Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
CAGL0M02959g8.839ON75875838030.0
ZYRO0G14168g8.839ON76479125000.0
TDEL0B005808.839ON71363924990.0
KAFR0B039108.839ON72464924760.0
NCAS0C004208.839ON72565123840.0
TBLA0D032608.839ON76867823520.0
Kpol_1068.98.839ON74558023240.0
TPHA0I002408.839ON73265122640.0
NDAI0K004208.839ON77864322650.0
YMR277W (FCP1)8.839ON73266222400.0
Skud_13.4498.839ON73466322330.0
Smik_13.4908.839ON73260622140.0
Suva_13.4658.839ON73260521960.0
KNAG0J002808.839ON74266421750.0
SAKL0D01496g8.839ON68865120700.0
Ecym_46108.839ON75171120500.0
Kwal_27.102638.839ON74365319950.0
ABL127W8.839ON72870119730.0
KLTH0C03894g8.839ON74559719580.0
KLLA0D01595g8.839ON71965319190.0
TPHA0E030705.202ON494561020.001
NDAI0C032305.94ON10341011010.002
NCAS0A068005.202ON47351970.005
SAKL0G12870g5.202ON39960960.006
KNAG0M017405.202ON48145960.007
Suva_10.995.202ON38545940.010
KLLA0F15620g5.202ON41445920.018
ZYRO0B10428g5.202ON48245920.020
YLL010C (PSR1)5.202ON42743920.020
Kpol_1010.615.94ON93298930.021
Smik_12.535.202ON41443920.022
TBLA0C060905.202ON484122920.023
YLR019W (PSR2)5.202ON39745910.024
Suva_10.655.202ON41543910.024
CAGL0K02959g2.530ON464326910.025
TPHA0N006705.202ON45243910.028
Smik_12.825.202ON39245900.030
SAKL0G15620g5.94ON87994910.031
Skud_8.492.530ON447129900.031
Smik_8.532.530ON446103900.035
CAGL0D03234g5.202ON41045890.048
NDAI0I021705.202ON39145880.053
NDAI0D018605.202ON51451880.061
YHR004C (NEM1)2.530ON446103880.061
Skud_12.875.202ON39245870.075
Skud_12.575.202ON41543870.081
TDEL0E042705.202ON45345870.083
Kpol_2002.1005.202ON47750860.10
NCAS0D027405.202ON39845850.13
TBLA0I014602.530ON393103840.18
TPHA0H010705.94ON101585830.27
KNAG0C058502.530ON443103820.28
CAGL0D05610g5.202ON44740820.34
NCAS0F009302.530ON422156810.39
Ecym_71045.202ON49240810.42
KAFR0E021405.94ON95183810.52
KAFR0J009905.202ON48345800.54
AAL158W5.202ON47845800.60
SAKL0A09416g2.530ON385103790.70
Suva_8.582.530ON452103790.71
Kpol_1050.635.94ON105892790.80
Kpol_478.165.202ON35093771.1
Kwal_33.151405.202ON41060771.2
Ecym_50527.46ON873124761.9
ADR369C7.46ON82792743.0
KLTH0B03388g5.202ON40960733.7
Ecym_72764.156ON59335725.1
Ecym_20665.94ON88098725.2
Ecym_32852.248ON74685725.5
SAKL0H20592g4.156ON50855725.5
TPHA0A051105.94ON106581726.0
YPL063W (TIM50)8.527ON476100708.1
TDEL0F030703.425ON87773718.1
KLLA0E15621g5.94ON89169718.2
ZYRO0F02640gsingletonON102989709.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0M02959g
         (758 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0M02959g Chr13 (332990..335266) [2277 bp, 758 aa] {ON} simil...  1469   0.0  
ZYRO0G14168g Chr7 (1128601..1130895) [2295 bp, 764 aa] {ON} simi...   967   0.0  
TDEL0B00580 Chr2 complement(111408..113549) [2142 bp, 713 aa] {O...   967   0.0  
KAFR0B03910 Chr2 (811940..814114) [2175 bp, 724 aa] {ON} Anc_8.8...   958   0.0  
NCAS0C00420 Chr3 complement(65252..67429) [2178 bp, 725 aa] {ON}...   922   0.0  
TBLA0D03260 Chr4 (810350..812656) [2307 bp, 768 aa] {ON} Anc_8.8...   910   0.0  
Kpol_1068.9 s1068 complement(15966..18203) [2238 bp, 745 aa] {ON...   899   0.0  
TPHA0I00240 Chr9 (43854..46052) [2199 bp, 732 aa] {ON} Anc_8.839...   876   0.0  
NDAI0K00420 Chr11 complement(94101..96437) [2337 bp, 778 aa] {ON...   877   0.0  
YMR277W Chr13 (820256..822454) [2199 bp, 732 aa] {ON}  FCP1Carbo...   867   0.0  
Skud_13.449 Chr13 (793592..795796) [2205 bp, 734 aa] {ON} YMR277...   864   0.0  
Smik_13.490 Chr13 (803288..805486) [2199 bp, 732 aa] {ON} YMR277...   857   0.0  
Suva_13.465 Chr13 (802947..805145) [2199 bp, 732 aa] {ON} YMR277...   850   0.0  
KNAG0J00280 Chr10 complement(41831..44059) [2229 bp, 742 aa] {ON...   842   0.0  
SAKL0D01496g Chr4 complement(120202..122268) [2067 bp, 688 aa] {...   801   0.0  
Ecym_4610 Chr4 (1188871..1191126) [2256 bp, 751 aa] {ON} similar...   794   0.0  
Kwal_27.10263 s27 complement(268744..270975) [2232 bp, 743 aa] {...   773   0.0  
ABL127W Chr2 (156798..158984) [2187 bp, 728 aa] {ON} Syntenic ho...   764   0.0  
KLTH0C03894g Chr3 complement(339897..342134) [2238 bp, 745 aa] {...   758   0.0  
KLLA0D01595g Chr4 complement(141459..143618) [2160 bp, 719 aa] {...   743   0.0  
TPHA0E03070 Chr5 (644651..646135) [1485 bp, 494 aa] {ON} Anc_5.2...    44   0.001
NDAI0C03230 Chr3 (734531..737635) [3105 bp, 1034 aa] {ON} Anc_5....    44   0.002
NCAS0A06800 Chr1 (1346677..1348098) [1422 bp, 473 aa] {ON} Anc_5...    42   0.005
SAKL0G12870g Chr7 (1100535..1101734) [1200 bp, 399 aa] {ON} simi...    42   0.006
KNAG0M01740 Chr13 (321477..322922) [1446 bp, 481 aa] {ON} Anc_5....    42   0.007
Suva_10.99 Chr10 (186341..187498) [1158 bp, 385 aa] {ON} YLR019W...    41   0.010
KLLA0F15620g Chr6 complement(1441560..1442804) [1245 bp, 414 aa]...    40   0.018
ZYRO0B10428g Chr2 (823155..824603) [1449 bp, 482 aa] {ON} simila...    40   0.020
YLL010C Chr12 complement(129330..130613) [1284 bp, 427 aa] {ON} ...    40   0.020
Kpol_1010.61 s1010 (148944..151325,151327..151743) [2799 bp, 932...    40   0.021
Smik_12.53 Chr12 complement(116428..117672) [1245 bp, 414 aa] {O...    40   0.022
TBLA0C06090 Chr3 complement(1478726..1480180) [1455 bp, 484 aa] ...    40   0.023
YLR019W Chr12 (180288..181481) [1194 bp, 397 aa] {ON}  PSR2Funct...    40   0.024
Suva_10.65 Chr10 complement(134276..135523) [1248 bp, 415 aa] {O...    40   0.024
CAGL0K02959g Chr11 complement(262936..264330) [1395 bp, 464 aa] ...    40   0.025
TPHA0N00670 Chr14 complement(147329..148687) [1359 bp, 452 aa] {...    40   0.028
Smik_12.82 Chr12 (167115..168293) [1179 bp, 392 aa] {ON} YLR019W...    39   0.030
SAKL0G15620g Chr7 (1342049..1344688) [2640 bp, 879 aa] {ON} some...    40   0.031
Skud_8.49 Chr8 complement(93604..94947) [1344 bp, 447 aa] {ON} Y...    39   0.031
Smik_8.53 Chr8 complement(90635..91975) [1341 bp, 446 aa] {ON} Y...    39   0.035
CAGL0D03234g Chr4 (334913..336145) [1233 bp, 410 aa] {ON} simila...    39   0.048
NDAI0I02170 Chr9 (498399..499574) [1176 bp, 391 aa] {ON} Anc_5.202     39   0.053
NDAI0D01860 Chr4 (437370..438914) [1545 bp, 514 aa] {ON} Anc_5.202     39   0.061
YHR004C Chr8 complement(111754..113094) [1341 bp, 446 aa] {ON}  ...    39   0.061
Skud_12.87 Chr12 (172096..173274) [1179 bp, 392 aa] {ON} YLR019W...    38   0.075
Skud_12.57 Chr12 complement(120706..121953) [1248 bp, 415 aa] {O...    38   0.081
TDEL0E04270 Chr5 (798352..799713) [1362 bp, 453 aa] {ON} Anc_5.2...    38   0.083
Kpol_2002.100 s2002 complement(238947..240380) [1434 bp, 477 aa]...    38   0.10 
NCAS0D02740 Chr4 complement(525116..526312) [1197 bp, 398 aa] {O...    37   0.13 
TBLA0I01460 Chr9 complement(318104..319285) [1182 bp, 393 aa] {O...    37   0.18 
TPHA0H01070 Chr8 (229632..232679) [3048 bp, 1015 aa] {ON} Anc_5....    37   0.27 
KNAG0C05850 Chr3 (1138155..1139486) [1332 bp, 443 aa] {ON} Anc_2...    36   0.28 
CAGL0D05610g Chr4 complement(534849..536192) [1344 bp, 447 aa] {...    36   0.34 
NCAS0F00930 Chr6 (187211..188479) [1269 bp, 422 aa] {ON} Anc_2.5...    36   0.39 
Ecym_7104 Chr7 (203366..204844) [1479 bp, 492 aa] {ON} similar t...    36   0.42 
KAFR0E02140 Chr5 (426065..428920) [2856 bp, 951 aa] {ON} Anc_5.9...    36   0.52 
KAFR0J00990 Chr10 complement(178980..180431) [1452 bp, 483 aa] {...    35   0.54 
AAL158W Chr1 (67892..69328) [1437 bp, 478 aa] {ON} Syntenic homo...    35   0.60 
SAKL0A09416g Chr1 complement(820552..821709) [1158 bp, 385 aa] {...    35   0.70 
Suva_8.58 Chr8 complement(108197..109555) [1359 bp, 452 aa] {ON}...    35   0.71 
Kpol_1050.63 s1050 (138268..141444) [3177 bp, 1058 aa] {ON} (138...    35   0.80 
Kpol_478.16 s478 complement(58800..59852) [1053 bp, 350 aa] {ON}...    34   1.1  
Kwal_33.15140 s33 complement(975769..977001) [1233 bp, 410 aa] {...    34   1.2  
Ecym_5052 Chr5 (112351..114972) [2622 bp, 873 aa] {ON} similar t...    34   1.9  
ADR369C Chr4 complement(1362309..1364792) [2484 bp, 827 aa] {ON}...    33   3.0  
KLTH0B03388g Chr2 (272914..274143) [1230 bp, 409 aa] {ON} simila...    33   3.7  
Ecym_7276 Chr7 complement(579526..581307) [1782 bp, 593 aa] {ON}...    32   5.1  
Ecym_2066 Chr2 complement(110523..113165) [2643 bp, 880 aa] {ON}...    32   5.2  
Ecym_3285 Chr3 complement(539184..541424) [2241 bp, 746 aa] {ON}...    32   5.5  
SAKL0H20592g Chr8 complement(1805321..1806847) [1527 bp, 508 aa]...    32   5.5  
TPHA0A05110 Chr1 (1149460..1152657) [3198 bp, 1065 aa] {ON} Anc_...    32   6.0  
YPL063W Chr16 (429939..431369) [1431 bp, 476 aa] {ON}  TIM50Esse...    32   8.1  
TDEL0F03070 Chr6 (559392..562025) [2634 bp, 877 aa] {ON} Anc_3.4...    32   8.1  
KLLA0E15621g Chr5 complement(1397950..1400625) [2676 bp, 891 aa]...    32   8.2  
ZYRO0F02640g Chr6 complement(209802..212891) [3090 bp, 1029 aa] ...    32   9.7  

>CAGL0M02959g Chr13 (332990..335266) [2277 bp, 758 aa] {ON} similar
           to uniprot|Q03254 Saccharomyces cerevisiae YMR277w FCP1
          Length = 758

 Score = 1469 bits (3803), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 729/758 (96%), Positives = 729/758 (96%)

Query: 1   MSTPVLTPMGLPYPITVDELMVPIGSYVEKGQRLFAYKFWYMVEIANSPDDNDIDYEGPE 60
           MSTPVLTPMGLPYPITVDELMVPIGSYVEKGQRLFAYKFWYMVEIANSPDDNDIDYEGPE
Sbjct: 1   MSTPVLTPMGLPYPITVDELMVPIGSYVEKGQRLFAYKFWYMVEIANSPDDNDIDYEGPE 60

Query: 61  IEKSKRKVRESIEFYEAPFEGDLLSWNVDEKDEIAGPNMAVCEIKRPCNHDIVYGGLCTM 120
           IEKSKRKVRESIEFYEAPFEGDLLSWNVDEKDEIAGPNMAVCEIKRPCNHDIVYGGLCTM
Sbjct: 61  IEKSKRKVRESIEFYEAPFEGDLLSWNVDEKDEIAGPNMAVCEIKRPCNHDIVYGGLCTM 120

Query: 121 CGKEVDEYDQVDANLTISHTDTNLRVSRKEAIDLDKQITTRLKNEKKLVLVVDLDQTVIH 180
           CGKEVDEYDQVDANLTISHTDTNLRVSRKEAIDLDKQITTRLKNEKKLVLVVDLDQTVIH
Sbjct: 121 CGKEVDEYDQVDANLTISHTDTNLRVSRKEAIDLDKQITTRLKNEKKLVLVVDLDQTVIH 180

Query: 181 CGVDPTIGEWKADPSNPNYETLKDVKCFSLEEEPILPLIYMGPKPPVRTCWYYVKIRPGL 240
           CGVDPTIGEWKADPSNPNYETLKDVKCFSLEEEPILPLIYMGPKPPVRTCWYYVKIRPGL
Sbjct: 181 CGVDPTIGEWKADPSNPNYETLKDVKCFSLEEEPILPLIYMGPKPPVRTCWYYVKIRPGL 240

Query: 241 KEFFEKIAPLYEMHIYTMATRAYALEIAKIIDPDKSLFGDRILSRDENGSLTQKSLTRLF 300
           KEFFEKIAPLYEMHIYTMATRAYALEIAKIIDPDKSLFGDRILSRDENGSLTQKSLTRLF
Sbjct: 241 KEFFEKIAPLYEMHIYTMATRAYALEIAKIIDPDKSLFGDRILSRDENGSLTQKSLTRLF 300

Query: 301 PTDQSMVVVIDDRGDVWNWCPNLIKVVPYNFFVGVGDINSNFLPKQQTTMLQLGRRTRQK 360
           PTDQSMVVVIDDRGDVWNWCPNLIKVVPYNFFVGVGDINSNFLPKQQTTMLQLGRRTRQK
Sbjct: 301 PTDQSMVVVIDDRGDVWNWCPNLIKVVPYNFFVGVGDINSNFLPKQQTTMLQLGRRTRQK 360

Query: 361 IKESEELLTDIMDTEKKLQEKIDEEVKRQEEKLNHQMATAEESTDQESKEKIAKKLEFSA 420
           IKESEELLTDIMDTEKKLQEKIDEEVKRQEEKLNHQMATAEESTDQESKEKIAKKLEFSA
Sbjct: 361 IKESEELLTDIMDTEKKLQEKIDEEVKRQEEKLNHQMATAEESTDQESKEKIAKKLEFSA 420

Query: 421 SLEVQQQNRPLAKLQKHLHDQRLLIDDDDELFYLKDTLAYIHKEFYHLLEDASDQNEADI 480
           SLEVQQQNRPLAKLQKHLHDQRLLIDDDDELFYLKDTLAYIHKEFYHLLEDASDQNEADI
Sbjct: 421 SLEVQQQNRPLAKLQKHLHDQRLLIDDDDELFYLKDTLAYIHKEFYHLLEDASDQNEADI 480

Query: 481 TMLLPKLKKKVFKECHFVFSGLIPLGTDIKRADIVIWTSLFGAESTSDIDEHTTHVVTKT 540
           TMLLPKLKKKVFKECHFVFSGLIPLGTDIKRADIVIWTSLFGAESTSDIDEHTTHVVTKT
Sbjct: 481 TMLLPKLKKKVFKECHFVFSGLIPLGTDIKRADIVIWTSLFGAESTSDIDEHTTHVVTKT 540

Query: 541 PGTYKARLAKAFNPDIKVVHPDWIFECLASWKRIDEKPYLLIVEQPVSEDXXXXXXXXXX 600
           PGTYKARLAKAFNPDIKVVHPDWIFECLASWKRIDEKPYLLIVEQPVSED          
Sbjct: 541 PGTYKARLAKAFNPDIKVVHPDWIFECLASWKRIDEKPYLLIVEQPVSEDELIEFKKKLE 600

Query: 601 XXXXXXXXXXXXXXXXXXXRANQMEPTMPLFGGDTSWLNDDEDEVEFGSDDDNSDEDSLI 660
                              RANQMEPTMPLFGGDTSWLNDDEDEVEFGSDDDNSDEDSLI
Sbjct: 601 QKKKKLEELEIEEEEELNERANQMEPTMPLFGGDTSWLNDDEDEVEFGSDDDNSDEDSLI 660

Query: 661 SEDTDNGLAANGNSSESSITNKVPEATEDVLNNPSDTQNEEDQIPNGNGNHLPKRPIDDV 720
           SEDTDNGLAANGNSSESSITNKVPEATEDVLNNPSDTQNEEDQIPNGNGNHLPKRPIDDV
Sbjct: 661 SEDTDNGLAANGNSSESSITNKVPEATEDVLNNPSDTQNEEDQIPNGNGNHLPKRPIDDV 720

Query: 721 SENAHEMASKKQLTSKDDDRSSDVESDFEEDLLNALDD 758
           SENAHEMASKKQLTSKDDDRSSDVESDFEEDLLNALDD
Sbjct: 721 SENAHEMASKKQLTSKDDDRSSDVESDFEEDLLNALDD 758

>ZYRO0G14168g Chr7 (1128601..1130895) [2295 bp, 764 aa] {ON} similar
           to uniprot|Q03254 Saccharomyces cerevisiae YMR277W FCP1
           Carboxy-terminal domain (CTD) phosphatase
          Length = 764

 Score =  967 bits (2500), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 485/791 (61%), Positives = 588/791 (74%), Gaps = 62/791 (7%)

Query: 1   MSTPVLTPMGLPYPITVDELMVPIGSYVEKGQRLFAYKFWYMVEIANSPDDNDIDYEGPE 60
           M+TPV+ P  LPYPIT+D+L+ PIGS V+KGQRLFAYKFWYMVEIA+SPD+ND +     
Sbjct: 1   MATPVIAPESLPYPITIDQLIAPIGSTVKKGQRLFAYKFWYMVEIASSPDENDGNGGA-- 58

Query: 61  IEKSKRKVRESIEFYEAPFEGDLLSWNVDEKDEIAGPNMAVCEIKRPCNHDIVYGGLCTM 120
            + SK+ VRESIEF+E+PFEGDL+SW VD  DE+A     +CEI RPCNHD+VYGGLCTM
Sbjct: 59  -QHSKKTVRESIEFFESPFEGDLVSWEVDRGDEVASARQVICEIMRPCNHDVVYGGLCTM 117

Query: 121 CGKEVDEYDQVDANLTISHTDTNLRVSRKEAIDLDKQITTRLKNEKKLVLVVDLDQTVIH 180
           CGKEVDE DQ++ANL ISHTDTNL+VSRKEA D++  +  RL+  KKLVLVVDLDQTVIH
Sbjct: 118 CGKEVDENDQMEANLAISHTDTNLKVSRKEAEDMEHFLKQRLRQSKKLVLVVDLDQTVIH 177

Query: 181 CGVDPTIGEWKADPSNPNYETLKDVKCFSLEEEPILPLIYMGPKPPVRTCWYYVKIRPGL 240
           CGVDPTIGEWK DPSNPNYETLKDV+ FSLEEEPI+P +YMGP+ P R CWY+VK+RPGL
Sbjct: 178 CGVDPTIGEWKKDPSNPNYETLKDVQMFSLEEEPIVPPMYMGPRLPERKCWYFVKVRPGL 237

