.003
TDEL0E00210singletonON570131960.005
SAKL0E00902g6.11ON54469960.006
CAGL0B03597g6.11ON54036920.017
Kwal_26.76282.445ON57087910.019
NCAS0A043502.445ON569549910.020
NCAS0F014702.445ON569553910.020
NCAS0F002006.11ON54928910.021
TPHA0G029002.445ON569158910.024
Kpol_1032.26.11ON53973900.025
Kwal_56.223556.11ON54177900.025
TDEL0G046006.11ON52828900.028
KAFR0L003406.11ON54053890.033
NDAI0K028906.11ON56130890.036
SAKL0E03630g2.445ON571128870.058
KLTH0C11506g6.11ON544131870.061
ZYRO0F00506g6.11ON55043870.063
Smik_5.296.11ON55541870.072
YEL058W (PCM1)6.11ON55728870.073
Skud_5.316.11ON55728860.076
Ecym_30146.11ON55190860.079
KLLA0D00858g6.11ON541136860.080
TDEL0A022102.445ON572303860.081
Suva_5.106.11ON55328860.081
KLLA0B12694g2.445ON568127860.089
YMR105C (PGM2)2.445ON569552860.094
TPHA0G024702.445ON569128840.14
Kpol_1033.542.445ON570132840.17
KNAG0E009406.11ON53821840.17
Smik_13.2912.445ON569547840.17
KLTH0D04796g2.445ON570161840.17
ACR015W6.11ON55283820.29
NDAI0H023502.445ON569548820.29
Skud_13.2632.445ON569558800.45
KAFR0D030102.445ON569127790.68
TBLA0B090102.445ON569111780.69
TPHA0M002106.11ON54528780.87
Suva_13.2822.445ON569127771.0
ABL029W2.445ON56886761.4
Kpol_1018.1612.445ON569131761.5
CAGL0K07480g2.445ON567127761.5
NDAI0I02680singletonON32277751.5
ZYRO0G02508g2.445ON569128751.8
Suva_11.982.445ON570126751.8
TBLA0I013802.445ON571141751.8
CAGL0I02662g8.849ON60685742.7
NDAI0I014606.141ON517159723.8
Smik_11.172singletonON18063704.2
KNAG0A062802.445ON57091724.3
Skud_11.1022.445ON57090724.3
Ecym_62921.321ON43057714.3
Kwal_14.1443na 1ON1170133724.5
NCAS0G038102.284ON66162724.8
SAKL0E13310g2.54ON763103708.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0M02981g
         (617 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0M02981g Chr13 (335863..337716) [1854 bp, 617 aa] {ON} simil...  1287   0.0  
Smik_13.491 Chr13 (805767..807635) [1869 bp, 622 aa] {ON} YMR278...   790   0.0  
Suva_13.466 Chr13 (805414..807282) [1869 bp, 622 aa] {ON} YMR278...   787   0.0  
KNAG0J00270 Chr10 complement(39750..41627) [1878 bp, 625 aa] {ON...   786   0.0  
YMR278W Chr13 (822763..824631) [1869 bp, 622 aa] {ON}  PGM3Phosp...   785   0.0  
NCAS0C00410 Chr3 complement(62893..64770) [1878 bp, 625 aa] {ON}...   779   0.0  
NDAI0K00410 Chr11 complement(91807..93687) [1881 bp, 626 aa] {ON...   768   0.0  
Skud_13.450 Chr13 (796030..797898) [1869 bp, 622 aa] {ON} YMR278...   758   0.0  
SAKL0D01474g Chr4 complement(117178..119052) [1875 bp, 624 aa] {...   750   0.0  
KAFR0B03920 Chr2 (814394..816268) [1875 bp, 624 aa] {ON} Anc_8.8...   746   0.0  
TPHA0I00250 Chr9 (46554..48443) [1890 bp, 629 aa] {ON} Anc_8.840...   743   0.0  
TDEL0B00570 Chr2 complement(109270..111162) [1893 bp, 630 aa] {O...   737   0.0  
Kpol_1068.8 s1068 complement(13542..15440) [1899 bp, 632 aa] {ON...   736   0.0  
ZYRO0G14190g Chr7 (1131206..1133038) [1833 bp, 610 aa] {ON} simi...   735   0.0  
Kwal_27.10258 s27 complement(265612..267474) [1863 bp, 620 aa] {...   726   0.0  
TBLA0B03250 Chr2 (757928..759859) [1932 bp, 643 aa] {ON} Anc_8.8...   716   0.0  
KLTH0C03872g Chr3 complement(337765..339630) [1866 bp, 621 aa] {...   715   0.0  
ABL126W Chr2 (159207..161081) [1875 bp, 624 aa] {ON} Syntenic ho...   692   0.0  
KLLA0D01573g Chr4 complement(139183..141006) [1824 bp, 607 aa] {...   671   0.0  
Ecym_4611 Chr4 (1191367..1193259) [1893 bp, 630 aa] {ON} similar...   664   0.0  
TBLA0G00980 Chr7 complement(248484..250160) [1677 bp, 558 aa] {O...    48   5e-05
CAGL0K03421g Chr11 complement(314680..316386) [1707 bp, 568 aa] ...    44   0.001
KNAG0E02390 Chr5 (475467..477176) [1710 bp, 569 aa] {ON} Anc_2.4...    42   0.003
TDEL0E00210 Chr5 (28244..29956) [1713 bp, 570 aa] {ON} Anc_2.445...    42   0.005
SAKL0E00902g Chr5 complement(68682..70316) [1635 bp, 544 aa] {ON...    42   0.006
CAGL0B03597g Chr2 complement(359018..360640) [1623 bp, 540 aa] {...    40   0.017
Kwal_26.7628 s26 (449302..451014) [1713 bp, 570 aa] {ON} YMR105C...    40   0.019
NCAS0A04350 Chr1 (878688..880397) [1710 bp, 569 aa] {ON} Anc_2.4...    40   0.020
NCAS0F01470 Chr6 complement(293218..294927) [1710 bp, 569 aa] {O...    40   0.020
NCAS0F00200 Chr6 complement(30474..32123) [1650 bp, 549 aa] {ON}...    40   0.021
TPHA0G02900 Chr7 (622303..624012) [1710 bp, 569 aa] {ON}               40   0.024
Kpol_1032.2 s1032 complement(1049..2668) [1620 bp, 539 aa] {ON} ...    39   0.025
Kwal_56.22355 s56 complement(62955..64580) [1626 bp, 541 aa] {ON...    39   0.025
TDEL0G04600 Chr7 (838381..839967) [1587 bp, 528 aa] {ON} Anc_6.1...    39   0.028
KAFR0L00340 Chr12 complement(62157..63779) [1623 bp, 540 aa] {ON...    39   0.033
NDAI0K02890 Chr11 (655311..656996) [1686 bp, 561 aa] {ON} Anc_6....    39   0.036
SAKL0E03630g Chr5 complement(294321..296036) [1716 bp, 571 aa] {...    38   0.058
KLTH0C11506g Chr3 (944869..946503) [1635 bp, 544 aa] {ON} simila...    38   0.061
ZYRO0F00506g Chr6 complement(49579..51231) [1653 bp, 550 aa] {ON...    38   0.063
Smik_5.29 Chr5 (45538..47205) [1668 bp, 555 aa] {ON} YEL058W (REAL)    38   0.072
YEL058W Chr5 (43252..44925) [1674 bp, 557 aa] {ON}  PCM1Essentia...    38   0.073
Skud_5.31 Chr5 (42262..43935) [1674 bp, 557 aa] {ON} YEL058W (REAL)    38   0.076
Ecym_3014 Chr3 complement(28261..29916) [1656 bp, 551 aa] {ON} s...    38   0.079
KLLA0D00858g Chr4 complement(80327..81952) [1626 bp, 541 aa] {ON...    38   0.080
TDEL0A02210 Chr1 (400375..402093) [1719 bp, 572 aa] {ON} Anc_2.4...    38   0.081
Suva_5.10 Chr5 (19280..20941) [1662 bp, 553 aa] {ON} YEL058W (REAL)    38   0.081
KLLA0B12694g Chr2 (1107696..1109402) [1707 bp, 568 aa] {ON} high...    38   0.089
YMR105C Chr13 complement(475897..477606) [1710 bp, 569 aa] {ON} ...    38   0.094
TPHA0G02470 Chr7 (507445..509154) [1710 bp, 569 aa] {ON} Anc_2.4...    37   0.14 
Kpol_1033.54 s1033 (136243..137955) [1713 bp, 570 aa] {ON} (1362...    37   0.17 
KNAG0E00940 Chr5 (176887..178503) [1617 bp, 538 aa] {ON} Anc_6.1...    37   0.17 
Smik_13.291 Chr13 complement(460399..462108) [1710 bp, 569 aa] {...    37   0.17 
KLTH0D04796g Chr4 (437416..439128) [1713 bp, 570 aa] {ON} highly...    37   0.17 
ACR015W Chr3 (383130..384788) [1659 bp, 552 aa] {ON} Syntenic ho...    36   0.29 
NDAI0H02350 Chr8 complement(571624..573333) [1710 bp, 569 aa] {O...    36   0.29 
Skud_13.263 Chr13 complement(451194..452903) [1710 bp, 569 aa] {...    35   0.45 
KAFR0D03010 Chr4 (594118..595827) [1710 bp, 569 aa] {ON} Anc_2.4...    35   0.68 
TBLA0B09010 Chr2 complement(2135961..2137670) [1710 bp, 569 aa] ...    35   0.69 
TPHA0M00210 Chr13 complement(42336..43973) [1638 bp, 545 aa] {ON...    35   0.87 
Suva_13.282 Chr13 complement(457565..459274) [1710 bp, 569 aa] {...    34   1.0  
ABL029W Chr2 (343850..345556) [1707 bp, 568 aa] {ON} Syntenic ho...    34   1.4  
Kpol_1018.161 s1018 (412372..414081) [1710 bp, 569 aa] {ON} (412...    34   1.5  
CAGL0K07480g Chr11 complement(740462..742165) [1704 bp, 567 aa] ...    34   1.5  
NDAI0I02680 Chr9 (630771..631739) [969 bp, 322 aa] {ON}                33   1.5  
ZYRO0G02508g Chr7 (192411..194120) [1710 bp, 569 aa] {ON} highly...    33   1.8  
Suva_11.98 Chr11 (189966..191678) [1713 bp, 570 aa] {ON} YMR105C...    33   1.8  
TBLA0I01380 Chr9 complement(297671..299386) [1716 bp, 571 aa] {O...    33   1.8  
CAGL0I02662g Chr9 (237396..239216) [1821 bp, 606 aa] {ON} simila...    33   2.7  
NDAI0I01460 Chr9 (345837..347390) [1554 bp, 517 aa] {ON} Anc_6.141     32   3.8  
Smik_11.172 Chr11 (292597..293139) [543 bp, 180 aa] {ON} YKL069W...    32   4.2  
KNAG0A06280 Chr1 (955994..957706) [1713 bp, 570 aa] {ON}               32   4.3  
Skud_11.102 Chr11 (190406..192118) [1713 bp, 570 aa] {ON} YKL127...    32   4.3  
Ecym_6292 Chr6 (547563..548855) [1293 bp, 430 aa] {ON} similar t...    32   4.3  
Kwal_14.1443 s14 complement(326134..329646) [3513 bp, 1170 aa] {...    32   4.5  
NCAS0G03810 Chr7 complement(703842..705827) [1986 bp, 661 aa] {O...    32   4.8  
SAKL0E13310g Chr5 (1098632..1100923) [2292 bp, 763 aa] {ON} cons...    32   8.3  

>CAGL0M02981g Chr13 (335863..337716) [1854 bp, 617 aa] {ON} similar
           to uniprot|Q03262 Saccharomyces cerevisiae YMR278w
          Length = 617

 Score = 1287 bits (3331), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 617/617 (100%), Positives = 617/617 (100%)

Query: 1   MSTTDIPVELRTAIESWLQLDKNEETRNEVIKLCNDQNWDELHKRFDSRIVFGTAGLRAR 60
           MSTTDIPVELRTAIESWLQLDKNEETRNEVIKLCNDQNWDELHKRFDSRIVFGTAGLRAR
Sbjct: 1   MSTTDIPVELRTAIESWLQLDKNEETRNEVIKLCNDQNWDELHKRFDSRIVFGTAGLRAR 60

Query: 61  MEAGTNRLNKLVILQASQGLATYIKDKFPQNLTAVVGHDHRYHSQEFAQVTAATFIRAGF 120
           MEAGTNRLNKLVILQASQGLATYIKDKFPQNLTAVVGHDHRYHSQEFAQVTAATFIRAGF
Sbjct: 61  MEAGTNRLNKLVILQASQGLATYIKDKFPQNLTAVVGHDHRYHSQEFAQVTAATFIRAGF 120

Query: 121 KVYYLNPHDEFVHTPMVPYSVDHLNASVGVMITASHNPKMDNGYKVYYTNGCQIIPPHDH 180
           KVYYLNPHDEFVHTPMVPYSVDHLNASVGVMITASHNPKMDNGYKVYYTNGCQIIPPHDH
Sbjct: 121 KVYYLNPHDEFVHTPMVPYSVDHLNASVGVMITASHNPKMDNGYKVYYTNGCQIIPPHDH 180

Query: 181 GIAETINNNLEPWSTDWNFTKILSNAETDGKIEYVRKRMLTSYLNSVVNQLIQRDFAAPD 240
           GIAETINNNLEPWSTDWNFTKILSNAETDGKIEYVRKRMLTSYLNSVVNQLIQRDFAAPD
Sbjct: 181 GIAETINNNLEPWSTDWNFTKILSNAETDGKIEYVRKRMLTSYLNSVVNQLIQRDFAAPD 240

Query: 241 EKPWFVYTPMHGVGHQIFSTILNESLNLKDNIDYITVPEQKDPDPSFRTVSFPNPEEKGA 300
           EKPWFVYTPMHGVGHQIFSTILNESLNLKDNIDYITVPEQKDPDPSFRTVSFPNPEEKGA
Sbjct: 241 EKPWFVYTPMHGVGHQIFSTILNESLNLKDNIDYITVPEQKDPDPSFRTVSFPNPEEKGA 300

Query: 301 LNLAITLAEANGIKLVLANDPNADRFSVAVRDDSKNEWKQLTGNEIGLLFAFYEFKMYQK 360
           LNLAITLAEANGIKLVLANDPNADRFSVAVRDDSKNEWKQLTGNEIGLLFAFYEFKMYQK
Sbjct: 301 LNLAITLAEANGIKLVLANDPNADRFSVAVRDDSKNEWKQLTGNEIGLLFAFYEFKMYQK 360

Query: 361 AADKGIKNKPLAMLNSTVSAQVIKRMAEKEGFLYKDTLTGFKWIGNEAAKLEEKGYFVPF 420
           AADKGIKNKPLAMLNSTVSAQVIKRMAEKEGFLYKDTLTGFKWIGNEAAKLEEKGYFVPF
Sbjct: 361 AADKGIKNKPLAMLNSTVSAQVIKRMAEKEGFLYKDTLTGFKWIGNEAAKLEEKGYFVPF 420

Query: 421 GYEEAIGYMFPAMEHDKDGVSAAIVFLQAYANWLQSSSNPIDIIHECYDKYGVSAEYNGY 480
           GYEEAIGYMFPAMEHDKDGVSAAIVFLQAYANWLQSSSNPIDIIHECYDKYGVSAEYNGY
Sbjct: 421 GYEEAIGYMFPAMEHDKDGVSAAIVFLQAYANWLQSSSNPIDIIHECYDKYGVSAEYNGY 480

Query: 481 YIVSDPSKTDKVFESIRSSYTSMGLSFPESIGEHFRVTEFRDLTIGFDSTTADKKPLLPV 540
           YIVSDPSKTDKVFESIRSSYTSMGLSFPESIGEHFRVTEFRDLTIGFDSTTADKKPLLPV
Sbjct: 481 YIVSDPSKTDKVFESIRSSYTSMGLSFPESIGEHFRVTEFRDLTIGFDSTTADKKPLLPV 540

Query: 541 DKNSQMITITAVPSGASNTGESVRFTIRGSGTEPKLKVYIEGISSTEGRARILAKSLWET 600
           DKNSQMITITAVPSGASNTGESVRFTIRGSGTEPKLKVYIEGISSTEGRARILAKSLWET
Sbjct: 541 DKNSQMITITAVPSGASNTGESVRFTIRGSGTEPKLKVYIEGISSTEGRARILAKSLWET 600

Query: 601 LKHEWFKPSSNGLSTDF 617
           LKHEWFKPSSNGLSTDF
Sbjct: 601 LKHEWFKPSSNGLSTDF 617

>Smik_13.491 Chr13 (805767..807635) [1869 bp, 622 aa] {ON} YMR278W
           (REAL)
          Length = 622

 Score =  790 bits (2040), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 371/616 (60%), Positives = 468/616 (75%), Gaps = 6/616 (0%)

Query: 6   IPVELRTAIESWLQLDKNEETRNEVIKLCNDQNWDELHKRFDSRIVFGTAGLRARMEAGT 65
           +P  L+ AI  W + D+N ET  EV  LC   +W+ELH+RFDSRI FGTAGLR++M+AG 
Sbjct: 9   VPSNLKEAISLWFEQDQNPETIEEVTALCKKSDWNELHRRFDSRIQFGTAGLRSQMQAGF 68

Query: 66  NRLNKLVILQASQGLATYIKDKFPQNLTAVVGHDHRYHSQEFAQVTAATFIRAGFKVYYL 125
           NR+N LVI+QASQGLATY K +FP NL AVVGHDHR+HS+EFA+ TA  F+  GFKV+YL
Sbjct: 69  NRMNTLVIIQASQGLATYAKQQFPNNLVAVVGHDHRFHSKEFARATATAFLLKGFKVHYL 128

Query: 126 NPHDEFVHTPMVPYSVDHLNASVGVMITASHNPKMDNGYKVYYTNGCQIIPPHDHGIAET 185
           NP  EFVHTP+VP++VD L ASVGVM+TASHNPKMDNGYKVYY+NGCQIIPPHDH I+++
Sbjct: 129 NPDHEFVHTPLVPFAVDKLKASVGVMVTASHNPKMDNGYKVYYSNGCQIIPPHDHAISDS 188

Query: 186 INNNLEPWSTDWNFTKILSNAETDGKIEYVRKRMLTSYLNSVVNQLIQRD---FAAPDEK 242
           I+ NLEPW+  WNF  +L+     GK+ Y R+ +L  YL  V   L+  D   F     K
Sbjct: 189 IDMNLEPWANVWNFDDVLNKGLKQGKLMYSREEILKLYLGEVSKNLVGTDPLKFEV-KAK 247

Query: 243 PWFVYTPMHGVGHQIFSTILNESLNLKDNIDYITVPEQKDPDPSFRTVSFPNPEEKGALN 302
           PWFVYTPMHGVG  IFSTI+ ++++L +  DY+ VPEQ++PDPSF TV+FPNPEEKGAL+
Sbjct: 248 PWFVYTPMHGVGFDIFSTIVKKTMSLVEGKDYLCVPEQQEPDPSFPTVAFPNPEEKGALD 307

Query: 303 LAITLAEANGIKLVLANDPNADRFSVAVRDDSKNEWKQLTGNEIGLLFAFYEFKMYQKAA 362
           L I LAE +GI L++ANDP+ADRFSVA++D    EW+QLTGNEIG LFA +EF+ ++   
Sbjct: 308 LGINLAENHGINLLIANDPDADRFSVAIKDIRSGEWRQLTGNEIGFLFAIFEFQKFKSME 367

Query: 363 DKGIKNKPLAMLNSTVSAQVIKRMAEKEGFLYKDTLTGFKWIGNEAAKLEEKGYFVPFGY 422
            +     PLAML+STVS+Q+IK+MAE EGF Y++TLTGFKWIGN A  LE++GY+VPFG+
Sbjct: 368 KQFQHAHPLAMLSSTVSSQMIKKMAEVEGFHYEETLTGFKWIGNRAILLEKEGYYVPFGF 427

Query: 423 EEAIGYMFPAMEHDKDGVSAAIVFLQAYANW-LQSSSNPIDIIHECYDKYGVSAEYNGYY 481
           EEAIGYMFPAMEHDKDG+SA+IVFLQAY  W +  + +PI I+ + + KYGV  EYNGYY
Sbjct: 428 EEAIGYMFPAMEHDKDGLSASIVFLQAYCQWKIDHNLDPISILEDGFKKYGVFKEYNGYY 487

Query: 482 IVSDPSKTDKVFESIRSSYTSMGLSFPESIGEHFRVTEFRDLTIGFDSTTADKKPLLPVD 541
           IVS P  T+++F+ IR++YT  G+S+P SIG+   V  +RDLTIG+ S T++ KP LP+D
Sbjct: 488 IVSSPIVTNEIFDYIRNAYTPKGVSYPSSIGKEIEVLNYRDLTIGYQSDTSNHKPTLPID 547

Query: 542 KNSQMITITAVPSGASNTGESVRFTIRGSGTEPKLKVYIEGISSTEGRARILAKSLWETL 601
            +SQMIT++A PS   N GE +RFTIRGSGTEPK+KVYIE  +  E RA  LAK  W  L
Sbjct: 548 PSSQMITVSAKPSDG-NEGEHIRFTIRGSGTEPKIKVYIEACADEEQRATFLAKLTWNVL 606

Query: 602 KHEWFKPSSNGLSTDF 617
           K EWF+P    + T F
Sbjct: 607 KREWFRPEKMDIVTHF 622

>Suva_13.466 Chr13 (805414..807282) [1869 bp, 622 aa] {ON} YMR278W
           (REAL)
          Length = 622

 Score =  787 bits (2032), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 367/615 (59%), Positives = 466/615 (75%), Gaps = 4/615 (0%)

Query: 6   IPVELRTAIESWLQLDKNEETRNEVIKLCNDQNWDELHKRFDSRIVFGTAGLRARMEAGT 65
           +P +L+  I  W   D+N ET  EV  LC + +WDELHKRFD+RI FGTAGLR+ M+AG 
Sbjct: 9   VPSDLKGPISLWFDQDRNPETIEEVTTLCKNSDWDELHKRFDTRIQFGTAGLRSEMQAGF 68

Query: 66  NRLNKLVILQASQGLATYIKDKFPQNLTAVVGHDHRYHSQEFAQVTAATFIRAGFKVYYL 125
           +R+N LVI+QA+QGLATYIK +FP NL  VVGHDHR+HS+EFA+ TA  F+  GFKV+YL
Sbjct: 69  SRMNTLVIIQATQGLATYIKQQFPDNLVVVVGHDHRFHSKEFARATATAFLLKGFKVHYL 128

Query: 126 NPHDEFVHTPMVPYSVDHLNASVGVMITASHNPKMDNGYKVYYTNGCQIIPPHDHGIAET 185
           NP  EFVHTP+VP++VD L ASVGVMITASHNPKMDNGYKVYY+NGCQIIPPHDH I+++
Sbjct: 129 NPDHEFVHTPLVPFAVDKLKASVGVMITASHNPKMDNGYKVYYSNGCQIIPPHDHAISDS 188

Query: 186 INNNLEPWSTDWNFTKILSNAETDGKIEYVRKRMLTSYLNSVVNQLIQRDFAAPD--EKP 243
           I+ NLEPW+  W F+ +L+ A   GK+ Y R+ ML  Y   V   L++ +    +   KP
Sbjct: 189 IDMNLEPWANVWKFSDVLNKALKQGKLMYSREEMLNLYSKEVSKTLVETNPLKLEIKAKP 248

Query: 244 WFVYTPMHGVGHQIFSTILNESLNLKDNIDYITVPEQKDPDPSFRTVSFPNPEEKGALNL 303
           WFVYTPMHGVG  IFSTI+ ++++L +  DY+ VPEQ++PDPSF TV FPNPEEKGAL++
Sbjct: 249 WFVYTPMHGVGFNIFSTIVKKTMSLVEGEDYLCVPEQQNPDPSFPTVGFPNPEEKGALDI 308