Query: 241 KEFFEKIAPLYEMHIYTMATRAYALEIAKIIDPDKSLFGDRILSRDENGSLTQKSLTRLF 300
           +EFF ++APLYEMHIYTMATR YALEIAKIIDPD SLFGDRILSRDENGSLTQKSL RLF
Sbjct: 238 REFFAQLAPLYEMHIYTMATRTYALEIAKIIDPDGSLFGDRILSRDENGSLTQKSLERLF 297

Query: 301 PTDQSMVVVIDDRGDVWNWCPNLIKVVPYNFFVGVGDINSNFLPKQQTTMLQLGRRTRQK 360
           PTDQSMV+VIDDRGDVWNWCPNLIKVVPYNFFVGVGDINSNFLP+QQ+ +LQLGRRT +K
Sbjct: 298 PTDQSMVIVIDDRGDVWNWCPNLIKVVPYNFFVGVGDINSNFLPRQQSGLLQLGRRTHKK 357

Query: 361 IKESEELLTDIMDTEKKLQEKIDEEVKRQEEKLNHQMATAEESTDQESKEKIAKKLEFSA 420
            +ES+ELLTDIMDTEK+LQEKIDEEVKRQEEKL+HQ+ T +E    ESKE++ KKLE+SA
Sbjct: 358 PQESDELLTDIMDTEKRLQEKIDEEVKRQEEKLSHQLTTNDEPVQGESKEQLTKKLEYSA 417

Query: 421 SLEVQQQNRPLAKLQKHLHDQRLLIDDDDELFYLKDTLAYIHKEFYHLLEDASDQNEADI 480
           SLEVQQQNRPLA LQKH+H+QRLL+DDDDEL+YLKDTLA IH+++Y LL D  ++N ADI
Sbjct: 418 SLEVQQQNRPLATLQKHMHNQRLLVDDDDELYYLKDTLAKIHRKYYKLL-DEGNENSADI 476

Query: 481 TMLLPKLKKKVFKECHFVFSGLIPLGTDIKRADIVIWTSLFGAESTSDIDEHTTHVVTKT 540
             L+P +K +VFK+C+FVFSGLIPLGT+I+RADIV+WT +FGA ++S+IDE+TTHV+TKT
Sbjct: 477 QSLVPTMKGQVFKDCYFVFSGLIPLGTNIRRADIVLWTGMFGAITSSEIDENTTHVITKT 536

Query: 541 PGTYKARLAKAFNPDIKVVHPDWIFECLASWKRIDEKPYLLIVEQPVSEDXXXXXXXXXX 600
           PGTYKAR+AK FN ++KVVHPDW+FECL +W  +DEKPY LI++ P +E+          
Sbjct: 537 PGTYKARIAKGFNENVKVVHPDWVFECLVTWTHVDEKPYELIIQDPATEEEIQDFKRKIE 596

Query: 601 XXXXXXXXXXXXXXXXXXXRANQMEPTMPLFGGDTSWLNDDEDEVE-------------- 646
                              +  Q + T+ LF G TSWLND+++E+               
Sbjct: 597 QRHLIEEQRREQFESEALMKTAQ-DSTLNLFAGGTSWLNDEDEEISEDEEDDNDDEEEEE 655

Query: 647 --------FGSDD--DNSDEDSLISEDTDNGLAAN----------GNSSESSITNKVPEA 686
                   +G++D  D  +ED+   E+  +    N              +     K PE+
Sbjct: 656 EEDVADGGYGANDIPDGGNEDNRNKENDSDRAPTNQQDQQDQKQDQGGEKPQEQTKDPES 715

Query: 687 TEDVLNNPSDTQNEEDQIPNGNGNHLPKRPIDDVSENAHEMASKKQLTSKDDDRSSDVES 746
            +  L N SD+Q+ EDQ P+    HL         EN+              +R  D ES
Sbjct: 716 LKRALQN-SDSQSSEDQ-PSQKKVHL---------ENSK------------GNREDDSES 752

Query: 747 DFEEDLLNALD 757
           D EE+LLNALD
Sbjct: 753 DLEEELLNALD 763

>TDEL0B00580 Chr2 complement(111408..113549) [2142 bp, 713 aa] {ON}
           Anc_8.839 YMR277W
          Length = 713

 Score =  967 bits (2499), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 454/639 (71%), Positives = 528/639 (82%), Gaps = 13/639 (2%)

Query: 1   MSTPVLTPMGLPYPITVDELMVPIGSYVEKGQRLFAYKFWYMVEIANSPDDNDIDYEGPE 60
           M+TPV +P  LPYPIT+D+L+ PIGS+VEKGQRLFA+KFWYMVEIA+SPD+N+  +    
Sbjct: 1   MTTPVFSPEVLPYPITIDQLIAPIGSHVEKGQRLFAFKFWYMVEIASSPDENEGGHR--- 57

Query: 61  IEKSKRKVRESIEFYEAPFEGDLLSWNVDEKDEIAGPNMAVCEIKRPCNHDIVYGGLCTM 120
               K+ VRESIEF+EAPFEGDL+SWNVD  DE+  PN A+CEI RPCNHDIVYGGLCT+
Sbjct: 58  ----KKTVRESIEFFEAPFEGDLMSWNVDVGDEVVAPNQAICEISRPCNHDIVYGGLCTL 113

Query: 121 CGKEVDEYDQVDANLTISHTDTNLRVSRKEAIDLDKQITTRLKNEKKLVLVVDLDQTVIH 180
           CGKEVDE +Q + NL ISHTD NL+VSRKEA D++  + TRL+  KKLVLVVDLDQTVIH
Sbjct: 114 CGKEVDESEQFNGNLAISHTDVNLKVSRKEATDIENNLKTRLRESKKLVLVVDLDQTVIH 173

Query: 181 CGVDPTIGEWKADPSNPNYETLKDVKCFSLEEEPILPLIYMGPKPPVRTCWYYVKIRPGL 240
           CGVDPTIGEWK D SNPNYE LKDV+ F+L+EEPILPL+YMGPKPPVR CWYYVK+RPGL
Sbjct: 174 CGVDPTIGEWKRDSSNPNYEALKDVQSFALDEEPILPLLYMGPKPPVRKCWYYVKVRPGL 233

Query: 241 KEFFEKIAPLYEMHIYTMATRAYALEIAKIIDPDKSLFGDRILSRDENGSLTQKSLTRLF 300
           KEFF+K+APL+EMHIYTMATRAYALEIAKIIDPD SLFGDRILSRDENGS+TQKSL RLF
Sbjct: 234 KEFFDKVAPLFEMHIYTMATRAYALEIAKIIDPDGSLFGDRILSRDENGSITQKSLERLF 293

Query: 301 PTDQSMVVVIDDRGDVWNWCPNLIKVVPYNFFVGVGDINSNFLPKQQTTMLQLGRRTRQK 360
           PTDQSMVVVIDDRGDVWNWCPNLIKVVPYNFFVGVGDINSNFLP+QQ TMLQLGR  R+K
Sbjct: 294 PTDQSMVVVIDDRGDVWNWCPNLIKVVPYNFFVGVGDINSNFLPRQQNTMLQLGRGARKK 353

Query: 361 IKESEELLTDIMDTEKKLQEKIDEEVKRQEEKLNHQMATAEESTDQESKEKIAKKLEFSA 420
            +ES+EL+TDIMDTEKKLQEKIDEEVKRQEEKLNHQMA+ EE    ESK+++AKKLE+SA
Sbjct: 354 TQESDELITDIMDTEKKLQEKIDEEVKRQEEKLNHQMASGEEVPAPESKDQLAKKLEYSA 413

Query: 421 SLEVQQQNRPLAKLQKHLHDQRLLIDDDDELFYLKDTLAYIHKEFYHLLEDASDQNEADI 480
           SLEVQQQNRPLA LQKH+H+QRLL+DDDDEL YL++ LA +H E+Y  L   S++ +ADI
Sbjct: 414 SLEVQQQNRPLATLQKHMHNQRLLVDDDDELNYLREILAKVHDEYYKTLGQDSEK-KADI 472

Query: 481 TMLLPKLKKKVFKECHFVFSGLIPLGTDIKRADIVIWTSLFGAESTSDIDEHTTHVVTKT 540
             LLP +K KVF++CHFVFSGLIPLGT+I RADIV+WT++FGA+S+ +ID+ TTHV+T+T
Sbjct: 473 KTLLPLMKSKVFEDCHFVFSGLIPLGTNINRADIVLWTNMFGAQSSPEIDDSTTHVITRT 532

Query: 541 PGTYKARLAKAFNPDIKVVHPDWIFECLASWKRIDEKPYLLIVEQPVSEDXXXXXXXXXX 600
           PGTYKAR+AKAFN +IKVVHPDW+FECL SWK +DEKPY LIVEQ  +++          
Sbjct: 533 PGTYKARIAKAFNENIKVVHPDWVFECLVSWKHVDEKPYELIVEQTATDEELGDYKQKLA 592

Query: 601 XXXXXXXXXXXXXXXXXXXRANQMEPTMPLFGGDTSWLN 639
                                     T+ LF G TSWLN
Sbjct: 593 RRSSALAEQEMELAMESAKNG-----TINLFAGGTSWLN 626

>KAFR0B03910 Chr2 (811940..814114) [2175 bp, 724 aa] {ON} Anc_8.839
           YMR277W
          Length = 724

 Score =  958 bits (2476), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 450/649 (69%), Positives = 534/649 (82%), Gaps = 4/649 (0%)

Query: 1   MSTPVLTPMGLPYPITVDELMVPIGSYVEKGQRLFAYKFWYMVEIANSPDDNDIDYEGPE 60
           M+TPVL P GLPYPIT+DEL+ PIG+Y+EKG RLFAYKFWYMVEIA+SPDDND      +
Sbjct: 1   MTTPVLAPEGLPYPITIDELICPIGTYIEKGIRLFAYKFWYMVEIASSPDDNDPANTDTQ 60

Query: 61  IEKSKRKVRESIEFYEAPFEGDLLSWNVDEKDEIAGPNMAVCEIKRPCNHDIVYGGLCTM 120
               K+K+RESIEF++APFEG L+SWN+D  DE++  +  +CEIKRPCNHDIVYGGLCT 
Sbjct: 61  ASHPKKKIRESIEFFDAPFEGTLISWNIDVGDELSSASQVICEIKRPCNHDIVYGGLCTQ 120

Query: 121 CGKEVDEYDQ--VDANLTISHTDTNLRVSRKEAIDLDKQITTRLKNEKKLVLVVDLDQTV 178
           CGKEVDE +Q    +N T+SHTDTNL++SRKEA+D+ +    RL+NEKKLVLVVDLDQTV
Sbjct: 121 CGKEVDESEQSQFGSNFTVSHTDTNLKISRKEALDIGEDFKKRLRNEKKLVLVVDLDQTV 180

Query: 179 IHCGVDPTIGEWKADPSNPNYETLKDVKCFSLEEEPILPLIYMGPKPPVRTCWYYVKIRP 238
           IHCGVDPTIGEWK+DP+NPNY+TLKDV+ F+LEEEP+LP +YMGPKP  R CWYYVK+RP
Sbjct: 181 IHCGVDPTIGEWKSDPNNPNYDTLKDVQMFALEEEPVLPFMYMGPKPTPRKCWYYVKVRP 240

Query: 239 GLKEFFEKIAPLYEMHIYTMATRAYALEIAKIIDPDKSLFGDRILSRDENGSLTQKSLTR 298
           GLKEFF+K+APL+EMHIYTMATRAYALEI KIIDP   LFG+RILSRDENGSLT KSL R
Sbjct: 241 GLKEFFKKVAPLFEMHIYTMATRAYALEITKIIDPTGELFGNRILSRDENGSLTSKSLER 300

Query: 299 LFPTDQSMVVVIDDRGDVWNWCPNLIKVVPYNFFVGVGDINSNFLPKQQTTMLQLGRRTR 358
           LFPTDQSMV++IDDRGDVWNW PNLIKVVPY+FFVGVGDINSNFLPKQQTTMLQLGRR+R
Sbjct: 301 LFPTDQSMVIIIDDRGDVWNWSPNLIKVVPYSFFVGVGDINSNFLPKQQTTMLQLGRRSR 360

Query: 359 QKIKESEELLTDIMDTEKKLQEKIDEEVKRQEEKLNHQMATAEESTDQESKEKIAKKLEF 418
           +K KE++ELLTDIMDTEKKLQEKIDEEVKRQE+ L+HQ+   EES   E+KE+  KKLE 
Sbjct: 361 EKAKEADELLTDIMDTEKKLQEKIDEEVKRQEKNLSHQVVPTEESVSNETKEEWTKKLEH 420

Query: 419 SASLEVQQQNRPLAKLQKHLHDQRLLIDDDDELFYLKDTLAYIHKEFYHLLEDAS-DQNE 477
           SAS+EVQQQNRPLA LQ+HLH+QRLLIDDDDEL++LKDTLA +H E+Y +LE+ S D++ 
Sbjct: 421 SASVEVQQQNRPLAALQEHLHNQRLLIDDDDELYFLKDTLAKVHNEYYSILENKSLDESG 480

Query: 478 ADITMLLPKLKKKVFKECHFVFSGLIPLGTDIKRADIVIWTSLFGAESTSDIDEHTTHVV 537
           ADI +++PKLK+ VF+ CHFVFSGLIPL TDI+RADIV+WTS+FGAES+S+I+E TTHV+
Sbjct: 481 ADIKLIMPKLKQSVFEGCHFVFSGLIPLHTDIRRADIVVWTSMFGAESSSEINEVTTHVI 540

Query: 538 TKTPGTYKARLAKAFNPDIKVVHPDWIFECLASWKRIDEKPYLLIVEQPVSEDXXXXXXX 597
           TKTPGT+KARLAK+FN DIK+VHPDW+FECL  W  +DEKPY LIVE+P+S+        
Sbjct: 541 TKTPGTFKARLAKSFNSDIKIVHPDWVFECLIRWTHVDEKPYTLIVEEPISDRELKKFRE 600

Query: 598 XXXXXXXXXXXXXXXXXXXXXXRANQMEPTMPLFGGDTSWLND-DEDEV 645
                                      + T+ LF   TSWLND DEDE+
Sbjct: 601 DLNNRKLTERNNEQNSGDITGTIVENFDNTVDLFATGTSWLNDEDEDEI 649

>NCAS0C00420 Chr3 complement(65252..67429) [2178 bp, 725 aa] {ON}
           Anc_8.839 YMR277W
          Length = 725

 Score =  922 bits (2384), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 442/651 (67%), Positives = 524/651 (80%), Gaps = 15/651 (2%)

Query: 1   MSTPVLTPMGLPYPITVDELMVPIGSYVEKGQRLFAYKFWYMVEIANSPDDNDIDYEGPE 60
           MST +L P+GLPYPIT+D+L+  +G  V+KG RL AYKFW++V++A+SPDDND+    P 
Sbjct: 1   MSTQILAPIGLPYPITIDQLITHVGDEVQKGDRLLAYKFWFVVDVASSPDDNDV--SSPP 58

Query: 61  IEKSKRKVRESIEFYEAPFEGDLLSWNVDEKDEIAGPNMAVCEIKRPCNHDIVYGGLCTM 120
               K+ +RESIEF+E+P++G L+SWNVD  DEIA PN  + EI RPCNHD+VYGGLCT+
Sbjct: 59  T-AGKKSIRESIEFFESPYKGQLISWNVDIGDEIASPNQVLAEIIRPCNHDVVYGGLCTL 117

Query: 121 CGKEVDEYDQ----VDANLTISHTDTNLRVSRKEAIDLDKQITTRLKNEKKLVLVVDLDQ 176
           CG+EVDE D       ANLTISHTDTNL++S +EA+D+   + TRL+ EKKLVLVVDLDQ
Sbjct: 118 CGEEVDEDDNDASGSGANLTISHTDTNLKISTREALDIGLNVRTRLRKEKKLVLVVDLDQ 177

Query: 177 TVIHCGVDPTIGEWKADPSNPNYETLKDVKCFSLEEEPILPLIYMGPKPPVRTCWYYVKI 236
           TVIHCGVDPTIGEWK DP NPN+ETLKDVK FSLEEEPILP +YMGPKPP+R CWYYVK+
Sbjct: 178 TVIHCGVDPTIGEWKNDPKNPNFETLKDVKQFSLEEEPILPTLYMGPKPPLRKCWYYVKV 237

Query: 237 RPGLKEFFEKIAPLYEMHIYTMATRAYALEIAKIIDPDKSLFGDRILSRDENGSLTQKSL 296
           RPGLKEF EKIAPL+EMHIYTMATRAYA EIAKIIDP+  LFGDRILSRDENGS+T KSL
Sbjct: 238 RPGLKEFLEKIAPLFEMHIYTMATRAYASEIAKIIDPNGDLFGDRILSRDENGSMTTKSL 297

Query: 297 TRLFPTDQSMVVVIDDRGDVWNWCPNLIKVVPYNFFVGVGDINSNFLPKQQTTMLQLGRR 356
            RLFPTDQSMV+VIDDRGDVWNW PNLIKVVPYNFFVGVGDINSNFLPKQQ TMLQLGRR
Sbjct: 298 ERLFPTDQSMVIVIDDRGDVWNWSPNLIKVVPYNFFVGVGDINSNFLPKQQATMLQLGRR 357

Query: 357 TRQKIKESEELLTDIMDTEKKLQEKIDEEVKRQEEKLNHQMATAEE--STDQESKEKIAK 414
           +R+K K++E+LL DIMD+EKKL+EKID+EVKRQEE+L+HQ AT EE  ++  E+KE+I+K
Sbjct: 358 SREKSKDTEDLLIDIMDSEKKLKEKIDQEVKRQEEELSHQSATTEEPPTSAGENKEEISK 417

Query: 415 KLEFSASLEVQQQNRPLAKLQKHLHDQRLLIDDDDELFYLKDTLAYIHKEFYHLLEDASD 474
           K+E+SASLEVQQQNRPLA LQKH HDQRLLIDDDDEL++LKDTL  IH ++Y++L+   +
Sbjct: 418 KIEYSASLEVQQQNRPLAALQKHFHDQRLLIDDDDELYHLKDTLVRIHDKYYNVLKKDGE 477

Query: 475 QNEADITMLLPKLKKKVFKECHFVFSGLIPLGTDIKRADIVIWTSLFGAESTSDIDEHTT 534
             +ADI +++P +K+ V   C FVFSGLIPLGTDI+RADIVIWT+ FGA STSDIDE TT
Sbjct: 478 L-KADIKLIMPAMKQNVLDNCRFVFSGLIPLGTDIQRADIVIWTNTFGAISTSDIDEKTT 536

Query: 535 HVVTKTPGTYKARLAKAFNPDIKVVHPDWIFECLASWKRIDEKPYLLIVEQPVSEDXXXX 594
           HV+TKTPGTYKARLAK+FNP IK++HPDW+FECL SWK +DEKPY LIVEQPVSE     
Sbjct: 537 HVITKTPGTYKARLAKSFNPKIKILHPDWVFECLTSWKHVDEKPYELIVEQPVSETELEE 596

Query: 595 XXXXXXXXXXXXXXXXXXXXXXXXXRANQMEPTMPLFGGDTSWLNDDEDEV 645
                                     A      + LF G  SWL+DDE ++
Sbjct: 597 FKKKLAKRQLLATANENLSPANGTNSAE-----LELFSGGMSWLDDDEGDI 642

>TBLA0D03260 Chr4 (810350..812656) [2307 bp, 768 aa] {ON} Anc_8.839
           YMR277W
          Length = 768

 Score =  910 bits (2352), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 445/678 (65%), Positives = 519/678 (76%), Gaps = 42/678 (6%)

Query: 1   MSTPVLTPMGLPYPITVDELMVPIGSYVEKGQRLFAYKFWYMVEIANSPDDNDIDYE--- 57
           MSTPVL+P  LP+PIT+D+L+ PIGS+VEKGQRLFAYKFWYMVEIA SPD+ND   E   
Sbjct: 1   MSTPVLSPADLPFPITIDQLITPIGSHVEKGQRLFAYKFWYMVEIAQSPDNNDPTSENSS 60

Query: 58  ------------GPEIEKSKRKVRESIEFYEAPFEGDLLSWNVDEKDEIAGPNMAVCEIK 105
                       G      K+ +RESIEF+E+PFEGDL+ WNVD+ DEI   N  +C+IK
Sbjct: 61  DLSGNNSDSNENGNNASHQKKSIRESIEFFESPFEGDLIGWNVDKGDEIISENQLLCDIK 120

Query: 106 RPCNHDIVYGGLCTMCGKEVDEYDQVDANLTISHTDTNLRVSRKEAIDLDKQITTRLKNE 165
           RPCNHDIVY G+CT CGKEVD+ D +DA+L+ISHTDTNL++SRKEA D+D+   +RLK  
Sbjct: 121 RPCNHDIVYAGICTQCGKEVDDSDIMDASLSISHTDTNLKISRKEARDIDQSSMSRLKKI 180

Query: 166 KKLVLVVDLDQTVIHCGVDPTIGEWKADPSNPNYETLKDVKCFSLEEEPILPLIYMGPKP 225
           KKL+LVVDLDQTVIHCGVDPTIGEWK DP NPNYETLKDV+ FSL+EEPILP  YMGP+P
Sbjct: 181 KKLILVVDLDQTVIHCGVDPTIGEWKNDPKNPNYETLKDVRSFSLDEEPILPPSYMGPRP 240

Query: 226 PVRTCWYYVKIRPGLKEFFEKIAPLYEMHIYTMATRAYALEIAKIIDPDKSLFGDRILSR 285
           PVR CWYYVK+RPGLKEFF KIAPLYEMHIYTMATRAYALEIAKIIDPD SLFG RILSR
Sbjct: 241 PVRKCWYYVKVRPGLKEFFAKIAPLYEMHIYTMATRAYALEIAKIIDPDGSLFGSRILSR 300

Query: 286 DENGSLTQKSLTRLFPTDQSMVVVIDDRGDVWNWCPNLIKVVPYNFFVGVGDINSNFLPK 345
           DENGSLTQKSL RLFPTDQSMV++IDDRGDVWNWC NLIKV+PYNFFVG+GDINSNFLP+
Sbjct: 301 DENGSLTQKSLERLFPTDQSMVIIIDDRGDVWNWCNNLIKVIPYNFFVGIGDINSNFLPR 360

Query: 346 QQTTMLQLGRRTRQKIK----------------------ESEELLTDIMDTEKKLQEKID 383
           QQ+TMLQLG R+ +K                        ++EELLTDIMDTEKKLQ+KID
Sbjct: 361 QQSTMLQLGIRSHKKKNTNETLNSEDDKSDSTLSVHEKDKTEELLTDIMDTEKKLQKKID 420

Query: 384 EEVKRQEEKL-NHQMATAEESTDQESKEKIAKKLEFSASLEVQQQNRPLAKLQKHLHDQR 442
           EEV+RQE+KL   +M   +  +D+ S  +++KK+EFSASLEVQQQNRPLA LQ+H  +QR
Sbjct: 421 EEVRRQEKKLIKDEMPKRKSISDESSNNELSKKIEFSASLEVQQQNRPLATLQRHRQNQR 480

Query: 443 LLIDDDDELFYLKDTLAYIHKEFYHLLEDASDQNEA-DITMLLPKLKKKVFKECHFVFSG 501
           LLIDDDDELFYLKD L  +H  FY  L++  D+NE+  I  L+P+LK  VF   +FVFSG
Sbjct: 481 LLIDDDDELFYLKDILTEVHDTFYEQLDE--DKNESVSIQTLMPRLKFSVFSGYNFVFSG 538

Query: 502 LIPLGTDIKRADIVIWTSLFGAESTSDIDEHTTHVVTKTPGTYKARLAKAFNPDIKVVHP 561
           LIPLGTDI+RADIV+WT++FGA ST+DIDE+TTHV+TKT GTYKARLAKAFNP+IKVVHP
Sbjct: 539 LIPLGTDIRRADIVLWTNMFGANSTADIDENTTHVITKTAGTYKARLAKAFNPEIKVVHP 598

Query: 562 DWIFECLASWKRIDEKPYLLIVEQPVSEDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRA 621
           DWIFECL SWKR+ EKPY LI+EQP SE+                               
Sbjct: 599 DWIFECLVSWKRMPEKPYELIIEQPASEEELEEFKKKLELKNELLEKREMETEAQFEA-L 657

Query: 622 NQMEPTMPLFGGDTSWLN 639
           N  +P + LF   TSWLN
Sbjct: 658 NTRDPAIDLFASGTSWLN 675

>Kpol_1068.9 s1068 complement(15966..18203) [2238 bp, 745 aa] {ON}
           complement(15966..18203) [2238 nt, 746 aa]
          Length = 745

 Score =  899 bits (2324), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 423/580 (72%), Positives = 492/580 (84%), Gaps = 7/580 (1%)

Query: 1   MSTPVLTPMGLPYPITVDELMVPIGSYVEKGQRLFAYKFWYMVEIANSPDDNDIDYEGPE 60
           MSTPV  P+GLPYPIT+ +L+  IGS+VEKGQRLFAYKFWY+VEIA SPD+ND   +G  
Sbjct: 1   MSTPVSAPLGLPYPITISKLIASIGSHVEKGQRLFAYKFWYIVEIAKSPDEND---DGVN 57

Query: 61  IEKSKRKVRESIEFYEAPFEGDLLSWNVDEKDEIAGPNMAVCEIKRPCNHDIVYGGLCTM 120
            E SK+ +RESIEF+++PFEGDL+SWNVD  DEI  PN  +CEI RPCNHDIVY G+CTM
Sbjct: 58  DEHSKKSIRESIEFFDSPFEGDLVSWNVDVGDEIVEPNQTICEIVRPCNHDIVYAGICTM 117

Query: 121 CGKEVDEYDQVDANLTISHTDTNLRVSRKEAIDLDKQITTRLKNEKKLVLVVDLDQTVIH 180
           CGKEVDE DQV ANLTISHTDTNL+VSR+EA D+ + I  RL  EKKL+LVVDLDQTVIH
Sbjct: 118 CGKEVDESDQVSANLTISHTDTNLKVSRREANDIGQGIKKRLIREKKLILVVDLDQTVIH 177

Query: 181 CGVDPTIGEWKADPSNPNYETLKDVKCFSLEEEPILPLIYMGPKPPVRTCWYYVKIRPGL 240
           CGVDPTI EWK DP+NPN+ETL+DVK F LEEEPILP +YMGPKPP   CWYYVKIRPGL
Sbjct: 178 CGVDPTIAEWKNDPTNPNFETLRDVKSFVLEEEPILPPMYMGPKPPTHKCWYYVKIRPGL 237

Query: 241 KEFFEKIAPLYEMHIYTMATRAYALEIAKIIDPDKSLFGDRILSRDENGSLTQKSLTRLF 300
           KEFFE+++ LYEMHIYTMATR+YA EIAKIIDPD +LF DRILSR+ENGSLT KSL RLF
Sbjct: 238 KEFFEEVSKLYEMHIYTMATRSYAQEIAKIIDPDGTLFADRILSRNENGSLTHKSLERLF 297

Query: 301 PTDQSMVVVIDDRGDVWNWCPNLIKVVPYNFFVGVGDINSNFLPKQQTTMLQLGRRTRQK 360
           PTDQSMVVVIDDRGDVWNWCPNLIKV PYNFFVG+GDINSNFLP+QQTTMLQLGRR  +K
Sbjct: 298 PTDQSMVVVIDDRGDVWNWCPNLIKVTPYNFFVGIGDINSNFLPRQQTTMLQLGRRNHKK 357

Query: 361 IKESEELLTDIMDTEKKLQEKIDEEVKRQEEKLNHQMAT-AEESTDQESKEKIAKKLEFS 419
            ++++ELLTDIMDTEKKLQEKIDEEVKRQEE L+HQ A   EE + Q  KE I KK+EFS
Sbjct: 358 TEDTDELLTDIMDTEKKLQEKIDEEVKRQEENLSHQSAALGEEISSQVRKEDITKKIEFS 417

Query: 420 ASLEVQQQNRPLAKLQKHLHDQRLLIDDDDELFYLKDTLAYIHKEFYHLLEDASDQNEAD 479
           ASLEVQQQNRPLA+LQKH+H+Q+LL DDDDELFYLKD L  + +++Y   E+     E  
Sbjct: 418 ASLEVQQQNRPLAELQKHMHNQQLLTDDDDELFYLKDILKNVQQKYY---EELKTDKEIQ 474

Query: 480 ITMLLPKLKKKVFKECHFVFSGLIPLGTDIKRADIVIWTSLFGAESTSDIDEHTTHVVTK 539
           I  L+PKLKKKV + C+FVFSGLIPLGT+I++ADIV+WT++FGA+S++DI E TTHV+TK
Sbjct: 475 IQTLMPKLKKKVLEGCNFVFSGLIPLGTNIQKADIVLWTNMFGAQSSADITEDTTHVITK 534

Query: 540 TPGTYKARLAKAFNPDIKVVHPDWIFECLASWKRIDEKPY 579
           TP TYKA++AKAF  DIKV+HPDW+FECL +WK + E PY
Sbjct: 535 TPHTYKAKIAKAFKSDIKVLHPDWVFECLLNWKYMPEFPY 574

>TPHA0I00240 Chr9 (43854..46052) [2199 bp, 732 aa] {ON} Anc_8.839
           YMR277W
          Length = 732

 Score =  876 bits (2264), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 429/651 (65%), Positives = 505/651 (77%), Gaps = 7/651 (1%)

Query: 1   MSTPVLTPMGLPYPITVDELMVPIGSYVEKGQRLFAYKFWYMVEIANSPDDNDIDYEGPE 60
           M+TPV  P G+PYPIT+ +L+ P+GSY+ KG RLFAYKFWY+VEIA SPD+ D++    +
Sbjct: 1   MATPVKFPDGMPYPITISKLIAPVGSYINKGDRLFAYKFWYLVEIAKSPDELDVNGNVQD 60

Query: 61  IEKSKRKVRESIEFYEAPFEGDLLSWNVDEKDEIAGPNMAVCEIKRPCNHDIVYGGLCTM 120
            E+SK+ +RESI+F++APFEG ++ WNVD  DEI  P   VCE+KRPC+HDIVY G+CTM
Sbjct: 61  GEQSKKTIRESIDFFDAPFEGTIIGWNVDVGDEIVEPGRIVCEVKRPCDHDIVYAGICTM 120

Query: 121 CGKEVDEYDQVDANLTISHTDTNLRVSRKEAIDLDKQITTRLKNEKKLVLVVDLDQTVIH 180
           CGKEVDE DQV ANLTISHTDTNL+VSR+EA ++ +   +RL   KKL+LVVDLDQTVIH
Sbjct: 121 CGKEVDERDQVSANLTISHTDTNLKVSRQEANNIGQTNKSRLIRSKKLILVVDLDQTVIH 180

Query: 181 CGVDPTIGEWKADPSNPNYETLKDVKCFSLEEEPILPLIYMGPKPPVRTCWYYVKIRPGL 240
           CGVDPTI EWK DPSNPNYETL++VK F LEEE ILP +YMGPKPPV  C YYVK+RPGL
Sbjct: 181 CGVDPTISEWKNDPSNPNYETLRNVKSFVLEEEAILPPMYMGPKPPVHKCSYYVKVRPGL 240

Query: 241 KEFFEKIAPLYEMHIYTMATRAYALEIAKIIDPDKSLFGDRILSRDENGSLTQKSLTRLF 300
           KEFFEK+AP+YEMHIYTMATRAYA EIAKIIDPD SLFG+RILSRDENGSLT KSL RLF
Sbjct: 241 KEFFEKVAPIYEMHIYTMATRAYAEEIAKIIDPDGSLFGNRILSRDENGSLTHKSLERLF 300

Query: 301 PTDQSMVVVIDDRGDVWNWCPNLIKVVPYNFFVGVGDINSNFLPKQQTTMLQLGRRTRQK 360
           PTDQSMVV+IDDRGDVWNW PNLIKV PYNFFVG+GDINSNFLP+QQ TMLQ+GRR    
Sbjct: 301 PTDQSMVVIIDDRGDVWNWSPNLIKVTPYNFFVGIGDINSNFLPRQQATMLQMGRRNHNA 360

Query: 361 --IKESEELLTDIMDTEKKLQEKIDEEVKRQEEKLNHQMAT-AEESTDQESKEKIAKKLE 417
              KESEELLTDI+DTEKKLQEKID+EVKRQE  L H+ A   EE+  Q     I KK+E
Sbjct: 361 EKEKESEELLTDIIDTEKKLQEKIDKEVKRQEADLTHKSAALGEEAVAQVRNGDITKKIE 420

Query: 418 FSASLEVQQQNRPLAKLQKHLHDQRLLIDDDDELFYLKDTLAYIHKEFYHLLE-DASDQN 476
           FSASLEVQQQNRPLA+LQKH+H+Q+LL DDDDEL YLK+ LA +  EFY  LE    + +
Sbjct: 421 FSASLEVQQQNRPLAELQKHMHNQQLLRDDDDELSYLKEILATVQSEFYKALELKNGNSD 480

Query: 477 EADITMLLPKLKKKVFKECHFVFSGLIPLGTDIKRADIVIWTSLFGAESTSDIDEHTTHV 536
           +  I  L+PKLK+ VFK+C+FVFSGLIPLGTDI++ADIV+WT +FGA STS+I E+TTHV
Sbjct: 481 DTSIQELMPKLKRSVFKDCNFVFSGLIPLGTDIQKADIVLWTKMFGASSTSNITENTTHV 540

Query: 537 VTKTPGTYKARLAKAFNPDIKVVHPDWIFECLASWKRIDEKPYLLIVEQPVSEDXXXXXX 596
           +TKTPGT KAR+AK+FNP IKVVHPDW+FECL++WK +DEK + L V+Q  SE       
Sbjct: 541 ITKTPGTLKARIAKSFNPSIKVVHPDWVFECLSTWKHVDEKSFELKVDQVASERELEEFK 600

Query: 597 XXXXXXXXXXXXXXXXXXXXXXXRANQMEPT---MPLFGGDTSWLNDDEDE 644
                                      M  T   + LF G +SWL DDE E
Sbjct: 601 KNLEKRNKNKLTDAVNFSGDLNNGTATMSSTDNVVDLFAGGSSWLVDDELE 651

>NDAI0K00420 Chr11 complement(94101..96437) [2337 bp, 778 aa] {ON}
           Anc_8.839 YMR277W
          Length = 778

 Score =  877 bits (2265), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 422/643 (65%), Positives = 515/643 (80%), Gaps = 54/643 (8%)

Query: 1   MSTPVL--TPMGLPYPITVDELMVPIGSYVEKGQRLFAYKFWYMVEIANSPDD------- 51
           M+TP +   P+GLPYPIT+DELM PIG+ + K  RL AYKFWY+VEIA SPD+       
Sbjct: 1   MATPTVIRAPLGLPYPITIDELMKPIGTEMNKDDRLLAYKFWYVVEIATSPDELEDDNDN 60

Query: 52  ------------NDIDYEG-------PEIEKSKRK-------------VRESIEFYEAPF 79
                       N I+          P IE   R              VRESIEF++ P+
Sbjct: 61  DNDNDPDGDVDKNTINGNNVTNLTNRPSIEPISRNTITHAHKKKKKKTVRESIEFFDCPY 120

Query: 80  EGDLLSWNVDEKDEIAGPNMAVCEIKRPCNHDIVYGGLCTMCGKEVDEYDQVD---ANLT 136
           +G L SW V++ D+I GPN  +CEI+RPCNHD++YGGLCT+CGKEVDE D  D    NLT
Sbjct: 121 DGILTSWLVEKGDQIVGPNQPLCEIQRPCNHDVIYGGLCTLCGKEVDENDIDDLSGPNLT 180

Query: 137 ISHTDTNLRVSRKEAIDLDKQITTRLKNEKKLVLVVDLDQTVIHCGVDPTIGEWKADPSN 196
           ISHTDTNL++S +EA+D+ + +  RL+++KKL+LVVDLDQTVIHCGVDPTIGEWK DP+N
Sbjct: 181 ISHTDTNLKISTREAVDIGQSVKKRLRDDKKLILVVDLDQTVIHCGVDPTIGEWKRDPTN 240

Query: 197 PNYETLKDVKCFSLEEEPILPLIYMGPKPPVRTCWYYVKIRPGLKEFFEKIAPLYEMHIY 256
           PN+ETLKDVK F+LEEEPILPL+YMGPKPP R CWYYVK+RPGLK+FF+K+APL+EMHIY
Sbjct: 241 PNFETLKDVKEFALEEEPILPLMYMGPKPPARKCWYYVKVRPGLKDFFQKVAPLFEMHIY 300

Query: 257 TMATRAYALEIAKIIDPDKSLFGDRILSRDENGSLTQKSLTRLFPTDQSMVVVIDDRGDV 316
           TMATRAYA EIAKIIDP   LFG+RILSRDENGSLT KSL RLFPTDQSMV++IDDRGDV
Sbjct: 301 TMATRAYASEIAKIIDPTGDLFGNRILSRDENGSLTTKSLERLFPTDQSMVIIIDDRGDV 360

Query: 317 WNWCPNLIKVVPYNFFVGVGDINSNFLPKQQTTMLQLGRRTRQ-----KIKESEELLTDI 371
           WNW PNLIKV+PYNFFVGVGDINSNFLPKQQ TMLQLGRR+ +       KE+++LLTDI
Sbjct: 361 WNWSPNLIKVIPYNFFVGVGDINSNFLPKQQATMLQLGRRSSRGESKVSTKENDDLLTDI 420

Query: 372 MDTEKKLQEKIDEEVKRQEEKLNHQMATAEE--STDQESKEKIAKKLEFSASLEVQQQNR 429
           MDTEK LQ KI+EEVKRQEEKLNHQ+AT EE  +T  E+KE+I+KK+E+SASLEVQQ+NR
Sbjct: 421 MDTEKVLQRKINEEVKRQEEKLNHQLATIEEPPTTAGENKEEISKKIEYSASLEVQQKNR 480

Query: 430 PLAKLQKHLHDQRLLIDDDDELFYLKDTLAYIHKEFYHLLEDAS---DQNEADITMLLPK 486
           PLA LQKH HDQRLLIDDD+EL++LKDTL+ IH ++Y +L+ A+   D  E DI  ++P+
Sbjct: 481 PLATLQKHFHDQRLLIDDDEELYHLKDTLSKIHSKYYEMLQKANENKDSIEPDIKYIMPQ 540

Query: 487 LKKKVFKECHFVFSGLIPLGTDIKRADIVIWTSLFGAESTSDIDEHTTHVVTKTPGTYKA 546
           +K+ V ++CHFVFSGLIPLGT+I+++DIVIWT++FGA ST+DIDE+TTHV+TKTPGTYKA
Sbjct: 541 MKQTVLQDCHFVFSGLIPLGTNIQKSDIVIWTNMFGARSTADIDENTTHVITKTPGTYKA 600

Query: 547 RLAKAFNPDIKVVHPDWIFECLASWKRIDEKPYLLIVEQPVSE 589
           RLAK+++PDIK+VHPDW+FECL  WK ++EKPY L+VEQ VS+
Sbjct: 601 RLAKSYDPDIKIVHPDWVFECLMRWKHVEEKPYELLVEQLVSD 643

>YMR277W Chr13 (820256..822454) [2199 bp, 732 aa] {ON}
           FCP1Carboxy-terminal domain (CTD) phosphatase, essential
           for dephosphorylation of the repeated C-terminal domain
           of the RNA polymerase II large subunit (Rpo21p)
          Length = 732

 Score =  867 bits (2240), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 420/662 (63%), Positives = 506/662 (76%), Gaps = 30/662 (4%)

Query: 1   MSTPVLTPMGLPYPITVDELMVPIGSYVEKGQRLFAYKFWYMVEIANSPDDNDIDYE--- 57
           M+T + +P GLPYPI +D+L+  +GSY+ +G RL  YKFWY+VE A+   D+D +++   
Sbjct: 1   MTTQIRSPQGLPYPIQIDKLIPSVGSYLHEGDRLLVYKFWYLVERASDTGDDDNEHDVSP 60

Query: 58  -----GPEIEKSKRKVRESIEFYEAPFEGDLLSWNVDEKDEIAGPNMAVCEIKRPCNHDI 112
                   +    +++RESIEF+E+P+EGDL+SWNVD  DE+A  N  +CEIKRPCNHDI
Sbjct: 61  GGSAGSNGVSPPTKQLRESIEFFESPYEGDLISWNVDVGDEVATANQVICEIKRPCNHDI 120

Query: 113 VYGGLCTMCGKEV--DEYDQVDANLTISHTDTNLRVSRKEAIDLDKQITTRLKNEKKLVL 170
           VYGGLCT CGKEV  D +D V  ++     D +L++S  EAI   K +   L+ +KKL+L
Sbjct: 121 VYGGLCTQCGKEVSADAFDGVPLDVV---GDVDLQISETEAIRTGKALKEHLRRDKKLIL 177

Query: 171 VVDLDQTVIHCGVDPTIGEWKADPSNPNYETLKDVKCFSLEEEPILPLIYMG------PK 224
           VVDLDQT+IHCGVDPTI EWK DP+NPN+ETL+DVK F+L+EE +LPL+YM         
Sbjct: 178 VVDLDQTIIHCGVDPTIAEWKNDPNNPNFETLRDVKSFTLDEELVLPLMYMNDDGSMLRP 237