Query: 304 AITLAEANGIKLVLANDPNADRFSVAVRDDSKNEWKQLTGNEIGLLFAFYEFKMYQKAAD 363
            + LAE + I L++ANDP+ADRFS+AV+D   ++W+QLTGNEIG LFAF+EF+ Y+   +
Sbjct: 309 GMRLAEEHDINLLVANDPDADRFSIAVKDTQSSKWRQLTGNEIGFLFAFFEFQRYKNKDE 368

Query: 364 KGIKNKPLAMLNSTVSAQVIKRMAEKEGFLYKDTLTGFKWIGNEAAKLEEKGYFVPFGYE 423
           +  ++ PLAML+STVS+Q+IK+MAE EGFLY+DTLTGFKWIGN A  LE++GY+VPFG+E
Sbjct: 369 EFQRSHPLAMLSSTVSSQMIKKMAEVEGFLYEDTLTGFKWIGNRAIILEKEGYYVPFGFE 428

Query: 424 EAIGYMFPAMEHDKDGVSAAIVFLQAYANW-LQSSSNPIDIIHECYDKYGVSAEYNGYYI 482
           EAIGYMFPAMEHDKDG+SAA+V LQAY  W + S+ +PIDI+   + KYGV  EYNGYY+
Sbjct: 429 EAIGYMFPAMEHDKDGISAAVVLLQAYCKWKIDSNLDPIDILENGFQKYGVFKEYNGYYV 488

Query: 483 VSDPSKTDKVFESIRSSYTSMGLSFPESIGEHFRVTEFRDLTIGFDSTTADKKPLLPVDK 542
           V  P  T ++FE IR+ YT  G+ +P SIGE   V  +RDLT G+ S T D KP+LPVD 
Sbjct: 489 VPSPLVTTEIFEYIRNVYTPTGVPYPPSIGEEIEVVYYRDLTTGYQSDTPDHKPVLPVDP 548

Query: 543 NSQMITITAVPSGASNTGESVRFTIRGSGTEPKLKVYIEGISSTEGRARILAKSLWETLK 602
            SQMIT++  PS   N  E +RFTIRGSGTEPKLKVYIE  +  E RA  LAK  W+ L+
Sbjct: 549 TSQMITLSGKPSDG-NGNEHIRFTIRGSGTEPKLKVYIEACADNEKRASYLAKLTWDVLR 607

Query: 603 HEWFKPSSNGLSTDF 617
             WF+P    ++TDF
Sbjct: 608 RGWFRPEIMNITTDF 622

>KNAG0J00270 Chr10 complement(39750..41627) [1878 bp, 625 aa] {ON}
           Anc_8.840 YMR278W
          Length = 625

 Score =  786 bits (2031), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 377/614 (61%), Positives = 459/614 (74%), Gaps = 4/614 (0%)

Query: 7   PVELRTAIESWLQLDKNEETRNEVIKLCNDQNWDELHKRFDSRIVFGTAGLRARMEAGTN 66
           P  L+  I  WL+LDKNEETR EV+ LC  Q+W EL+ RF  RI+FGTAGLR+RMEAGTN
Sbjct: 13  PEGLQHRILEWLRLDKNEETRREVLDLCQRQDWSELNSRFSQRILFGTAGLRSRMEAGTN 72

Query: 67  RLNKLVILQASQGLATYIKDKFPQNLTAVVGHDHRYHSQEFAQVTAATFIRAGFKVYYLN 126
           RLN LVILQA+QGLA YI  +FP+N  AVVGHDHR+HS+EFA VTAA F+RAGFKV YLN
Sbjct: 73  RLNSLVILQATQGLARYIASQFPKNKVAVVGHDHRFHSKEFATVTAAVFLRAGFKVLYLN 132

Query: 127 PHDEFVHTPMVPYSVDHLNASVGVMITASHNPKMDNGYKVYYTNGCQIIPPHDHGIAETI 186
           P D  VHTP+VP++VDHLNASVGVMITASHNPKMDNGYKVY+ NGCQIIPPHD  IA +I
Sbjct: 133 PGDTLVHTPLVPFTVDHLNASVGVMITASHNPKMDNGYKVYFANGCQIIPPHDLNIARSI 192

Query: 187 NNNLEPWSTDWNFTKILSNAETDGKIEYVRKRMLTSYLNSVVNQLI--QRDFAAPDEKPW 244
           + NLEPW   W++  ++  AE + +I YV+ +M   Y  +   QLI  ++    P   PW
Sbjct: 193 DQNLEPWEPSWDWPTVIQAAEKEDRIVYVKDQMTQLYTKTAELQLIGGRKVLRNPGSGPW 252

Query: 245 FVYTPMHGVGHQIFSTILNESLNLKDNIDYITVPEQKDPDPSFRTVSFPNPEEKGALNLA 304
           FVYTPMHGVG +IFS I  + L +K+N DY+ VPEQK PDPSF TVSFPNPEEKGAL+ A
Sbjct: 253 FVYTPMHGVGSEIFSRISEDVLGIKENEDYLCVPEQKHPDPSFPTVSFPNPEEKGALDKA 312

Query: 305 ITLAEANGIKLVLANDPNADRFSVAVRDDSKNEWKQLTGNEIGLLFAFYEFKMYQKAADK 364
           I LA  NGI LV+ANDP+ADRFS+AV D     W+QLTGNEIG LFA+ +F+MY+   D 
Sbjct: 313 IELASQNGINLVIANDPDADRFSLAVFDSKTANWRQLTGNEIGFLFAYQQFEMYKAMDDI 372

Query: 365 GIKNKPLAMLNSTVSAQVIKRMAEKEGFLYKDTLTGFKWIGNEAAKLEEKGYFVPFGYEE 424
             K  PL +LNSTVS+Q+IK+MAE EGF Y+DTLTGFKWIGN A  LE+KG+F PFGYEE
Sbjct: 373 FQKEHPLVLLNSTVSSQMIKKMAEVEGFHYEDTLTGFKWIGNRARDLEKKGFFAPFGYEE 432

Query: 425 AIGYMFPAMEHDKDGVSAAIVFLQAYANWLQSSSN-PIDIIHECYDKYGVSAEYNGYYIV 483
           AIGYMF  MEHDKDG+SA+++FL +Y +W+  +   P+DI+ + Y KYGV  EYNGYYIV
Sbjct: 433 AIGYMFTQMEHDKDGISASLMFLLSYYHWVYDAHKFPLDILEDGYKKYGVFKEYNGYYIV 492

Query: 484 SDPSKTDKVFESIRSSYTSMGLSFPESIGEHFRVTEFRDLTIGFDSTTADKKPLLPVDKN 543
            +P    + F+ IR+     G  +PE+IG  F+V  FRDLT+GF S T+D  P LPVD N
Sbjct: 493 DNPKIMKETFDYIRNDRKP-GTQYPEAIGSEFQVVSFRDLTLGFQSDTSDHIPTLPVDPN 551

Query: 544 SQMITITAVPSGASNTGESVRFTIRGSGTEPKLKVYIEGISSTEGRARILAKSLWETLKH 603
           SQMIT+ A P+  +   + VRFTIRGSGTEPKLKVYIE  S +E  A+ LAK +W+TL+ 
Sbjct: 552 SQMITVCAKPTHDNVERDHVRFTIRGSGTEPKLKVYIEACSGSETGAQQLAKQMWDTLQE 611

Query: 604 EWFKPSSNGLSTDF 617
            WF+P + GL TDF
Sbjct: 612 VWFRPQTTGLVTDF 625

>YMR278W Chr13 (822763..824631) [1869 bp, 622 aa] {ON}
           PGM3Phosphoglucomutase, catalyzes interconversion of
           glucose-1-phosphate and glucose-6-phospate;
           transcription induced in response to stress; green
           fluorescent protein (GFP)-fusion protein localizes to
           the cytoplasm and nucleus; non-essential
          Length = 622

 Score =  785 bits (2026), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 372/616 (60%), Positives = 468/616 (75%), Gaps = 6/616 (0%)

Query: 6   IPVELRTAIESWLQLDKNEETRNEVIKLCNDQNWDELHKRFDSRIVFGTAGLRARMEAGT 65
           +P +L+  I  W + D+N +T  EV  LC   +W+ELHKRFDSRI FGTAGLR++M+AG 
Sbjct: 9   VPSDLKDPISLWFKQDRNPKTIEEVTALCKKSDWNELHKRFDSRIQFGTAGLRSQMQAGF 68

Query: 66  NRLNKLVILQASQGLATYIKDKFPQNLTAVVGHDHRYHSQEFAQVTAATFIRAGFKVYYL 125
           +R+N LV++QASQGLATY++ +FP NL AVVGHDHR+HS+EFA+ TAA F+  GFKV+YL
Sbjct: 69  SRMNTLVVIQASQGLATYVRQQFPDNLVAVVGHDHRFHSKEFARATAAAFLLKGFKVHYL 128

Query: 126 NPHDEFVHTPMVPYSVDHLNASVGVMITASHNPKMDNGYKVYYTNGCQIIPPHDHGIAET 185
           NP  EFVHTP+VP++VD L ASVGVMITASHNPKMDNGYKVYY+NGCQIIPPHDH I+++
Sbjct: 129 NPDHEFVHTPLVPFAVDKLKASVGVMITASHNPKMDNGYKVYYSNGCQIIPPHDHAISDS 188

Query: 186 INNNLEPWSTDWNFTKILSNAETDGKIEYVRKRMLTSYLNSVVNQLIQRDFAAPD--EKP 243
           I+ NLEPW+  W+F  +L+ A   GK+ Y R+ ML  YL  V   L++ +    +   KP
Sbjct: 189 IDANLEPWANVWDFDDVLNKALKQGKLMYSREEMLKLYLEEVSKNLVEINPLKLEVKAKP 248

Query: 244 WFVYTPMHGVGHQIFSTILNESLNLKDNIDYITVPEQKDPDPSFRTVSFPNPEEKGALNL 303
           WFVYTPMHGVG  IFSTI+ ++L L +  DY+ VPEQ++PDPSF TV FPNPEEKGAL++
Sbjct: 249 WFVYTPMHGVGFDIFSTIVKKTLCLVEGKDYLCVPEQQNPDPSFPTVGFPNPEEKGALDI 308

Query: 304 AITLAEANGIKLVLANDPNADRFSVAVRDDSKNEWKQLTGNEIGLLFAFYEFKMYQKAAD 363
            I LAE + I L++ANDP+ADRFSVAV+D    EW+QLTGNEIG LFAFYE++ Y K+ D
Sbjct: 309 GINLAEKHDIDLLVANDPDADRFSVAVKDMQSGEWRQLTGNEIGFLFAFYEYQKY-KSMD 367

Query: 364 KGIKN-KPLAMLNSTVSAQVIKRMAEKEGFLYKDTLTGFKWIGNEAAKLEEKGYFVPFGY 422
           K  ++  PLAMLNSTVS+Q+IK+MAE EGF Y+DTLTGFKWIGN A  LE+KGY+VPFG+
Sbjct: 368 KEFQHVHPLAMLNSTVSSQMIKKMAEIEGFHYEDTLTGFKWIGNRAILLEKKGYYVPFGF 427

Query: 423 EEAIGYMFPAMEHDKDGVSAAIVFLQAYANW-LQSSSNPIDIIHECYDKYGVSAEYNGYY 481
           EEAIGYMFPAMEHDKDG+SA+IVFLQAY  W +  + +P++++   + KYGV  EYNGYY
Sbjct: 428 EEAIGYMFPAMEHDKDGISASIVFLQAYCKWKIDHNLDPLNVLENGFKKYGVFKEYNGYY 487

Query: 482 IVSDPSKTDKVFESIRSSYTSMGLSFPESIGEHFRVTEFRDLTIGFDSTTADKKPLLPVD 541
           +V +P+ T  +F+ IR+ YT  G S+P SIGE   V  +RDLT G+ S T + KP LPVD
Sbjct: 488 VVPNPTVTKDIFDYIRNVYTPEGASYPSSIGEEIEVLYYRDLTTGYQSDTINHKPTLPVD 547

Query: 542 KNSQMITITAVPSGASNTGESVRFTIRGSGTEPKLKVYIEGISSTEGRARILAKSLWETL 601
             SQMIT++A PS  S   E +RFTIRGSGTEPKLKVYIE  ++ E RA  LAK  W  L
Sbjct: 548 PTSQMITVSARPSNGSEN-EHIRFTIRGSGTEPKLKVYIEACANEEQRASFLAKLTWNVL 606

Query: 602 KHEWFKPSSNGLSTDF 617
           + EWF+P    + T F
Sbjct: 607 RREWFRPDEMNIVTKF 622

>NCAS0C00410 Chr3 complement(62893..64770) [1878 bp, 625 aa] {ON}
           Anc_8.840 YMR278W
          Length = 625

 Score =  779 bits (2011), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 373/619 (60%), Positives = 460/619 (74%), Gaps = 3/619 (0%)

Query: 2   STTDIPVELRTAIESWLQLDKNEETRNEVIKLCNDQNWDELHKRFDSRIVFGTAGLRARM 61
           S ++ P  LR  I  WL+LD+NEETR EV++LC ++NW ELH+RFD+RIVFGTAGLR+RM
Sbjct: 7   SLSNCPENLREPINLWLRLDQNEETRKEVLQLCENKNWPELHQRFDTRIVFGTAGLRSRM 66

Query: 62  EAGTNRLNKLVILQASQGLATYIKDKFPQNLTAVVGHDHRYHSQEFAQVTAATFIRAGFK 121
           EAG +R+N L+ILQ++QGLA YIK++FP NLTAVVGHDHR+HS+EFA VTA+ F+RAGFK
Sbjct: 67  EAGFSRMNSLIILQSTQGLANYIKEQFPNNLTAVVGHDHRFHSKEFAIVTASIFLRAGFK 126

Query: 122 VYYLNPHDEFVHTPMVPYSVDHLNASVGVMITASHNPKMDNGYKVYYTNGCQIIPPHDHG 181
           V+YL P D+FVHTP+VP+SV +L ASVGVMITASHNPKMDNGYKVYY N CQIIPPHD  
Sbjct: 127 VFYLTPDDQFVHTPLVPFSVLNLKASVGVMITASHNPKMDNGYKVYYDNACQIIPPHDKN 186

Query: 182 IAETINNNLEPWSTDWNFTKILSNAETDGKIEYVRKRMLTSYLNSVVNQLIQRD-FAAPD 240
           IAE I  NLEPWST W++           K+ +++  M   YL  +   LI     +  D
Sbjct: 187 IAEMIQKNLEPWSTSWDWDATFKKGLETNKLVFIKDLMTEKYLMQMKRVLIHSSHLSLKD 246

Query: 241 EK-PWFVYTPMHGVGHQIFSTILNESLNLKDNIDYITVPEQKDPDPSFRTVSFPNPEEKG 299
            K P+FVYTPMHGVG +IF+ + +E LNL +N+DY+ V EQ+ PDPSF TVSFPNPEEKG
Sbjct: 247 VKTPFFVYTPMHGVGAEIFAKVSSELLNLHENVDYLVVSEQRLPDPSFPTVSFPNPEEKG 306

Query: 300 ALNLAITLAEANGIKLVLANDPNADRFSVAVRDDSKNEWKQLTGNEIGLLFAFYEFKMYQ 359
           AL+LAI LA+ NG+ LV+ANDP+ADRFS AV +    +W+QLTGNEIG L  +YEF++Y+
Sbjct: 307 ALSLAIKLAQENGLSLVIANDPDADRFSAAVLNKKTGKWRQLTGNEIGFLLGYYEFQLYE 366

Query: 360 KAADKGIKNKPLAMLNSTVSAQVIKRMAEKEGFLYKDTLTGFKWIGNEAAKLEEKGYFVP 419
           +      K  PLAM+NSTVS+Q+IKRMA+  GF Y+DTLTGFKWIGN+A  L ++GY+VP
Sbjct: 367 QQDVAFRKTHPLAMINSTVSSQMIKRMADMNGFHYEDTLTGFKWIGNKAIDLRQEGYYVP 426

Query: 420 FGYEEAIGYMFPAMEHDKDGVSAAIVFLQAYANWL-QSSSNPIDIIHECYDKYGVSAEYN 478
           FG+EEAIGYMFP ME DKDG+SAA VFLQAY +W+ Q   +P DI+ E + K+GV  EYN
Sbjct: 427 FGFEEAIGYMFPDMECDKDGISAATVFLQAYCHWMNQYQMSPFDIMEEGFGKFGVFKEYN 486

Query: 479 GYYIVSDPSKTDKVFESIRSSYTSMGLSFPESIGEHFRVTEFRDLTIGFDSTTADKKPLL 538
           GYYI+ D S T  VF+ IR  Y S    +P  IG    VT FRDLT+G+ S T D  P L
Sbjct: 487 GYYILKDLSITKTVFDFIRHEYPSTNKKYPSEIGNELIVTVFRDLTVGYQSNTKDNIPNL 546

Query: 539 PVDKNSQMITITAVPSGASNTGESVRFTIRGSGTEPKLKVYIEGISSTEGRARILAKSLW 598
           PVD  SQMIT+ A PS  SN   +VR T+RGSGTEPKLKVYIE  S +E  A  LA+S W
Sbjct: 547 PVDPTSQMITVEAKPSEFSNLEGTVRLTMRGSGTEPKLKVYIEACSKSEESATNLARSTW 606

Query: 599 ETLKHEWFKPSSNGLSTDF 617
           + LK EWF+P   GL+T F
Sbjct: 607 DILKREWFRPEVTGLTTSF 625

>NDAI0K00410 Chr11 complement(91807..93687) [1881 bp, 626 aa] {ON}
           Anc_8.840 YMR278W
          Length = 626

 Score =  768 bits (1984), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 371/618 (60%), Positives = 462/618 (74%), Gaps = 7/618 (1%)

Query: 5   DIPVELRTAIESWLQLDKNEETRNEVIKLCNDQNWDELHKRFDSRIVFGTAGLRARMEAG 64
           D P  LR  I+ WL+ DK EETRNEVI+LC D NW ELHKRFDSRIVFGTAGLR+RMEAG
Sbjct: 11  DCPANLRENIDLWLRQDKCEETRNEVIQLCKDSNWIELHKRFDSRIVFGTAGLRSRMEAG 70

Query: 65  TNRLNKLVILQASQGLATYIKDKFPQNLTAVVGHDHRYHSQEFAQVTAATFIRAGFKVYY 124
            +R+N LVILQASQGLA YIK +FP NLTAVVGHDHR+HS++FA +TA+ F+R GFKVYY
Sbjct: 71  FSRMNPLVILQASQGLAKYIKAQFPTNLTAVVGHDHRFHSKQFAMITASVFLRVGFKVYY 130

Query: 125 LNPHDEFVHTPMVPYSVDHLNASVGVMITASHNPKMDNGYKVYYTNGCQIIPPHDHGIAE 184
           LNP D FVHTP+VP+SV+HLNAS+GVMITASHNPKMDNGYKVYY+NGCQIIPPHD  IA 
Sbjct: 131 LNPEDSFVHTPLVPFSVNHLNASIGVMITASHNPKMDNGYKVYYSNGCQIIPPHDKNIAA 190

Query: 185 TINNNLEPWSTDWNFTKILSNAETDGKIEYVRKRMLTSYLNSVVNQLIQRDFAAPD---E 241
           TI+ NLEPWS+DWN+         + K+ YVR+ M   YL ++ + L+    + P+   +
Sbjct: 191 TIDENLEPWSSDWNWDSTFEKNLKEKKLVYVREEMTNKYLQAMKDILVSSSISRPNNNGK 250

Query: 242 KPWFVYTPMHGVGHQIFSTILNESLNLKDNIDYITVPEQKDPDPSFRTVSFPNPEEKGAL 301
           KPWFVYTPMHGVG+ IF+ I    L+ ++N+DY  V EQ  PDP+F TVSFPNPEEKGAL
Sbjct: 251 KPWFVYTPMHGVGYNIFTKISKNILHYEENMDYFVVKEQMYPDPAFPTVSFPNPEEKGAL 310

Query: 302 NLAITLAEANGIKLVLANDPNADRFSVAVRDDSKNEWKQLTGNEIGLLFAFYEFKMYQKA 361
           +LA  LAE N I LV+ANDP+ADRFSVA +++   +W+QL+GNEIG LFA +E + Y   
Sbjct: 311 SLATKLAEENNISLVIANDPDADRFSVASKNEKTGQWQQLSGNEIGFLFASFELEKYMSQ 370

Query: 362 ADKGIKNKPLAMLNSTVSAQVIKRMAEKEGFLYKDTLTGFKWIGNEAAKLEEKGYFVPFG 421
             +  +  PLAM+NSTVS+Q+IK+MA+ E F Y+DTLTGFKWIGN A  L+ +GY+VPFG
Sbjct: 371 DIEWRRTHPLAMINSTVSSQMIKKMAQVESFHYEDTLTGFKWIGNRALDLQGQGYYVPFG 430

Query: 422 YEEAIGYMFPAMEHDKDGVSAAIVFLQAYANWLQS-SSNPIDIIHECYDKYGVSAEYNGY 480
           +EEAIGYMFP M  DKDGVSAA+VFL AY+ WL +  S P DI+ + + K+G   EYNGY
Sbjct: 431 FEEAIGYMFPTMVTDKDGVSAAVVFLLAYSYWLNNDGSYPFDILEKGFKKFGFFKEYNGY 490

Query: 481 YIVSDPSKTDKVFESIRSSYTSMGLSFPESIGEHFRVTEFRDLTIGFDSTTADKKPLLPV 540
           YI  DP  T ++F+ +R  Y + G  +P++IG+ F++  FRDLT G+ S T D  P LPV
Sbjct: 491 YIYDDPKTTKQIFDFVRYQYDTSGNPYPKNIGKEFKIEVFRDLTTGYQSNTIDNLPNLPV 550

Query: 541 DKNSQMITITAVPSGASNTGES-VRFTIRGSGTEPKLKVYIEGISSTEGRARILAKSLWE 599
           D +S+MITI AVP    + G+S VRFT+RGSGTEPKLK+YIE ++  E  A  LA  +W 
Sbjct: 551 DPHSEMITIEAVPK--QDIGKSKVRFTMRGSGTEPKLKLYIEAVADNEKCAIDLAYEMWN 608

Query: 600 TLKHEWFKPSSNGLSTDF 617
            LK EW +P   GL+T F
Sbjct: 609 VLKKEWIRPDVTGLTTTF 626

>Skud_13.450 Chr13 (796030..797898) [1869 bp, 622 aa] {ON} YMR278W
           (REAL)
          Length = 622

 Score =  758 bits (1957), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 368/615 (59%), Positives = 462/615 (75%), Gaps = 4/615 (0%)

Query: 6   IPVELRTAIESWLQLDKNEETRNEVIKLCNDQNWDELHKRFDSRIVFGTAGLRARMEAGT 65
           IP +L+  I  W   D++ ET  EV  LC   +WDELHKRFD+RI FGTAGLR++M+AG 
Sbjct: 9   IPSDLKGPISLWFDQDRDPETIEEVTALCKKSDWDELHKRFDTRIQFGTAGLRSQMQAGF 68

Query: 66  NRLNKLVILQASQGLATYIKDKFPQNLTAVVGHDHRYHSQEFAQVTAATFIRAGFKVYYL 125
           +R+N LVI+QASQGLATYI+ +FP NL AVVGHDHR+HS++FA+ TA  F+  GFKV+YL
Sbjct: 69  SRMNNLVIIQASQGLATYIRQQFPNNLVAVVGHDHRFHSKKFARATATAFLLKGFKVHYL 128

Query: 126 NPHDEFVHTPMVPYSVDHLNASVGVMITASHNPKMDNGYKVYYTNGCQIIPPHDHGIAET 185
           NP  EFVHTP+VP++VD LNASVGVMITASHNPKMDNGYKVYY+NGCQIIPPHD  I+  
Sbjct: 129 NPGQEFVHTPLVPFAVDELNASVGVMITASHNPKMDNGYKVYYSNGCQIIPPHDQAISNA 188

Query: 186 INNNLEPWSTDWNFTKILSNAETDGKIEYVRKRMLTSYLNSVVNQLIQRDFAAPD--EKP 243
           I+ NLEPW+  WNF  ILS     GK+ Y R+ ML  YL  + + L++      +   KP
Sbjct: 189 IDMNLEPWANAWNFDDILSKNLKQGKLMYSREEMLKLYLEKISDNLVETTPLKLEVRSKP 248

Query: 244 WFVYTPMHGVGHQIFSTILNESLNLKDNIDYITVPEQKDPDPSFRTVSFPNPEEKGALNL 303
           WFVYTPMHGVG  IFSTI+ +S+ L +  DY+ VPEQ++PDPSF TV FPNPEEKGALN+
Sbjct: 249 WFVYTPMHGVGFDIFSTIVKKSMCLVEGKDYLCVPEQQNPDPSFPTVGFPNPEEKGALNI 308

Query: 304 AITLAEANGIKLVLANDPNADRFSVAVRDDSKNEWKQLTGNEIGLLFAFYEFKMYQKAAD 363
            + LAE + I L++ANDP+ADRFSVA++D     W+QLTGNEIG LFAF+EF+ ++   +
Sbjct: 309 GMRLAEKHDISLLIANDPDADRFSVAIKDMQSGMWQQLTGNEIGFLFAFFEFEKFKSMDE 368

Query: 364 KGIKNKPLAMLNSTVSAQVIKRMAEKEGFLYKDTLTGFKWIGNEAAKLEEKGYFVPFGYE 423
           +  +  PLAML+STVS+Q+IKRMAE EGF Y+DTLTGFKWIGN A  LE++GY+VPFG+E
Sbjct: 369 QFQQTHPLAMLSSTVSSQMIKRMAEVEGFHYEDTLTGFKWIGNRAIILEKEGYYVPFGFE 428

Query: 424 EAIGYMFPAMEHDKDGVSAAIVFLQAYANW-LQSSSNPIDIIHECYDKYGVSAEYNGYYI 482
           EAIGYMFPAMEHDKDG+SA++VFLQAY  W L ++ +PI+++   + KYGV  EYNGYYI
Sbjct: 429 EAIGYMFPAMEHDKDGISASVVFLQAYCKWKLANNLDPINVLENGFKKYGVFKEYNGYYI 488

Query: 483 VSDPSKTDKVFESIRSSYTSMGLSFPESIGEHFRVTEFRDLTIGFDSTTADKKPLLPVDK 542
           V +P  T ++F+ IR  YT   + +P  IGE  RV  +RDLT G+ S T D KP LPVD 
Sbjct: 489 VPNPIVTKEIFKYIRDVYTPRNVPYPPYIGEEIRVLCYRDLTTGYQSDTLDHKPTLPVDP 548

Query: 543 NSQMITITAVPSGASNTGESVRFTIRGSGTEPKLKVYIEGISSTEGRARILAKSLWETLK 602
            SQMIT+ A P+  SN  E +RFTIRGSGTEPKLKVYIE  ++ E RA  LAK  W+ L+
Sbjct: 549 TSQMITVFARPND-SNGNEHIRFTIRGSGTEPKLKVYIETRANEERRASFLAKLTWDVLR 607

Query: 603 HEWFKPSSNGLSTDF 617
            EWF+P    ++T+F
Sbjct: 608 REWFRPEKTNITTNF 622

>SAKL0D01474g Chr4 complement(117178..119052) [1875 bp, 624 aa] {ON}
           similar to uniprot|Q03262 Saccharomyces cerevisiae
           YMR278W Hypothetical ORF
          Length = 624

 Score =  750 bits (1936), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 359/624 (57%), Positives = 458/624 (73%), Gaps = 11/624 (1%)

Query: 2   STTDIPVELRTAIESWLQLDKNEETRNEVIKLCNDQNWDELHKRFDSRIVFGTAGLRARM 61
           S T +P +L+ ++  WL  DKN ETR+E++ L   ++W+ELH R D RI FGTAGLR+RM
Sbjct: 4   SYTTVPDDLKESVNLWLTYDKNPETRSELLNLVEGKHWEELHGRLDERISFGTAGLRSRM 63

Query: 62  EAGTNRLNKLVILQASQGLATYIKDKFPQNLTAVVGHDHRYHSQEFAQVTAATFIRAGFK 121
           EAG +R+N L +LQASQGLA+YIK +FP+NL+ +VGHDHRYHS EFA+VT   F++ GFK
Sbjct: 64  EAGFSRMNTLTVLQASQGLASYIKSQFPENLSVIVGHDHRYHSNEFARVTVTAFLQLGFK 123

Query: 122 VYYLN-----PHDEFVHTPMVPYSVDHLNASVGVMITASHNPKMDNGYKVYYTNGCQIIP 176
           VYYLN       + FVHTPMVP++++ LNAS G+MITASHNPKMDNGYKVYY+NGCQIIP
Sbjct: 124 VYYLNLSSKDSTETFVHTPMVPFTINQLNASAGIMITASHNPKMDNGYKVYYSNGCQIIP 183

Query: 177 PHDHGIAETINNNLEPWSTDWNFTKILSNAETDGKIEYVRKRMLTSYLNSVVNQLIQRDF 236
           PHD  I+ETI+ NL PW+  W+  +++  A   G +  V++++ + Y+ +V ++L++   
Sbjct: 184 PHDRLISETIDQNLVPWNKAWDCDEVIKTAIESGFLFDVKEKVTSKYIKTVSDELVRVPM 243

Query: 237 AAPDEKPWFVYTPMHGVGHQIFSTILNESLNLKDNIDYITVPEQKDPDPSFRTVSFPNPE 296
              D KPWFVYTPMHGVG +IF  I   +L LK+   Y+ VPEQ+ PDP+F TVSFPNPE
Sbjct: 244 LDCD-KPWFVYTPMHGVGFEIFEQIALLALGLKEGKHYVCVPEQRCPDPAFPTVSFPNPE 302

Query: 297 EKGALNLAITLAEANGIKLVLANDPNADRFSVAVRDDSKNEWKQLTGNEIGLLFAFYEFK 356
           EKGAL+L+I LAE   I+LV+ANDP+ADRFSVAV++  +  W QLTGNEIG LFA+Y+++
Sbjct: 303 EKGALDLSIALAEEQDIRLVIANDPDADRFSVAVKNGDR--WSQLTGNEIGFLFAYYQWQ 360

Query: 357 MYQKAADKGIKNKPLAMLNSTVSAQVIKRMAEKEGFLYKDTLTGFKWIGNEAAKLEEKGY 416
            YQK  +   K  PLAM+NSTVS+Q+IK +AE E F Y+DTLTGFKW+GN A +LE +GY
Sbjct: 361 DYQKLGESFKKQHPLAMINSTVSSQMIKSLAEAEKFHYEDTLTGFKWLGNRAFELETQGY 420

Query: 417 FVPFGYEEAIGYMFPAMEHDKDGVSAAIVFLQAYANWL-QSSSNPIDIIHECYDKYGVSA 475
           +VPF YEEAIGYMFP +EHDKDG+SAA+VFLQ Y  WL +    P+ ++ E + KYGV  
Sbjct: 421 YVPFAYEEAIGYMFPEVEHDKDGISAAVVFLQMYCEWLSKDRMTPLQVLDEGFGKYGVFK 480

Query: 476 EYNGYYIVSDPSKTDKVFESIRSSYTSMGLSFPESIGEHFRVTEFRDLTIGFDSTTADKK 535
           EYNGYYIV   S T +VF+ IR  YT  G ++P +IG  F V  FRDLT G+ S T D  
Sbjct: 481 EYNGYYIVPRLSLTKEVFDYIREDYTPSGHAYPPAIGSEFSVISFRDLTTGYQSDTIDNV 540

Query: 536 PLLPVDKNSQMITITAVPSGA--SNTGESVRFTIRGSGTEPKLKVYIEGISSTEGRARIL 593
           P LPVD +SQMIT T  PS    S +GE VRFTIRGSGTEPKLKVYIE  S+ E RA+ L
Sbjct: 541 PNLPVDASSQMITATLRPSNGKESTSGEQVRFTIRGSGTEPKLKVYIEAKSTDEKRAQHL 600

Query: 594 AKSLWETLKHEWFKPSSNGLSTDF 617
           A+  W+ L+ EWF+P   GL T F
Sbjct: 601 ARETWQVLRREWFRPERTGLETKF 624

>KAFR0B03920 Chr2 (814394..816268) [1875 bp, 624 aa] {ON} Anc_8.840
           YMR278W
          Length = 624

 Score =  746 bits (1927), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 352/616 (57%), Positives = 443/616 (71%), Gaps = 10/616 (1%)

Query: 6   IPVELRTAIESWLQLDKNEETRNEVIKLCNDQNWDELHKRFDSRIVFGTAGLRARMEAGT 65
           +P  L+ + + WL+ D+NEETR+E++ +   ++W EL  R + RI FGTAGLR RMEAG 
Sbjct: 15  VPERLKVSCDRWLRYDQNEETRSEILTIIGRKDWKELGNRLEGRIPFGTAGLRGRMEAGF 74

Query: 66  NRLNKLVILQASQGLATYIKDKFPQNLTAVVGHDHRYHSQEFAQVTAATFIRAGFKVYYL 125
            R+N LVILQ SQGLA YI +KFPQNL+ VVGHDHRYHS+EFA +T ATF+ AGFKV+YL
Sbjct: 75  TRMNSLVILQTSQGLAQYIMEKFPQNLSVVVGHDHRYHSKEFADITVATFLNAGFKVFYL 134

Query: 126 NPHDEFVHTPMVPYSVDHLNASVGVMITASHNPKMDNGYKVYYTNGCQIIPPHDHGIAET 185
           N  +EFVHTP+VPYSVD L ++ GVMITASHNPK DNGYKVYY+NGCQIIPPHD  IA T
Sbjct: 135 NTENEFVHTPLVPYSVDKLRSACGVMITASHNPKDDNGYKVYYSNGCQIIPPHDKNIALT 194

Query: 186 INNNLEPWSTDWNFTKILSNAETDGKIEYVRKRMLTSYLNSVVNQLIQRDFAAP---DEK 242
           I  NL PWS DWN+  + S  E +G +E+   +M  +Y+  +   +      +P     K
Sbjct: 195 IEKNLTPWSKDWNWKDLFSTEERNGNLEFNGNKMFLAYVQDITRYVFTN--GSPMLKTGK 252

Query: 243 PWFVYTPMHGVGHQIFSTILNESLNLKDNIDYITVPEQKDPDPSFRTVSFPNPEEKGALN 302
           PWFVYTPMHGVGH+IF  I  + L L +N+DY +VPEQ  PDPSF TVSFPNPEEKGAL+
Sbjct: 253 PWFVYTPMHGVGHKIFGQIAKQVLGLSENVDYFSVPEQIKPDPSFPTVSFPNPEEKGALD 312

Query: 303 LAITLAEANGIKLVLANDPNADRFSVAVRDDSKNEWKQLTGNEIGLLFAFYEFKMYQKAA 362
           +AI LAE  G+ L++ANDP+ADRFS AV+D   +EW+QL+GNEIG LFA ++    Q+  
Sbjct: 313 MAIQLAEREGLTLIIANDPDADRFSAAVKDKRSHEWRQLSGNEIGSLFAIFKL---QEHK 369

Query: 363 DKGIKNKPLAMLNSTVSAQVIKRMAEKEGFLYKDTLTGFKWIGNEAAKLEEKGYFVPFGY 422
           +K    KPLAMLNSTVS+Q++K+MA+ EGF Y++TLTGFKWIGN A +LE++GY V FGY
Sbjct: 370 EKAASRKPLAMLNSTVSSQMLKKMAQVEGFHYEETLTGFKWIGNRALQLEQQGYDVCFGY 429

Query: 423 EEAIGYMFPAMEHDKDGVSAAIVFLQAYANWLQ-SSSNPIDIIHECYDKYGVSAEYNGYY 481
           EEAIGYMFP MEHDKDG+ A++VFL  Y+ WL+     P+D++  C++KYGV +EYNGYY
Sbjct: 430 EEAIGYMFPCMEHDKDGIIASVVFLHMYSKWLELEGLGPLDVLDLCFEKYGVFSEYNGYY 489

Query: 482 IVSDPSKTDKVFESIRSSYTSMGLSFPESIGEHFRVTEFRDLTIGFDSTTADKKPLLPVD 541
            V +P+  + VF  IR  Y      +PE +G  F +T FRDLT+G+ S T D KP LPVD
Sbjct: 490 TVEEPALIESVFSYIRDEYCPKARPYPEKLGREFFLTSFRDLTLGYQSDTIDFKPTLPVD 549

Query: 542 KNSQMITITAVPSGASNTGESVRFTIRGSGTEPKLKVYIEGISSTEGRARILAKSLWETL 601
            +SQMIT T  P       E +RFTIRGSGTEPKLKVYIE  ++ +  A  LA   W  L
Sbjct: 550 ASSQMITATLKPERTVGH-EEIRFTIRGSGTEPKLKVYIESHAANKEAAANLAHLTWNVL 608

Query: 602 KHEWFKPSSNGLSTDF 617
           + EWF+P   GL T F
Sbjct: 609 RREWFRPEITGLKTSF 624

>TPHA0I00250 Chr9 (46554..48443) [1890 bp, 629 aa] {ON} Anc_8.840
           YMR278W
          Length = 629

 Score =  743 bits (1919), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 362/619 (58%), Positives = 458/619 (73%), Gaps = 7/619 (1%)

Query: 4   TDIPVELRTAIESWLQLDKNEETRNEVIKLCNDQNWDELHKRFDSRIVFGTAGLRARMEA 63
           + IP +L+  I  W + D N+ET +EV +LC +++ DELHKRFD RIVFGTAGLR+RMEA
Sbjct: 13  SSIPEDLKEKIRVWFRYDDNQETVDEVKELCVNKSLDELHKRFDQRIVFGTAGLRSRMEA 72

Query: 64  GTNRLNKLVILQASQGLATYIKDKFPQNLTAVVGHDHRYHSQEFAQVTAATFIRAGFKVY 123
           G NR+N L +LQ++QGLA+YIK +FP NLTAVVGHDHRYHS+EFAQ+TAA F+ AGFKVY
Sbjct: 73  GFNRMNALTVLQSTQGLASYIKSQFPSNLTAVVGHDHRYHSKEFAQITAAVFLNAGFKVY 132

Query: 124 YLNPHDEFVHTPMVPYSVDHLNASVGVMITASHNPKMDNGYKVYYTNGCQIIPPHDHGIA 183
           YLNP+DEFVHTPMVP+ ++  +AS+GVMITASHNP+MDNGYKVYY NGCQIIPPHD  IA
Sbjct: 133 YLNPNDEFVHTPMVPFGINLYSASIGVMITASHNPEMDNGYKVYYNNGCQIIPPHDKNIA 192

Query: 184 ETINNNLEPWSTDWNFTKILSNAETDGKIEYVRKRMLTSYLNSVVNQLIQRDFA----AP 239
           E I  NLEP S +WN   ++S A  + K+ Y ++ +L  Y+ ++   +I ++ +      
Sbjct: 193 ECIEKNLEPLSDNWNTEAVISKAIENVKLIYSKEDVLQQYMLNLDKYIIPKNISLGTTIK 252

Query: 240 DEKPWFVYTPMHGVGHQIFSTILNESLNLKDNIDYITVPEQKDPDPSFRTVSFPNPEEKG 299
            +KPWFVYTPMHGVG+QIF  I +  LNL ++IDY+ V EQ  PDPSF TVSFPNPEEKG
Sbjct: 253 GKKPWFVYTPMHGVGYQIFHRISSTCLNLVEDIDYVCVKEQIVPDPSFPTVSFPNPEEKG 312

Query: 300 ALNLAITLAEANGIKLVLANDPNADRFSVAVRDDSKNEWKQLTGNEIGLLFAFYEFKMYQ 359
           AL+L I  A+ + I LV+ANDP+ADRFSVAVR+   +E++QLTGNEIG LFA++ ++ Y 
Sbjct: 313 ALDLGIKYAKKHNIDLVVANDPDADRFSVAVRNPLTDEFQQLTGNEIGFLFAYFLWEQYS 372

Query: 360 KAADKGIKNKPLAMLNSTVSAQVIKRMAEKEGFLYKDTLTGFKWIGNEAAKLEEKGYFVP 419
                     PLAM+NSTVS+Q+IK+MAE EGF Y+DTLTGFKWIGN+A +LE++GY+VP
Sbjct: 373 MLPADFKDKFPLAMINSTVSSQMIKKMAEVEGFYYEDTLTGFKWIGNKARELEKEGYYVP 432

Query: 420 FGYEEAIGYMFPAMEHDKDGVSAAIVFLQAYANWLQSSSNPI-DIIHECYDKYGVSAEYN 478
           FG+EEAIGYMFP ME DKDG++A +VFLQAY  W  ++   + DII   + KYGV  EYN
Sbjct: 433 FGFEEAIGYMFPKMECDKDGITATVVFLQAYYGWCMNNKQSLFDIIETGFKKYGVFKEYN 492

Query: 479 GYYIVSDPSKTDKVFESIRSSYTSMGLSFPESIGEHFRVTEFRDLTIGFDSTTADKKPLL 538
           GYYIV+D S T  +F++IR +       +   IG  F+V  FRDLT+G+ S T    P L
Sbjct: 493 GYYIVNDLSLTKIIFDNIRENKNDKE-KYVSHIGTEFKVITFRDLTLGYQSDTIGNVPTL 551

Query: 539 PVDKNSQMITITAVPSGASNTGESVRFTIRGSGTEPKLKVYIEGISSTEGRARILAKSLW 598
           PVD +SQMIT+T +P+     G SVRFTIRGSGTEPKLKVYIE  + TE  A  LAK  W
Sbjct: 552 PVDPSSQMITMTIIPTSLPENG-SVRFTIRGSGTEPKLKVYIEANAKTEAEANRLAKLTW 610

Query: 599 ETLKHEWFKPSSNGLSTDF 617
           + LK EWF     GL+T+F
Sbjct: 611 DVLKREWFSSEKTGLTTNF 629

>TDEL0B00570 Chr2 complement(109270..111162) [1893 bp, 630 aa] {ON}
           Anc_8.840 YMR278W
          Length = 630

 Score =  737 bits (1902), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 355/615 (57%), Positives = 446/615 (72%), Gaps = 4/615 (0%)

Query: 6   IPVELRTAIESWLQLDKNEETRNEVIKLCNDQNWDELHKRFDSRIVFGTAGLRARMEAGT 65
           +P +L   + SWL  D N++TR E++ LC  ++W ELHKR D+RI+FGTAGLR+RMEAG 
Sbjct: 17  VPTDLSQLVASWLSQDGNKQTRLEILNLCKAKDWLELHKRLDTRILFGTAGLRSRMEAGF 76

Query: 66  NRLNKLVILQASQGLATYIKDKFPQNLTAVVGHDHRYHSQEFAQVTAATFIRAGFKVYYL 125
           +R+N LV+LQA+QGLA +IK +FP  LTAVVGHDHR++SQEFA  T ATF++AGFKV +L
Sbjct: 77  SRMNTLVVLQATQGLAQHIKKQFPDALTAVVGHDHRFNSQEFALATVATFLQAGFKVIFL 136

Query: 126 NPHDEFVHTPMVPYSVDHLNASVGVMITASHNPKMDNGYKVYYTNGCQIIPPHDHGIAET 185
           N  D+FVHTP+VP++V+ + ASVGVMITASHNPKMDNGYKVYY+NGCQIIPPHD  IA++
Sbjct: 137 NDGDKFVHTPIVPFTVNEVGASVGVMITASHNPKMDNGYKVYYSNGCQIIPPHDSEIAQS 196

Query: 186 INNNLEPWSTDWNFTKILSNAETDGKIEYVRKRMLTSYLNSVVNQLIQRDF--AAPDEKP 243
           I  NL  W   W + ++L        + Y  + M+  Y   +   L+ R    A  + KP
Sbjct: 197 IEENLTLWPKAWKWDELLKEGLDTKCLVYAGEEMIERYTKKMGQSLVDRTTISAEKEGKP 256

Query: 244 WFVYTPMHGVGHQIFSTILNESLNLKDNIDYITVPEQKDPDPSFRTVSFPNPEEKGALNL 303
           WFVYTP+HGVG+ IF  I  E++NL +  DY+ V EQ+ PDPSF TV FPNPEEKGAL++
Sbjct: 257 WFVYTPIHGVGYDIFRQIAEETMNLINGRDYLCVKEQQLPDPSFPTVPFPNPEEKGALDM 316

Query: 304 AITLAEANGIKLVLANDPNADRFSVAVRDDSKNEWKQLTGNEIGLLFAFYEFKMYQKAAD 363
           AI++A+ NGI LVLANDP+ADRFS AV+D+    W+QLTGNEIG LFAFYEF+ YQK  +
Sbjct: 317 AISVADKNGISLVLANDPDADRFSAAVKDNKTGTWRQLTGNEIGALFAFYEFQKYQKKNE 376

Query: 364 KGIKNKPLAMLNSTVSAQVIKRMAEKEGFLYKDTLTGFKWIGNEAAKLEEKGYFVPFGYE 423
           +  +  PLAMLNSTVS+Q+I +MAE E F Y DTLTGFKWIGN    LE   Y+VPFG+E
Sbjct: 377 EYKEKHPLAMLNSTVSSQLIMKMAEIEQFHYIDTLTGFKWIGNRTLDLEAMNYYVPFGFE 436

Query: 424 EAIGYMFPAMEHDKDGVSAAIVFLQAYANWLQSSSNP-IDIIHECYDKYGVSAEYNGYYI 482
           EAIGYMFP MEHDKDG+SAA VFLQ Y  WL  S    + ++ + ++KYGV  EYNGYY 
Sbjct: 437 EAIGYMFPVMEHDKDGISAASVFLQMYRKWLVGSKKTLLTVLEDIFEKYGVFKEYNGYYS 496

Query: 483 VSDPSKTDKVFESIRSSYTSMGLSFPESIGEHFRVTEFRDLTIGFDSTTADKKPLLPVDK 542
           V+DP    +VF+ IR+ Y+     +P  IGE  +V +FRDLT+G+ S T +++P LPVD 
Sbjct: 497 VNDPKVIKEVFDFIRNDYSETHDPYPSRIGEELKVNKFRDLTLGYQSDTVNQRPDLPVDP 556

Query: 543 NSQMITITAVPSGASNTGESVRFTIRGSGTEPKLKVYIEGISSTEGRARILAKSLWETLK 602
           NSQMIT     +GA    ESVRFTIRGSGTEPKLKVYIE  S +E RA  LA+  W  LK
Sbjct: 557 NSQMITAWTKVNGAKPY-ESVRFTIRGSGTEPKLKVYIEACSKSEERASELAQLTWRVLK 615

Query: 603 HEWFKPSSNGLSTDF 617
            EWF+P   GL+T F
Sbjct: 616 REWFRPDVTGLTTTF 630

>Kpol_1068.8 s1068 complement(13542..15440) [1899 bp, 632 aa] {ON}
           complement(13542..15440) [1899 nt, 633 aa]
          Length = 632

 Score =  736 bits (1901), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 358/621 (57%), Positives = 453/621 (72%), Gaps = 12/621 (1%)

Query: 6   IPVELRTAIESWLQLDKNEETRNEVIKLCNDQNWDELHKRFDSRIVFGTAGLRARMEAGT 65
           +PV+LR  + +WL  DKN ET NEVI+LC   + +ELHKRFD+RI+FGTAGLR++MEAG 
Sbjct: 15  LPVDLRDKVGTWLAQDKNPETINEVIRLCKANSLNELHKRFDNRILFGTAGLRSKMEAGF 74