Query: 225 PPVRTCWYYVKIRPGLKEFFEKIAPLYEMHIYTMATRAYALEIAKIIDPDKSLFGDRILS 284
           PPVR CWYYVK+RPGLKEFF K+APL+EMHIYTMATRAYAL+IAKI+DP   LFGDRILS
Sbjct: 238 PPVRKCWYYVKVRPGLKEFFAKVAPLFEMHIYTMATRAYALQIAKIVDPTGELFGDRILS 297

Query: 285 RDENGSLTQKSLTRLFPTDQSMVVVIDDRGDVWNWCPNLIKVVPYNFFVGVGDINSNFLP 344
           RDENGSLT KSL +LFPTDQSMVVVIDDRGDVWNWCPNLIKVVPYNFFVGVGDINSNFLP
Sbjct: 298 RDENGSLTTKSLAKLFPTDQSMVVVIDDRGDVWNWCPNLIKVVPYNFFVGVGDINSNFLP 357

Query: 345 KQQTTMLQLGRRTRQKIKESEELLTDIMDTEKKLQEKIDEEVKRQEEKLNHQMATAEEST 404
           KQ T MLQLGR+TRQK +ES+ELLTDIMD EKKLQEKID+EVKRQEEKLNHQ+ATAEE  
Sbjct: 358 KQSTGMLQLGRKTRQKSQESQELLTDIMDNEKKLQEKIDKEVKRQEEKLNHQLATAEEPP 417

Query: 405 DQESKEKIAKKLEFSASLEVQQQNRPLAKLQKHLHDQRLLIDDDDELFYLKDTLAYIHKE 464
             ESKE++ KKLE+SASLEVQQQNRPLAKLQKHLHDQ+LL+DDDDEL+YL  TL+ IHK 
Sbjct: 418 ANESKEELTKKLEYSASLEVQQQNRPLAKLQKHLHDQKLLVDDDDELYYLMGTLSNIHKT 477

Query: 465 FYHLLEDASDQNEADITML--LPKLKKKVFKECHFVFSGLIPLGTDIKRADIVIWTSLFG 522
           +Y +L   S QNE +  ++  +P LK+KVF+ C+FVFSGLIPLGTDI+R+DIVIWTS FG
Sbjct: 478 YYDML---SQQNEPEPNLMEIIPSLKQKVFQNCYFVFSGLIPLGTDIQRSDIVIWTSTFG 534

Query: 523 AESTSDIDEHTTHVVTKTPGTYKARLAKAFNPDIKVVHPDWIFECLASWKRIDEKPYLLI 582
           A ST DID  TTH++TK P TYKARLAK FNP IK+VHPDWIFECL +WK++DEKPY LI
Sbjct: 535 ATSTPDIDYLTTHLITKNPSTYKARLAKKFNPQIKIVHPDWIFECLVNWKKVDEKPYTLI 594

Query: 583 VEQPVSEDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRANQMEPTMPLFGGDTSWLNDDE 642
           V+ P+S++                                  +  + LF   TSWLN+D+
Sbjct: 595 VDSPISDEELQNFQTQLQKRQEYLEETQEQQHMLTS------QENLNLFAAGTSWLNNDD 648

Query: 643 DE 644
           DE
Sbjct: 649 DE 650

>Skud_13.449 Chr13 (793592..795796) [2205 bp, 734 aa] {ON} YMR277W
           (REAL)
          Length = 734

 Score =  864 bits (2233), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 420/663 (63%), Positives = 511/663 (77%), Gaps = 31/663 (4%)

Query: 1   MSTPVLTPMGLPYPITVDELMVPIGSYVEKGQRLFAYKFWYMVEIAN---SPDDNDIDYE 57
           M+T + +P GLPYPI +D+L+  +GSY+ +G RL  YKFWY+VE A+     DDN+ D  
Sbjct: 1   MTTQIRSPEGLPYPIQIDKLVPSVGSYLHEGDRLIVYKFWYLVERASDTTGDDDNEHDAT 60

Query: 58  GPEIEKSK------RKVRESIEFYEAPFEGDLLSWNVDEKDEIAGPNMAVCEIKRPCNHD 111
                 S       +++RESIEF+E+P+EGDL+SWNVD  DEIA  N  +CEIKRPCNHD
Sbjct: 61  PGGGAGSGSVSPPTKQLRESIEFFESPYEGDLISWNVDVGDEIATANQVICEIKRPCNHD 120

Query: 112 IVYGGLCTMCGKEV--DEYDQVDANLTISHTDTNLRVSRKEAIDLDKQITTRLKNEKKLV 169
           IVYGGLCT CGKEV  D +D V  ++     D +L++S  EAI   + +   L+ +KKL+
Sbjct: 121 IVYGGLCTQCGKEVSADAFDGVPLDVV---GDMDLQISETEAIRSGEALKEHLRRDKKLI 177

Query: 170 LVVDLDQTVIHCGVDPTIGEWKADPSNPNYETLKDVKCFSLEEEPILPLIYMG------P 223
           LVVDLDQT+IHCGVDPTI EWK DP+NPN+ETL+DVK F+L+EE +LPL+YM        
Sbjct: 178 LVVDLDQTIIHCGVDPTIAEWKNDPNNPNFETLRDVKSFTLDEELVLPLMYMNEDGSVLK 237

Query: 224 KPPVRTCWYYVKIRPGLKEFFEKIAPLYEMHIYTMATRAYALEIAKIIDPDKSLFGDRIL 283
            PPVR CWYYVK+RPGLKEFF+K+APL+EMHIYTMATRAYA++IAKI+DP   LFGDRIL
Sbjct: 238 PPPVRKCWYYVKVRPGLKEFFDKVAPLFEMHIYTMATRAYAIQIAKIVDPTGELFGDRIL 297

Query: 284 SRDENGSLTQKSLTRLFPTDQSMVVVIDDRGDVWNWCPNLIKVVPYNFFVGVGDINSNFL 343
           SRDENGSLT KSL +LFPTDQSMVVVIDDRGDVWNWCPNLIKVVPYNFFVGVGDINSNFL
Sbjct: 298 SRDENGSLTTKSLAKLFPTDQSMVVVIDDRGDVWNWCPNLIKVVPYNFFVGVGDINSNFL 357

Query: 344 PKQQTTMLQLGRRTRQKIKESEELLTDIMDTEKKLQEKIDEEVKRQEEKLNHQMATAEES 403
           PKQ T MLQLGR+TRQK +ES+ELLTDIMD EKKLQEKID+EVKRQEEKLNHQ+ATAEE 
Sbjct: 358 PKQSTGMLQLGRKTRQKSQESQELLTDIMDNEKKLQEKIDKEVKRQEEKLNHQLATAEEP 417

Query: 404 TDQESKEKIAKKLEFSASLEVQQQNRPLAKLQKHLHDQRLLIDDDDELFYLKDTLAYIHK 463
           +  ESKE++ KKLE+SASLEVQQQNRPLAKLQKHLHDQ+LL+DDDDEL+YL  TL+ IH 
Sbjct: 418 SANESKEELTKKLEYSASLEVQQQNRPLAKLQKHLHDQKLLVDDDDELYYLMGTLSNIHN 477

Query: 464 EFYHLLEDASDQNEADITMLLPKLKKKVFKECHFVFSGLIPLGTDIKRADIVIWTSLFGA 523
            +Y ++   S++ E ++  ++P LK+KVF+ CHFVFSGLIPLGTDI+R+DIVIWTS FGA
Sbjct: 478 TYYQMIS-QSNEPEPNLMEIIPSLKQKVFQNCHFVFSGLIPLGTDIQRSDIVIWTSTFGA 536

Query: 524 ESTSDIDEHTTHVVTKTPGTYKARLAKAFNPDIKVVHPDWIFECLASWKRIDEKPYLLIV 583
            STSDID  TTH++TK P TYKARLAK FNP+IK++HPDWIFECL +WK++DEKPY LIV
Sbjct: 537 TSTSDIDYLTTHLITKNPSTYKARLAKKFNPEIKIIHPDWIFECLVNWKKVDEKPYTLIV 596

Query: 584 EQPVSEDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRANQMEP--TMPLFGGDTSWLNDD 641
           + P+S++                             + + + P   + LF   TSWLN+D
Sbjct: 597 DSPISDE--------ELQNFQKQLQKRQEYLEENQQQQHMLTPQENLNLFAAGTSWLNND 648

Query: 642 EDE 644
           +DE
Sbjct: 649 DDE 651

>Smik_13.490 Chr13 (803288..805486) [2199 bp, 732 aa] {ON} YMR277W
           (REAL)
          Length = 732

 Score =  857 bits (2214), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 409/606 (67%), Positives = 490/606 (80%), Gaps = 20/606 (3%)

Query: 1   MSTPVLTPMGLPYPITVDELMVPIGSYVEKGQRLFAYKFWYMVEIANSP--DDNDIDYE- 57
           M+T + +P GLPYPI +D+L+  +GSY+ +G RL  YKFWY+VE A+    DDN+ D   
Sbjct: 1   MTTQIRSPEGLPYPIQIDKLIPSVGSYLHEGDRLLVYKFWYLVERASETGVDDNEHDASP 60

Query: 58  -----GPEIEKSKRKVRESIEFYEAPFEGDLLSWNVDEKDEIAGPNMAVCEIKRPCNHDI 112
                   +    +++RESIEF+E+P+EGDL+SWNVD  DE+A  N  +CEIKRPCNHDI
Sbjct: 61  GGGAGSNGVSPPTKQLRESIEFFESPYEGDLISWNVDVGDEVATANQVICEIKRPCNHDI 120

Query: 113 VYGGLCTMCGKEV--DEYDQVDANLTISHTDTNLRVSRKEAIDLDKQITTRLKNEKKLVL 170
           VYGGLCT CGKEV  D +D V  ++     D +L++S  EAI   K +   L+ +KKL+L
Sbjct: 121 VYGGLCTQCGKEVSADAFDGVPLDVV---GDMDLQISETEAIRTGKALKEHLRRDKKLIL 177

Query: 171 VVDLDQTVIHCGVDPTIGEWKADPSNPNYETLKDVKCFSLEEEPILPLIYMGP------K 224
           VVDLDQT+IHCGVDPTI EWK DP+NPN+ETL+DVK F+L+EE +LPL+YM         
Sbjct: 178 VVDLDQTIIHCGVDPTIAEWKNDPNNPNFETLRDVKSFTLDEELVLPLMYMNEDGSVLRP 237

Query: 225 PPVRTCWYYVKIRPGLKEFFEKIAPLYEMHIYTMATRAYALEIAKIIDPDKSLFGDRILS 284
           PPVR CWYYVK+RPGLKEFF K+APL+EMHIYTMATRAYAL+IAKI+DP   LFGDRILS
Sbjct: 238 PPVRKCWYYVKVRPGLKEFFAKVAPLFEMHIYTMATRAYALQIAKIVDPTGKLFGDRILS 297

Query: 285 RDENGSLTQKSLTRLFPTDQSMVVVIDDRGDVWNWCPNLIKVVPYNFFVGVGDINSNFLP 344
           RDENGSLT KSL +LFPTDQSMVVVIDDRGDVWNWCPNLIKVVPYNFFVGVGDINSNFLP
Sbjct: 298 RDENGSLTTKSLAKLFPTDQSMVVVIDDRGDVWNWCPNLIKVVPYNFFVGVGDINSNFLP 357

Query: 345 KQQTTMLQLGRRTRQKIKESEELLTDIMDTEKKLQEKIDEEVKRQEEKLNHQMATAEEST 404
           KQ T MLQLGR+TRQK +ES+ELLTDIMD EKKLQEKID+EVKRQEEKLNHQ+ATAEE  
Sbjct: 358 KQSTGMLQLGRKTRQKSQESQELLTDIMDNEKKLQEKIDKEVKRQEEKLNHQLATAEEPP 417

Query: 405 DQESKEKIAKKLEFSASLEVQQQNRPLAKLQKHLHDQRLLIDDDDELFYLKDTLAYIHKE 464
             ESKE++ KKLE+SASLEVQQQNRPLAKLQKHLHDQ+LL+DDDDEL+YL  TL+ IH  
Sbjct: 418 ANESKEELTKKLEYSASLEVQQQNRPLAKLQKHLHDQKLLVDDDDELYYLMGTLSNIHMT 477

Query: 465 FYHLLEDASDQNEADITMLLPKLKKKVFKECHFVFSGLIPLGTDIKRADIVIWTSLFGAE 524
           +Y +L    ++ E ++  ++P LK+KVF+ C FVFSGLIPLGTDI+R+DIVIWTS FGA 
Sbjct: 478 YYQML-SQENEPEPNLMEIIPSLKQKVFQNCFFVFSGLIPLGTDIQRSDIVIWTSTFGAT 536

Query: 525 STSDIDEHTTHVVTKTPGTYKARLAKAFNPDIKVVHPDWIFECLASWKRIDEKPYLLIVE 584
           STSDID  TTH++TK P TYKARLAK FNP+IK+VHPDWIFECL +WK++DEKPY LIV+
Sbjct: 537 STSDIDFLTTHLITKNPSTYKARLAKKFNPEIKIVHPDWIFECLVNWKKVDEKPYTLIVD 596

Query: 585 QPVSED 590
            P+S++
Sbjct: 597 SPISDE 602

>Suva_13.465 Chr13 (802947..805145) [2199 bp, 732 aa] {ON} YMR277W
           (REAL)
          Length = 732

 Score =  850 bits (2196), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 409/605 (67%), Positives = 490/605 (80%), Gaps = 19/605 (3%)

Query: 1   MSTPVLTPMGLPYPITVDELMVPIGSYVEKGQRLFAYKFWYMVE-------IANSPDDND 53
           M+T + +P GLPYPI +D+L+  +GS++++G RL  YKFWY+VE         N  D + 
Sbjct: 1   MTTQIRSPEGLPYPIQIDKLIPSVGSFLQEGDRLLVYKFWYLVERPSDAGDDDNDHDSSP 60

Query: 54  IDYEGPEIEKSKRKVRESIEFYEAPFEGDLLSWNVDEKDEIAGPNMAVCEIKRPCNHDIV 113
               G  +    +++RESIEF+E+P+EGDL+SWNVD  DEIA  N  +CEIKRPCNHDIV
Sbjct: 61  GGGGGGSVSPPTKQLRESIEFFESPYEGDLISWNVDVGDEIATANQVICEIKRPCNHDIV 120

Query: 114 YGGLCTMCGKEV--DEYDQVDANLTISHTDTNLRVSRKEAIDLDKQITTRLKNEKKLVLV 171
           YGGLCT CGKEV  D +D V  ++     D +L++S  EAI   + +   L+ +KKL+LV
Sbjct: 121 YGGLCTQCGKEVSADAFDGVPLDVV---GDMDLQISETEAIRTGRALKEHLRRDKKLILV 177

Query: 172 VDLDQTVIHCGVDPTIGEWKADPSNPNYETLKDVKCFSLEEEPILPLIYMG-----PKPP 226
           VDLDQT+IHCGVDPTI EWK DP+NPN+ETL+DVK F+L+EE +LPL+YM      PKPP
Sbjct: 178 VDLDQTIIHCGVDPTIAEWKNDPNNPNFETLRDVKSFTLDEELVLPLMYMAEDGSVPKPP 237

Query: 227 -VRTCWYYVKIRPGLKEFFEKIAPLYEMHIYTMATRAYALEIAKIIDPDKSLFGDRILSR 285
            VR CWYYVK+RPGLKEFF K+APL+EMHIYTMATRAYAL+IAKI+DP   LFGDRILSR
Sbjct: 238 PVRKCWYYVKVRPGLKEFFAKVAPLFEMHIYTMATRAYALQIAKIVDPTGELFGDRILSR 297

Query: 286 DENGSLTQKSLTRLFPTDQSMVVVIDDRGDVWNWCPNLIKVVPYNFFVGVGDINSNFLPK 345
           DENGSLT KSL +LFPTDQSMVVVIDDRGDVWNWCPNLIKVVPYNFFVGVGDINSNFLPK
Sbjct: 298 DENGSLTTKSLAKLFPTDQSMVVVIDDRGDVWNWCPNLIKVVPYNFFVGVGDINSNFLPK 357

Query: 346 QQTTMLQLGRRTRQKIKESEELLTDIMDTEKKLQEKIDEEVKRQEEKLNHQMATAEESTD 405
           Q T MLQLGR+TRQK +ES+EL+TDIMD EKKLQEKID EVKRQEE+LNHQ+ATAEE + 
Sbjct: 358 QSTGMLQLGRKTRQKSQESQELITDIMDNEKKLQEKIDIEVKRQEEQLNHQLATAEEPSA 417

Query: 406 QESKEKIAKKLEFSASLEVQQQNRPLAKLQKHLHDQRLLIDDDDELFYLKDTLAYIHKEF 465
            ESKE++ KKLE+SASLEVQQQNRPLAKLQKHLHDQ+LL+DDDDEL YL  TL  IHK +
Sbjct: 418 NESKEELTKKLEYSASLEVQQQNRPLAKLQKHLHDQKLLVDDDDELHYLMSTLLNIHKTY 477

Query: 466 YHLLEDASDQNEADITMLLPKLKKKVFKECHFVFSGLIPLGTDIKRADIVIWTSLFGAES 525
           Y +L     + E ++  ++P LK+KVF+ C+FVFSGLIPLGTDI+R+DIVIWTS FGA S
Sbjct: 478 YQMLSQPG-EIEPNLMEIIPSLKQKVFQNCYFVFSGLIPLGTDIQRSDIVIWTSTFGATS 536

Query: 526 TSDIDEHTTHVVTKTPGTYKARLAKAFNPDIKVVHPDWIFECLASWKRIDEKPYLLIVEQ 585
           TSDI+  TTH++TK PGTYKARLAK FNP+IKVVHPDWIFECL +WK++DEKPY LIV+ 
Sbjct: 537 TSDINYLTTHLITKNPGTYKARLAKKFNPEIKVVHPDWIFECLVNWKKVDEKPYTLIVDS 596

Query: 586 PVSED 590
           P+S+D
Sbjct: 597 PISDD 601

>KNAG0J00280 Chr10 complement(41831..44059) [2229 bp, 742 aa] {ON}
           Anc_8.839 YMR277W
          Length = 742

 Score =  842 bits (2175), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 417/664 (62%), Positives = 508/664 (76%), Gaps = 27/664 (4%)

Query: 3   TPVLTPMGLPYPITVDELMVPIGSYVEKGQRLFAYKFWYMVEIANSPDDNDIDYEGPEIE 62
           TPV++  GLPYP+TVDEL+  +G  V +G RLFAYKFWY+VE+A      + D +G    
Sbjct: 7   TPVVSGAGLPYPVTVDELIPQVGDRVSRGDRLFAYKFWYVVELAGVDAAAEGDSDGTGT- 65

Query: 63  KSKRKVRESIEFYEAPFEGDLLSWNVDEKDEIAGPNMAVCEIKRPCNHDIVYGGLCTMCG 122
            +K+ VRES+EF+E+PFEG ++SW+VD  DEI GP   +C ++RPCNHD+VY GLCT+CG
Sbjct: 66  TAKKSVRESVEFFESPFEGTVVSWDVDAGDEIPGPGAPLCLLRRPCNHDVVYNGLCTLCG 125

Query: 123 KEVDEYD---------QVDANLTISHTDTNLRVSRKEAIDLDKQITTRLKNEKKLVLVVD 173
           +EVDEY+          V  NLT+SH DTNL++SR EA  LD Q+  RL+  +KLVLVVD
Sbjct: 126 REVDEYEIQAAAAASGGVGPNLTVSHRDTNLQISRVEAQQLDLQLQQRLRAAQKLVLVVD 185

Query: 174 LDQTVIHCGVDPTIGEWKADPSNPNYETLKDVKCFSLEEEPILPLIYMGPKPPV-RTCWY 232
           LDQTV+HCGVDPTIGEWK DP NPNYE L+DV+ F+LEEEPILP +Y+G K P  R CWY
Sbjct: 186 LDQTVVHCGVDPTIGEWKRDPRNPNYEALRDVQSFALEEEPILPFLYVGGKRPAPRKCWY 245

Query: 233 YVKIRPGLKEFFEKIAPLYEMHIYTMATRAYALEIAKIIDPDKSLFGDRILSRDENGSLT 292
           YVK+RPGLK+FF+++APL+EMHIYTMATRAYALEIAKIIDPDKSLFGDRILSRDENGSLT
Sbjct: 246 YVKVRPGLKQFFKRLAPLFEMHIYTMATRAYALEIAKIIDPDKSLFGDRILSRDENGSLT 305