Query: 66  NRLNKLVILQASQGLATYIKDKFPQNLTAVVGHDHRYHSQEFAQVTAATFIRAGFKVYYL 125
           +R+N LV+LQA+QGLATYIK +FP NL AV+GHDHRYHS+EFA++  + F+ AGF VY L
Sbjct: 75  SRMNTLVVLQATQGLATYIKQQFPSNLKAVIGHDHRYHSKEFAEIATSVFLSAGFTVYNL 134

Query: 126 NPHDEFVHTPMVPYSVDHLNASVGVMITASHNPKMDNGYKVYYTNGCQIIPPHDHGIAET 185
           NP   FVHTP+VP++VD + ASVGVMITASHNPKMDNGYKVYY+NGCQIIPP D  IA+ 
Sbjct: 135 NPPGTFVHTPLVPFTVDQIGASVGVMITASHNPKMDNGYKVYYSNGCQIIPPVDASIAKC 194

Query: 186 INNNLEPWSTDWNFTKILSNAETDGKIEYVRKRMLTSYLNSVVNQLIQ----RDFAAPDE 241
           I+ NLEPWS  W+ +K +    ++ K+ Y+R  ML +Y + V N +I     R+F   DE
Sbjct: 195 IDENLEPWSNSWDSSKAIEAGLSNKKLIYLRNEMLLAYSDKVDNNIIDKKTIREF---DE 251

Query: 242 --KPWFVYTPMHGVGHQIFSTILNESLNLKDNIDYITVPEQKDPDPSFRTVSFPNPEEKG 299
             KPWFVYTPMHGVG++IF++++ E +NLK+N DY+TV EQ  PDP+F T+SFPNPEEKG
Sbjct: 252 HRKPWFVYTPMHGVGYEIFTSLVLEKVNLKENRDYLTVKEQIVPDPAFPTISFPNPEEKG 311

Query: 300 ALNLAITLAEANGIKLVLANDPNADRFSVAVRDDSKNEWKQLTGNEIGLLFAFYEFKMYQ 359
           AL++AI LA+ N I LV+ANDP+ADRFS A+ +    EW+QLTGNEIG LF +Y F  Y 
Sbjct: 312 ALDMAIALAKENDISLVIANDPDADRFSAAIYNSHSGEWQQLTGNEIGFLFGYYLFNKYT 371

Query: 360 KAADKGIKNKPLAMLNSTVSAQVIKRMAEKEGFLYKDTLTGFKWIGNEAAKLEEKGYFVP 419
               +  KN PLAMLNSTVS++++K MA+ E F + DTLTGFKWIGN+A  L+++GY V 
Sbjct: 372 NMDPEFKKNHPLAMLNSTVSSRMLKSMADTENFKFIDTLTGFKWIGNKAIDLKKEGYHVV 431

Query: 420 FGYEEAIGYMFPAMEHDKDGVSAAIVFLQAYANWLQ-SSSNPIDIIHECYDKYGVSAEYN 478
           FGYEEAIGYMFPAMEHDKDG++A++VFLQAY  W   S    IDI+ +  +KYG   EYN
Sbjct: 432 FGYEEAIGYMFPAMEHDKDGITASVVFLQAYFEWDNLSKVTVIDILEQGIEKYGAFKEYN 491

Query: 479 GYYIVSDPSKTDKVFESIRSSYTSMGLSFPESIGEHFRVTEFRDLTIGFDSTTADKKPLL 538
           GYY+VS+P  T+ +F  IR+ Y   G  +P+ IG    V  FRDLT GF S T D  P L
Sbjct: 492 GYYVVSNPQVTNDIFHYIRNEYPKNGNQYPKMIGTLLEVCSFRDLTTGFQSDTVDNIPSL 551

Query: 539 PVDKNSQMITITA--VPSGASNTGESVRFTIRGSGTEPKLKVYIEGISSTEGRARILAKS 596
           PVD +SQMITITA         +   VRFT+RGSGTEPKLK+YIEG S     A  +AK 
Sbjct: 552 PVDPSSQMITITAKICDDEYQKSDSIVRFTMRGSGTEPKLKLYIEGHSKDPIAASKIAKL 611

Query: 597 LWETLKHEWFKPSSNGLSTDF 617
            W+ LK EW +P   G++T +
Sbjct: 612 TWDVLKKEWIRPEVTGVTTSY 632

>ZYRO0G14190g Chr7 (1131206..1133038) [1833 bp, 610 aa] {ON} similar
           to uniprot|Q03262 Saccharomyces cerevisiae YMR278W
           Hypothetical ORF
          Length = 610

 Score =  735 bits (1897), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 351/615 (57%), Positives = 458/615 (74%), Gaps = 6/615 (0%)

Query: 3   TTDIPVELRTAIESWLQLDKNEETRNEVIKLCNDQNWDELHKRFDSRIVFGTAGLRARME 62
           +++IP  L+  I  WL  D+NE+T  E+ +LC+ +NW ELH+R +SR+ FGTAGLRARME
Sbjct: 2   SSNIPENLKQPISLWLAQDRNEKTCKEIAELCDAENWSELHERLNSRLQFGTAGLRARME 61

Query: 63  AGTNRLNKLVILQASQGLATYIKDKFPQNLTAVVGHDHRYHSQEFAQVTAATFIRAGFKV 122
           AG +R+N LV++QA+QGLA YIK +FP +L AVVGHDHR++S +FA+ TA   ++AGF+V
Sbjct: 62  AGFSRMNTLVVIQATQGLAQYIKKQFPDHLVAVVGHDHRFNSMDFAKATATVLLKAGFEV 121

Query: 123 YYLNPHDEFVHTPMVPYSVDHLNASVGVMITASHNPKMDNGYKVYYTNGCQIIPPHDHGI 182
           +YLN  D +VHTPMVP++VD + ASVGVMITASHNPK+DNGYKVYY NGCQIIPPHD  I
Sbjct: 122 HYLNQGDSYVHTPMVPFTVDRVKASVGVMITASHNPKLDNGYKVYYANGCQIIPPHDSAI 181

Query: 183 AETINNNLEPWSTDWNFTKILSNAETDGKIEYVRKRMLTSYLNSVVNQLIQRDFAAPDEK 242
           A +I +NLEP +  W++ + +  A  +GK+ Y R +ML  Y++ V +  +    + P  K
Sbjct: 182 ARSIESNLEPGNGVWDWDQTMQQAADEGKLIYGRDKMLEQYISCVKDSFVTELDSLPKGK 241

Query: 243 PWFVYTPMHGVGHQIFSTILNESLNLKDNIDYITVPEQKDPDPSFRTVSFPNPEEKGALN 302
           PWFVYTPMHGVG+Q+F  I ++ L L+ N D++ V EQ +PDP F TV FPNPEEKGAL+
Sbjct: 242 PWFVYTPMHGVGYQVFDQIASKILQLEVNRDFLVVSEQLNPDPEFPTVQFPNPEEKGALD 301

Query: 303 LAITLAEANGIKLVLANDPNADRFSVAVRDDSKNEWKQLTGNEIGLLFAFYEFKMYQKAA 362
           LAI LAE +GIKLV+A+DP+ADRFSVA +    + W+QL+GN+IG LFA+YE + Y+   
Sbjct: 302 LAIKLAENHGIKLVIASDPDADRFSVAFK--GPHGWQQLSGNDIGFLFAYYELQKYRGFD 359

Query: 363 DKGIKNKPLAMLNSTVSAQVIKRMAEKEGFLYKDTLTGFKWIGNEAAKLEEKGYFVPFGY 422
            +  K+ PLAMLNSTVS+Q+I  MA  EGF ++DTLTGFKWIGN A +LE +GY+VPFG+
Sbjct: 360 AEYQKSHPLAMLNSTVSSQMINSMAALEGFHHEDTLTGFKWIGNRALELEARGYYVPFGF 419

Query: 423 EEAIGYMFPAMEHDKDGVSAAIVFLQAYANWLQSSSNPIDIIHECYDKYGVSAEYNGYYI 482
           EEAIGYMFPA EHDKDG+SAA+VFLQAY +W+    +P+DI+ E   KYGV  EYNGYY+
Sbjct: 420 EEAIGYMFPATEHDKDGISAAVVFLQAYHSWISQGKSPLDILDEASAKYGVFREYNGYYL 479

Query: 483 VSDPSKTDKVFESIRSSYTSMGLSFPESIGEHFRVTEFRDLTIGFDSTTADKKPLLPVDK 542
           V +PS T+K F  IR  YT  G ++P +IG+  +V  FRDLT G+ S T +  P L VD 
Sbjct: 480 VDEPSLTNKTFAYIREDYTPKGENYPRTIGD-LQVKTFRDLTTGYQSDTPNNIPNLHVDP 538

Query: 543 NSQMITITAVPSGASNTGESVRFTIRGSGTEPKLKVYIEGISSTEGRARILAKSLWETLK 602
           +SQMITI A P G   +GE VRFT+RGSGTEPKLKVYIE  + ++ RAR LA+  W+ L+
Sbjct: 539 SSQMITIVAQPKGGG-SGEHVRFTLRGSGTEPKLKVYIEAGAQSDPRARELARQTWDILR 597

Query: 603 HEWFKPSSNGLSTDF 617
            EWF  +  GL+T F
Sbjct: 598 EEWF--NRPGLTTKF 610

>Kwal_27.10258 s27 complement(265612..267474) [1863 bp, 620 aa] {ON}
           YMR278W - Hypothetical ORF [contig 37] FULL
          Length = 620

 Score =  726 bits (1874), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 352/622 (56%), Positives = 443/622 (71%), Gaps = 15/622 (2%)

Query: 4   TDIPVELRTAIESWLQLDKNEETRNEVIKLCNDQNWDELHKRFDSRIVFGTAGLRARMEA 63
            +IP +L++++ESW + DKNEETRNE+++L  +QNW+ELHKR D RI FGTAGLR++MEA
Sbjct: 6   VEIPADLKSSVESWFEHDKNEETRNEILQLVTEQNWNELHKRLDQRISFGTAGLRSKMEA 65

Query: 64  GTNRLNKLVILQASQGLATYIKDKFPQNLTAVVGHDHRYHSQEFAQVTAATFIRAGFKVY 123
           G +R+N L +LQASQGLA YI +KFP+N T  VGHDHR++S++FA+VT+  F++  FKVY
Sbjct: 66  GFSRMNTLTVLQASQGLAKYIAEKFPENKTVAVGHDHRFNSRDFAEVTSVAFLQLRFKVY 125

Query: 124 YLN-----PHDEFVHTPMVPYSVDHLNASVGVMITASHNPKMDNGYKVYYTNGCQIIPPH 178
            L        D FVHTPMVP+++D L AS GVMITASHNPKMDNGYKVYY+NGCQIIPPH
Sbjct: 126 SLGFNADPKKDAFVHTPMVPFAIDRLGASAGVMITASHNPKMDNGYKVYYSNGCQIIPPH 185

Query: 179 DHGIAETINNNLEPWSTDWNFTKILSNAETDGKIEYVRKRMLTSYLNSVVNQLIQRDFAA 238
           D  IA++I +NL PW   W+   +++ A   G    ++K M+  Y+  + ++L+  D   
Sbjct: 186 DRLIAQSILDNLNPWERAWDCKAVIAEATEKGYFVDMKKPMVDHYVKEISDKLVSSDIG- 244

Query: 239 PDEKPWFVYTPMHGVGHQIFSTILNESLNLKDNIDYITVPEQKDPDPSFRTVSFPNPEEK 298
              KPWFVYTP+HGVG +IF  I +E L L +  DY  V E K PDP+F TVSFPNPEE 
Sbjct: 245 DRSKPWFVYTPLHGVGFEIFERIASEVLGLVEGRDYWCVSEHKQPDPAFPTVSFPNPEEA 304

Query: 299 GALNLAITLAEANGIKLVLANDPNADRFSVAVRDDSKNEWKQLTGNEIGLLFAFYEFKMY 358
           GAL+LAI LA+ NGI  VL NDP+ADRFS AV+   K  W+QLTGNEIG LFA + ++ Y
Sbjct: 305 GALDLAIALADKNGISFVLGNDPDADRFSAAVKHQGK--WRQLTGNEIGFLFAQFVWEKY 362

Query: 359 QKAADKGIKNKPLAMLNSTVSAQVIKRMAEKEGFLYKDTLTGFKWIGNEAAKLEEKGYFV 418
           QK + +     PLA++NSTVS+Q+IK++A  E F Y+DTLTGFKW+GN A +LE  GY+V
Sbjct: 363 QKESSEFKLENPLALINSTVSSQMIKKLAGVEKFHYEDTLTGFKWLGNRARQLESSGYYV 422

Query: 419 PFGYEEAIGYMFPAMEHDKDGVSAAIVFLQAYANWLQSSSNPIDIIHECYDKYGVSAEYN 478
           PF YEEAIG+MF  + HDKDGVSAA+VFLQ   +W + + +PID++   + KYGV  EYN
Sbjct: 423 PFAYEEAIGFMFSDIVHDKDGVSAAVVFLQMLWSWKKQALSPIDVLQSAFGKYGVFKEYN 482

Query: 479 GYYIVSDPSKTDKVFESIRSSYTSMGLSFPESIGEHFRVTEFRDLTIGFDSTTADKKPLL 538
           GYY V D S TD++F  IRSSY     S+P+ IG  F V  F DLT GF S TAD  P L
Sbjct: 483 GYYTVPDLSLTDRIFSDIRSSYD----SYPKHIGNQFDVVSFTDLTKGFQSDTADNTPRL 538

Query: 539 PVDKNSQMITITAVPSGASNTG---ESVRFTIRGSGTEPKLKVYIEGISSTEGRARILAK 595
           PVD +SQMI  T VPS +  +G   E VRFT RGSGTEPKLKVYIE  S  E RA  LA+
Sbjct: 539 PVDPSSQMIQATLVPSTSGGSGAPLEIVRFTARGSGTEPKLKVYIEATSVEETRASDLAR 598

Query: 596 SLWETLKHEWFKPSSNGLSTDF 617
           + W  L+ EWFKP   GLST F
Sbjct: 599 TTWNVLRDEWFKPKETGLSTKF 620

>TBLA0B03250 Chr2 (757928..759859) [1932 bp, 643 aa] {ON} Anc_8.840
           YMR278W
          Length = 643

 Score =  716 bits (1848), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 355/636 (55%), Positives = 452/636 (71%), Gaps = 28/636 (4%)

Query: 5   DIPVELRTAIESWLQLDKNEETRNEVIKLCNDQNWDELHKRFDSRIVFGTAGLRARMEAG 64
           D P +L+  +  WL+ DK++ TR E+I LC   N  ELH+RFDSRI FGTAGLR+ MEAG
Sbjct: 13  DYPEDLQKKVLLWLEQDKDDSTRKEIIDLCKSANVKELHERFDSRITFGTAGLRSTMEAG 72

Query: 65  TNRLNKLVILQASQGLATYIKDKFP---QNLTAVVGHDHRYHSQEFAQVTAATFIRAGFK 121
            +R+N L +LQASQGLATY+K+      Q L AV+GHDHRYHS+EFA++ A  F+ AGFK
Sbjct: 73  FSRMNTLTVLQASQGLATYMKNDAKNTGQKLIAVIGHDHRYHSKEFAKIAATVFLIAGFK 132

Query: 122 VYYLN------PHD-EFVHTPMVPYSVDHLNASVGVMITASHNPKMDNGYKVYYTNGCQI 174
           VYYLN      P D +FVHTPMVP++V +L ASVGVM+TASHNPKMDNGYKVYY+NGCQI
Sbjct: 133 VYYLNDDSLEDPRDNKFVHTPMVPFTVKNLKASVGVMVTASHNPKMDNGYKVYYSNGCQI 192

Query: 175 IPPHDHGIAETINNNLEPWSTDWNFTKILSNAETDGKIEYVRKRMLTSYLNSVVNQLIQR 234
           IPPHD GI++ I+ NLEPW   WN+ +I++NAE+ G + Y R  ML  Y+  +  +L  +
Sbjct: 193 IPPHDSGISQCIDANLEPWENSWNYKEIMANAESKGDLIYHRDVMLNDYITQLEEKLTSK 252

Query: 235 DFAAPDE------KPWFVYTPMHGVGHQIFSTILNESLNLKDNIDYITVPEQKDPDPSFR 288
           D     +      KPWFVYTPMHGVG++IF+ I NE L++K+  D+I V EQK PDP F 
Sbjct: 253 DIIHLSKKIDVKSKPWFVYTPMHGVGYEIFTKISNEILHMKEGEDFIVVEEQKHPDPGFP 312

Query: 289 TVSFPNPEEKGALNLAITLAEANGIKLVLANDPNADRFSVAVRDD-SKNEWKQLTGNEIG 347
           TVSFPNPEEKGA+++ I LAE NGI LV+ANDP+ADRFS+AV+   S+  W Q TGNEIG
Sbjct: 313 TVSFPNPEEKGAIDMGIKLAEDNGISLVIANDPDADRFSIAVKSKGSQGTWHQFTGNEIG 372

Query: 348 LLFAFYEFKMYQKAADKGIKNKPLAMLNSTVSAQVIKRMAEKEGFLYKDTLTGFKWIGNE 407
            LFA++EF+ Y K + + +    L M+NSTVS+Q+IK+MAE EGF Y++TLTGFKWIGN 
Sbjct: 373 YLFAYFEFQKY-KISKQDLHR--LYMVNSTVSSQMIKKMAEIEGFNYEETLTGFKWIGNR 429

Query: 408 AAKLEEKGYFVPFGYEEAIGYMFPAMEHDKDGVSAAIVFLQAYANWLQ-SSSNPIDIIHE 466
           A  L  KG  VPFGYEEAIGYMFP ME DKDG++A ++F+QA+  W Q    +P +II  
Sbjct: 430 AIDLINKGNIVPFGYEEAIGYMFPTMEIDKDGIAATVIFIQAFMYWNQIDKMDPYEIIQL 489

Query: 467 CYDKYGVSAEYNGYYIVSDPSKTDKVFESIRSSYTSMGLS-----FPESIGEHFRVTEFR 521
            + KYGV  EYNGYY  +D   T K+F+ +R  Y   G+S     +P+ IGE F++ ++R
Sbjct: 490 GFKKYGVFIEYNGYYRYTDLGITKKIFDYVRYDYDK-GVSEGNKKYPDHIGEEFKIIKYR 548

Query: 522 DLTIGFDSTTADKKPLLPVDKNSQMITITAVPSGASNTGESVRFTIRGSGTEPKLKVYIE 581
           DLT G+ S T D KPLLPVD +SQMIT+  +P+   + G S+R TIRGSGTEPKLKVYIE
Sbjct: 549 DLTTGYQSDTPDNKPLLPVDPSSQMITVEMIPTDNESDG-SIRLTIRGSGTEPKLKVYIE 607

Query: 582 GISSTEGRARILAKSLWETLKHEWFKPSSNGLSTDF 617
             S +   A  LAK  W  LK EW +P   G++T F
Sbjct: 608 ACSRSATEASFLAKQAWNVLKREWMRPEQTGITTAF 643

>KLTH0C03872g Chr3 complement(337765..339630) [1866 bp, 621 aa] {ON}
           similar to uniprot|Q03262 Saccharomyces cerevisiae
           YMR278W Hypothetical ORF
          Length = 621

 Score =  715 bits (1845), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 347/625 (55%), Positives = 440/625 (70%), Gaps = 15/625 (2%)

Query: 1   MSTTDIPVELRTAIESWLQLDKNEETRNEVIKLCNDQNWDELHKRFDSRIVFGTAGLRAR 60
           ++  ++P +L+  +E+WL+ DKNE+TR+++IKL  D++W EL  R + RI FGTAGLR+R
Sbjct: 4   LTNAEVPEDLKLGVEAWLKYDKNEQTRDQIIKLVEDKSWTELRNRLNFRITFGTAGLRSR 63

Query: 61  MEAGTNRLNKLVILQASQGLATYIKDKFPQNLTAVVGHDHRYHSQEFAQVTAATFIRAGF 120
           MEAG NR+N L +LQASQGLA YI   FP NL+ VVGHDHR++S++FA+VT   F++ GF
Sbjct: 64  MEAGFNRMNTLTVLQASQGLAKYIASNFPDNLSVVVGHDHRFNSKDFAEVTIVAFLQLGF 123

Query: 121 KVYYLN-----PHDEFVHTPMVPYSVDHLNASVGVMITASHNPKMDNGYKVYYTNGCQII 175
           KVY L        D  VHTPMVP+ +DHL AS G+MITASHNPKMDNGYKVYY+NGCQII
Sbjct: 124 KVYDLGFTEDASQDVVVHTPMVPFGIDHLRASGGIMITASHNPKMDNGYKVYYSNGCQII 183

Query: 176 PPHDHGIAETINNNLEPWSTDWNFTKILSNAETDGKIEYVRKRMLTSYLNSVVNQLIQRD 235
           PPHD  I+++I  NLEPW   W+   + + A     +   +K ++  Y+++V   L+  +
Sbjct: 184 PPHDQRISQSILANLEPWDRAWDCAAVKAEAVQSEMLIDAKKVLVDQYVDTVRRSLVITN 243

Query: 236 FAAPDEKPWFVYTPMHGVGHQIFSTILNESLNLKDNIDYITVPEQKDPDPSFRTVSFPNP 295
                + PWFVYTP+HGVG +IF  IL+ +  L    DY+ V EQK PDP+F TVSFPNP
Sbjct: 244 -VNHTKAPWFVYTPLHGVGFEIFEKILSSAWRLGQGRDYLCVEEQKYPDPNFPTVSFPNP 302

Query: 296 EEKGALNLAITLAEANGIKLVLANDPNADRFSVAVRDDSKNEWKQLTGNEIGLLFAFYEF 355
           EEKGAL+ AI LAE + I  VL NDP+ADRFSVA + +   +W+QLTGNEIG LFA Y++
Sbjct: 303 EEKGALDKAIELAEKHDITFVLGNDPDADRFSVAAKHN--GQWRQLTGNEIGFLFAQYKW 360

Query: 356 KMYQKAADKGIKNKPLAMLNSTVSAQVIKRMAEKEGFLYKDTLTGFKWIGNEAAKLEEKG 415
           + Y+  +DK     PLAM+NSTVS+Q+IK+MAE EGF Y+DTLTGFKW+GN A +LE  G
Sbjct: 361 ETYRLESDKFKGTNPLAMINSTVSSQMIKKMAEVEGFHYEDTLTGFKWLGNRARELENAG 420

Query: 416 YFVPFGYEEAIGYMFPAMEHDKDGVSAAIVFLQAYANWLQSSSNPIDIIHECYDKYGVSA 475
           YFVPF YEEAIGYMF  + HDKDG+SAA+VFLQ   +W   +  P D++   Y KYGV  
Sbjct: 421 YFVPFAYEEAIGYMFSDVVHDKDGISAAVVFLQMLWSWKAQALTPFDVLQRAYQKYGVFK 480

Query: 476 EYNGYYIVSDPSKTDKVFESIRSSYTSMGLSFPESIGEHFRVTEFRDLTIGFDSTTADKK 535
           EYNGYYIV D S TDKVF  IRS ++      P  IG+ FRV  + DLT G+ S T D +
Sbjct: 481 EYNGYYIVPDLSLTDKVFSGIRSGFSLQ----PTHIGQEFRVESYTDLTTGYQSNTPDSE 536

Query: 536 PLLPVDKNSQMITITAVP---SGASNTGESVRFTIRGSGTEPKLKVYIEGISSTEGRARI 592
           P LPVD +SQMIT T  P   +G     ESVRFT RGSGTEPKLKVYIE +SS+E  A  
Sbjct: 537 PRLPVDPSSQMITATLTPTSSTGRQGFSESVRFTARGSGTEPKLKVYIEAVSSSEELASA 596

Query: 593 LAKSLWETLKHEWFKPSSNGLSTDF 617
           LAK  W+ L+ EWFKP   GL+T+F
Sbjct: 597 LAKKAWDVLRREWFKPEQTGLATNF 621

>ABL126W Chr2 (159207..161081) [1875 bp, 624 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR278W
          Length = 624

 Score =  692 bits (1787), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 333/625 (53%), Positives = 432/625 (69%), Gaps = 13/625 (2%)

Query: 2   STTDIPVELRTAIESWLQLDKNEETRNEVIKLCNDQNWDELHKRFDSRIVFGTAGLRARM 61
           +T  +P  L+ ++  WL  DKN ET++E+ +L ++  WDEL KR   RI FGTAGLRARM
Sbjct: 4   NTDAVPSSLKDSLMEWLTFDKNSETQHEICELVSNHQWDELRKRLLPRITFGTAGLRARM 63

Query: 62  EAGTNRLNKLVILQASQGLATYIKDKFPQNLTAVVGHDHRYHSQEFAQVTAATFIRAGFK 121
           EAG +R+N L ++QASQGLA YIK +FP +L  V+GHDHR+HS+EFA+ T A F++  + 
Sbjct: 64  EAGFSRMNTLTVIQASQGLARYIKSQFPDDLKVVIGHDHRFHSREFAEATIAAFLQLDYD 123

Query: 122 VYYLN------PHDEFVHTPMVPYSVDHLNA---SVGVMITASHNPKMDNGYKVYYTNGC 172
           +YYLN        D FVHTPMVP++++++     S GVMITASHNPKMDNGYKVYY NGC
Sbjct: 124 IYYLNYVPPGSDEDVFVHTPMVPFAINNVEGGPTSCGVMITASHNPKMDNGYKVYYANGC 183

Query: 173 QIIPPHDHGIAETINNNLEPWSTDWNFTKILSNAETDGKIEYVRKRMLTSYLNSVVNQLI 232
           QIIPPHD  I   I+ NLEPW+  W+   ++  A   GK+  VRK ML  Y +S+   L+
Sbjct: 184 QIIPPHDELIGRHIDANLEPWTRAWDSKALIEEAIKSGKLHDVRKEMLQKYKDSIQTMLV 243

Query: 233 QRDFAAPDEKPWFVYTPMHGVGHQIFSTILNESLNLKDNIDYITVPEQKDPDPSFRTVSF 292
           ++        PWFVYTPMHGVG++ F   +   L ++++ DYI VPEQK PDP F TVSF
Sbjct: 244 KQSNLKFAGGPWFVYTPMHGVGYEFFKEAVASVLGIEEDKDYIVVPEQKYPDPEFPTVSF 303

Query: 293 PNPEEKGALNLAITLAEANGIKLVLANDPNADRFSVAVRDDSKNEWKQLTGNEIGLLFAF 352
           PNPEE+GAL++A+ +A+ANGI +VLANDP+ADRFSVAV+     EW QLTGN+IG+LFA 
Sbjct: 304 PNPEERGALDMAMKVADANGITVVLANDPDADRFSVAVK--YHGEWNQLTGNQIGILFAQ 361

Query: 353 YEFKMYQKAADKGIKNKPLAMLNSTVSAQVIKRMAEKEGFLYKDTLTGFKWIGNEAAKLE 412
            E + Y K  +  +  K LAML S VS+Q++++MAE+EGFL  +TLTGFKW+GN A +LE
Sbjct: 362 AEMQSYFK--EPKLDRKQLAMLTSAVSSQLLRKMAEEEGFLAVETLTGFKWLGNRARELE 419

Query: 413 EKGYFVPFGYEEAIGYMFPAMEHDKDGVSAAIVFLQAYANWLQSSSNPIDIIHECYDKYG 472
            +GY+VPF YEEAIGYMF  + HDKDG++AA VFLQ    W + + +  +++ ECY+KYG
Sbjct: 420 LEGYYVPFAYEEAIGYMFSQVVHDKDGIAAAAVFLQMCYEWKKVAKSSQEVLQECYEKYG 479

Query: 473 VSAEYNGYYIVSDPSKTDKVFESIRSSYTSMGLSFPESIGEHFRVTEFRDLTIGFDSTTA 532
              +YNGYYI S P+ T +VF+  R+ YT  G  +P  IG  F V   RDLT+G+ S TA
Sbjct: 480 YFVDYNGYYISSAPAVTKEVFDYFRNEYTPAGKPYPSHIGCEFEVEYLRDLTVGYQSDTA 539

Query: 533 DKKPLLPVDKNSQMITITAVPSGASNTGESVRFTIRGSGTEPKLKVYIEGISSTEGRARI 592
              P LPVD NSQMIT    P       ESVRFT RGSGTEPKLKVYIE  ++   RA  
Sbjct: 540 TNIPDLPVDHNSQMITCVLKPVKMETDCESVRFTARGSGTEPKLKVYIESCAANHQRASH 599

Query: 593 LAKSLWETLKHEWFKPSSNGLSTDF 617
           L+   W+ LK EWF+P+  GL T+F
Sbjct: 600 LSHLAWDVLKREWFRPTETGLQTNF 624

>KLLA0D01573g Chr4 complement(139183..141006) [1824 bp, 607 aa] {ON}
           similar to uniprot|Q03262 Saccharomyces cerevisiae
           YMR278W Hypothetical ORF
          Length = 607

 Score =  671 bits (1732), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 341/627 (54%), Positives = 440/627 (70%), Gaps = 31/627 (4%)

Query: 1   MSTTDI----PVELRTAIESWLQLDKNEETRNEVIKLCNDQNWDELHKRFDSRIVFGTAG 56
           MS T++    P +L+  + +WL+ DK EETRNE+++LC   +  ELHKR D+ I FGTAG
Sbjct: 1   MSETEVIESLPSDLQGKVRNWLKYDKVEETRNEILQLCLKGDITELHKRLDTMIAFGTAG 60

Query: 57  LRARMEAGTNRLNKLVILQASQGLATYIKDKFPQNLTAVVGHDHRYHSQEFAQVTAATFI 116
           LR RMEAG NR+N L + QASQGLA YIK +FP+NLT VVGHDHR++S+ F +VT  TF+
Sbjct: 61  LRGRMEAGFNRMNALTVKQASQGLAKYIKKQFPENLTVVVGHDHRHNSRLFGKVTVDTFL 120

Query: 117 RAGFKVYYLNPHDE--FVHTPMVPYSVDHLNASVGVMITASHNPKMDNGYKVYYTNGCQI 174
           + GFKV++LN  +E   VHTP+VP++V+   ASVG+MITASHNPKMDNGYKVYYTNGCQI
Sbjct: 121 QLGFKVFHLNHENEKSLVHTPLVPFTVNATGASVGIMITASHNPKMDNGYKVYYTNGCQI 180

Query: 175 IPPHDHGIAETINNNLEPWSTDWNFTKILSNAETDGKIEYVRKRMLTSYLNSVVNQLIQR 234
           IPPHD  IAE+I +NLEP+S+              G I   +++M   Y++++ + LI  
Sbjct: 181 IPPHDKLIAESIIHNLEPFSSPQT-----------GTIIDCKEKMTKKYIDAIGSTLIDG 229

Query: 235 DFAAPDEKPWFVYTPMHGVGHQIFSTILNESLNLKDNIDYITVPEQKDPDPSFRTVSFPN 294
                  +PWFVYTPMHGVG +IF +I  + L+L++  DY+ V EQK PD  F TVSFPN
Sbjct: 230 AVNKKTNEPWFVYTPMHGVGFEIFESISKQLLSLEEGKDYLVVEEQKYPDADFPTVSFPN 289

Query: 295 PEEKGALNLAITLAEANG-IKLVLANDPNADRFSVAVRDDSKN---EWKQLTGNEIGLLF 350
           PEEKGAL+LA+     N  + L++ANDP+ADRFSVAVRD+ +N    W+QLTGNEIG LF
Sbjct: 290 PEEKGALDLAVEYGRKNDTVDLIIANDPDADRFSVAVRDNDQNTTTAWRQLTGNEIGFLF 349

Query: 351 AFYEFKMYQKAADKGIKNKPLAMLNSTVSAQVIKRMAEKEGFLYKDTLTGFKWIGNEAAK 410
           A+YE++ Y+ +      ++PLAMLNSTVS+Q+IKRMAE EGF Y+DTLTGFKW+GN A +
Sbjct: 350 AYYEWERYKHSP----IDEPLAMLNSTVSSQMIKRMAEIEGFHYEDTLTGFKWLGNRALE 405

Query: 411 LEEKGYFVPFGYEEAIGYMFPAMEHDKDGVSAAIVFLQAYANWLQSSSNPIDIIHECYDK 470
           LE++GY+ PF YEEAIGYMF ++ HDKDG+SAAIVFLQAY+ W  S    +DI+     K
Sbjct: 406 LEQEGYYTPFAYEEAIGYMFSSVVHDKDGISAAIVFLQAYSKWRASGQTVLDILATASLK 465

Query: 471 YGVSAEYNGYYIVSDPSKTDKVFESIRSSYTSMGLSFPESIGEHFRVTEFRDLTIGFDST 530
           YG   E+NGYYIV D + T +VF++IR    S+   +P+ +G  F + +FRDLT G+ S 
Sbjct: 466 YGHFKEFNGYYIVPDLAITKQVFDAIR----SIESPYPKKLGSSFEIIKFRDLTNGYQSD 521

Query: 531 TADKKPLLPVDKNSQMITITAVPSGASNTGESVRFTIRGSGTEPKLKVYIEGISSTEGRA 590
           T D  P L  D +SQMIT   +          VRFTIRGSGTEPKLKVYIE  ++TE  +
Sbjct: 522 TPDHIPELASDPSSQMITCEMLL--VEQPTSRVRFTIRGSGTEPKLKVYIEARTNTEPNS 579

Query: 591 RILAKSLWETLKHEWFKPSSNGLSTDF 617
             LAK  W+ L+ EWFKP   GL T F
Sbjct: 580 IALAKFTWDVLRQEWFKPELTGLLTPF 606

>Ecym_4611 Chr4 (1191367..1193259) [1893 bp, 630 aa] {ON} similar to
           Ashbya gossypii ABL126W
          Length = 630

 Score =  664 bits (1713), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 329/623 (52%), Positives = 427/623 (68%), Gaps = 16/623 (2%)

Query: 6   IPVELRTAIESWLQLDKNEETRNEVIKLCNDQNWDELHKRFDSRIVFGTAGLRARMEAGT 65
           IP +LR  I+ W + DKN +T  E+  L + QNW+EL  R   RI FGTAGLRARMEAG 
Sbjct: 13  IPDDLRDKIDKWFKYDKNPQTTAEIRSLVDSQNWNELRGRLCQRISFGTAGLRARMEAGF 72

Query: 66  NRLNKLVILQASQGLATYIKDKFPQNLTAVVGHDHRYHSQEFAQVTAATFIRAGFKVYYL 125
            R+N L ++QASQGLATYIK +FP NL  VVGHDHRY+S+ FA+V  A F++ GF+VYYL
Sbjct: 73  ARMNTLTVIQASQGLATYIKSQFPNNLKVVVGHDHRYNSKSFAEVAIAAFLQLGFEVYYL 132

Query: 126 N--PHDE----FVHTPMVPYSVDHL--NASVGVMITASHNPKMDNGYKVYYTNGCQIIPP 177
           N  P ++    +VHTPMVP++V ++   AS G+MITASHNPKMDNGYKVYY+NGCQI PP
Sbjct: 133 NYVPSNKDVESYVHTPMVPFTVSNIEGGASCGIMITASHNPKMDNGYKVYYSNGCQITPP 192

Query: 178 HDHGIAETINNNLEPWSTDWNFTKILSNAETDGKIEYVRKRMLTSYLNSVVNQLIQRDFA 237
           HD  IA  I+ NL PW   W+  K++ +A  + ++  V++ ++ +Y+  + + L+  +  
Sbjct: 193 HDKKIASEIDANLVPWDQAWDAQKLIEDARNNNRLHDVKQELIKNYVQRIQSSLVTTNSL 252

Query: 238 APDEKPWFVYTPMHGVGHQIFSTILNESLNLKDNIDYITVPEQKDPDPSFRTVSFPNPEE 297
           A   K WFVYTPMHGVG++IF+ I+  +L+LK++  Y+ V  QK PDP F TVSFPNPEE
Sbjct: 253 ADCGKNWFVYTPMHGVGYEIFNNIVTNTLHLKEDEHYLVVGAQKFPDPEFTTVSFPNPEE 312

Query: 298 KGALNLAITLAEANGIKLVLANDPNADRFSVAVRDDSKNEWKQLTGNEIGLLFAFYEFKM 357
           +GALNLAI LA  +G +LVLANDP+ADRFS AV+D   N+WKQLTGN++G LFA  +   
Sbjct: 313 EGALNLAIELAARSGAELVLANDPDADRFSAAVKDG--NKWKQLTGNQLGYLFAVGQL-- 368

Query: 358 YQKAADKGIKNKPLAMLNSTVSAQVIKRMAEKEGFLYKDTLTGFKWIGNEAAKLEEKGYF 417
            +K +++    KPLAML STVS+Q+I +MA+ EGF + +TLTGFKW+ N A  LE  G++
Sbjct: 369 -EKFSNQNENKKPLAMLGSTVSSQMIAKMADVEGFTFVETLTGFKWLANRAIDLENDGFY 427

Query: 418 VPFGYEEAIGYMFPAMEHDKDGVSAAIVFLQAYANWLQSSSNPIDIIHECYDKYGVSAEY 477
           VPF YEEAIGYMF ++ HDKDGVSAA  FLQ  A W +    P+D+++  Y+KYG   EY
Sbjct: 428 VPFAYEEAIGYMFSSVTHDKDGVSAATEFLQMAARWKKEGKTPLDVLNAGYEKYGNFVEY 487

Query: 478 NGYYIVSDPSKTDKVFESIRSSYTSMGLSFPESIGEHFRVTEFRDLTIGFDSTTADKKPL 537
           NGYY V D S    VF+ IR++     + +P +IG  F V  FRDLT+G+ S T +  P 
Sbjct: 488 NGYYSVQDLSIIGDVFKYIRNACNGNDVPYPSTIGNEFAVASFRDLTVGYQSDTGNHIPN 547

Query: 538 LPVDKNSQMITITAVP---SGASNTGESVRFTIRGSGTEPKLKVYIEGISSTEGRARILA 594
           LPV   S MIT    P     A  + + VRFTIRGSGTEPKLKVYIE  +  +  A  LA
Sbjct: 548 LPVSPGSHMITCVLKPLIKETAQTSSDYVRFTIRGSGTEPKLKVYIESNALDKEYATKLA 607

Query: 595 KSLWETLKHEWFKPSSNGLSTDF 617
           K  W+ LK EWF+P   GL T F
Sbjct: 608 KLTWDVLKREWFRPEVTGLQTKF 630

>TBLA0G00980 Chr7 complement(248484..250160) [1677 bp, 558 aa] {ON}
           Anc_6.11 YEL058W
          Length = 558

 Score = 48.1 bits (113), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 29/96 (30%), Positives = 48/96 (50%), Gaps = 14/96 (14%)

Query: 140 SVDHLNASVGVMITASHNPKMDNGYKVYYTNGCQIIPPHDHGIAETINNNLEPWSTDWNF 199
           S+ H   +VGVM+TASHNP +DNG K+   NG              ++ + EP +TD   
Sbjct: 54  SLSHDGKAVGVMVTASHNPPVDNGVKIVEPNG------------SMLSQDWEPIATD--L 99

Query: 200 TKILSNAETDGKIEYVRKRMLTSYLNSVVNQLIQRD 235
             + S  + D  +++V  +++    N V   ++ RD
Sbjct: 100 ANLASQGKIDELVQFVNAKLIELNSNKVPTLIVGRD 135

>CAGL0K03421g Chr11 complement(314680..316386) [1707 bp, 568 aa]
           {ON} highly similar to uniprot|P37012 Saccharomyces
           cerevisiae YMR105c Phosphoglucomutase 2
          Length = 568

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 124/554 (22%), Positives = 218/554 (39%), Gaps = 86/554 (15%)

Query: 53  GTAGLRARMEAGTNRLNKLVILQASQGLATYIKDKFPQNLTA---VVGHDHRYHSQEFAQ 109
           GT+GLR + +   ++ N +      +     + +  P+       VVG D RY++    Q
Sbjct: 18  GTSGLRKKTKVFEDQPNYV------ENFIQSVMEAIPEGAKGAVLVVGGDGRYYNDVILQ 71

Query: 110 VTAATFIRAGFKVYYLNPHDEFVHTPMVPYSVDHLN--ASVGVMITASHN---PKMDNGY 164
             AA     G K   +   +  + TP   + +       + G+++TASHN   P+ D G 
Sbjct: 72  KIAAIGAANGVKKLVIG-QNGLLSTPAASHIMRTYKEKCTGGIILTASHNPGGPENDMGI 130

Query: 165 KVYYTNGCQIIPPHDHGIAETINNNLEPWST-----DWNFTKILSNAE-----------T 208
           K   +NG     P  + I E I+  L  +       + + TK++ N +           T
Sbjct: 131 KYNLSNGGPAPEPVTNKIWE-ISKKLTHYKIVKDFPELDLTKLVENKKYGPLLVDVIDTT 189

Query: 209 DGKIEYVRKRMLTSYLNSVVNQLIQRDFAAPDEKPW-FVYTPMHGVGHQIFSTILNESLN 267
           D  I+ +++      ++  + +  QR      EK W  +   M+GV       I  +   
Sbjct: 190 DAYIQLLKEIFDFELIHKFIAK--QR-----KEKGWKLLVDSMNGVTGPYAKAIFVDEFG 242

Query: 268 LKDNIDYITVPEQKDPDPSFRTVSFPNPEEKGALNLAITLAE---ANGIKLVLANDPNAD 324
           L    D   V +   P P F  +  P+P     L  A TL E      I+   A+D + D
Sbjct: 243 L----DSKEVLQNWHPQPDFGGLH-PDPN----LTYAHTLVERVNKEKIEFGAASDGDGD 293

Query: 325 RFSVAVRDDSKNEWKQLTGNEIGLLFAFY-EFKMYQKAADKGIKNKPLAMLNSTVSAQVI 383
           R  +     +        G+ + ++  +  E   ++K   +GI      +  S  +A  I
Sbjct: 294 RNMIYGYGPAFVS----PGDSVAIIAEYANEIPYFKK---QGI----YGLARSFPTASAI 342

Query: 384 KRMAEKEGFLYKDTLTGFKWIGN--EAAKLEEKGYFVPFGYEEAIGYMFPAMEHDKDGVS 441
            R+A+K G    +  TG+K+     +A KL   G       EE+ G     +  +KDG+ 
Sbjct: 343 DRVAKKHGLNCYEVPTGWKFFCALFDAKKLSICG-------EESFGTGSNHV-REKDGIW 394

Query: 442 AAIVFLQAYANWLQ----SSSNPIDIIHECYDKYGVSAEYNGYYIVSDPSKTDKVFESIR 497
           A + +L   A + Q      ++   I +E +D YG +      Y   +  K +KV E++R
Sbjct: 395 AIMAWLNILAIFNQRHPDKEASIKTIQNEFWDTYGRTFFTRYDYEKVETDKANKVIENLR 454

Query: 498 ---SSYTSMGLSFPESIGEHFRVTEFRDLT-IGFDSTTADKKPLLPVDKNSQMITITAVP 553
              +   + G  FP        V +  D +    D T +  + L  +  N     +    
Sbjct: 455 QYVADSGTKGSKFPTD--SALTVVDAGDFSYTDLDGTISSHQGLYVILSNGARFVVRL-- 510

Query: 554 SGASNTGESVRFTI 567
           SG  ++G ++R  I
Sbjct: 511 SGTGSSGATIRLYI 524

>KNAG0E02390 Chr5 (475467..477176) [1710 bp, 569 aa] {ON} Anc_2.445
           YKL127W
          Length = 569

 Score = 42.4 bits (98), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 125/552 (22%), Positives = 217/552 (39%), Gaps = 82/552 (14%)

Query: 53  GTAGLRARMEAGTNRLNKLVILQASQGLATYIKDKFPQNL---TAVVGHDHRYHSQEFAQ 109
           GT+GLR +    TN  +       ++     + +  P+     T VVG D RY++     
Sbjct: 19  GTSGLRKKTAVFTNEPH------YTENFIQAVMEAIPEGCKGATLVVGGDGRYYNDVILH 72

Query: 110 VTAATFIRAGFKVYYLNPHDEFVHTPMVPYSVDHLN--ASVGVMITASHN---PKMDNGY 164
             AA     G +   +   +  + TP   + +       + G+++TASHN   PK D G 
Sbjct: 73  KIAAIGAANGVRKLVIG-QNGLLSTPAASHIMRTYKEKCTGGIILTASHNPGGPKNDMGI 131

Query: 165 KVYYTNGCQIIPPHDHGIAETINN-------------NLEPWSTDWNFTKILSNA--ETD 209
           K   +NG     P  + I E                  L+  + +  +  +L +    T 
Sbjct: 132 KYNLSNGGPAPEPVTNKIWEVSKQLDHYKIIPDLPELALDTLAENVQYGPLLVDVVDTTR 191

Query: 210 GKIEYVRKRMLTSYLNSVVNQLIQRDFAAPDEKPW-FVYTPMHGVGHQIFSTILNESLNL 268
             +E++++      + S +++  QR      +K W  ++  M+GV       I  +   L
Sbjct: 192 DYVEFLKEIFDFPLIKSFIHK--QR-----SQKHWKLLFDGMNGVTGPYGKAIFVDEFEL 244

Query: 269 KDNIDYITVPEQKDPDPSFRTVSFPNPEEKGALNLAITLAEANGIKLVLANDPNADRFSV 328
                   V +   P P F  +  P+P    A +L   +   N I+   A+D + DR  +
Sbjct: 245 PAE----EVLQNWHPQPDFGGIH-PDPNLTYARSLVDRVDREN-IEFGAASDGDGDRNMI 298

Query: 329 AVRDDSKNEWKQLTGNEIGLLFAFYEFKMYQKAADKGIKNKPLAMLNSTVSAQVIKRMAE 388
                         G+ + ++  +     Y   A +GI      +  S  +A  I R+AE
Sbjct: 299 Y----GAGPAFVSPGDSVAIIAEYAAEIPY--FAKQGI----YGLARSFPTASAIDRVAE 348

Query: 389 KEGFLYKDTLTGFKWIGN--EAAKLEEKGYFVPFGYEEAIGYMFPAMEHDKDGVSAAIVF 446
           K G    +  TG+K+     +A KL   G       EE+ G     +  +KDGV A I +
Sbjct: 349 KHGLKCYEVPTGWKFFCALFDAKKLSICG-------EESFGTGSNHV-REKDGVWAIIAW 400

Query: 447 LQAYANWLQSSSN---PIDIIH-ECYDKYG--VSAEYNGYYIVSDPSKTDKVFESIRSSY 500
           L   A + +   +    I II  E + KYG      Y+  ++ S+ +K  KV +++R SY
Sbjct: 401 LNLLAIYNRRHPDRDVSIKIIQEEFWKKYGRVFFTRYDYEHVDSNSAK--KVIDNLR-SY 457

Query: 501 TS----MGLSFPESIGEHFRVTEFRDLTI-GFDSTTADKKPLLPVDKNSQMITITAVPSG 555
           T     +G  FP        VTE  D +    D + ++ + L     N     +    SG
Sbjct: 458 TEKPGVVGSKFPTDT--TLTVTESGDFSYKDLDGSVSEHQGLYVRLSNGARFVVRL--SG 513

Query: 556 ASNTGESVRFTI 567
             ++G ++R  +
Sbjct: 514 TGSSGATIRLYL 525

>TDEL0E00210 Chr5 (28244..29956) [1713 bp, 570 aa] {ON} Anc_2.445
           YKL127W
          Length = 570

 Score = 41.6 bits (96), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 35/131 (26%), Positives = 57/131 (43%), Gaps = 19/131 (14%)

Query: 53  GTAGLRARMEAGTNRLNKLVILQASQGLATYIKDKFPQ---NLTAVVGHDHRYHSQEFAQ 109
           GT+GLR +     N +        ++     I D  P+   +   VVG D RY++ +  Q
Sbjct: 17  GTSGLRKKTAVFMNNV------HYTENFIQSILDAIPESSKDAILVVGGDGRYYNDKILQ 70