Query: 293 QKSLTRLFPTDQSMVVVIDDRGDVWNWCPNLIKVVPYNFFVGVGDINSNFLPKQQTTMLQ 352
            KSL RLFPTDQSMV VIDDRGDVWNWC NLIKVVPYNFFVGVGDINSNFLPKQQ TMLQ
Sbjct: 306 HKSLERLFPTDQSMVTVIDDRGDVWNWCANLIKVVPYNFFVGVGDINSNFLPKQQPTMLQ 365

Query: 353 LGRRTR--QKIKESEE---------LLTDIMDTEKKLQEKIDEEVKRQEEKLNHQMATA- 400
           +GRR++  ++  ES++         LLTDIM+TEK+LQEKID+EVKRQE KLN   A   
Sbjct: 366 MGRRSKLNERGHESKQQQDDVKDDLLLTDIMNTEKQLQEKIDQEVKRQEHKLNKGNAAGD 425

Query: 401 EESTDQESKEKIAKKLEFSASLEVQQQNRPLAKLQKHLHDQRLLIDDDDELFYLKDTLAY 460
           E+ T  +SKE+  KKLEFSAS+EVQQ+NRPLA LQKHLH+Q+LL+D+DDELFYLKD LA 
Sbjct: 426 EQQTPGQSKEEWTKKLEFSASVEVQQKNRPLATLQKHLHNQKLLVDNDDELFYLKDRLAD 485

Query: 461 IHKEFYHLLEDASDQNEADITMLLPKLKKKVFKECHFVFSGLIPLGTDIKRADIVIWTSL 520
           +HK +Y  L++  +  + +I  ++ +LK +VF++CHFVFSGLIPL T+++ ADIVIWT+ 
Sbjct: 486 LHKRYYSTLKE--NPQDTNIQSIMTQLKTRVFQDCHFVFSGLIPLNTNVQAADIVIWTNK 543

Query: 521 FGAESTSDIDEHTTHVVTKTPGTYKARLAKAFNPDIKVVHPDWIFECLASWKRIDEKPYL 580
           FGA +T+D+DE TTH++TKTPGT KARLAKAFNPDIK+VHPDWIFECL  W+R+D KPYL
Sbjct: 544 FGATTTNDLDETTTHLITKTPGTNKARLAKAFNPDIKIVHPDWIFECLIKWERVDVKPYL 603

Query: 581 LIVEQPVSEDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRANQMEPTMPLFGGDTSWLND 640
           LIVE PVSE                              +    EP + LF G  SWLND
Sbjct: 604 LIVEDPVSEAQVREFKEKLTRQKERAERQTSRTALLPANKP--AEPDIDLFAGGISWLND 661

Query: 641 DEDE 644
           ++DE
Sbjct: 662 EDDE 665

>SAKL0D01496g Chr4 complement(120202..122268) [2067 bp, 688 aa] {ON}
           similar to uniprot|Q03254 Saccharomyces cerevisiae
           YMR277W FCP1 Carboxy-terminal domain (CTD) phosphatase
          Length = 688

 Score =  801 bits (2070), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 395/651 (60%), Positives = 486/651 (74%), Gaps = 26/651 (3%)

Query: 1   MSTPVLTPMGLPYPITVDELMVPIGSYVEKGQRLFAYKFWYMVEIANSPDDNDIDYEGPE 60
           M+T +  P  LPYPIT+ +L    G  ++KGQRLFAYK+W   ++  SP+D         
Sbjct: 1   MTTALKLPDNLPYPITIAQLCASTGDPIKKGQRLFAYKYWEFQDVVTSPNDTST------ 54

Query: 61  IEKSKRKVRESIEFYEAPFEGDLLSWNVDEKDEIAGPNMAVCEIKRPCNHDIVYGGLCTM 120
             K K++  + I  +++P EG L+S+N+   DE    N  V EIK+ C HD+ YGGLC +
Sbjct: 55  --KPKKQRVDLIGTFDSPVEGALVSFNLSLGDEFVNSNHVVAEIKQACTHDVTYGGLCVI 112

Query: 121 CGKEVDEYDQVDAN------LTISHTDTNLRVSRKEAIDLDKQITTRLKNEKKLVLVVDL 174
           CGK V+EY    A+      LT+SHT+TN+++S ++A  +++    +L+  KKLVLVVDL
Sbjct: 113 CGKSVEEYSSNSASDPSQNKLTMSHTNTNIKISERQAAAIEETAQKQLRKLKKLVLVVDL 172

Query: 175 DQTVIHCGVDPTIGEWKADPSNPNYETLKDVKCFSLEEEPILPLIYMGPKPPVRTCWYYV 234
           DQTVIHCGVDPTIGEW  DP NPNYE LKD+K F+L EEPILP  YMGPKPP R CWYYV
Sbjct: 173 DQTVIHCGVDPTIGEWSRDPKNPNYEALKDIKSFALVEEPILPPFYMGPKPPARKCWYYV 232

Query: 235 KIRPGLKEFFEKIAPLYEMHIYTMATRAYALEIAKIIDPDKSLFGDRILSRDENGSLTQK 294
           K+RPGLKEFFEKIAP +E+HIYTMATRAYALEIAKIIDPD  LFGDRILSRDENGS+T K
Sbjct: 233 KLRPGLKEFFEKIAPHFELHIYTMATRAYALEIAKIIDPDGKLFGDRILSRDENGSITHK 292

Query: 295 SLTRLFPTDQSMVVVIDDRGDVWNWCPNLIKVVPYNFFVGVGDINSNFLPKQQTTMLQLG 354
           SL RLFP DQSMVV+IDDRGDVWNWC NLIKVVPY+FFVGVGDINSNFLP+QQ +ML LG
Sbjct: 293 SLERLFPMDQSMVVIIDDRGDVWNWCENLIKVVPYSFFVGVGDINSNFLPRQQNSMLHLG 352

Query: 355 RRTRQKIKESEELLTDIMDTEKKLQEKIDEEVKRQEEKLNHQMATAEESTDQESKEKIAK 414
           RR R+K +E EELLTDI+DTEKKLQEKIDEEVKRQEEKL+ +M   ++  D  SKE +AK
Sbjct: 353 RRHRKKAEE-EELLTDILDTEKKLQEKIDEEVKRQEEKLS-KMTEEKQPEDTNSKEDLAK 410

Query: 415 KLEFSASLEVQQQNRPLAKLQKHLHDQRLLIDDDDELFYLKDTLAYIHKEFYHLLEDASD 474
           KLE SASLEVQQQNRPLA+LQKHLH+Q+LLIDDDDEL +L   L  +H ++Y  L   S 
Sbjct: 411 KLEHSASLEVQQQNRPLAELQKHLHNQKLLIDDDDELPHLSRILLQVHGKYYEDLSKHS- 469

Query: 475 QNEADITMLLPKLKKKVFKECHFVFSGLIPLGTDIKRADIVIWTSLFGAESTSDIDEHTT 534
            +  +I  L+P+LKK+VF +C FVFSGLIPLGTD+++ADI +WTS+FGA++T+DIDE TT
Sbjct: 470 -SPPNIKNLMPQLKKRVFCKCSFVFSGLIPLGTDVRKADIALWTSMFGAKTTADIDEATT 528

Query: 535 HVVTKTPGTYKARLAKAFNPDIKVVHPDWIFECLASWKRIDEKPYLLIVEQPVSEDXXXX 594
           H++TKTPGT+KARLAKAFNP+IKVVHPDWIFECL +WKR+DEK Y L++EQPVSE+    
Sbjct: 529 HIITKTPGTFKARLAKAFNPEIKVVHPDWIFECLVNWKRVDEKAYELLIEQPVSEE---- 584

Query: 595 XXXXXXXXXXXXXXXXXXXXXXXXXRANQMEPTMPLFGGDTSWLNDDEDEV 645
                                    R +  E  + L  G+ SWL++D+DE+
Sbjct: 585 --ELDDFKKKLENEKKDAQIQEEVDRVSSDE--INLLAGNDSWLDNDDDEM 631

>Ecym_4610 Chr4 (1188871..1191126) [2256 bp, 751 aa] {ON} similar to
           Ashbya gossypii ABL127W
          Length = 751

 Score =  794 bits (2050), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 401/711 (56%), Positives = 496/711 (69%), Gaps = 25/711 (3%)

Query: 1   MSTPVLTPMGLPYPITVDELMVPIGSYVEKGQRLFAYKFWYMVEIANSPDDNDIDYEGPE 60
           MSTP+  P  LPYPITV +L V  G  VE+GQRLFAYK+W   +I  SP D         
Sbjct: 1   MSTPIRLPDNLPYPITVAQLAVSAGDMVERGQRLFAYKYWDFEQIVTSPGDESAG----- 55

Query: 61  IEKSKRKVRESIEFYEAPFEGDLLSWNVDEKDEIAGPNMAVCEIKRPCNHDIVYGGLCTM 120
             KSKR+  + +  +++P  G ++S N+   DE       V EIK+PC HD+ YGGLC  
Sbjct: 56  -GKSKRQRIDLVGTFDSPVSGQVVSLNITLGDEFVNSQCTVAEIKQPCTHDVTYGGLCVQ 114

Query: 121 CGKEVDEYDQV------DANLTISHTDTNLRVSRKEAIDLDKQITTRLKNEKKLVLVVDL 174
           CG+ V++           A LT+SHT+ N+R+S K+A  L+K    +L+  +KLVLVVDL
Sbjct: 115 CGQTVEDEQTSGSLLDNQAKLTMSHTNMNIRISEKQAYTLEKSAQKQLREARKLVLVVDL 174

Query: 175 DQTVIHCGVDPTIGEWKADPSNPNYETLKDVKCFSLEEEPILPLIYMGPKPPVRTCWYYV 234
           DQTVIHCGVDPTIGEW  DP NPNYE+LKDV+ FSL EEP+LP  YMGPKPP R CWYYV
Sbjct: 175 DQTVIHCGVDPTIGEWSKDPDNPNYESLKDVRSFSLHEEPVLPPFYMGPKPPTRKCWYYV 234

Query: 235 KIRPGLKEFFEKIAPLYEMHIYTMATRAYALEIAKIIDPDKSLFGDRILSRDENGSLTQK 294
           K+RPGL++FF  IAP +E+HIYTMATR YALEIAKIIDPD +LFGDRILSRDENGSLTQK
Sbjct: 235 KLRPGLQDFFSNIAPHFELHIYTMATRTYALEIAKIIDPDGTLFGDRILSRDENGSLTQK 294

Query: 295 SLTRLFPTDQSMVVVIDDRGDVWNWCPNLIKVVPYNFFVGVGDINSNFLPKQQTTMLQLG 354
           SL RLFP DQSMVV+IDDRGDVWNWC NLIKVVPY+FFVG+GDINSNFLP+QQ +ML LG
Sbjct: 295 SLERLFPMDQSMVVIIDDRGDVWNWCENLIKVVPYDFFVGIGDINSNFLPRQQNSMLHLG 354

Query: 355 RRTRQKIKESEELLTDIMDTEKKLQEKIDEEVKRQEEKLNHQMATAEESTDQ-ESKEKIA 413
           RR R+K+K+ EELLTDI+DTEKKL+ KI EEVKRQEE++  Q  + E+  D   SKE IA
Sbjct: 355 RRNRKKLKQDEELLTDILDTEKKLKVKISEEVKRQEEEM--QKLSEEKIPDHTTSKEDIA 412

Query: 414 KKLEFSASLEVQQQNRPLAKLQKHLHDQRLLIDDDDELFYLKDTLAYIHKEFYHLLE--- 470
           KKLE +ASLEVQQQNRPLA+LQKHLH++RLLIDDDDEL +L D L  +H  +Y  LE   
Sbjct: 413 KKLEHNASLEVQQQNRPLAELQKHLHNERLLIDDDDELPHLTDILLRVHSAYYDQLEKNK 472

Query: 471 DASDQNEADITMLLPKLKKKVFKECHFVFSGLIPLGTDIKRADIVIWTSLFGAESTSDID 530
             + +   DI  L+P LK+ VFK C+FVFSGLIPL T+I RADIV+WT+ FGA++T +ID
Sbjct: 473 HGATELSPDIKHLIPSLKEIVFKGCNFVFSGLIPLHTNIDRADIVLWTNTFGAKTTINID 532

Query: 531 EHTTHVVTKTPGTYKARLAKAFNPDIKVVHPDWIFECLASWKRIDEKPYLLIVEQPVSED 590
            +TTH++TKTPGT KARLA +FN DIK+VHPDWIFEC+ +WKR+DEKPY LIVE+PVS++
Sbjct: 533 YNTTHLITKTPGTMKARLASSFNRDIKIVHPDWIFECIVNWKRVDEKPYELIVEEPVSKE 592

Query: 591 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXRANQMEPTMPLFGGDTSWLNDDEDEVEFGSD 650
                                          N     M L GG  SWL++D++  EF +D
Sbjct: 593 YLENFKKELEETEKSKNSVDANISSQKYETFND---AMILLGGSDSWLDNDDEMDEFLND 649

Query: 651 DDNSDEDSLISEDTDNGLAANGNSSESSITNKVPEATEDVLNNPSDTQNEE 701
            D+ D  +    + +NG   +  +S  S+ N       + L N    QN++
Sbjct: 650 SDSEDHRN----EGENGGDKSTTNSHESVNNIQHNKLTENLKNQHIQQNQK 696

>Kwal_27.10263 s27 complement(268744..270975) [2232 bp, 743 aa] {ON}
           YMR277W (FCP1) - TFIIF interacting component of CTD
           phosphatase [contig 37] FULL
          Length = 743

 Score =  773 bits (1995), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 376/653 (57%), Positives = 478/653 (73%), Gaps = 27/653 (4%)

Query: 1   MSTPVLTPMGLPYPITVDELMVPIGSYVEKGQRLFAYKFWYMVEIANSPDDNDIDYEGPE 60
           M+TP+  P  LP+PIT+ +L V  G  V KGQRLF YK+W + ++  +P++        E
Sbjct: 1   MTTPIRLPPNLPFPITIAKLYVSKGESVTKGQRLFVYKYWELQDVITAPNE--------E 52

Query: 61  IEKSKRKVRESIEFYEAPFEGDLLSWNVDEKDEIAGPNMAVCEIKRPCNHDIVYGGLCTM 120
             K KR+V + I  +++P EG L+S  V   DE    +  + E+++PC+H++ YG LC +
Sbjct: 53  ASKKKRRV-DLIGTFDSPIEGTLVSLKVRVGDEFVNDSNIIAELRQPCSHEVTYGALCVV 111

Query: 121 CGKEVDEYDQ-------VDANLTISHTDTNLRVSRKEAIDLDKQITTRLKNEKKLVLVVD 173
           CGK VDE D         +  LT++H +TN++VS ++A  ++K     L+  KKLVLVVD
Sbjct: 112 CGKAVDEDDSNMSGSGVSNGKLTVAHNNTNIKVSERQAASIEKTAQKELRERKKLVLVVD 171

Query: 174 LDQTVIHCGVDPTIGEWKADPSNPNYETLKDVKCFSLEEEPILPLIYMGPKPPVRTCWYY 233
           LDQTVIHCGVDPTI EW  DPSNPNY+ LK+VK FSL+E+PILP  YMGP+PP R C YY
Sbjct: 172 LDQTVIHCGVDPTIKEWANDPSNPNYDALKNVKTFSLDEDPILPPFYMGPRPPPRRCQYY 231

Query: 234 VKIRPGLKEFFEKIAPLYEMHIYTMATRAYALEIAKIIDPDKSLFGDRILSRDENGSLTQ 293
           VK+RPGL+EFF+K+AP +E+HIYTMATRAYALEIAKIIDP  +LFGDRILSRDENGSLT 
Sbjct: 232 VKLRPGLQEFFDKVAPHFELHIYTMATRAYALEIAKIIDPTSALFGDRILSRDENGSLTH 291

Query: 294 KSLTRLFPTDQSMVVVIDDRGDVWNWCPNLIKVVPYNFFVGVGDINSNFLPKQQTTMLQL 353
           KSL RLFP DQSMVV+IDDRGDVW+WC NLIKVVPYNFFVGVGDINSNFLP+QQ +ML +
Sbjct: 292 KSLERLFPMDQSMVVIIDDRGDVWSWCENLIKVVPYNFFVGVGDINSNFLPRQQNSMLHM 351

Query: 354 GRRTRQKIKESEELLTDIMDTEKKLQEKIDEEVKRQEEKLNHQMATAEESTDQESKEKIA 413
           GRR R+K +E EELLTDIMDTEKKLQEKID+EVK+QEEK N +++   +     SKE + 
Sbjct: 352 GRRHRKKAEE-EELLTDIMDTEKKLQEKIDQEVKKQEEKFN-KISEENQPDRSMSKEDLT 409

Query: 414 KKLEFSASLEVQQQNRPLAKLQKHLHDQRLLIDDDDELFYLKDTLAYIHKEFYHLLEDAS 473
           KKLE +ASLEVQQQNRPLA+LQKH+++Q+LLIDDDDEL +L + L  +H+ +Y  L  A 
Sbjct: 410 KKLEHNASLEVQQQNRPLAELQKHMNNQKLLIDDDDELPHLSEILLNVHRTYYEEL--AK 467

Query: 474 DQNEADITMLLPKLKKKVFKECHFVFSGLIPLGTDIKRADIVIWTSLFGAESTSDIDEHT 533
            +   DI +L+P++K KVF +CHFVFSGLIPLGT+I+ ADIV+WT++FGA+++SDIDE+T
Sbjct: 468 TEVFPDIKLLMPQMKAKVFAQCHFVFSGLIPLGTNIRHADIVLWTNMFGAQTSSDIDENT 527

Query: 534 THVVTKTPGTYKARLAKAFNPDIKVVHPDWIFECLASWKRIDEKPYLLIVEQPVSEDXXX 593
           THV+TKTPGT+KARLAK++NPDIK+VHPDWIFECL  W R DEKPY LI+EQ VS D   
Sbjct: 528 THVITKTPGTFKARLAKSYNPDIKIVHPDWIFECLVKWVRADEKPYELIIEQEVSSDELE 587

Query: 594 XXXXXXXXXXXXXXXXXXXXXXXXXXRANQMEPTMPLFGGDTSWLNDDEDEVE 646
                                       N       L  G+  WL++D+DE++
Sbjct: 588 EFQRNLKKRQMAEKAARESLQQETGEELN-------LLAGNDMWLDNDDDEMD 633

>ABL127W Chr2 (156798..158984) [2187 bp, 728 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR277W (FCP1)
          Length = 728

 Score =  764 bits (1973), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 387/701 (55%), Positives = 496/701 (70%), Gaps = 36/701 (5%)

Query: 1   MSTPVLTPMGLPYPITVDELMVPIGSYVEKGQRLFAYKFWYMVEIANSPDDNDIDYEGPE 60
           MSTP+  P  LPYPIT+ +L V  G  VEKGQRL AYK+W +V++  +P +        E
Sbjct: 1   MSTPIRLPDSLPYPITIAQLGVSTGDTVEKGQRLLAYKYWDLVDVITAPGEE-------E 53

Query: 61  IEKSKRKVRESIEFYEAPFEGDLLSWNVDEKDEIAGPNMAVCEIKRPCNHDIVYGGLCTM 120
             K++++  + +  +++P  G ++S +V   DE       V EI++ C HD+ YGGLC  
Sbjct: 54  AGKARKQRVDLVGTFDSPVAGTVVSLDVRVGDEFVNSQRPVVEIRQACPHDVTYGGLCVQ 113

Query: 121 CGKEV-DEYDQVD----ANLTISHTDTNLRVSRKEAIDLDKQITTRLKNEKKLVLVVDLD 175
           CG+ V DE    D    A LT+SHT+T++RVS ++A  L +    +L+  +KLVLVVDLD
Sbjct: 114 CGQAVEDEAGAADGVEQAKLTVSHTNTHIRVSERQAASLGQSAQLKLREARKLVLVVDLD 173

Query: 176 QTVIHCGVDPTIGEWKADPSNPNYETLKDVKCFSLEEEPILPLIYMGPKPPVRTCWYYVK 235
           QTVIHCGVDPTIGEW  DP+NPNYE LKDV+ FSL+EEP+LP  YMGPKPP R CWYYVK
Sbjct: 174 QTVIHCGVDPTIGEWSKDPNNPNYEALKDVQSFSLDEEPVLPPFYMGPKPPTRKCWYYVK 233

Query: 236 IRPGLKEFFEKIAPLYEMHIYTMATRAYALEIAKIIDPDKSLFGDRILSRDENGSLTQKS 295
           +RPGLKEFF KIAP +E+HIYTMATRAYALEIAKIIDPD  LFGDRILSRDENGSLTQKS
Sbjct: 234 LRPGLKEFFAKIAPHFELHIYTMATRAYALEIAKIIDPDGKLFGDRILSRDENGSLTQKS 293