Query: 110 VTAATFIRAGFKVYYLNPHDEFVHTPMVPYSV------DHLNASVGVMITASHN---PKM 160
           + AA     G +   +  H   + TP   + +      D    + G+++TASHN   P+ 
Sbjct: 71  IIAAISAANGVRKLVIGQHG-LLSTPAASHIIRSYQDKDGKKVTGGIILTASHNPGGPEN 129

Query: 161 DNGYKVYYTNG 171
           D G K   +NG
Sbjct: 130 DIGIKYNLSNG 140

>SAKL0E00902g Chr5 complement(68682..70316) [1635 bp, 544 aa] {ON}
           similar to uniprot|P38628 Saccharomyces cerevisiae
           YEL058W PCM1 Essential N-acetylglucosamine-phosphate
           mutase a hexosephosphate mutase involved in the
           biosynthesis of chitin
          Length = 544

 Score = 41.6 bits (96), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 26/69 (37%), Positives = 37/69 (53%), Gaps = 18/69 (26%)

Query: 148 VGVMITASHNPKMDNGYKVYYTNGCQIIPPHDHGIAETINNNLEPWSTDWNFTKILSNAE 207
           VGVMITASHNP  DNG K        I+ P      E ++   EP++T+      L+N+ 
Sbjct: 58  VGVMITASHNPPQDNGVK--------IVDPK----GEMLDQAWEPFATE------LANSA 99

Query: 208 TDGKIEYVR 216
           + GK E ++
Sbjct: 100 SKGKQELIK 108

>CAGL0B03597g Chr2 complement(359018..360640) [1623 bp, 540 aa] {ON}
           similar to uniprot|P38628 Saccharomyces cerevisiae
           YEL058w PCM1 phosphoacetylglucosamine mutase
          Length = 540

 Score = 40.0 bits (92), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 18/36 (50%), Positives = 24/36 (66%)

Query: 140 SVDHLNASVGVMITASHNPKMDNGYKVYYTNGCQII 175
           S+    A VGVMITASHNP  DNG K+  ++G  ++
Sbjct: 46  SISCQCAPVGVMITASHNPPRDNGVKIVESDGSMLL 81

>Kwal_26.7628 s26 (449302..451014) [1713 bp, 570 aa] {ON} YMR105C
           (PGM2) - Phosphoglucomutase [contig 55] FULL
          Length = 570

 Score = 39.7 bits (91), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 27/87 (31%), Positives = 42/87 (48%), Gaps = 6/87 (6%)

Query: 90  QNLTAVVGHDHRYHSQEFAQVTAATFIRAGFKVYYLNPHDEFVHTPMVPYSVDHL--NAS 147
           +N T VVG D RY++ E  Q+  A     G +   L   +  + TP   + +       +
Sbjct: 53  ENATLVVGGDGRYYNNEVMQIIGAIAAANGVRKMILG-QNGILSTPAASHIIRSYPEKCT 111

Query: 148 VGVMITASHN---PKMDNGYKVYYTNG 171
            G+++TASHN   P+ D G K   +NG
Sbjct: 112 GGIILTASHNPGGPENDFGIKYNLSNG 138

>NCAS0A04350 Chr1 (878688..880397) [1710 bp, 569 aa] {ON} Anc_2.445
           YKL127W
          Length = 569

 Score = 39.7 bits (91), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 122/549 (22%), Positives = 211/549 (38%), Gaps = 74/549 (13%)

Query: 53  GTAGLRARMEAGTNRLNKLVILQASQGLATYIKDKFP---QNLTAVVGHDHRYHSQEFAQ 109
           GT+GLR +     N  N       ++     + D  P   Q+ T VVG D R+++     
Sbjct: 19  GTSGLRKKTAIFMNEPN------YTENFIQAMLDAIPEGSQDATLVVGGDGRFYNDVIMN 72

Query: 110 VTAATFIRAGFKVYYLNPHDEFVHTPMVPYSVDHLNASV--GVMITASHN---PKMDNGY 164
             AA     G K   +   +  + TP   + +      V  G+++TASHN   P+ D G 
Sbjct: 73  KIAAISAANGVKKLIIG-QNGLLSTPAASHIIRSYEEKVTGGIILTASHNPGGPENDLGI 131

Query: 165 KVYYTNGCQIIPPHDHGIAETINNNLEPWSTDWNFTKI-LSNAETDGKIEYVRKRML--- 220
           K    NG        + I E ++  L  +    NF  + LS    D K   +   ++   
Sbjct: 132 KYNLANGGPAPESVTNAIWE-VSKKLTHYKIIKNFPPLDLSKMGKDQKYGPLLVDIIDVT 190

Query: 221 ---TSYLNSVVN-QLIQRDFAAPDE-KPW-FVYTPMHGVGHQIFSTILNESLNLKDNIDY 274
                +L  + + +LI++      E K W  ++  ++G+       I  +  +L  N   
Sbjct: 191 KDYVDFLKEIFDFELIKKFIHKQRETKNWKLLFDSLNGITGPYGKAIFVDEFDLPAN--- 247

Query: 275 ITVPEQKDPDPSFRTVSFPNPEEKGALNLAITLAE---ANGIKLVLANDPNADRFSVAVR 331
             V +   P P F  +  P+P     L  A TL E      I+   A+D + DR  +   
Sbjct: 248 -EVLQNWHPKPDFGGLH-PDPN----LTYAKTLVERVDREKIEFGAASDGDGDRNMIY-- 299

Query: 332 DDSKNEWKQLTGNEIGLLFAFYEFKMYQKAADKGIKNKPLAMLNSTVSAQVIKRMAEKEG 391
                      G+ + ++        Y       +K     +  S  ++  I R+A+  G
Sbjct: 300 --GAGPAFVSPGDSVAII------AEYASEIPYFVKQGIYGLARSFPTSAAIDRVAKAHG 351

Query: 392 FLYKDTLTGFKWIGN--EAAKLEEKGYFVPFGYEEAIGYMFPAMEHDKDGVSAAIVFLQA 449
               +  TG+K+     +A KL   G       EE+ G     +  +KDG+ A + +L  
Sbjct: 352 LSCYEVPTGWKFFCALFDAKKLSICG-------EESFGTGSNHI-REKDGLWAIVAWLNV 403

Query: 450 YANWLQSSSNP------IDIIHECYDKYGVS--AEYNGYYIVS-DPSKTDKVFESIRSSY 500
            A  + +  NP        I  E ++KYG +    Y+  +I + D SK   +  +  S  
Sbjct: 404 LA--IYNKHNPEKDASIKTIQEEFWNKYGRTFFTRYDYEHISNEDASKVVDLLNNFVSKP 461

Query: 501 TSMGLSFPESIGEHFRVTEFRDLT-IGFDSTTADKKPLLPVDKNSQMITITAVPSGASNT 559
             +G +FP    E   V +  D +    D + +D + L     N   I +    SG  ++
Sbjct: 462 NVIGSAFPGD--ESLTVVDAGDFSYTDLDGSVSDHQGLFFKLSNGARIVLRL--SGTGSS 517

Query: 560 GESVRFTIR 568
           G ++R  + 
Sbjct: 518 GATIRIYVE 526

>NCAS0F01470 Chr6 complement(293218..294927) [1710 bp, 569 aa] {ON}
           Anc_2.445 YKL127W
          Length = 569

 Score = 39.7 bits (91), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 125/553 (22%), Positives = 212/553 (38%), Gaps = 84/553 (15%)

Query: 53  GTAGLRARMEAGTNRLNKLVILQASQGLATYIKDKFPQN---LTAVVGHDHRYHSQEFAQ 109
           GT+GLR + +   +  N       ++     I D  P+     T VVG D RY++     
Sbjct: 19  GTSGLRKKTKIFKDTPN------YTENFIQAIMDAIPEGSKGATLVVGGDGRYYNDVILH 72

Query: 110 VTAATFIRAGFKVYYLNPHDEFVHTPMVPYSVDHLNASV--GVMITASHNP---KMDNGY 164
             AA     G K   +      + TP   + +         G+++TASHNP   K D G 
Sbjct: 73  KIAAIGAANGVKKLVIGQRG-LLSTPAASHIMRTYEEKTQGGIILTASHNPGGIKNDMGI 131

Query: 165 KVYYTNGCQIIPPHDHGIAETINN-------------NLEPWSTDWNFTKILSNA--ETD 209
           K   +NG     P  + I E                  LE    +  +  +L +    T 
Sbjct: 132 KFNLSNGGPAPEPVTNKIWEISKKMTSFKIIKDFPELELETLGKNKKYGPLLVDVIDTTK 191

Query: 210 GKIEYVRKRMLTSYLNSVVNQLIQRDFAAPDEKPW-FVYTPMHGVGHQIFSTILNESLNL 268
             +E+V++      +   V++  QR     D K W  ++  M+GV       I  + L L
Sbjct: 192 AYVEFVKQIFDFDLIKKFVHK--QR-----DTKHWKLLFDGMNGVTGPYGKAIFVDELGL 244

Query: 269 KDNIDYITVPEQKDPDPSFRTVSFPNPEEKGALNLAITLAEANGIKLVLANDPNADRFSV 328
             +     V +Q  P P F  V  P+P    A  L   +   N I+   A+D + DR  +
Sbjct: 245 PAD----EVLQQWHPSPDFGGVH-PDPNLTYAKALVDRVDREN-IEFGAASDGDGDRNMI 298

Query: 329 AVRDDSKNEWKQLTGNEIGLLFAFYEFKMYQKAADKGIKNKPLAMLNSTVSAQVIKRMAE 388
                         G+ + ++  +     Y   A +GI      +  S  ++  I R+A+
Sbjct: 299 Y----GAGPAFVSPGDSVAIIAEYAAEIPY--FAKQGI----YGLARSFPTSSAIDRVAK 348

Query: 389 KEGFLYKDTLTGFKWIGN--EAAKLEEKGYFVPFGYEEAIGYMFPAMEH--DKDGVSAAI 444
             G    +  TG+K+     +A KL   G       EE+ G       H  +KDG+ A +
Sbjct: 349 AHGLNCYEVPTGWKFFCALFDAKKLSICG-------EESFG---TGSNHVREKDGIWAIL 398

Query: 445 VFLQAYANWLQSSSN---PIDIIH-ECYDKYGVS--AEYNGYYIVSDPSKTDKVFESIRS 498
            +L   A + +   +    I II  E ++KYG +    Y+   + ++ +   KV +++R 
Sbjct: 399 AWLNLLAIYNKHHPDRDVSIKIIQDEFWNKYGRTFFTRYDYEKVATEDAA--KVIDNLRK 456

Query: 499 ---SYTSMGLSFPESIGEHFRVTEFRDLT-IGFDSTTADKKPLLPVDKNSQMITITAVPS 554
              S T +   FP    E   V E  D +    D + +  + L     N   + +    S
Sbjct: 457 HVESKTFVNHKFPTD--ESLTVVEAGDFSYTDLDGSVSAHQGLFFKLSNGARVVVRL--S 512

Query: 555 GASNTGESVRFTI 567
           G  ++G ++R  +
Sbjct: 513 GTGSSGATIRLYV 525

>NCAS0F00200 Chr6 complement(30474..32123) [1650 bp, 549 aa] {ON}
           Anc_6.11 YEL058W
          Length = 549

 Score = 39.7 bits (91), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 17/28 (60%), Positives = 20/28 (71%)

Query: 148 VGVMITASHNPKMDNGYKVYYTNGCQII 175
           VGVM+TASHNP +DNG KV    G  +I
Sbjct: 60  VGVMVTASHNPPLDNGVKVVEPTGAMLI 87

>TPHA0G02900 Chr7 (622303..624012) [1710 bp, 569 aa] {ON} 
          Length = 569

 Score = 39.7 bits (91), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 43/158 (27%), Positives = 67/158 (42%), Gaps = 16/158 (10%)

Query: 53  GTAGLRARMEAGTNRLNKLVILQASQGLATYIKDKFPQ---NLTAVVGHDHRYHSQEFAQ 109
           GT+GLR + +   N  N       ++     I D  P+   N T VVG D R+++    Q
Sbjct: 19  GTSGLRKKSKVFMNEPN------YTENFIQAILDAIPEGSENSTLVVGGDGRFYNDVILQ 72

Query: 110 VTAATFIRAGFKVYYLNPHDEFVHTPMVPYSVD--HLNASVGVMITASHN---PKMDNGY 164
           + A      G +   +      + TP   + +   H   + G+++TASHN   P+ D G 
Sbjct: 73  LIAEIGAANGVRKLIIG-QAGILSTPAASHIIRTYHEEVTGGIILTASHNPGGPENDIGI 131

Query: 165 KVYYTNGCQIIPPHDHGIAETINNNLEPWSTDWNFTKI 202
           K    NG        + I E  + NL  + T  +F KI
Sbjct: 132 KYNLANGGPAPESVTNAIWEA-SKNLTTYKTMKDFPKI 168

>Kpol_1032.2 s1032 complement(1049..2668) [1620 bp, 539 aa] {ON}
           complement(1049..2668) [1620 nt, 540 aa]
          Length = 539

 Score = 39.3 bits (90), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 25/73 (34%), Positives = 37/73 (50%), Gaps = 14/73 (19%)

Query: 147 SVGVMITASHNPKMDNGYKVYYTNGCQIIPPHDHGIAETINNNLEPWSTDWNFTKILSNA 206
           +VGVMITASHNP  DNG K+   NG              ++ + EP +T+     I +N+
Sbjct: 53  AVGVMITASHNPPEDNGVKIVEPNGAM------------LDQSWEPMATE--LANIAANS 98

Query: 207 ETDGKIEYVRKRM 219
             D    YV +++
Sbjct: 99  TFDDLKAYVEEKV 111

>Kwal_56.22355 s56 complement(62955..64580) [1626 bp, 541 aa] {ON}
           YEL058W (PCM1) - Phosphoacetylglucosamine Mutase [contig
           186] FULL
          Length = 541

 Score = 39.3 bits (90), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 27/77 (35%), Positives = 40/77 (51%), Gaps = 20/77 (25%)

Query: 147 SVGVMITASHNPKMDNGYKVYYTNGCQIIPPHDHGIAETINNNLEPWSTDWNFTKILSNA 206
           +VGVMITASHNP  DNG K+    G            E +  + E ++TD      L+N+
Sbjct: 57  TVGVMITASHNPPEDNGVKIVDPKG------------EMLEQSWEVYATD------LANS 98

Query: 207 ETDGKIEYVR--KRMLT 221
            + G  E+V   +R++T
Sbjct: 99  ASQGFSEFVASVERLMT 115

>TDEL0G04600 Chr7 (838381..839967) [1587 bp, 528 aa] {ON} Anc_6.11
           YEL058W
          Length = 528

 Score = 39.3 bits (90), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 18/28 (64%), Positives = 20/28 (71%)

Query: 148 VGVMITASHNPKMDNGYKVYYTNGCQII 175
           VGVMITASHNP  DNG KV   +G  +I
Sbjct: 57  VGVMITASHNPSGDNGVKVVEPDGSMLI 84

>KAFR0L00340 Chr12 complement(62157..63779) [1623 bp, 540 aa] {ON}
           Anc_6.11 YEL058W
          Length = 540

 Score = 38.9 bits (89), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 22/53 (41%), Positives = 29/53 (54%), Gaps = 5/53 (9%)

Query: 148 VGVMITASHNPKMDNGYKVYYTNGCQIIPPHDHGIAETINNNLEPWSTDWNFT 200
           +GVMITASHNP  DNG K+   +G  +I        E I  +L   ++  NFT
Sbjct: 59  IGVMITASHNPPQDNGVKIVEPSGAMLIESW-----EQIATDLANIASHGNFT 106

>NDAI0K02890 Chr11 (655311..656996) [1686 bp, 561 aa] {ON} Anc_6.11
           YEL058W
          Length = 561

 Score = 38.9 bits (89), Expect = 0.036,   Method: Compositional matrix adjust.
 Identities = 15/30 (50%), Positives = 22/30 (73%)

Query: 146 ASVGVMITASHNPKMDNGYKVYYTNGCQII 175
           +++GVM+TASHNP  DNG K+   NG  ++
Sbjct: 66  SAIGVMVTASHNPPEDNGVKIIEPNGSMLL 95

>SAKL0E03630g Chr5 complement(294321..296036) [1716 bp, 571 aa] {ON}
           highly similar to uniprot|P37012 Saccharomyces
           cerevisiae YMR105C PGM2 Phosphoglucomutase catalyzes the
           conversion from glucose-1-phosphate to
           glucose-6-phosphate which is a key step in hexose
           metabolism functions as the acceptor for a
           Glc-phosphotransferase and to YKL127W uniprot|P33401
           Saccharomyces cerevisiae YKL127W PGM1
           Phosphoglucomutase, minor isoform; catalyzes the
           conversion from glucose-1-phosphate to glucose-6-
           phosphate, which is a key step in hexose metabolism
          Length = 571

 Score = 38.1 bits (87), Expect = 0.058,   Method: Compositional matrix adjust.
 Identities = 35/128 (27%), Positives = 55/128 (42%), Gaps = 16/128 (12%)

Query: 53  GTAGLRARMEAGTNRLNKLVILQASQGLATYIKDKFP---QNLTAVVGHDHRYHSQEFAQ 109
           GT+GLR + +      N       ++     + D  P   Q+ T VVG D R+++    Q
Sbjct: 19  GTSGLRKKTKVFMEEPN------YTENFIQAVMDAIPEGSQDATLVVGGDGRFYNDVVVQ 72

Query: 110 VTAATFIRAGFKVYYLNPHDEFVHTPMVPYSVD---HLNASVGVMITASHNP---KMDNG 163
             AA     G     +   +  + TP   + +    H   + G+++TASHNP   K D G
Sbjct: 73  KIAAIGAANGVHKLVIG-QNGILSTPAASHIIRTYPHAKITGGIILTASHNPGGAKNDFG 131

Query: 164 YKVYYTNG 171
            K   +NG
Sbjct: 132 IKYNLSNG 139

>KLTH0C11506g Chr3 (944869..946503) [1635 bp, 544 aa] {ON} similar
           to uniprot|P38628 Saccharomyces cerevisiae YEL058W PCM1
           Essential N-acetylglucosamine- phosphate mutase a
           hexosephosphate mutase involved in the biosynthesis of
           chitin
          Length = 544

 Score = 38.1 bits (87), Expect = 0.061,   Method: Compositional matrix adjust.
 Identities = 36/131 (27%), Positives = 54/131 (41%), Gaps = 42/131 (32%)

Query: 101 RYHSQEFAQVTAATFIRAGFKVYYLNPHDEFVHTPMVPYSVDHLNASVGVMITASHNPKM 160
           RY +     V   T + AG +  YL                     +VGVMITASHNP  
Sbjct: 29  RYKADVLDTVMFTTGVLAGLRSIYLEGR------------------TVGVMITASHNPPE 70

Query: 161 DNGYKVYYTNGCQIIPPHDHGIAETINNNLEPWSTDWNFTKILSNAETDGKIEYVRKRML 220
           DNG K        I+ P      E +  + E ++TD      L+N+ T     ++     
Sbjct: 71  DNGVK--------IVDPK----GEMLEQSWESYATD------LANSATQSFTAFL----- 107

Query: 221 TSYLNSVVNQL 231
            +YL ++V++L
Sbjct: 108 -AYLQNLVSEL 117

>ZYRO0F00506g Chr6 complement(49579..51231) [1653 bp, 550 aa] {ON}
           similar to uniprot|P38628 Saccharomyces cerevisiae
           YEL058W PCM1 Essential N-acetylglucosamine-phosphate
           mutase a hexosephosphate mutase involved in the
           biosynthesis of chitin
          Length = 550

 Score = 38.1 bits (87), Expect = 0.063,   Method: Compositional matrix adjust.
 Identities = 19/43 (44%), Positives = 27/43 (62%), Gaps = 1/43 (2%)

Query: 148 VGVMITASHNPKMDNGYKVYYTNGCQIIPPHDHGIAETINNNL 190
           +GVM+TASHNP +DNG KV   +G  ++P     +A  + N L
Sbjct: 59  IGVMVTASHNPPVDNGVKVVEPDG-SMMPESWEPLATELANTL 100

>Smik_5.29 Chr5 (45538..47205) [1668 bp, 555 aa] {ON} YEL058W (REAL)
          Length = 555

 Score = 38.1 bits (87), Expect = 0.072,   Method: Compositional matrix adjust.
 Identities = 19/41 (46%), Positives = 25/41 (60%), Gaps = 3/41 (7%)

Query: 148 VGVMITASHNPKMDNGYKVYYTNGCQIIP---PHDHGIAET 185
           VGVMITASHNP  DNG K+   +G  ++    P+   +A T
Sbjct: 60  VGVMITASHNPYQDNGVKIVEPDGSMLLATWEPYAMQLANT 100

>YEL058W Chr5 (43252..44925) [1674 bp, 557 aa] {ON}  PCM1Essential
           N-acetylglucosamine-phosphate mutase; converts
           GlcNAc-6-P to GlcNAc-1-P, which is a precursor for the
           biosynthesis of chitin and for the formation of
           N-glycosylated mannoproteins and
           glycosylphosphatidylinositol anchors
          Length = 557

 Score = 38.1 bits (87), Expect = 0.073,   Method: Compositional matrix adjust.
 Identities = 16/28 (57%), Positives = 20/28 (71%)

Query: 148 VGVMITASHNPKMDNGYKVYYTNGCQII 175
           VGVMITASHNP  DNG K+   +G  ++
Sbjct: 60  VGVMITASHNPYQDNGVKIVEPDGSMLL 87

>Skud_5.31 Chr5 (42262..43935) [1674 bp, 557 aa] {ON} YEL058W (REAL)
          Length = 557

 Score = 37.7 bits (86), Expect = 0.076,   Method: Compositional matrix adjust.
 Identities = 16/28 (57%), Positives = 20/28 (71%)

Query: 148 VGVMITASHNPKMDNGYKVYYTNGCQII 175
           VGVMITASHNP  DNG K+   +G  ++
Sbjct: 60  VGVMITASHNPYQDNGVKIVEPDGSMLL 87

>Ecym_3014 Chr3 complement(28261..29916) [1656 bp, 551 aa] {ON}
           similar to Ashbya gossypii ACR015W
          Length = 551

 Score = 37.7 bits (86), Expect = 0.079,   Method: Compositional matrix adjust.
 Identities = 28/90 (31%), Positives = 41/90 (45%), Gaps = 25/90 (27%)

Query: 143 HLNAS-VGVMITASHNPKMDNGYKVYYTNGCQIIPPHDHGIAETINNNLEPWSTDWNFTK 201
           HL    VG MITASHNP  DNG K+    G            E +    E ++T+     
Sbjct: 52  HLKGQYVGAMITASHNPPQDNGVKLVDPKG------------EMLKQEWEVYATE----- 94

Query: 202 ILSNAETDGKIEYVRKRMLTSYLNSVVNQL 231
            L+N  +DGK +++ +      L  ++NQ 
Sbjct: 95  -LANCASDGKHQFLHR------LQELMNQF 117

>KLLA0D00858g Chr4 complement(80327..81952) [1626 bp, 541 aa] {ON}
           similar to uniprot|P38628 Saccharomyces cerevisiae
           YEL058W PCM1 Essential N-acetylglucosamine-phosphate
           mutase a hexosephosphate mutase involved in the
           biosynthesis of chitin
          Length = 541

 Score = 37.7 bits (86), Expect = 0.080,   Method: Compositional matrix adjust.
 Identities = 42/136 (30%), Positives = 59/136 (43%), Gaps = 36/136 (26%)

Query: 103 HSQEFAQVTAATFIRAGFKVYYLNPHDEFVHTPM-------VPYSVDHLNASVGVMITAS 155
           + Q   Q  A T+  AGF+      H+  + T M       V  S+   +  VGVMITAS
Sbjct: 7   YEQYCKQGHAYTYGTAGFRA-----HNSVLDTVMFTTGIVAVLRSIYLKSKFVGVMITAS 61