Query: 296 LTRLFPTDQSMVVVIDDRGDVWNWCPNLIKVVPYNFFVGVGDINSNFLPKQQTTMLQLGR 355
           L RLFP DQSMVVVIDDRGDVWNWC NLIKVVPY+FFVG+GDINSNFLP QQ +ML LGR
Sbjct: 294 LERLFPMDQSMVVVIDDRGDVWNWCENLIKVVPYDFFVGIGDINSNFLPIQQNSMLHLGR 353

Query: 356 RTRQKIKESEELLTDIMDTEKKLQEKIDEEVKRQEEKLNHQMATAEESTDQESKEKIAKK 415
           R R+K K+ EELLTDI+DTEKKL+EKI+EEVKRQE+++ H++ T E+  D      IAKK
Sbjct: 354 RNRKKPKQEEELLTDILDTEKKLKEKINEEVKRQEDQM-HRL-TDEKLPDTRD---IAKK 408

Query: 416 LEFSASLEVQQQNRPLAKLQKHLHDQRLLIDDDDELFYLKDTLAYIHKEFYHLLE--DAS 473
           LE +ASLEVQQQNRPLA+LQKH+ ++RLL DDDDEL +L + L  +H  +Y  L+  ++ 
Sbjct: 409 LEHNASLEVQQQNRPLAELQKHMRNERLLFDDDDELPHLGNILLKVHSAYYDQLQRYNSG 468

Query: 474 DQNEADITMLLPKLKKKVFKECHFVFSGLIPLGTDIKRADIVIWTSLFGAESTSDIDEHT 533
           +    DI +L+PKLK+ VF+ C FVFSGLIPL T+I+RADIV+WT++FGA +T+++D +T
Sbjct: 469 EDPIPDIKILMPKLKETVFEGCRFVFSGLIPLHTNIERADIVLWTNMFGASTTANLDYNT 528

Query: 534 THVVTKTPGTYKARLAKAFNPDIKVVHPDWIFECLASWKRIDEKPYLLIVEQPVSEDXXX 593
           TH++T+TPGT KARLAK+FNP IK+VHPDWIFECL  W+R++E PY LIVE+PV E+   
Sbjct: 529 THLITRTPGTMKARLAKSFNPAIKIVHPDWIFECLVGWERVEESPYELIVEEPVGEEYLE 588

Query: 594 XXXXXXXXXXXXXXXXXXXXXXXXXXRANQMEPTMPLFGGDTSWLNDDEDEV-EFGSDDD 652
                                      A     ++ L  G+ SWL+ D+DE+ EF +++ 
Sbjct: 589 NFKRDLAEAQKKVDPP-----------AQDSRSSLLLLDGNGSWLDYDDDEMDEFLNEES 637

Query: 653 NSDEDS-----LISEDTDNGLAANGNSSESSITNKVPEATE 688
           +++ED+            NG  + G    +  +   PE  E
Sbjct: 638 DNEEDTEQMAPASKAPRPNGFPSGGERPAAVQSQDKPELPE 678

>KLTH0C03894g Chr3 complement(339897..342134) [2238 bp, 745 aa] {ON}
           similar to uniprot|Q03254 Saccharomyces cerevisiae
           YMR277W FCP1 Carboxy-terminal domain (CTD) phosphatase
          Length = 745

 Score =  758 bits (1958), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 366/597 (61%), Positives = 457/597 (76%), Gaps = 24/597 (4%)

Query: 1   MSTPVLTPMGLPYPITVDELMVPIGSYVEKGQRLFAYKFWYMVEIANSPDDNDIDYEGPE 60
           M+TP+  P  LP+P+T+ +L V  G  V+KGQRLF YK+W + +I  +P++        E
Sbjct: 1   MTTPIRLPSNLPFPVTIAKLCVSTGDSVKKGQRLFVYKYWELQDIITAPNE--------E 52

Query: 61  IEKSKRKVRESIEFYEAPFEGDLLSWNVDEKDEIAGPNMAVCEIKRPCNHDIVYGGLCTM 120
             K KR+V + I  +++P EG L+S N+   DE       + E+ + C+H++ YGGLC +
Sbjct: 53  APKKKRRV-DLIGTFDSPVEGTLVSLNIGLGDEFVNDANVIAEVNQLCSHEVTYGGLCVV 111

Query: 121 CGKEVDEYDQ-------VDANLTISHTDTNLRVSRKEAIDLDKQITTRLKNEKKLVLVVD 173
           CGK V+E DQ        ++ LT++H +TN++VS ++A  ++K     L+  KKLVLVVD
Sbjct: 112 CGKTVEEDDQNVSDNGISNSKLTVAHNNTNIKVSERQAATIEKTAQKHLREHKKLVLVVD 171

Query: 174 LDQTVIHCGVDPTIGEWKADPSNPNYETLKDVKCFSLEEEPILPLIYMGPKPPVRTCWYY 233
           LDQTVIHCGVDPTI EW  DPSNPNY+ LK+VK FSL+E+PILP  YMGP+PP R C YY
Sbjct: 172 LDQTVIHCGVDPTIHEWANDPSNPNYDALKNVKTFSLDEDPILPPFYMGPRPPPRKCQYY 231

Query: 234 VKIRPGLKEFFEKIAPLYEMHIYTMATRAYALEIAKIIDPDKSLFGDRILSRDENGSLTQ 293
           VK+RPGL+EFF+KIAP +E+HIYTMATRAYALEIAKIIDP   LFGDRILSRDENGSLT 
Sbjct: 232 VKLRPGLQEFFDKIAPHFELHIYTMATRAYALEIAKIIDPKGELFGDRILSRDENGSLTH 291

Query: 294 KSLTRLFPTDQSMVVVIDDRGDVWNWCPNLIKVVPYNFFVGVGDINSNFLPKQQTTMLQL 353
           KSL RLFP DQSMVV+IDDRGDVW+WC NLIKVVPYNFFVGVGDINSNFLP+QQ +ML L
Sbjct: 292 KSLERLFPMDQSMVVIIDDRGDVWSWCENLIKVVPYNFFVGVGDINSNFLPRQQNSMLHL 351

Query: 354 GRRTRQKIKESEELLTDIMDTEKKLQEKIDEEVKRQEEKLNHQMATAEESTDQE--SKEK 411
           GRR R+K +E EELLTDIMDTEKKLQEKID+EVK+QEEK N      EE+  +   SKE 
Sbjct: 352 GRRNRKKAEE-EELLTDIMDTEKKLQEKIDQEVKKQEEKFN---KINEENQPERPISKED 407

Query: 412 IAKKLEFSASLEVQQQNRPLAKLQKHLHDQRLLIDDDDELFYLKDTLAYIHKEFYHLLED 471
           + KKLE +ASLEVQQQNRPLA+LQKH+++Q+LL DDDDEL +L + L  +HK +Y  L  
Sbjct: 408 LTKKLEHNASLEVQQQNRPLAELQKHMNNQKLLTDDDDELPHLSNILLNVHKTYYDKL-- 465

Query: 472 ASDQNEADITMLLPKLKKKVFKECHFVFSGLIPLGTDIKRADIVIWTSLFGAESTSDIDE 531
           A      DI  L+P++K +VFK CHFVFSGLIPLGT++++ADIV+WTS+FGA ++ D+DE
Sbjct: 466 AEQGQPPDIKTLMPQMKSQVFKRCHFVFSGLIPLGTNVRQADIVLWTSMFGATTSVDVDE 525

Query: 532 HTTHVVTKTPGTYKARLAKAFNPDIKVVHPDWIFECLASWKRIDEKPYLLIVEQPVS 588
            TTHV+TKTPGT+KARLAK +NP+IKV+HPDWIFECL  W R++EKPY L  EQ VS
Sbjct: 526 ATTHVITKTPGTFKARLAKTYNPNIKVIHPDWIFECLVKWVRVNEKPYELTTEQDVS 582

>KLLA0D01595g Chr4 complement(141459..143618) [2160 bp, 719 aa] {ON}
           similar to uniprot|Q03254 Saccharomyces cerevisiae
           YMR277W FCP1 Carboxy-terminal domain (CTD) phosphatase ,
          Length = 719

 Score =  743 bits (1919), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 373/653 (57%), Positives = 469/653 (71%), Gaps = 30/653 (4%)

Query: 1   MSTPVLTPMGLPYPITVDELMVPIGSYVEKGQRLFAYKFWYMVEIANSPDDNDIDYEGPE 60
           + T V     LPYPITV +L V  G +VEKGQRLFAY++W   ++        + YE   
Sbjct: 3   LETNVKVTSDLPYPITVAQLYVKPGDHVEKGQRLFAYEYWDFQDVL-------VKYE--- 52

Query: 61  IEKSKRKVRESIEFYEAPFEGDLLSWNVDEKDEIAGPNMAVCEIKRPCNHDIVYGGLCTM 120
            EK+K++  + +  +++P  G +  W+   KDE A  N  V  I++ CNHDI YGGLC  
Sbjct: 53  -EKTKKQRVDRVATFDSPVSGTVKEWHCSVKDEFASANHEVITIRQDCNHDITYGGLCVQ 111

Query: 121 CGKEVDEYDQVDANLTISHTDTNLRVSRKEAIDLDKQITTRLKNEKKLVLVVDLDQTVIH 180
           CG  VDE D    NLTISH +TN++VS ++A  L++   TRL+ EKKLVLVVDLDQTVIH
Sbjct: 112 CGNTVDEEDN-SKNLTISHVNTNIKVSEQQAETLERSSLTRLREEKKLVLVVDLDQTVIH 170

Query: 181 CGVDPTIGEWKADPSNPNYETLKDVKCFSLEEEPILPLIYMGPKPPVRTCWYYVKIRPGL 240
           CGVDPTIGEW  DP NPNY+ L+DVK F+LE+EPI+P  Y GPKPP R  WYYVK+RPGL
Sbjct: 171 CGVDPTIGEWMRDPKNPNYKALQDVKSFTLEDEPIIPSFYFGPKPPARKSWYYVKLRPGL 230

Query: 241 KEFFEKIAPLYEMHIYTMATRAYALEIAKIIDPDKSLFGDRILSRDENGSLTQKSLTRLF 300
           KEFFE ++P +EMHIYTMATR+YA EIAKIIDP   LFGDRILSRDENGSLT KSL RLF
Sbjct: 231 KEFFEAVSPHFEMHIYTMATRSYAHEIAKIIDPTGELFGDRILSRDENGSLTTKSLERLF 290

Query: 301 PTDQSMVVVIDDRGDVWNWCPNLIKVVPYNFFVGVGDINSNFLPKQQTTMLQLGRRTRQK 360
           P DQSMVVVIDDRGDVWNW  NLIKVVPY+FFVG+GDINSNFLP+QQ ++L LGR  R+K
Sbjct: 291 PMDQSMVVVIDDRGDVWNWFENLIKVVPYSFFVGIGDINSNFLPRQQNSVLHLGRHHRRK 350

Query: 361 IKESEELLTDIMDTEKKLQEKIDEEVKRQEEKLNHQMATAEESTDQE----SKEKIAKKL 416
            +E E+L++DI+D EKKL+EKIDEEVKRQEE ++H     +++T +E    +KE I+KKL
Sbjct: 351 -QEEEKLISDIIDNEKKLKEKIDEEVKRQEEIISH---IGDDNTRKEGGPPNKEDISKKL 406

Query: 417 EFSASLEVQQQNRPLAKLQKHLHDQRLLIDDDDELFYLKDTLAYIHKEFYHLLEDASDQN 476
           E SASLEVQQQNRPLA+LQKHLH+Q LLIDDDDEL +L   L  +HKE+++   +A  +N
Sbjct: 407 EHSASLEVQQQNRPLAELQKHLHNQTLLIDDDDELPHLSQILLRVHKEYFNQYTEAP-KN 465

Query: 477 EADITMLLPKLKKKVFKECHFVFSGLIPLGTDIKRADIVIWTSLFGAESTSDIDEHTTHV 536
             DI  LLP++K KVF+ CHFVFSGLIPL TD+++ADIV+WT +FGA ++SDI+  TTH+
Sbjct: 466 PPDIKYLLPQMKYKVFQGCHFVFSGLIPLETDVRKADIVLWTDMFGATTSSDINYKTTHI 525

Query: 537 VTKTPGTYKARLAKAFNPDIKVVHPDWIFECLASWKRIDEKPYLLIVEQPVSEDXXXXXX 596
           +T T  T+KARLAK+FNPDIK+VHPDW+FECL  W+R+ E PY L+++ PV ED      
Sbjct: 526 ITTTSRTFKARLAKSFNPDIKIVHPDWLFECLVQWERVKESPYELLIQDPVDEDKVKEFK 585

Query: 597 XXXXXXXXXXXXXXXXXXXXXXXRANQMEPTMP----LFGGDTSWLNDDEDEV 645
                                    N+ E  +     L  G+ SWL++D+DE+
Sbjct: 586 EKLDKKISNPSSSVNPFED-----GNEDEEVLGDEFHLLAGNDSWLDNDDDEM 633

>TPHA0E03070 Chr5 (644651..646135) [1485 bp, 494 aa] {ON} Anc_5.202
           YLL010C
          Length = 494

 Score = 43.9 bits (102), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 17/56 (30%), Positives = 32/56 (57%)

Query: 228 RTCWYYVKIRPGLKEFFEKIAPLYEMHIYTMATRAYALEIAKIIDPDKSLFGDRIL 283
           +T   YV  RPG+ EF ++++ LYE+ ++T +   Y   +  I+DP  ++   R+ 
Sbjct: 356 QTHHVYVIKRPGVDEFLKRVSELYEVVVFTASVSRYGDPLLNILDPANTIIHHRLF 411

>NDAI0C03230 Chr3 (734531..737635) [3105 bp, 1034 aa] {ON} Anc_5.94
           YHR154W
          Length = 1034

 Score = 43.5 bits (101), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 29/101 (28%), Positives = 47/101 (46%), Gaps = 7/101 (6%)

Query: 496 HFVFSGLIPLGT-DIKRADIVIWTSL---FGAESTSDIDEHTTHVVTKT---PGTYKARL 548
           HF  +  I + T  +K ++ + ++ L    G   T  I+  TTH++      P     + 
Sbjct: 131 HFFRNFQICISTYSMKFSEYIFYSELINSLGGTITHVINNKTTHLIAIAIDDPAIIAIKE 190

Query: 549 AKAFNPDIKVVHPDWIFECLASWKRIDEKPYLLIVEQPVSE 589
               N  IK V+P W+ +C    K IDE P+L+  +Q  SE
Sbjct: 191 KGQNNTIIKSVYPTWLVQCFKERKYIDESPHLITEDQNNSE 231

>NCAS0A06800 Chr1 (1346677..1348098) [1422 bp, 473 aa] {ON}
           Anc_5.202
          Length = 473

 Score = 42.0 bits (97), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 16/51 (31%), Positives = 30/51 (58%)

Query: 233 YVKIRPGLKEFFEKIAPLYEMHIYTMATRAYALEIAKIIDPDKSLFGDRIL 283
           YV  RPG++EF +++  L+E+ ++T +   Y   +  I+DP + L   R+ 
Sbjct: 340 YVIKRPGVEEFLKRVGELFEVVVFTASVARYGDPLLDILDPGRQLIHHRLF 390

>SAKL0G12870g Chr7 (1100535..1101734) [1200 bp, 399 aa] {ON} similar
           to uniprot|Q07800 Saccharomyces cerevisiae YLL010C
          Length = 399

 Score = 41.6 bits (96), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 21/60 (35%), Positives = 32/60 (53%), Gaps = 4/60 (6%)

Query: 233 YVKIRPGLKEFFEKIAPLYEMHIYTMATRAYALEIAKIIDPDKS----LFGDRILSRDEN 288
           YV  RPG+ EF E++  LYE+ ++T +   Y   +  I+DP  +    LF D   + D N
Sbjct: 267 YVIKRPGVDEFLERVGKLYEVVVFTASVSRYGDPLLDILDPRGAVHHRLFRDSCYNYDGN 326

>KNAG0M01740 Chr13 (321477..322922) [1446 bp, 481 aa] {ON} Anc_5.202
           YLL010C
          Length = 481

 Score = 41.6 bits (96), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 17/45 (37%), Positives = 27/45 (60%)

Query: 233 YVKIRPGLKEFFEKIAPLYEMHIYTMATRAYALEIAKIIDPDKSL 277
           YV  RPG+ EF  ++  LYE+ ++T +   Y   +  I+D DKS+
Sbjct: 349 YVIKRPGVDEFLRRVGKLYEVVVFTASVSRYGDPLLDILDKDKSI 393

>Suva_10.99 Chr10 (186341..187498) [1158 bp, 385 aa] {ON} YLR019W
           (REAL)
          Length = 385

 Score = 40.8 bits (94), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 15/45 (33%), Positives = 29/45 (64%)

Query: 233 YVKIRPGLKEFFEKIAPLYEMHIYTMATRAYALEIAKIIDPDKSL 277
           YV  RPG+ EF  +++ LYE+ ++T +   YA  +   +DP++++
Sbjct: 253 YVIKRPGVDEFLHRVSQLYEVVVFTASVSRYANPLLDTLDPNRTI 297

>KLLA0F15620g Chr6 complement(1441560..1442804) [1245 bp, 414 aa]
           {ON} similar to uniprot|Q07800 Saccharomyces cerevisiae
           YLL010C
          Length = 414

 Score = 40.0 bits (92), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 17/45 (37%), Positives = 27/45 (60%)

Query: 233 YVKIRPGLKEFFEKIAPLYEMHIYTMATRAYALEIAKIIDPDKSL 277
           YV  RPG+ EF  +I  LYE+ ++T +   Y   +  I+D DK++
Sbjct: 282 YVIKRPGVDEFLRRITELYEVVVFTASVSRYGDPLLDILDKDKTI 326

>ZYRO0B10428g Chr2 (823155..824603) [1449 bp, 482 aa] {ON} similar
           to uniprot|Q07800 Saccharomyces cerevisiae YLL010C
          Length = 482

 Score = 40.0 bits (92), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 17/45 (37%), Positives = 27/45 (60%)

Query: 233 YVKIRPGLKEFFEKIAPLYEMHIYTMATRAYALEIAKIIDPDKSL 277
           YV  RPG+ EF +K+  L+E+ I+T +   Y   +  I+D  KS+
Sbjct: 350 YVMKRPGVDEFLKKVGSLFEVVIFTASVARYGDPLLDILDKHKSV 394

>YLL010C Chr12 complement(129330..130613) [1284 bp, 427 aa] {ON}
           PSR1Plasma membrane associated protein phosphatase
           involved in the general stress response; required along
           with binding partner Whi2p for full activation of
           STRE-mediated gene expression, possibly through
           dephosphorylation of Msn2p
          Length = 427

 Score = 40.0 bits (92), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 16/43 (37%), Positives = 27/43 (62%)

Query: 233 YVKIRPGLKEFFEKIAPLYEMHIYTMATRAYALEIAKIIDPDK 275
           YV  RPG++EF E++  L+E+ ++T +   Y   +  I+D DK
Sbjct: 295 YVIKRPGVEEFLERVGKLFEVVVFTASVSRYGDPLLDILDTDK 337

>Kpol_1010.61 s1010 (148944..151325,151327..151743) [2799 bp, 932
           aa] {ON} (148944..151325,151327..151743) [2799 nt, 933
           aa]
          Length = 932

 Score = 40.4 bits (93), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 27/98 (27%), Positives = 47/98 (47%), Gaps = 10/98 (10%)

Query: 489 KKVFKECHFVFSGLIPLGTDIKRADIVIWTSLFGA--ESTSD-IDEHTTHVVTKTPG--T 543
           + + K+C    S  +       R + ++++ L  A   S SD I   TTH+++  P    
Sbjct: 120 RHILKDCTIYVSRTV-----FNRTENILYSELINALGGSVSDMISNKTTHLISSDPTDPA 174

Query: 544 YKARLAKAFNPDIKVVHPDWIFECLASWKRIDEKPYLL 581
             A +A   +  IK V+P W+ +C    K +DEK ++L
Sbjct: 175 LIAIVASDCHSRIKQVYPAWLCQCFLEVKYVDEKNFIL 212

>Smik_12.53 Chr12 complement(116428..117672) [1245 bp, 414 aa] {ON}
           YLL010C (REAL)
          Length = 414

 Score = 40.0 bits (92), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 16/43 (37%), Positives = 27/43 (62%)

Query: 233 YVKIRPGLKEFFEKIAPLYEMHIYTMATRAYALEIAKIIDPDK 275
           YV  RPG++EF E++  L+E+ ++T +   Y   +  I+D DK
Sbjct: 282 YVIKRPGVEEFLERVGKLFEVVVFTASVSRYGDPLLDILDADK 324

>TBLA0C06090 Chr3 complement(1478726..1480180) [1455 bp, 484 aa]
           {ON} Anc_5.202 YLL010C
          Length = 484

 Score = 40.0 bits (92), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 32/122 (26%), Positives = 54/122 (44%), Gaps = 29/122 (23%)

Query: 163 KNEKKLVLVVDLDQTVIHCGVDPTIGEWKADPSNPNYETLKDVKCFSLEEEPILPL-IYM 221
           K++ K  L++DLD+T++H              +NP++               ILP+ I  
Sbjct: 308 KDKHKKCLILDLDETLVHSSFKFI--------NNPDF---------------ILPIEIED 344

Query: 222 GPKPPVRTCWYYVKIRPGLKEFFEKIAPLYEMHIYTMATRAYALEIAKIIDPDKSLFGDR 281
           G    V     YV  RPG+  F  ++   YE+ I+T +   YA  +  ++D D +L   R
Sbjct: 345 GQIHNV-----YVIKRPGVDRFLREVKKWYEIVIFTASLSRYANPLLDLLDKDHNLINHR 399

Query: 282 IL 283
           + 
Sbjct: 400 LF 401

>YLR019W Chr12 (180288..181481) [1194 bp, 397 aa] {ON}
           PSR2Functionally redundant Psr1p homolog, a plasma
           membrane phosphatase involved in the general stress
           response; required with Psr1p and Whi2p for full
           activation of STRE-mediated gene expression, possibly
           through dephosphorylation of Msn2p
          Length = 397

 Score = 39.7 bits (91), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 15/45 (33%), Positives = 28/45 (62%)

Query: 233 YVKIRPGLKEFFEKIAPLYEMHIYTMATRAYALEIAKIIDPDKSL 277
           YV  RPG+ EF  +++ LYE+ ++T +   YA  +   +DP+ ++
Sbjct: 265 YVIKRPGVDEFLNRVSQLYEVVVFTASVSRYANPLLDTLDPNGTI 309

>Suva_10.65 Chr10 complement(134276..135523) [1248 bp, 415 aa] {ON}
           YLL010C (REAL)
          Length = 415

 Score = 39.7 bits (91), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 16/43 (37%), Positives = 27/43 (62%)

Query: 233 YVKIRPGLKEFFEKIAPLYEMHIYTMATRAYALEIAKIIDPDK 275
           YV  RPG++EF E++  L+E+ ++T +   Y   +  I+D DK
Sbjct: 283 YVIKRPGVEEFLERVGKLFEVVVFTASVSRYGDPLLDILDTDK 325

>CAGL0K02959g Chr11 complement(262936..264330) [1395 bp, 464 aa]
           {ON} similar to uniprot|P38757 Saccharomyces cerevisiae
           YHR004c
          Length = 464

 Score = 39.7 bits (91), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 79/326 (24%), Positives = 119/326 (36%), Gaps = 77/326 (23%)

Query: 10  GLPYPITVDELMVPIGSYVEKGQRLFAYKFWYMVEIANSPDDNDIDYEGPEIEK------ 63
           GL + I V  ++    +Y+     LF    W+++    S  ++ +   G   E       
Sbjct: 118 GLKFFIVVWSIITFFPNYILIKPTLFV---WFILTFPLSLIEHSVRRRGKATENEHLSQS 174

Query: 64  ---------SKRKVRESIEFYEAPFEGDLLSWNVDE--KDEIAGPNMAVCEIKRPCNHDI 112
                    SKR     +   E   E DL+S  V E  KD + G  +       P N D 
Sbjct: 175 PATNKDNSPSKR-----LNVIEEAIEDDLISGEVMELQKDALKGSLL-------PTNKDS 222

Query: 113 VYGGLCTMCGKEVDEYDQVDANLTISHTDTNLRVSRKEAIDLDKQITTR--LKNEKKLVL 170
                    GK+           T SHT   L           K++  R  L +EKK  L
Sbjct: 223 SQNSSQKDRGKKTTS--------TPSHTSNILGTKSMGRFQFPKKLIPRSILYSEKKKTL 274

Query: 171 VVDLDQTVIHCGVDPTIGEWKADPSNPNYETLKDVKCFSLEEEPILPLIYMGPKPPVRTC 230
           V+DLD+T+IH     T        SN +   + +V+ F++     L              
Sbjct: 275 VIDLDETLIHSVSRGTTH------SNSSQAHIIEVR-FAISGVSTL-------------- 313

Query: 231 WYYVKIRPGLKEFFEKIAPLYEMHIYTMATRAYALEIAKIIDPDKSLFGDRILSRDENGS 290
            YYV  RP    F  K+   Y + I+T + + YA     +ID  +S F          GS
Sbjct: 314 -YYVHKRPYCDLFLSKVCKWYNLIIFTASMKEYA---DPVIDWLESSFS---------GS 360

Query: 291 LTQKSLTRLFPTDQSMVVVIDDRGDV 316
            TQ+ + R     +  V  I D G++
Sbjct: 361 FTQR-MYRNHCIARDGVGYIKDLGNI 385

>TPHA0N00670 Chr14 complement(147329..148687) [1359 bp, 452 aa] {ON}
           Anc_5.202 YLL010C
          Length = 452

 Score = 39.7 bits (91), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 16/43 (37%), Positives = 25/43 (58%)

Query: 233 YVKIRPGLKEFFEKIAPLYEMHIYTMATRAYALEIAKIIDPDK 275
           YV  RPG+ EF + +  LYE+ ++T +   Y   +  I+DP K
Sbjct: 320 YVSKRPGVDEFLKIVGDLYEVIVFTASVSRYGNPLMDILDPHK 362

>Smik_12.82 Chr12 (167115..168293) [1179 bp, 392 aa] {ON} YLR019W
           (REAL)
          Length = 392

 Score = 39.3 bits (90), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 15/45 (33%), Positives = 27/45 (60%)

Query: 233 YVKIRPGLKEFFEKIAPLYEMHIYTMATRAYALEIAKIIDPDKSL 277
           YV  RPG+ EF  ++  LYE+ ++T +   YA  +   +DP+ ++
Sbjct: 260 YVIKRPGVDEFLSRVCQLYEVVVFTASVSRYANPLLDTLDPNGTI 304

>SAKL0G15620g Chr7 (1342049..1344688) [2640 bp, 879 aa] {ON} some
           similarities with uniprot|P38850 Saccharomyces
           cerevisiae YHR154W RTT107 Regulator of Ty1 Transposition
           Establishes Silent Chromatin involved in silencing
          Length = 879

 Score = 39.7 bits (91), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 27/94 (28%), Positives = 46/94 (48%), Gaps = 2/94 (2%)

Query: 482 MLLPKLKKKVFKECHFVFSGLIPLGTDIKRADIVIWTSLFGAESTSDIDEHTTHVVTKTP 541
           +LL  L+ K+F +   + S    LG   +R  I       G  ST+++ +  THV++  P
Sbjct: 331 LLLSPLRPKIFHKNELLLSYTNYLGQ--QRFYIQKLVEALGGASTTELSKKNTHVLSCMP 388

Query: 542 GTYKARLAKAFNPDIKVVHPDWIFECLASWKRID 575
              K + A  ++   KVV+  W+ EC    K++D
Sbjct: 389 YGQKYQAAVRWSDTCKVVNHLWLEECYKFAKKLD 422

>Skud_8.49 Chr8 complement(93604..94947) [1344 bp, 447 aa] {ON}
           YHR004C (REAL)
          Length = 447

 Score = 39.3 bits (90), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 35/129 (27%), Positives = 56/129 (43%), Gaps = 24/129 (18%)

Query: 138 SHTDTNLRVSRKEAIDLDKQITTR--LKNEKKLVLVVDLDQTVIHCGVDPTIGEWKADPS 195
           S+T+T     R       K++  +  L  +KK  LV+DLD+T+IH     T        S
Sbjct: 220 SNTNTVFGTKRMGRFLFPKKLIPKSILNTQKKKKLVIDLDETLIHSASRSTT------HS 273

Query: 196 NPNYETLKDVKCFSLEEEPILPLIYMGPKPPVRTCWYYVKIRPGLKEFFEKIAPLYEMHI 255
           N +   L +VK F +   P L               Y++  RP    F  K++  Y++ I
Sbjct: 274 NSSQGHLVEVK-FGISGIPTL---------------YFIHKRPYCDFFLTKVSRWYDLII 317

Query: 256 YTMATRAYA 264
           +T + + YA
Sbjct: 318 FTASMKEYA 326

>Smik_8.53 Chr8 complement(90635..91975) [1341 bp, 446 aa] {ON}
           YHR004C (REAL)
          Length = 446

 Score = 39.3 bits (90), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 31/103 (30%), Positives = 47/103 (45%), Gaps = 22/103 (21%)

Query: 162 LKNEKKLVLVVDLDQTVIHCGVDPTIGEWKADPSNPNYETLKDVKCFSLEEEPILPLIYM 221
           L  +KK  LV+DLD+T+IH     T        SN +   L +VK F +           
Sbjct: 246 LNTQKKKKLVIDLDETLIHSASRSTTH------SNSSQGHLVEVK-FGIS---------- 288

Query: 222 GPKPPVRTCWYYVKIRPGLKEFFEKIAPLYEMHIYTMATRAYA 264
                +RT  Y++  RP    F  K++  YE+ I+T + + YA
Sbjct: 289 ----GIRTL-YFIHKRPYCDLFLTKVSKWYELIIFTASMKEYA 326

>CAGL0D03234g Chr4 (334913..336145) [1233 bp, 410 aa] {ON} similar
           to uniprot|Q07949 Saccharomyces cerevisiae YLR019w PSR2
           oruniprot|Q07800 Saccharomyces cerevisiae YLL010c PSR1
          Length = 410

 Score = 38.9 bits (89), Expect = 0.048,   Method: Compositional matrix adjust.
 Identities = 16/45 (35%), Positives = 27/45 (60%)

Query: 233 YVKIRPGLKEFFEKIAPLYEMHIYTMATRAYALEIAKIIDPDKSL 277
           YV  RPG+ EF +++  LYE+ ++T +   Y   +  I+D  KS+
Sbjct: 278 YVIKRPGVDEFLKRVGELYEVVVFTASVARYGDPLLDILDQHKSI 322

>NDAI0I02170 Chr9 (498399..499574) [1176 bp, 391 aa] {ON} Anc_5.202
          Length = 391

 Score = 38.5 bits (88), Expect = 0.053,   Method: Compositional matrix adjust.
 Identities = 16/45 (35%), Positives = 26/45 (57%)

Query: 233 YVKIRPGLKEFFEKIAPLYEMHIYTMATRAYALEIAKIIDPDKSL 277
           YV  RPG+ EF  ++A LYE+ ++T +   Y   +  I+D   S+
Sbjct: 259 YVIKRPGVDEFLRRVAQLYEVVVFTASVSRYGDPLLDILDSSNSI 303

>NDAI0D01860 Chr4 (437370..438914) [1545 bp, 514 aa] {ON} Anc_5.202
          Length = 514

 Score = 38.5 bits (88), Expect = 0.061,   Method: Compositional matrix adjust.
 Identities = 17/51 (33%), Positives = 26/51 (50%)

Query: 233 YVKIRPGLKEFFEKIAPLYEMHIYTMATRAYALEIAKIIDPDKSLFGDRIL 283
           YV  RPG+ EF EK+  L+E+ I+T +   Y   +   +DP       R+ 
Sbjct: 381 YVIKRPGVDEFLEKVGKLFEVVIFTASVSRYGDPLLDRLDPKGKSIHHRLF 431

>YHR004C Chr8 complement(111754..113094) [1341 bp, 446 aa] {ON}
           NEM1Probable catalytic subunit of Nem1p-Spo7p
           phosphatase holoenzyme; regulates nuclear growth by
           controlling phospholipid biosynthesis, required for
           normal nuclear envelope morphology and sporulation;
           homolog of the human protein Dullard
          Length = 446

 Score = 38.5 bits (88), Expect = 0.061,   Method: Compositional matrix adjust.
 Identities = 31/103 (30%), Positives = 47/103 (45%), Gaps = 22/103 (21%)

Query: 162 LKNEKKLVLVVDLDQTVIHCGVDPTIGEWKADPSNPNYETLKDVKCFSLEEEPILPLIYM 221
           L  +KK  LV+DLD+T+IH     T        SN +   L +VK F L           
Sbjct: 246 LNTQKKKKLVIDLDETLIHSASRSTTH------SNSSQGHLVEVK-FGLS---------- 288

Query: 222 GPKPPVRTCWYYVKIRPGLKEFFEKIAPLYEMHIYTMATRAYA 264
                +RT  Y++  RP    F  K++  Y++ I+T + + YA
Sbjct: 289 ----GIRTL-YFIHKRPYCDLFLTKVSKWYDLIIFTASMKEYA 326

>Skud_12.87 Chr12 (172096..173274) [1179 bp, 392 aa] {ON} YLR019W
           (REAL)
          Length = 392

 Score = 38.1 bits (87), Expect = 0.075,   Method: Compositional matrix adjust.
 Identities = 14/45 (31%), Positives = 28/45 (62%)

Query: 233 YVKIRPGLKEFFEKIAPLYEMHIYTMATRAYALEIAKIIDPDKSL 277
           YV  RPG+ EF  +++ +YE+ ++T +   YA  +   +DP+ ++
Sbjct: 260 YVIKRPGVDEFLHRVSQVYEVVVFTASVSRYANPLLDTLDPNGTI 304

>Skud_12.57 Chr12 complement(120706..121953) [1248 bp, 415 aa] {ON}
           YLL010C (REAL)
          Length = 415

 Score = 38.1 bits (87), Expect = 0.081,   Method: Compositional matrix adjust.
 Identities = 15/43 (34%), Positives = 27/43 (62%)

Query: 233 YVKIRPGLKEFFEKIAPLYEMHIYTMATRAYALEIAKIIDPDK 275
           YV  RPG++EF E++  L+E+ ++T +   Y   +  I+D +K
Sbjct: 283 YVIKRPGVEEFLERVGKLFEVVVFTASVSRYGDPLLDILDTNK 325

>TDEL0E04270 Chr5 (798352..799713) [1362 bp, 453 aa] {ON} Anc_5.202
           YLL010C
          Length = 453

 Score = 38.1 bits (87), Expect = 0.083,   Method: Compositional matrix adjust.
 Identities = 15/45 (33%), Positives = 27/45 (60%)

Query: 233 YVKIRPGLKEFFEKIAPLYEMHIYTMATRAYALEIAKIIDPDKSL 277
           YV  RPG+ EF +++  LYE+ ++T +   Y   +  I+D  K++
Sbjct: 321 YVIKRPGVDEFLKRVGALYEVVVFTASVSRYGDPLLDILDKHKTI 365

>Kpol_2002.100 s2002 complement(238947..240380) [1434 bp, 477 aa]
           {ON} complement(238947..240380) [1434 nt, 478 aa]
          Length = 477

 Score = 37.7 bits (86), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 15/50 (30%), Positives = 29/50 (58%)

Query: 228 RTCWYYVKIRPGLKEFFEKIAPLYEMHIYTMATRAYALEIAKIIDPDKSL 277
           +T   YV  RPG+ EF +++  ++E+ ++T +   Y   +  I+D  KS+
Sbjct: 340 QTHQVYVIKRPGVDEFLKRVGKIFEVVVFTASVSRYGDPLLDILDSSKSI 389

>NCAS0D02740 Chr4 complement(525116..526312) [1197 bp, 398 aa] {ON}
           Anc_5.202
          Length = 398

 Score = 37.4 bits (85), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 15/45 (33%), Positives = 26/45 (57%)

Query: 233 YVKIRPGLKEFFEKIAPLYEMHIYTMATRAYALEIAKIIDPDKSL 277
           YV  RPG+ EF +++  LYE+ ++T +   Y   +  I+D   S+
Sbjct: 266 YVIKRPGVDEFLKRVGELYEVVVFTASVSRYGDPLLNILDQSNSV 310

>TBLA0I01460 Chr9 complement(318104..319285) [1182 bp, 393 aa] {ON}
           Anc_2.530 YHR004C
          Length = 393

 Score = 37.0 bits (84), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 30/103 (29%), Positives = 50/103 (48%), Gaps = 10/103 (9%)

Query: 162 LKNEKKLVLVVDLDQTVIHCGVDPTIGEWKADPSNPNYETLKDVKCFSLEEEPILPLIYM 221
           LK  K+  L++DLD+T+IH     ++    +  +  NY  L +VK  +    P       
Sbjct: 187 LKTNKRKKLILDLDETLIH-----SMSRNISSSTISNYH-LIEVKFPTPTSAPTSA---P 237

Query: 222 GPKPPVRTCWYYVKIRPGLKEFFEKIAPLYEMHIYTMATRAYA 264
           GP  P+ +  YYV  RP    F   ++  Y++ I+T + + YA
Sbjct: 238 GPSLPLSSL-YYVYKRPYCDHFLNLVSDWYDLIIFTASMKEYA 279

>TPHA0H01070 Chr8 (229632..232679) [3048 bp, 1015 aa] {ON} Anc_5.94
           YHR154W
          Length = 1015

 Score = 36.6 bits (83), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 21/85 (24%), Positives = 41/85 (48%), Gaps = 6/85 (7%)

Query: 511 RADIVIWTSL---FGAESTSDIDEHTTHVVTKTPG--TYKARLAKAFNPDIKVVHPDWIF 565
           + +++ ++ L    G  +   I   TTH++T  P      A +A     +I  V+P W+ 
Sbjct: 134 KTEVLFYSELINALGGTTVDHISTLTTHLITNDPTDQAVIATIASEQKQNISFVYPTWLC 193

Query: 566 ECLASWKRIDEKPYLLIVEQPVSED 590
           +C  S   ++E  +L+ + Q  +ED
Sbjct: 194 QCFKSMTLVNESDHLINI-QSSAED 217

 Score = 35.4 bits (80), Expect = 0.69,   Method: Compositional matrix adjust.
 Identities = 25/100 (25%), Positives = 47/100 (47%), Gaps = 4/100 (4%)

Query: 477 EADITMLLPKLKKKVFKECHFVFSGLIPLGTDIKRADIVIWTSLFGAESTSDIDEHTTHV 536
           +A   + L   KKK+F+    + +     G   +R  I   T L G  +++D+ +  TH+
Sbjct: 327 DATSKIFLKPFKKKIFERSQLILAYTNYFGP--QRYYIQRLTRLMGGIASTDLSKKNTHL 384

Query: 537 VTKTPGTYKARLAKAFNPDIKV-VHPDWIFECLASWKRID 575
           +  +P   K   A    P+I V  +  W+ +C  S +++D
Sbjct: 385 IFGSPHGKKYDFAMR-RPNILVTTNHSWLEDCYISGEKLD 423

>KNAG0C05850 Chr3 (1138155..1139486) [1332 bp, 443 aa] {ON}
           Anc_2.530 YHR004C
          Length = 443

 Score = 36.2 bits (82), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 31/103 (30%), Positives = 47/103 (45%), Gaps = 22/103 (21%)

Query: 162 LKNEKKLVLVVDLDQTVIHCGVDPTIGEWKADPSNPNYETLKDVKCFSLEEEPILPLIYM 221
           L  EKK  LV+DLD+T+IH     ++      P N +   + +VK FS+     L     
Sbjct: 244 LNREKKKTLVMDLDETLIH-----SVSRGTTHP-NSSQGHIVEVK-FSISGVSTL----- 291

Query: 222 GPKPPVRTCWYYVKIRPGLKEFFEKIAPLYEMHIYTMATRAYA 264
                     YYV  RP    F  K++  Y++ I+T + + YA
Sbjct: 292 ----------YYVFKRPYCDLFLTKVSKWYDIVIFTASMKEYA 324

>CAGL0D05610g Chr4 complement(534849..536192) [1344 bp, 447 aa] {ON}
           similar to uniprot|Q07800 Saccharomyces cerevisiae
           YLL010c PSR1 or uniprot|Q07949 Saccharomyces cerevisiae
           YLR019w PSR2
          Length = 447

 Score = 36.2 bits (82), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 13/40 (32%), Positives = 24/40 (60%)

Query: 233 YVKIRPGLKEFFEKIAPLYEMHIYTMATRAYALEIAKIID 272
           YV  RPG+ EF +++  LYE+ ++T +   Y   +  ++D
Sbjct: 315 YVIKRPGVDEFLQRVGELYEVVVFTASVSRYGDPLLDVLD 354

>NCAS0F00930 Chr6 (187211..188479) [1269 bp, 422 aa] {ON} Anc_2.530
           YHR004C
          Length = 422

 Score = 35.8 bits (81), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 40/156 (25%), Positives = 67/156 (42%), Gaps = 29/156 (18%)