Query: 156 HNPKMDNGYKVYYTNGCQIIPPHDHGIAETINNNLEPWSTDWNFTKILSNAETDGKIEYV 215
           HNP  DNG KV        + P+     E +  N EP +T       L+NA +    +  
Sbjct: 62  HNPPEDNGVKV--------VEPY----GEMLVQNWEPIATK------LANAASSSFTQ-- 101

Query: 216 RKRMLTSYLNSVVNQL 231
               L S L S++ +L
Sbjct: 102 ----LESTLQSIIAEL 113

>TDEL0A02210 Chr1 (400375..402093) [1719 bp, 572 aa] {ON} Anc_2.445
           YKL127W
          Length = 572

 Score = 37.7 bits (86), Expect = 0.081,   Method: Compositional matrix adjust.
 Identities = 73/303 (24%), Positives = 115/303 (37%), Gaps = 53/303 (17%)

Query: 53  GTAGLRARMEAGTNRLNKLVILQASQGLATYIKDKFPQ---NLTAVVGHDHRYHSQEFAQ 109
           GT+GLR + +    + +       ++     I D  P+   + T VVG D RY++ +  Q
Sbjct: 19  GTSGLRKKTKVFMEKPH------YTENFIQSILDAIPEGSKDATLVVGGDGRYYNDKILQ 72

Query: 110 VTAATFIRAGFKVYYLNPHDEFVHTPMVPYSV----DHLNASV--GVMITASHN---PKM 160
           + A+     G     +  H   + TP   + +    D     V  G+++TASHN   P  
Sbjct: 73  IIASISAANGVGKLVIGQHG-LLSTPAASHIIRTYQDKSGKKVTGGIILTASHNPGGPDN 131

Query: 161 DNGYKVYYTNGCQIIPPHDHGIAET--------INNNLEPWSTDWNFTKILSNAETD--- 209
           D G K   +NG        + I E         I  NL          K L N E D   
Sbjct: 132 DIGIKYNLSNGGPAPESVTNAIWEISKKLTSYKIIKNLPQLDLSTKGEKKLGNLEIDVVD 191

Query: 210 ---GKIEYVRKRMLTSYLNSVVNQLIQRDFAAPDEKPW-FVYTPMHGVGHQIFSTILNES 265
                +E++++      +   V+   QR       K W  ++  ++GV       I  + 
Sbjct: 192 VTQAYVEFLKEIFDFDLIKKFVDT--QR-----STKHWKLLFDGLNGVTGPYGKAIFVDE 244

Query: 266 LNLKDNIDYITVPEQKDPDPSFRTVSFPNPEEKGALNLAITLAE---ANGIKLVLANDPN 322
           L L +N     V +   P P F  +  P+P     L  A TL E      I+   A+D +
Sbjct: 245 LGLPEN----EVLQNCHPKPDFGGIH-PDPN----LTYARTLVERVDKEKIEFGAASDGD 295

Query: 323 ADR 325
            DR
Sbjct: 296 GDR 298

>Suva_5.10 Chr5 (19280..20941) [1662 bp, 553 aa] {ON} YEL058W (REAL)
          Length = 553

 Score = 37.7 bits (86), Expect = 0.081,   Method: Compositional matrix adjust.
 Identities = 16/28 (57%), Positives = 20/28 (71%)

Query: 148 VGVMITASHNPKMDNGYKVYYTNGCQII 175
           VGVMITASHNP  DNG K+   +G  ++
Sbjct: 60  VGVMITASHNPYQDNGVKIVEPDGSMLL 87

>KLLA0B12694g Chr2 (1107696..1109402) [1707 bp, 568 aa] {ON} highly
           similar to uniprot|P37012 Saccharomyces cerevisiae
           YMR105C PGM2 Phosphoglucomutase catalyzes the conversion
           from glucose-1-phosphate to glucose-6-phosphate which is
           a key step in hexose metabolism functions as the
           acceptor for a Glc-phosphotransferase and to YKL127W
           uniprot|P33401 Saccharomyces cerevisiae YKL127W PGM1
           Phosphoglucomutase, minor isoform; catalyzes the
           conversion from glucose-1-phosphate to glucose-6-
           phosphate, which is a key step in hexose metabolism
          Length = 568

 Score = 37.7 bits (86), Expect = 0.089,   Method: Compositional matrix adjust.
 Identities = 35/127 (27%), Positives = 54/127 (42%), Gaps = 15/127 (11%)

Query: 53  GTAGLRARMEAGTNRLNKLVILQASQGLATYIKDKFP---QNLTAVVGHDHRYHSQEFAQ 109
           GT+GLR + +      N       ++     I +  P   Q  T V+G D RY++    Q
Sbjct: 19  GTSGLRKKTKVFEETPNY------TENFIQAIMEAIPEGSQGATLVIGGDGRYYNDVVIQ 72

Query: 110 VTAATFIRAGFKVYYLNPHDEFVHTPMVPYSVD--HLNASVGVMITASHNPKM---DNGY 164
             AA     G +   +  H+  + TP   + +   H   + G+++TASHNP     D G 
Sbjct: 73  KIAAIGSANGVRKIVIG-HNGILSTPAASHIIRAYHEKCTGGIILTASHNPGGPTNDFGI 131

Query: 165 KVYYTNG 171
           K    NG
Sbjct: 132 KYNLANG 138

>YMR105C Chr13 complement(475897..477606) [1710 bp, 569 aa] {ON}
           PGM2Phosphoglucomutase, catalyzes the conversion from
           glucose-1-phosphate to glucose-6-phosphate, which is a
           key step in hexose metabolism; functions as the acceptor
           for a Glc-phosphotransferase
          Length = 569

 Score = 37.7 bits (86), Expect = 0.094,   Method: Compositional matrix adjust.
 Identities = 120/552 (21%), Positives = 215/552 (38%), Gaps = 82/552 (14%)

Query: 53  GTAGLRARMEAGTNRLNKLVILQASQGLATYIKDKFPQN---LTAVVGHDHRYHSQEFAQ 109
           GT+GLR + +   +  N       ++     I +  P+     T VVG D RY++     
Sbjct: 19  GTSGLRKKTKVFKDEPN------YTENFIQSIMEAIPEGSKGATLVVGGDGRYYNDVILH 72

Query: 110 VTAATFIRAGFKVYYLNPHDEFVHTPMVPYSVDHL--NASVGVMITASHN---PKMDNGY 164
             AA     G K   +  H   + TP   + +       + G+++TASHN   P+ D G 
Sbjct: 73  KIAAIGAANGIKKLVIGQHG-LLSTPAASHIMRTYEEKCTGGIILTASHNPGGPENDMGI 131

Query: 165 KVYYTNGCQIIPPHDHGIAETINNNLEPWSTDWNFTKILSN-AETD-GKIEYVRK----- 217
           K   +NG            E++ N +   S      KI+ +  E D G I   +K     
Sbjct: 132 KYNLSNGGP--------APESVTNAIWEISKKLTSYKIIKDFPELDLGTIGKNKKYGPLL 183

Query: 218 -------RMLTSYLNSVVNQLIQRDFA--APDEKPW-FVYTPMHGVGHQIFSTILNESLN 267
                  +   ++L  + +  + + F       K W  ++  M+GV       I  +   
Sbjct: 184 VDIIDITKDYVNFLKEIFDFDLIKKFIDNQRSTKNWKLLFDSMNGVTGPYGKAIFVDEFG 243

Query: 268 LKDNIDYITVPEQKDPDPSFRTVSFPNPEEKGALNLAITLAEANGIKLVLANDPNADRFS 327
           L  +     V +   P P F  +  P+P    A +L +   +   I+   A+D + DR  
Sbjct: 244 LPAD----EVLQNWHPSPDFGGMH-PDPNLTYASSL-VKRVDREKIEFGAASDGDGDRNM 297

Query: 328 VAVRDDSKNEWKQLTGNEIGLLFAFYEFKMYQKAADKGIKNKPLAMLNSTVSAQVIKRMA 387
           +     S        G+ + ++  +     Y   A +GI      +  S  ++  I R+A
Sbjct: 298 IYGYGPSFVS----PGDSVAIIAEYAAEIPY--FAKQGI----YGLARSFPTSGAIDRVA 347

Query: 388 EKEGFLYKDTLTGFKWIGN--EAAKLEEKGYFVPFGYEEAIGYMFPAMEH--DKDGVSAA 443
           +  G    +  TG+K+     +A KL   G       EE+ G       H  +KDGV A 
Sbjct: 348 KAHGLNCYEVPTGWKFFCALFDAKKLSICG-------EESFG---TGSNHVREKDGVWAI 397

Query: 444 IVFLQAYANW----LQSSSNPIDIIHECYDKYGVSAEYNGYYIVSDPSKTDKVFESIRSS 499
           + +L   A +     ++ ++   I +E + KYG +      +   +  K +K+ + +R+ 
Sbjct: 398 MAWLNILAIYNKHHPENEASIKTIQNEFWAKYGRTFFTRYDFEKVETEKANKIVDQLRAY 457

Query: 500 YTSMGL---SFPESIGEHFRVTEFRDLT-IGFDSTTADKKPLLPVDKNSQMITITAVPSG 555
            T  G+   +FP    E  +VT+  D +    D + +D + L     N     +    SG
Sbjct: 458 VTKSGVVNSAFPAD--ESLKVTDCGDFSYTDLDGSVSDHQGLYVKLSNGARFVLRL--SG 513

Query: 556 ASNTGESVRFTI 567
             ++G ++R  I
Sbjct: 514 TGSSGATIRLYI 525

>TPHA0G02470 Chr7 (507445..509154) [1710 bp, 569 aa] {ON} Anc_2.445
           YKL127W
          Length = 569

 Score = 37.0 bits (84), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 34/128 (26%), Positives = 55/128 (42%), Gaps = 15/128 (11%)

Query: 53  GTAGLRARMEAGTNRLNKLVILQASQGLATYIKDKFPQ---NLTAVVGHDHRYHSQEFAQ 109
           GT+GLR + +   N  N       ++     I D  P+   + T VVG D R+++    Q
Sbjct: 19  GTSGLRKKTKIFMNEPN------YTENFIQAILDAIPEGSEDSTLVVGGDGRFYNDVILQ 72

Query: 110 VTAATFIRAGFKVYYLNPHDEFVHTPMVPYSVD--HLNASVGVMITASHN---PKMDNGY 164
           + A      G +   +      + TP   + +   H   + G+++TASHN   P+ D G 
Sbjct: 73  LIAEIGAANGVRKLIIG-QAGILSTPATSHVIRTYHEEVTGGIILTASHNPGGPENDIGI 131

Query: 165 KVYYTNGC 172
           K    NG 
Sbjct: 132 KYNLANGA 139

>Kpol_1033.54 s1033 (136243..137955) [1713 bp, 570 aa] {ON}
           (136243..137955) [1713 nt, 571 aa]
          Length = 570

 Score = 37.0 bits (84), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 35/132 (26%), Positives = 60/132 (45%), Gaps = 24/132 (18%)

Query: 53  GTAGLRARMEAGTNRLNKLVILQASQGLATYIKDKFP---QNLTAVVGHDHRYHSQ---- 105
           GT+GLR + +   +  N       ++     I +  P   +N T VVG D R+++     
Sbjct: 19  GTSGLRKKTKIFMSEKN------YTENFIQSILNSIPNGVKNSTIVVGGDGRFYNDIILD 72

Query: 106 EFAQVTAATFIRAGFKVYYLNPHDEFVHTPMVPYSVDHLNASV---GVMITASHN---PK 159
           +  Q++AA  +R       +   +  + TP   Y + +   S    G+++TASHN   P+
Sbjct: 73  KIMQISAANGVRK-----LVIGQNGILSTPAASYIIRNYKESCNGGGIILTASHNPGGPE 127

Query: 160 MDNGYKVYYTNG 171
            D G K   +NG
Sbjct: 128 NDIGIKYNLSNG 139

>KNAG0E00940 Chr5 (176887..178503) [1617 bp, 538 aa] {ON} Anc_6.11
           YEL058W
          Length = 538

 Score = 37.0 bits (84), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 16/21 (76%), Positives = 17/21 (80%)

Query: 146 ASVGVMITASHNPKMDNGYKV 166
           A VGVM+TASHNP  DNG KV
Sbjct: 56  AQVGVMVTASHNPPEDNGVKV 76

>Smik_13.291 Chr13 complement(460399..462108) [1710 bp, 569 aa] {ON}
           YKL127W (REAL)
          Length = 569

 Score = 37.0 bits (84), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 116/547 (21%), Positives = 214/547 (39%), Gaps = 72/547 (13%)

Query: 53  GTAGLRARMEAGTNRLNKLVILQASQGLATYIKDKFPQN---LTAVVGHDHRYHSQEFAQ 109
           GT+GLR + +   ++ N       ++     I +  P+     T VVG D RY++     
Sbjct: 19  GTSGLRKKTKVFKDQPN------YTENFIQSIMEAIPEGSKGATLVVGGDGRYYNDVILH 72

Query: 110 VTAATFIRAGFKVYYLNPHDEFVHTPMVPYSVDHL--NASVGVMITASHN---PKMDNGY 164
             AA     G K   +  H   + TP   + +       + G+++TASHN   P+ D G 
Sbjct: 73  KIAAIGAANGVKKLVIGQHG-LLSTPAASHIMRTYEEKCTGGIILTASHNPGGPENDMGI 131

Query: 165 KVYYTNGCQIIPPHDHGIAETINNNLEPWSTDWNFTKILSNAETDGKIEYVRKRML---- 220
           K   +NG    P     +   I+  L  +    +F ++  +  T GK +     ++    
Sbjct: 132 KYNLSNGGP-APESVTNVIWDISKKLTSYKIIKDFPEL--DLATIGKNKKYGPLLVDIID 188

Query: 221 -----TSYLNSVVNQLIQRDFA--APDEKPW-FVYTPMHGVGHQIFSTILNESLNLKDNI 272
                  +L  + +  + + F       K W  ++  M+GV       I  +   L  + 
Sbjct: 189 ITKDYVDFLKEIFDFKLIKKFIDNQRSTKNWKLLFDSMNGVTGPYGKAIFVDEFGLPAD- 247

Query: 273 DYITVPEQKDPDPSFRTVSFPNPEEKGALNLAITLAEANGIKLVLANDPNADRFSVAVRD 332
               V +   P P F  +  P+P    A  L +   +   I+   A+D + DR  +    
Sbjct: 248 ---EVLQNWHPSPDFGGMH-PDPNLTYASTL-VKRVDREKIEFGAASDGDGDRNMIYGYG 302

Query: 333 DSKNEWKQLTGNEIGLLFAFYEFKMYQKAADKGIKNKPLAMLNSTVSAQVIKRMAEKEGF 392
            S        G+ + ++  +     Y   A +GI      +  S  ++  I R+A+  G 
Sbjct: 303 PSFVS----PGDSVAIIAEYAAEIPY--FAKQGI----YGLARSFPTSAAIDRVAKAHGL 352

Query: 393 LYKDTLTGFKWIGN--EAAKLEEKGYFVPFGYEEAIGYMFPAMEH--DKDGVSAAIVFLQ 448
              +  TG+K+     +A KL   G       EE+ G       H  +KDGV A + +L 
Sbjct: 353 NCYEVPTGWKFFCALFDAKKLSICG-------EESFG---TGSNHVREKDGVWAIMAWLN 402

Query: 449 AYANW----LQSSSNPIDIIHECYDKYGVSAEYNGYYIVSDPSKTDKVFESIRSSYTSMG 504
             A +     ++ ++   I +E + KYG +      +   +  K +K+ + +++  T  G
Sbjct: 403 ILAIYNKHHPENEASIKTIQNEFWAKYGRTFFTRYDFEKVESQKANKIVDQLKAYVTKSG 462

Query: 505 L---SFPESIGEHFRVTEFRDLT-IGFDSTTADKKPLLPVDKNSQMITITAVPSGASNTG 560
           +   +FP    E  +VT+  D +    D + +D + L     N     +    SG  ++G
Sbjct: 463 VVSSAFPAD--ESLKVTDCGDFSYTDLDGSVSDHQGLYVKLSNGARFVLRL--SGTGSSG 518

Query: 561 ESVRFTI 567
            ++R  I
Sbjct: 519 ATIRLYI 525

>KLTH0D04796g Chr4 (437416..439128) [1713 bp, 570 aa] {ON} highly
           similar to uniprot|P37012 Saccharomyces cerevisiae
           YMR105C PGM2 Phosphoglucomutase catalyzes the conversion
           from glucose-1-phosphate to glucose-6-phosphate which is
           a key step in hexose metabolism functions as the
           acceptor for a Glc-phosphotransferase and to YKL127W
           uniprot|P33401 Saccharomyces cerevisiae YKL127W PGM1
           Phosphoglucomutase, minor isoform; catalyzes the
           conversion from glucose-1-phosphate to glucose-6-
           phosphate, which is a key step in hexose metabolism
          Length = 570

 Score = 37.0 bits (84), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 41/161 (25%), Positives = 67/161 (41%), Gaps = 22/161 (13%)

Query: 53  GTAGLRARMEAGTNRLNKLVILQASQGLATYIKDKFP---QNLTAVVGHDHRYHSQEFAQ 109
           GT+GLR + +   N  +       ++     I +  P   Q+   VVG D RY++ E  Q
Sbjct: 19  GTSGLRKKTKVFMNEPH------YTENFIQAIMEAIPEGSQDAVLVVGGDGRYYNNEVLQ 72

Query: 110 VTAATFIRAGFKVYYLNPHDEFVHTPMVPYSVDHL--NASVGVMITASHN---PKMDNGY 164
                    G K   +   +  + TP   + +      ++ G+++TASHN   P+ D G 
Sbjct: 73  KIGEIGAANGVKKLIVG-QNGLLSTPAASHIIRSYPEKSTGGIILTASHNPGGPENDFGI 131

Query: 165 KVYYTNGCQIIPPHDHGIAETI---NNNLEPWSTDWNFTKI 202
           K   +NG     P    +  +I   +  L  + T  NF KI
Sbjct: 132 KYNLSNGG----PAPESVTNSIFEKSKQLASYKTVKNFPKI 168

>ACR015W Chr3 (383130..384788) [1659 bp, 552 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YEL058W (PCM1)
          Length = 552

 Score = 36.2 bits (82), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 26/83 (31%), Positives = 34/83 (40%), Gaps = 26/83 (31%)

Query: 101 RYHSQEFAQVTAATFIRAGFKVYYLNPHDEFVHTPMVPYSVDHLNASVGVMITASHNPKM 160
           R  ++  A V  AT + A  +  YL                    A VGVM+TASHNP  
Sbjct: 29  RSRAEVLAPVVFATGLLACLRSLYLG------------------GAYVGVMLTASHNPPE 70

Query: 161 DNGYKVYYTNGCQIIPPHDHGIA 183
           DNG K        ++ PH   +A
Sbjct: 71  DNGVK--------LVDPHGEMLA 85

>NDAI0H02350 Chr8 complement(571624..573333) [1710 bp, 569 aa] {ON}
           Anc_2.445 YKL127W
          Length = 569

 Score = 36.2 bits (82), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 123/548 (22%), Positives = 217/548 (39%), Gaps = 74/548 (13%)

Query: 53  GTAGLRARMEAGTNRLNKLVILQASQGLATYIKDKFPQNL---TAVVGHDHRYHSQEFAQ 109
           GT+GLR +     ++         ++     I D  P+     T VVG D RY++     
Sbjct: 19  GTSGLRKKTRVFKDKP------HYTENFIQAIMDAIPEGAKGATLVVGGDGRYYNDVILH 72

Query: 110 VTAATFIRAGFKVYYLNPHDEFVHTPMVPYSVDHL--NASVGVMITASHNP---KMDNGY 164
             AA     G K   +  H   + TP   + +       + G+++TASHNP   + D G 
Sbjct: 73  KIAAIGAANGVKKLVVGQHG-LLSTPAASHIMRTYEEKTTGGIILTASHNPGGLENDMGI 131

Query: 165 KVYYTNGCQIIPPHDHGIAETINNNLEPWSTDWNFTKILSNAETDGK--------IEYVR 216
           K   +NG     P  + I E I+  +  +    +F ++    ET GK        ++ + 
Sbjct: 132 KYNLSNGGPAPEPVTNKIWE-ISKKMTHYKIIKDFPEL--ELETLGKNKKYGPLLVDVID 188

Query: 217 -KRMLTSYLNSVVN-QLIQRDFAAPDEKP-W-FVYTPMHGVGHQIFSTILNESLNLKDNI 272
             +    +L  + + +LI++      EK  W  ++  M+GV       I  +   L  + 
Sbjct: 189 ITKAYVDFLKEIFDFELIKKFIHNQREKKHWKLLFDGMNGVTGPYGKAIFVDEFGLPAD- 247

Query: 273 DYITVPEQKDPDPSFRTVSFPNPEEKGALNLAITLAEANGIKLVLANDPNADRFSVAVRD 332
               V +Q  P P F  V  P+P    A  L +       I+   A+D + DR  +    
Sbjct: 248 ---EVLQQWHPQPDFGGVH-PDPNLTYAKAL-VDRVNREKIEFGAASDGDGDRNMIY--- 299

Query: 333 DSKNEWKQLTGNEIGLLFAFY-EFKMYQKAADKGIKNKPLAMLNSTVSAQVIKRMAEKEG 391
                     G+ + ++  +  E   ++K   +GI      +  S  +A  I R+A+  G
Sbjct: 300 -GAGPAFVSPGDSVAIIAEYASEIPYFKK---QGI----YGLARSFPTASSIDRVAKAHG 351

Query: 392 FLYKDTLTGFKWIGN--EAAKLEEKGYFVPFGYEEAIGYMFPAMEHDKDGVSAAIVFLQA 449
                  TG+K+     +A KL   G       EE+ G     +  +KDG+ A I +L  
Sbjct: 352 LNCYQVPTGWKFFCALFDANKLSICG-------EESFGTGSNHVR-EKDGLWAIIAWLNV 403

Query: 450 YANWLQSSSNP-----IDIIH-ECYDKYGVS--AEYNGYYIVSDPSKTDKVFESIRSSYT 501
            A  + +  NP     I II  E ++KYG +    Y+  ++ ++ +   KV + +R    
Sbjct: 404 LA--IYNKHNPEKDVSIKIIQDEFWNKYGRTFFTRYDYEHVTTEAA--GKVIDQLRKHVE 459

Query: 502 SMGLSFPE-SIGEHFRVTEFRDLT-IGFDSTTADKKPLLPVDKNSQMITITAVPSGASNT 559
           S      + S  E   VT+  D +    D + +  + L     N   + +    SG  ++
Sbjct: 460 SSNFVNSKFSADETLTVTDAGDFSYTDLDGSVSAHQGLYFRLSNGSRVVVRL--SGTGSS 517

Query: 560 GESVRFTI 567
           G ++R  +
Sbjct: 518 GATIRLYV 525

>Skud_13.263 Chr13 complement(451194..452903) [1710 bp, 569 aa] {ON}
           YKL127W (REAL)
          Length = 569

 Score = 35.4 bits (80), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 118/558 (21%), Positives = 217/558 (38%), Gaps = 94/558 (16%)

Query: 53  GTAGLRARMEAGTNRLNKLVILQASQGLATYIKDKFPQN---LTAVVGHDHRYHSQEFAQ 109
           GT+GLR + +   ++ N       ++     I +  P+     T VVG D RY++     
Sbjct: 19  GTSGLRKKTKVFKDQPN------YTENFIQSIMEAIPEGSKGATLVVGGDGRYYNDVILN 72

Query: 110 VTAATFIRAGFKVYYLNPHDEFVHTPMVPYSVDHLN--ASVGVMITASHN---PKMDNGY 164
             AA     G K   +  +   + TP   + +       + G+++TASHN   P+ D G 
Sbjct: 73  KIAAIGSANGIKKLVIGQYG-LLSTPAASHIMRTYEEECTGGIILTASHNPGGPENDMGI 131