Query: 136 TISHTDTNLRVSRKEAIDLDKQITTR--LKNEKKLVLVVDLDQTVIHCGVDPTIGEWKAD 193
           +IS  +T+    R       K++  R  ++  ++  LV+DLD+T+IH     T       
Sbjct: 192 SISSNNTSFSSKRMGKFLFPKKLIPRSIVQTNRRKKLVLDLDETLIHSMSRGTTH----- 246

Query: 194 PSNPNYETLKDVKCFSLEEEPILPLIYMGPKPPVRTCWYYVKIRPGLKEFFEKIAPLYEM 253
            SN +   + +VK FS+     L               YYV  RP    F  K++  Y++
Sbjct: 247 -SNSSQGHIVEVK-FSVSGVSTL---------------YYVHKRPYCDFFLSKVSKWYDL 289

Query: 254 HIYTMATRAYALEIAKIID---PDKSLFGDRILSRD 286
            I+T + + YA  +   ++   PDK  F  R+   D
Sbjct: 290 IIFTASMKEYADPVIDWLEDSLPDK--FSQRLYRTD 323

>Ecym_7104 Chr7 (203366..204844) [1479 bp, 492 aa] {ON} similar to
           Ashbya gossypii AAL158W
          Length = 492

 Score = 35.8 bits (81), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 14/40 (35%), Positives = 23/40 (57%)

Query: 233 YVKIRPGLKEFFEKIAPLYEMHIYTMATRAYALEIAKIID 272
           YV  RPG+ EF  ++  LYE+ ++T +   Y   +  I+D
Sbjct: 360 YVIKRPGVDEFLRRVGELYEVVVFTASVSRYGDPLLDILD 399

>KAFR0E02140 Chr5 (426065..428920) [2856 bp, 951 aa] {ON} Anc_5.94
           YHR154W
          Length = 951

 Score = 35.8 bits (81), Expect = 0.52,   Method: Compositional matrix adjust.
 Identities = 20/83 (24%), Positives = 41/83 (49%), Gaps = 7/83 (8%)

Query: 512 ADIVIWTSL---FGAESTSDIDEHTTHVVTKTPG-TYKARLAKAFNPDIKVVHPDWIFEC 567
           ++ +++T L    G     +I+  TTH++T  P  +    L +     IK ++P W+  C
Sbjct: 140 SEYLLYTELIHSMGGTCVENINNKTTHIITTNPKESCFEILKRNGTTSIKYIYPTWLIHC 199

Query: 568 LASWKRIDEKPYLLIVEQPVSED 590
           +   + IDE  + ++   P ++D
Sbjct: 200 VKESQLIDESEHEIV---PFTDD 219

>KAFR0J00990 Chr10 complement(178980..180431) [1452 bp, 483 aa] {ON}
           Anc_5.202 YLL010C
          Length = 483

 Score = 35.4 bits (80), Expect = 0.54,   Method: Compositional matrix adjust.
 Identities = 13/45 (28%), Positives = 27/45 (60%)

Query: 233 YVKIRPGLKEFFEKIAPLYEMHIYTMATRAYALEIAKIIDPDKSL 277
           YV  RPG+ EF +++  ++E+ ++T +   Y   +  ++D  KS+
Sbjct: 351 YVIKRPGVDEFLKRVGEIFEVVVFTASVSRYGDPLLDVLDKGKSI 395

>AAL158W Chr1 (67892..69328) [1437 bp, 478 aa] {ON} Syntenic homolog
           of Saccharomyces cerevisiae YLL010C (PSR1) and YLR019W
           (PSR2)
          Length = 478

 Score = 35.4 bits (80), Expect = 0.60,   Method: Compositional matrix adjust.
 Identities = 14/45 (31%), Positives = 27/45 (60%)

Query: 233 YVKIRPGLKEFFEKIAPLYEMHIYTMATRAYALEIAKIIDPDKSL 277
           YV  RPG+ EF +++  L+E+ ++T +   Y   +  I+D  K++
Sbjct: 346 YVIKRPGVDEFLKRVGELFEVVVFTASVSRYGDPLLDILDQYKAV 390

>SAKL0A09416g Chr1 complement(820552..821709) [1158 bp, 385 aa] {ON}
           similar to uniprot|P38757 Saccharomyces cerevisiae
           YHR004C NEM1 Protein of the nuclear envelope required
           for the spherical shape of the nucleus required for
           normal sporulation
          Length = 385

 Score = 35.0 bits (79), Expect = 0.70,   Method: Compositional matrix adjust.
 Identities = 29/103 (28%), Positives = 45/103 (43%), Gaps = 22/103 (21%)

Query: 162 LKNEKKLVLVVDLDQTVIHCGVDPTIGEWKADPSNPNYETLKDVKCFSLEEEPILPLIYM 221
           L NEKK +LV+DLD+T+IH     T     +         + +VK F++     L     
Sbjct: 195 LNNEKKKILVLDLDETLIHSMSRGTSSSNSSQGH------MVEVK-FAVSGISSL----- 242

Query: 222 GPKPPVRTCWYYVKIRPGLKEFFEKIAPLYEMHIYTMATRAYA 264
                     Y+V  RP    F  K+A  Y + ++T + + YA
Sbjct: 243 ----------YFVHKRPYCDLFLSKVAKWYTLVVFTASMKEYA 275

>Suva_8.58 Chr8 complement(108197..109555) [1359 bp, 452 aa] {ON}
           YHR004C (REAL)
          Length = 452

 Score = 35.0 bits (79), Expect = 0.71,   Method: Compositional matrix adjust.
 Identities = 29/103 (28%), Positives = 44/103 (42%), Gaps = 22/103 (21%)

Query: 162 LKNEKKLVLVVDLDQTVIHCGVDPTIGEWKADPSNPNYETLKDVKCFSLEEEPILPLIYM 221
           L  +KK  LV+DLD+T+IH     T        SN +   L +VK F +     L     
Sbjct: 251 LNTQKKKKLVIDLDETLIHSASRGTT------HSNSSQGHLVEVK-FGISGISTL----- 298

Query: 222 GPKPPVRTCWYYVKIRPGLKEFFEKIAPLYEMHIYTMATRAYA 264
                     Y++  RP    F  K +  Y++ I+T + + YA
Sbjct: 299 ----------YFIHKRPYCDLFLTKASKWYDLIIFTASMKEYA 331

>Kpol_1050.63 s1050 (138268..141444) [3177 bp, 1058 aa] {ON}
           (138268..141444) [3177 nt, 1059 aa]
          Length = 1058

 Score = 35.0 bits (79), Expect = 0.80,   Method: Compositional matrix adjust.
 Identities = 22/92 (23%), Positives = 42/92 (45%), Gaps = 2/92 (2%)

Query: 488 KKKVFKECHFVFSGLIPLGTDIKRADIVIWTSLFGAESTSDIDEHTTHVVTKTPGTYKAR 547
           KK VF +   + +     G   +R  I   T+  G  +T+ +      +V   P   K +
Sbjct: 340 KKSVFNKDELILTYTNLFGP--QRTYIKTLTNALGGVTTATLSHINNCLVYGIPEGMKYK 397

Query: 548 LAKAFNPDIKVVHPDWIFECLASWKRIDEKPY 579
            A+ +   + +V P+W+ EC  + K++D K +
Sbjct: 398 TAEKWGDKLIIVGPNWLEECYKANKKLDPKLF 429

>Kpol_478.16 s478 complement(58800..59852) [1053 bp, 350 aa] {ON}
           complement(58800..59852) [1053 nt, 351 aa]
          Length = 350

 Score = 34.3 bits (77), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 24/93 (25%), Positives = 45/93 (48%), Gaps = 5/93 (5%)

Query: 233 YVKIRPGLKEFFEKIAPLYEMHIYTMATRAYALEIAKIIDPDKSLFGDRIL---SRDENG 289
           YV  RPG+  F +  + L+E+ I+T +   Y   +  I+D    L   R+      + NG
Sbjct: 217 YVIKRPGVDAFLQYTSKLFEVVIFTASVEKYGNPLLDILDSTNDLVHHRLFRDACYNYNG 276

Query: 290 SLTQKSLTRLFPTDQSMVVVIDDRGDVWNWCPN 322
           +   K+L +L     S ++++D+    + + PN
Sbjct: 277 NYI-KNLAQL-GRPLSDIIILDNSPTSYLFHPN 307

>Kwal_33.15140 s33 complement(975769..977001) [1233 bp, 410 aa] {ON}
           YLR019W (PSR2) - Plasma membrane Sodium Response 2
           [contig 94] FULL
          Length = 410

 Score = 34.3 bits (77), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 18/60 (30%), Positives = 30/60 (50%), Gaps = 4/60 (6%)

Query: 233 YVKIRPGLKEFFEKIAPLYEMHIYTMATRAYALEIAKIIDPDKS----LFGDRILSRDEN 288
           YV  RPG+ EF + +  LYE+ ++T +   Y   +  ++D  +     LF D   + D N
Sbjct: 278 YVIKRPGVDEFLKLVGQLYEVVVFTASVSRYGDPLLDVLDQTQCIHHRLFRDSCYNYDGN 337

>Ecym_5052 Chr5 (112351..114972) [2622 bp, 873 aa] {ON} similar to
           Ashbya gossypii ADR369C
          Length = 873

 Score = 33.9 bits (76), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 33/124 (26%), Positives = 52/124 (41%), Gaps = 9/124 (7%)

Query: 469 LEDASDQNEADITMLLPKLKKKVFKECHFVFSGLIPLGTDIKRADIVIWTSLFGAESTSD 528
           L+ A D+   +    L +  ++VF+ C    +G      +  R +IV+    F    T  
Sbjct: 68  LQKAQDERLCEEYEELGEKFRRVFEGCKVYINGRTDPDREQLRKEIVLHGGQFVQYLTKK 127

Query: 529 IDEHTTHVVTKTPGTYKARLAKAFNPDIKVVHPDWIFECLASWKRIDEKPYLLIV---EQ 585
            D   TH+V +     K    + F    KVV P WI  C+   K +  + Y +IV   +Q
Sbjct: 128 SD--VTHIVAQNLSAAKCIEFRNF----KVVQPGWIGACVRIGKMLSWREYSVIVRSGDQ 181

Query: 586 PVSE 589
           P  E
Sbjct: 182 PFLE 185

>ADR369C Chr4 complement(1362309..1364792) [2484 bp, 827 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOR346W
           (REV1)
          Length = 827

 Score = 33.1 bits (74), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 26/92 (28%), Positives = 38/92 (41%), Gaps = 6/92 (6%)

Query: 488 KKKVFKECHFVFSGLIPLGTDIKRADIVIWTSLFGAESTSDIDEHTTHVVTKTPGTYKAR 547
           +  +F+ C    +G      +  R +IV+    F        D   TH+V +     K R
Sbjct: 40  RTPIFRGCRVHVNGHTDPDREELRREIVMHGGTFVHYLARPSD--VTHIVAEHVPVAKRR 97

Query: 548 LAKAFNPDIKVVHPDWIFECLASWKRIDEKPY 579
           L  A     KVV P W+  CL S + +  KPY
Sbjct: 98  LWHA----CKVVRPAWVSACLCSGELVPWKPY 125

>KLTH0B03388g Chr2 (272914..274143) [1230 bp, 409 aa] {ON} similar
           to uniprot|Q07800 Saccharomyces cerevisiae YLL010C
          Length = 409

 Score = 32.7 bits (73), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 17/60 (28%), Positives = 29/60 (48%), Gaps = 4/60 (6%)

Query: 233 YVKIRPGLKEFFEKIAPLYEMHIYTMATRAYALEIAKIIDPDKS----LFGDRILSRDEN 288
           YV  RPG+ +F   +  LYE+ ++T +   Y   +  ++D +      LF D   + D N
Sbjct: 277 YVIKRPGVDDFLRLVGQLYEVVVFTASVSRYGDPLLDVLDQNHCIHHRLFRDSCYNYDGN 336

>Ecym_7276 Chr7 complement(579526..581307) [1782 bp, 593 aa] {ON}
           similar to Ashbya gossypii AGL051C
          Length = 593

 Score = 32.3 bits (72), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 15/35 (42%), Positives = 19/35 (54%)

Query: 533 TTHVVTKTPGTYKARLAKAFNPDIKVVHPDWIFEC 567
           TTH V     +    LA+A N +I VV P+WI  C
Sbjct: 211 TTHFVCNDAQSDDKELARAKNGNIPVVRPEWIRAC 245

>Ecym_2066 Chr2 complement(110523..113165) [2643 bp, 880 aa] {ON}
           similar to Ashbya gossypii ADL145C
          Length = 880

 Score = 32.3 bits (72), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 22/98 (22%), Positives = 38/98 (38%), Gaps = 9/98 (9%)

Query: 488 KKKVFKECHFVFSGLIPLGTDIKRADIVIWTSLF---GAESTSDIDEHTTHVVTKTPGTY 544
           K    K+C+   S           A+  ++TS+    G      +    TH++T  P   
Sbjct: 115 KTHFMKDCYVYVSS-----QQFSAAEYELYTSMLTYMGGCCMDYLSTKVTHIITSDPKDQ 169

Query: 545 KARLAKAFNP-DIKVVHPDWIFECLASWKRIDEKPYLL 581
              + K FN  ++  V   W+ EC    + + E  YL+
Sbjct: 170 AVLVLKRFNKFEVLTVSSAWLAECFVRQEYVSEAAYLV 207

>Ecym_3285 Chr3 complement(539184..541424) [2241 bp, 746 aa] {ON}
           similar to Ashbya gossypii ADL253C
          Length = 746

 Score = 32.3 bits (72), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 27/85 (31%), Positives = 43/85 (50%), Gaps = 7/85 (8%)

Query: 363 ESEELLTDIMDTEKKLQEKIDEEVKRQEEKLNHQMATAEESTDQESKEKIAKK---LEFS 419
           ES++++ +   TE    +K +EE++ Q EK        +E   Q  KEK+ +K    E+ 
Sbjct: 269 ESKDIVVEAPFTEIVQVQKTEEELRLQAEKRRETGKRLQEQAKQRRKEKLVQKEEEYEYY 328

Query: 420 ASLEVQQQNRP----LAKLQKHLHD 440
             + VQ Q++P    LA LQK   D
Sbjct: 329 LQIRVQLQDQPKKSVLATLQKAGFD 353

>SAKL0H20592g Chr8 complement(1805321..1806847) [1527 bp, 508 aa]
           {ON} some similarities with uniprot|Q12114 Saccharomyces
           cerevisiae YLR330W CHS5 Protein of unknown function
           involved in chitin biosynthesis by regulating Chs3p
           localization also involved in cell fusion during mating
          Length = 508

 Score = 32.3 bits (72), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 20/55 (36%), Positives = 28/55 (50%), Gaps = 3/55 (5%)

Query: 516 IWTSL--FGAESTSD-IDEHTTHVVTKTPGTYKARLAKAFNPDIKVVHPDWIFEC 567
           I TSL   GA++  D +   TTH +     +    L KA N +I VV P+W+  C
Sbjct: 191 IETSLSNIGAKALQDHVGLDTTHFICNEKDSEDPELEKAQNSNIPVVRPEWVRAC 245

>TPHA0A05110 Chr1 (1149460..1152657) [3198 bp, 1065 aa] {ON}
           Anc_5.94 YHR154W
          Length = 1065

 Score = 32.3 bits (72), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 19/81 (23%), Positives = 38/81 (46%), Gaps = 4/81 (4%)

Query: 510 KRADIVIWTSLFGAESTSDIDEHTTHVVTKTPGTYKARLAKAFNPDIKVVHPDWIFECLA 569
           +R  I    +  G +ST  + +  TH++   P   K   A++    I VV+  W+ +C+ 
Sbjct: 363 QRHYIKNLVTALGGKSTPTLSKRNTHLIFGVPYGKKYNYARSKLNKINVVNIKWLEQCVL 422

Query: 570 SWKRIDEKPYLLIVEQPVSED 590
              R+ E     + E+P++ +
Sbjct: 423 LKSRVPEN----LFEKPITSN 439

>YPL063W Chr16 (429939..431369) [1431 bp, 476 aa] {ON}
           TIM50Essential component of the Translocase of the Inner
           Mitochondrial membrane (TIM23 complex); acts as receptor
           for the TIM23 complex guiding incoming precursors from
           the TOM complex; may control the gating of the
           Tim23p-Tim17p channel
          Length = 476

 Score = 31.6 bits (70), Expect = 8.1,   Method: Compositional matrix adjust.
 Identities = 27/100 (27%), Positives = 50/100 (50%), Gaps = 10/100 (10%)

Query: 237 RPGLKEFFEKIAPLYEMHIYTMATRAYALEIAKIIDP-----DKSLFGDRILSRDENGSL 291
           RPG   F   ++  YE+ +++     Y+ +IA+ +DP       +LF +  + +D    +
Sbjct: 218 RPGADYFLGYLSQYYEIVLFSSNYMMYSDKIAEKLDPIHAFVSYNLFKEHCVYKD---GV 274

Query: 292 TQKSLTRLFPTDQSMVVVIDDRGDVWNWCP-NLIKVVPYN 330
             K L++L   D S V++ID   + +   P N I + P+N
Sbjct: 275 HIKDLSKL-NRDLSKVIIIDTDPNSYKLQPENAIPMEPWN 313

>TDEL0F03070 Chr6 (559392..562025) [2634 bp, 877 aa] {ON} Anc_3.425
           YGR089W
          Length = 877

 Score = 32.0 bits (71), Expect = 8.1,   Method: Compositional matrix adjust.
 Identities = 27/73 (36%), Positives = 41/73 (56%), Gaps = 9/73 (12%)

Query: 403 STDQESKEKIAKKLEFSASLEVQQQNRPLAKLQKHL---HDQRLLIDDDDELFYLKDTLA 459
           S +  + EK A K+E S    VQQ  + LAKL++HL    D+  L++++    YLK   A
Sbjct: 705 SQNASNDEKSASKVE-SLKTAVQQSEKTLAKLEQHLKQTSDKEALLEEE----YLKQKDA 759

Query: 460 YIHKEF-YHLLED 471
           ++ K+  Y  LED
Sbjct: 760 HLRKQMEYSKLED 772

>KLLA0E15621g Chr5 complement(1397950..1400625) [2676 bp, 891 aa]
           {ON} some similarities with uniprot|P38850 Saccharomyces
           cerevisiae YHR154W RTT107 Regulator of Ty1 Transposition
           Establishes Silent Chromatin involved in silencing
          Length = 891

 Score = 32.0 bits (71), Expect = 8.2,   Method: Compositional matrix adjust.
 Identities = 16/69 (23%), Positives = 31/69 (44%), Gaps = 1/69 (1%)

Query: 518 TSLFGAESTSDIDEHTTHVVTKTPGTYKARLAKAFNP-DIKVVHPDWIFECLASWKRIDE 576
            S+FG      +    TH++T        +  + F+   +  + P+W+ +CL   + I E
Sbjct: 146 VSVFGGTCMDYLSTKATHIITWDKNDVAIKAMQKFHKYTVIYLMPNWLVDCLCGLEYIKE 205

Query: 577 KPYLLIVEQ 585
             YL+ V +
Sbjct: 206 DEYLINVNE 214

>ZYRO0F02640g Chr6 complement(209802..212891) [3090 bp, 1029 aa]
           {ON} weakly similar to uniprot|P47068 Saccharomyces
           cerevisiae YJL020C BBC1 Protein possibly involved in
           assembly of actin patches interacts with an actin
           assembly factor Las17p and with the SH3 domains of Type
           I myosins Myo3p and Myo5p localized predominantly to
           cortical actin patches
          Length = 1029

 Score = 31.6 bits (70), Expect = 9.7,   Method: Compositional matrix adjust.
 Identities = 29/89 (32%), Positives = 39/89 (43%), Gaps = 14/89 (15%)

Query: 391 EKLNHQMATAEESTDQESKEKIAKKLEFSAS----LEVQQQNRPLAKLQKHLHDQRL--L 444
           EKLN    TA  ST   S     K + FS+     LE         K   H   Q++  L
Sbjct: 763 EKLNTMSRTATFSTKDGSGSAEGKTIRFSSEDSWWLE--------KKFPSHAFGQKVNCL 814

Query: 445 IDDDDELFYLKDTLAYIHKEFYHLLEDAS 473
           ++ DD L   K   +Y+ ++FY L ED S
Sbjct: 815 MEVDDHLIKKKLHESYMVRDFYFLFEDYS 843

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.314    0.134    0.392 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 87,614,179
Number of extensions: 4323789
Number of successful extensions: 42148
Number of sequences better than 10.0: 1318
Number of HSP's gapped: 40798
Number of HSP's successfully gapped: 1715
Length of query: 758
Length of database: 53,481,399
Length adjustment: 117
Effective length of query: 641
Effective length of database: 40,065,477
Effective search space: 25681970757
Effective search space used: 25681970757
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 70 (31.6 bits)