Query: 165 KVYYTNGCQIIPPHDHGIAETINNNLEPWSTDWNFTKILSN-----------AETDGK-- 211
           K   +NG            E++ N +      W+ +K L+N            +T GK  
Sbjct: 132 KYNLSNGGP--------APESVTNAI------WDISKKLTNYKIVKDFPELDLKTIGKNK 177

Query: 212 ------IEYVR-KRMLTSYLNSVVNQLIQRDFA--APDEKPW-FVYTPMHGVGHQIFSTI 261
                 I+ +   +    +L  + +  + + F       K W  ++  M+GV       I
Sbjct: 178 KYGPLLIDVIDITKAYVDFLKKIFDFDLIKKFIDNQRSTKNWKLLFDSMNGVTGPYGKAI 237

Query: 262 LNESLNLKDNIDYITVPEQKDPDPSFRTVSFPNPEEKGALNLAITLAEANGIKLVLANDP 321
             +   L        V +   P P F  +  P+P    A +L +   +   I+   A+D 
Sbjct: 238 FVDEFGLPAE----EVLQNWHPSPDFGGMH-PDPNLTYASSL-VKRVDREKIEFGAASDG 291

Query: 322 NADRFSVAVRDDSKNEWKQLTGNEIGLLFAFYEFKMYQKAADKGIKNKPLAMLNSTVSAQ 381
           + DR  +     S        G+ + ++  +     Y   A +GI      +  S  ++ 
Sbjct: 292 DGDRNMIYGYGPSFVS----PGDSVAIIAEYAAEIPY--FAKQGI----YGLARSFPTSA 341

Query: 382 VIKRMAEKEGFLYKDTLTGFKWIGN--EAAKLEEKGYFVPFGYEEAIGYMFPAMEH--DK 437
            I R+A+  G    +  TG+K+     +A KL   G       EE+ G       H  +K
Sbjct: 342 AIDRVAKAHGLNCYEVPTGWKFFCALFDAKKLSICG-------EESFG---TGSNHVREK 391

Query: 438 DGVSAAIVFLQAYANW----LQSSSNPIDIIHECYDKYGVSAEYNGYYIVSDPSKTDKVF 493
           DGV A + +L   A +     ++ ++   I +E + KYG +      +   +  K +K+ 
Sbjct: 392 DGVWAVMAWLNILAIYNKHHPENEASIKTIQNEFWAKYGRTFFTRYDFEKVESEKANKIV 451

Query: 494 ESIRSSYTSMGL---SFPESIGEHFRVTEFRDLT-IGFDSTTADKKPLLPVDKNSQMITI 549
           + +R+  T  G+   +FP    E  +VT+  D +    D + +D + L     N     +
Sbjct: 452 DQLRAYVTKSGVINSAFPAD--ESLKVTDCGDFSYTDLDGSVSDHQGLYVKLSNGARFVL 509

Query: 550 TAVPSGASNTGESVRFTI 567
               SG  ++G ++R  +
Sbjct: 510 RL--SGTGSSGATIRLYV 525

>KAFR0D03010 Chr4 (594118..595827) [1710 bp, 569 aa] {ON} Anc_2.445
           YKL127W
          Length = 569

 Score = 35.0 bits (79), Expect = 0.68,   Method: Compositional matrix adjust.
 Identities = 34/127 (26%), Positives = 53/127 (41%), Gaps = 15/127 (11%)

Query: 53  GTAGLRARMEAGTNRLNKLVILQASQGLATYIKDKFPQN---LTAVVGHDHRYHSQEFAQ 109
           GT+GLR +     +  N       ++     I +  P+     T VVG D RY++    +
Sbjct: 19  GTSGLRKKTVIFKDEPN------YTENFIQAIMESIPEGSDGATLVVGGDGRYYNDVILE 72

Query: 110 VTAATFIRAGFKVYYLNPHDEFVHTPMVPYSVD--HLNASVGVMITASHN---PKMDNGY 164
             A      G K   +   +  + TP   + +   H   + G+++TASHN   PK D G 
Sbjct: 73  KIAKIGAANGVKKLVVG-QNGLLSTPAASHIIRSYHEKVTGGIILTASHNPGGPKNDMGI 131

Query: 165 KVYYTNG 171
           K    NG
Sbjct: 132 KYNLANG 138

>TBLA0B09010 Chr2 complement(2135961..2137670) [1710 bp, 569 aa]
           {ON} Anc_2.445 YKL127W
          Length = 569

 Score = 34.7 bits (78), Expect = 0.69,   Method: Compositional matrix adjust.
 Identities = 29/111 (26%), Positives = 48/111 (43%), Gaps = 12/111 (10%)

Query: 53  GTAGLRARMEAGTNRLNKLVILQASQGLATYIKDKFPQ---NLTAVVGHDHRYHSQEFAQ 109
           GT+GLR + +   +  N       ++     I D  P+   + T VVG D R+++     
Sbjct: 19  GTSGLRKKTKVFMDEPN------YTENFIQAIMDAIPEGSKDATLVVGGDGRFYNDVIMN 72

Query: 110 VTAATFIRAGFKVYYLNPHDEFVHTPMVPYSVDHLNASV--GVMITASHNP 158
             AA     G K   +   +  + TP   + +      V  G+++TASHNP
Sbjct: 73  KIAAIGAANGVKKLIIG-QNGILSTPAASHIIRTYKDKVTGGIILTASHNP 122

>TPHA0M00210 Chr13 complement(42336..43973) [1638 bp, 545 aa] {ON}
           Anc_6.11 YEL058W
          Length = 545

 Score = 34.7 bits (78), Expect = 0.87,   Method: Compositional matrix adjust.
 Identities = 15/28 (53%), Positives = 19/28 (67%)

Query: 147 SVGVMITASHNPKMDNGYKVYYTNGCQI 174
           +VGVMITASHN   DNG K+   +G  +
Sbjct: 57  AVGVMITASHNQPCDNGVKIVEPDGSML 84

>Suva_13.282 Chr13 complement(457565..459274) [1710 bp, 569 aa] {ON}
           YKL127W (REAL)
          Length = 569

 Score = 34.3 bits (77), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 33/127 (25%), Positives = 55/127 (43%), Gaps = 15/127 (11%)

Query: 53  GTAGLRARMEAGTNRLNKLVILQASQGLATYIKDKFPQN---LTAVVGHDHRYHSQEFAQ 109
           GT+GLR + +   ++ +       ++     + D  P+     T VVG D RY++     
Sbjct: 19  GTSGLRKKTKIFKDQPH------YTENFIQSVLDAIPEGSKGATLVVGGDGRYYNDVILH 72

Query: 110 VTAATFIRAGFKVYYLNPHDEFVHTPMVPYSVDHL--NASVGVMITASHN---PKMDNGY 164
             AA     G K   +  H   + TP   + +       + G+++TASHN   P+ D G 
Sbjct: 73  KIAAISAANGVKKLVIGQHG-LLSTPAASHIMRTYEDKCTGGIILTASHNPGGPENDMGI 131

Query: 165 KVYYTNG 171
           K   +NG
Sbjct: 132 KYNLSNG 138

>ABL029W Chr2 (343850..345556) [1707 bp, 568 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YKL127W (PGM1) and
           YMR105C (PGM2)
          Length = 568

 Score = 33.9 bits (76), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 24/86 (27%), Positives = 43/86 (50%), Gaps = 12/86 (13%)

Query: 90  QNLTAVVGHDHRYHS----QEFAQVTAATFIRAGFKVYYLNPHDEFVHTPMVPYSVD--H 143
           +N   V+G D RY++    Q+ A+V +A  +R       +   +  + TP   + +   H
Sbjct: 53  ENAVLVIGGDGRYYNDAVMQKIAEVGSANGVRK-----LIIGQNGLLSTPAASHIIRTYH 107

Query: 144 LNASVGVMITASHNPKM-DNGYKVYY 168
              + G+++TASHNP   DN + + Y
Sbjct: 108 DKVTGGIILTASHNPGGPDNDFGIKY 133

>Kpol_1018.161 s1018 (412372..414081) [1710 bp, 569 aa] {ON}
           (412372..414081) [1710 nt, 570 aa]
          Length = 569

 Score = 33.9 bits (76), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 33/131 (25%), Positives = 53/131 (40%), Gaps = 23/131 (17%)

Query: 53  GTAGLRARMEAGTNRLNKLVILQASQGLATYIKDKFPQNL---TAVVGHDHRYHS----Q 105
           GT+GLR + +      N       ++       D  P+     T VVG D RY++     
Sbjct: 19  GTSGLRKKTKVFAEEPN------YTENFIQATMDAIPEGCKGATLVVGGDGRYYNDVIMN 72

Query: 106 EFAQVTAATFIRAGFKVYYLNPHDEFVHTPMVPYSVDHLN--ASVGVMITASHN---PKM 160
           +   +  A  +R       +  H+  + TP   + +       + G+++TASHN   PK 
Sbjct: 73  KIVSIAGANGVRK-----LIIGHNGILSTPAASHVIRSYKEKCTGGIILTASHNPGGPKN 127

Query: 161 DNGYKVYYTNG 171
           D G K    NG
Sbjct: 128 DIGIKYNLANG 138

>CAGL0K07480g Chr11 complement(740462..742165) [1704 bp, 567 aa]
           {ON} highly similar to uniprot|P37012 Saccharomyces
           cerevisiae YMR105c PGM2 phosphoglucomutase
          Length = 567

 Score = 33.9 bits (76), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 32/127 (25%), Positives = 53/127 (41%), Gaps = 15/127 (11%)

Query: 53  GTAGLRARMEAGTNRLNKLVILQASQGLATYIKDKFPQ---NLTAVVGHDHRYHSQEFAQ 109
           GT+GLR + +      N       ++     I D  P+   +   VVG D R+++    Q
Sbjct: 17  GTSGLRKKTKVFMEEPN------YTENFIQAIMDAIPEGAKDAVLVVGGDGRFYNDVIMQ 70

Query: 110 VTAATFIRAGFKVYYLNPHDEFVHTPMVPYSVDHL--NASVGVMITASHN---PKMDNGY 164
             AA     G +   +   +  + TP   + +       + G+++TASHN   P+ D G 
Sbjct: 71  KIAAIGAANGVRKLIIG-QNGLLSTPAASHVIRSYAEKCTGGIILTASHNPGGPENDLGI 129

Query: 165 KVYYTNG 171
           K    NG
Sbjct: 130 KYNLANG 136

>NDAI0I02680 Chr9 (630771..631739) [969 bp, 322 aa] {ON} 
          Length = 322

 Score = 33.5 bits (75), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 22/77 (28%), Positives = 35/77 (45%), Gaps = 14/77 (18%)

Query: 449 AYANWLQSSSNPIDI---IHECYDKYGVSAEYNGYYIVSDPSKTDKVFESIRSSYTSM-G 504
            +A W       +D+    HE Y KYG S ++ G Y+ ++           R+ + +  G
Sbjct: 172 TFAFWFYCQPEFMDLGPKAHEIYYKYGWSEQFMGKYLTAEQ----------RAFFNTFGG 221

Query: 505 LSFPESIGEHFRVTEFR 521
              PE +G+ FR  EFR
Sbjct: 222 PKLPELLGKEFRDIEFR 238

>ZYRO0G02508g Chr7 (192411..194120) [1710 bp, 569 aa] {ON} highly
           similar to uniprot|P37012 Saccharomyces cerevisiae
           YMR105C PGM2 Phosphoglucomutase catalyzes the conversion
           from glucose-1-phosphate to glucose-6-phosphate which is
           a key step in hexose metabolism functions as the
           acceptor for a Glc-phosphotransferase and to YKL127W
           uniprot|P33401 Saccharomyces cerevisiae YKL127W PGM1
           Phosphoglucomutase, minor isoform; catalyzes the
           conversion from glucose-1-phosphate to glucose-6-
           phosphate, which is a key step in hexose metabolism
          Length = 569

 Score = 33.5 bits (75), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 34/128 (26%), Positives = 52/128 (40%), Gaps = 16/128 (12%)

Query: 53  GTAGLRARMEAGTNRLNKLVILQASQGLATYIKDKFPQNL---TAVVGHDHRYHSQEFAQ 109
           GT+GLR R +      N       ++     I +  P+ +     +VG D RY++    Q
Sbjct: 19  GTSGLRKRTKVFAEEPNY------TENFIQAILEAIPEGVKDSVLLVGGDGRYYNDVVLQ 72

Query: 110 VTAATFIRAGFKVYYLNPHDEFVHTPMVPY---SVDHLNASVGVMITASHNPKMDN---G 163
             AA     G K   +   +  + TP   +   S      + G+++TASHNP   N   G
Sbjct: 73  KIAAIGAANGVKRLVVG-QNGILSTPAASHVIRSYSKAKVTGGIILTASHNPGGPNNDFG 131

Query: 164 YKVYYTNG 171
            K    NG
Sbjct: 132 IKYNLANG 139

>Suva_11.98 Chr11 (189966..191678) [1713 bp, 570 aa] {ON} YMR105C
           (REAL)
          Length = 570

 Score = 33.5 bits (75), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 35/126 (27%), Positives = 53/126 (42%), Gaps = 12/126 (9%)

Query: 53  GTAGLRARMEAGTNRLNKLVILQASQGLATYIKDKFPQNLTAVVGHDHRYHSQEFAQVTA 112
           GT+GLR + +   N  +        Q +   I +  P   T VVG D R+++       A
Sbjct: 19  GTSGLRKKTKVFMNEPH--YTENFIQAMMECIPEG-PSGATLVVGGDGRFYNDVIMNKIA 75

Query: 113 ATFIRAGFKVYYLNPHDEFVHTPMVPYSV----DHLNASVGVMITASHN---PKMDNGYK 165
           A     G K   +      + TP   + +    D+ N   G+++TASHN   P+ D G K
Sbjct: 76  AVGAANGIKKLVIG-QAGLLSTPAASHIIRTYEDNCNGG-GIILTASHNPGGPENDLGIK 133

Query: 166 VYYTNG 171
               NG
Sbjct: 134 YNLPNG 139

>TBLA0I01380 Chr9 complement(297671..299386) [1716 bp, 571 aa] {ON}
           Anc_2.445 YKL127W
          Length = 571

 Score = 33.5 bits (75), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 37/141 (26%), Positives = 54/141 (38%), Gaps = 16/141 (11%)

Query: 53  GTAGLRARMEAGTNRLNKLVILQASQGLATYIKDKFPQNL---TAVVGHDHRYHSQEFAQ 109
           GT+GLR +        N       ++     I +  P+     T VVG D RY++     
Sbjct: 20  GTSGLRKKTAIFEKEPN------YTENFIQAIMEAIPEGCKGATLVVGGDGRYYNDAILH 73

Query: 110 VTAATFIRAGFKVYYLNPHDEFVHTPMVPYSVDHL---NASVGVMITASHN---PKMDNG 163
             AA     G K   +   +  + TP   + +        + G+++TASHN   PK D G
Sbjct: 74  NIAAIGAANGVKKLIVG-QNGLLSTPAASHIIRTYAPGEITGGIILTASHNPGGPKNDMG 132

Query: 164 YKVYYTNGCQIIPPHDHGIAE 184
            K    NG     P    I E
Sbjct: 133 IKYNIQNGAPAPEPVTEAIWE 153

>CAGL0I02662g Chr9 (237396..239216) [1821 bp, 606 aa] {ON} similar
           to uniprot|P32807 Saccharomyces cerevisiae YMR284w HDF1
           high-affinity DNA-binding protein
          Length = 606

 Score = 33.1 bits (74), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 25/85 (29%), Positives = 35/85 (41%), Gaps = 4/85 (4%)

Query: 141 VDHLNASVGVMITASHNPKMDNGYKVYYTNGCQI-IPPHDHGIAETINNNLEPWSTDWNF 199
           + H N   G       NP ++  YK+ +    Q+ IP  D+ I +     L    T    
Sbjct: 493 ISHFNLKSGYHAEEFRNPALNRHYKLLHDYLLQVEIPQDDNDIRDRY---LREDDTLLKI 549

Query: 200 TKILSNAETDGKIEYVRKRMLTSYL 224
           TKI      D  I+ V KR L+ YL
Sbjct: 550 TKIRERIMKDTTIDDVEKRRLSKYL 574

>NDAI0I01460 Chr9 (345837..347390) [1554 bp, 517 aa] {ON} Anc_6.141
          Length = 517

 Score = 32.3 bits (72), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 37/159 (23%), Positives = 60/159 (37%), Gaps = 20/159 (12%)

Query: 102 YH--SQEFAQVTAATFIRAGFKVYYLNPH----DEFVHTPM-----VPYSVDHLNASVGV 150
           YH  S E   V+       G  +YYLN      D+ ++ P+     VP    H  A  GV
Sbjct: 84  YHDGSAENKNVSFGKVTTGGQSIYYLNDEEVDLDKLINEPLPQVPRVPTFTAHWLAVEGV 143

Query: 151 MITASHNPKMDN--GYKVYYTNGCQIIPPHDHGIAETINNNLEPW-------STDWNFTK 201
                 NP +++    +  +  G  +   +D  +  +  +N           S  ++  K
Sbjct: 144 QPAIIENPNLNDIRASQPPFVRGAIVTALNDTSLQTSTTSNESAMIVSENKESDHFSIVK 203

Query: 202 ILSNAETDGKIEYVRKRMLTSYLNSVVNQLIQRDFAAPD 240
              N E    +++V  + L  Y N V+  LI  D   PD
Sbjct: 204 PGQNTEVKPLVKHVLSKELQIYFNKVIAALITTDTENPD 242

>Smik_11.172 Chr11 (292597..293139) [543 bp, 180 aa] {ON} YKL069W
           (REAL)
          Length = 180

 Score = 31.6 bits (70), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 18/63 (28%), Positives = 27/63 (42%), Gaps = 10/63 (15%)

Query: 423 EEAIGYMFPAMEHDKDGVSAAIVFLQAYANWLQSSSNPIDIIHECYDKYGVSAEYNGYYI 482
           EE +G +  + E   DG            NW+ + SN   +I   Y   GVS  + G+Y+
Sbjct: 22  EEVLGQLLLSYEGLSDG----------QVNWVCNLSNASSLIWHAYKSLGVSVNWAGFYV 71

Query: 483 VSD 485
             D
Sbjct: 72  TQD 74

>KNAG0A06280 Chr1 (955994..957706) [1713 bp, 570 aa] {ON} 
          Length = 570

 Score = 32.3 bits (72), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 25/91 (27%), Positives = 44/91 (48%), Gaps = 14/91 (15%)

Query: 90  QNLTAVVGHDHRYHS----QEFAQVTAATFIRAGFKVYYLNPHDEFVHTPMVPYSVDHLN 145
           ++ T V+G D R+++     + A ++AA  +R       +   +  + TP   Y +    
Sbjct: 54  KDATLVIGGDGRFYNDVVINKIAAISAANGVRK-----LVIGQNGLLSTPATSYIIRSYK 108

Query: 146 --ASVGVMITASHN---PKMDNGYKVYYTNG 171
             A+ G+++TASHN   P+ D G K    NG
Sbjct: 109 DKATGGIILTASHNPGGPENDMGIKYNLANG 139

>Skud_11.102 Chr11 (190406..192118) [1713 bp, 570 aa] {ON} YKL127W
           (REAL)
          Length = 570

 Score = 32.3 bits (72), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 26/90 (28%), Positives = 38/90 (42%), Gaps = 9/90 (10%)

Query: 89  PQNLTAVVGHDHRYHSQEFAQVTAATFIRAGFKVYYLNPHDEFVHTPMVPYSV----DHL 144
           P   T VVG D R+++       AA     G +   +      + TP   + +    D  
Sbjct: 52  PDGATLVVGGDGRFYNDVIMNKIAAVGAANGIRKLIIG-QGGLLSTPAASHIIRTYEDRC 110

Query: 145 NASVGVMITASHN---PKMDNGYKVYYTNG 171
           N   G+++TASHN   P+ D G K    NG
Sbjct: 111 NGG-GIILTASHNPGGPENDLGIKYNLRNG 139

>Ecym_6292 Chr6 (547563..548855) [1293 bp, 430 aa] {ON} similar to
           Ashbya gossypii AEL170C
          Length = 430

 Score = 32.0 bits (71), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 16/57 (28%), Positives = 29/57 (50%)

Query: 472 GVSAEYNGYYIVSDPSKTDKVFESIRSSYTSMGLSFPESIGEHFRVTEFRDLTIGFD 528
           G+       Y +S P++ D+ F  I  +   +G+S+ +  G HF +T+F  + I  D
Sbjct: 300 GIQRALECGYFLSMPNEFDRKFSIIYKALDYLGVSYTKPQGAHFIITDFSKVKIPED 356

>Kwal_14.1443 s14 complement(326134..329646) [3513 bp, 1170 aa] {ON}
           [contig 242] FULL
          Length = 1170

 Score = 32.3 bits (72), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 33/133 (24%), Positives = 59/133 (44%), Gaps = 18/133 (13%)

Query: 170 NGCQIIPPHDHGIAETINNNLEPWSTDWNFTKILSNAETDGKIEYVRKRMLTSYLNSVVN 229
           N   ++ P D G+   +   +   +T+W  +  +     DGK+ Y    +LT+++N+ +N
Sbjct: 575 NTTHVLQPLDVGVFSNLKKKVRSLATEWCPSPSMG---PDGKLRYGHFDILTNFMNA-LN 630

Query: 230 QLIQRDFAAPDEKPWFV----YTPMHGVGHQIFSTIL---NESLNLKD----NIDYITVP 278
           Q +  DF        FV    Y P   + +    T++   +   N+KD    NI  IT  
Sbjct: 631 QTLLHDFEQSKIAQAFVTAGIYPPEKSLFNPAVRTVMKHFDAHANMKDIFLRNILPIT-- 688

Query: 279 EQKDPDPSFRTVS 291
            Q +  P  RT++
Sbjct: 689 -QCNNKPRTRTIA 700

>NCAS0G03810 Chr7 complement(703842..705827) [1986 bp, 661 aa] {ON} 
          Length = 661

 Score = 32.3 bits (72), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 17/62 (27%), Positives = 34/62 (54%), Gaps = 7/62 (11%)

Query: 536 PLLPVDKNSQMITITAVPSGASNTGESVRFTIRGSGTEPKLKVYIEGISSTEGRARILAK 595
           P+ PV K SQ + ++++P+   NT +S  F ++ + T      Y++  + TE   + L K
Sbjct: 393 PMQPVQK-SQTLPVSSIPTNLQNTNKSSPFNLKSTTT------YVDSETQTETPKQTLNK 445

Query: 596 SL 597
           ++
Sbjct: 446 AI 447

>SAKL0E13310g Chr5 (1098632..1100923) [2292 bp, 763 aa] {ON}
           conserved hypothetical protein
          Length = 763

 Score = 31.6 bits (70), Expect = 8.3,   Method: Compositional matrix adjust.
 Identities = 28/103 (27%), Positives = 46/103 (44%), Gaps = 27/103 (26%)

Query: 123 YYLNPHDEFVHTPMVPYSVDHLNASVGVMITASHNPKMDNGYKVYYTNGCQIIPPHDHGI 182
           Y++N +D+ V T  VP                   PK  +G+K        + P HD GI
Sbjct: 40  YHMNTYDDPVDTTQVPA------------------PKFGDGFK-----DSHVQPSHDSGI 76

Query: 183 AETINNNLEPWSTDWNFT-KILSNAETDGKIEYVRKRMLTSYL 224
             +   N++   T    T K ++ ++TDG +E +R+R+ T  L
Sbjct: 77  QSS---NVDYTITSTTSTQKKVTKSKTDGDLEDLRERLPTPPL 116

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.316    0.133    0.395 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 69,146,623
Number of extensions: 3120675
Number of successful extensions: 8665
Number of sequences better than 10.0: 87
Number of HSP's gapped: 8814
Number of HSP's successfully gapped: 88
Length of query: 617
Length of database: 53,481,399
Length adjustment: 116
Effective length of query: 501
Effective length of database: 40,180,143
Effective search space: 20130251643
Effective search space used: 20130251643
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 69 (31.2 bits)