Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
CAGL0L13288g6.17ON64664632670.0
Skud_5.276.17ON61566213481e-179
ZYRO0C07876g6.17ON68167613271e-175
Suva_5.56.17ON61967212991e-172
TDEL0G045206.17ON67968213051e-172
Smik_5.256.17ON61566512911e-170
YEL062W (NPR2)6.17ON61566012831e-169
Kpol_1045.726.17ON69570412611e-165
Ecym_30216.17ON67469312281e-160
SAKL0E01100g6.17ON71071612271e-159
KLLA0D01067g6.17ON66068212001e-156
KNAG0M011406.17ON59465911531e-150
NDAI0D008606.17ON66670311321e-146
TPHA0J003106.17ON67570911251e-145
NCAS0H008706.17ON61268111181e-144
Kwal_56.224116.17ON68969911221e-144
KLTH0C11308g6.17ON69070411131e-143
ACR009W6.17ON68070611081e-142
TBLA0G010106.17ON71048910901e-139
KAFR0L003806.17ON54048110291e-132
Kwal_27.98043.183ON473151770.97
TPHA0G023602.411ON117273751.9
KNAG0F011602.58ON111764742.4
TPHA0B004404.340ON145591715.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0L13288g
         (646 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0L13288g Chr12 complement(1420781..1422721) [1941 bp, 646 aa...  1263   0.0  
Skud_5.27 Chr5 (33530..35377) [1848 bp, 615 aa] {ON} YEL062W (REAL)   523   e-179
ZYRO0C07876g Chr3 (598500..600545) [2046 bp, 681 aa] {ON} simila...   515   e-175
Suva_5.5 Chr5 (10147..12006) [1860 bp, 619 aa] {ON} YEL062W (REAL)    504   e-172
TDEL0G04520 Chr7 (822826..824865) [2040 bp, 679 aa] {ON} Anc_6.1...   507   e-172
Smik_5.25 Chr5 (36761..38452,38453..38605) [1845 bp, 615 aa] {ON...   501   e-170
YEL062W Chr5 (34407..36254) [1848 bp, 615 aa] {ON}  NPR2Subunit ...   498   e-169
Kpol_1045.72 s1045 (167094..169181) [2088 bp, 695 aa] {ON} (1670...   490   e-165
Ecym_3021 Chr3 complement(40454..42478) [2025 bp, 674 aa] {ON} s...   477   e-160
SAKL0E01100g Chr5 complement(83492..85624) [2133 bp, 710 aa] {ON...   477   e-159
KLLA0D01067g Chr4 complement(94114..96096) [1983 bp, 660 aa] {ON...   466   e-156
KNAG0M01140 Chr13 complement(204691..206475) [1785 bp, 594 aa] {...   448   e-150
NDAI0D00860 Chr4 (193625..195625) [2001 bp, 666 aa] {ON} Anc_6.1...   440   e-146
TPHA0J00310 Chr10 complement(68890..70917) [2028 bp, 675 aa] {ON...   437   e-145
NCAS0H00870 Chr8 (158877..160715) [1839 bp, 612 aa] {ON} Anc_6.1...   435   e-144
Kwal_56.22411 s56 complement(115007..117076) [2070 bp, 689 aa] {...   436   e-144
KLTH0C11308g Chr3 (929710..931782) [2073 bp, 690 aa] {ON} simila...   433   e-143
ACR009W Chr3 (371964..374006) [2043 bp, 680 aa] {ON} Syntenic ho...   431   e-142
TBLA0G01010 Chr7 complement(253690..255822) [2133 bp, 710 aa] {O...   424   e-139
KAFR0L00380 Chr12 complement(69525..71147) [1623 bp, 540 aa] {ON...   400   e-132
Kwal_27.9804 s27 (69307..70728) [1422 bp, 473 aa] {ON} YDL017W (...    34   0.97 
TPHA0G02360 Chr7 (477456..480974) [3519 bp, 1172 aa] {ON} Anc_2....    33   1.9  
KNAG0F01160 Chr6 (207614..210967) [3354 bp, 1117 aa] {ON} Anc_2....    33   2.4  
TPHA0B00440 Chr2 complement(93810..98177) [4368 bp, 1455 aa] {ON...    32   5.9  

>CAGL0L13288g Chr12 complement(1420781..1422721) [1941 bp, 646 aa]
           {ON} similar to uniprot|P39923 Saccharomyces cerevisiae
           YEL062w nitrogen permease regulator
          Length = 646

 Score = 1263 bits (3267), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 618/646 (95%), Positives = 618/646 (95%)

Query: 1   MASQFEGFVDIHSIFYSTFHPTEGSKVKFDFPPRSLENSGINFDSIKNYVIPKRALCHRL 60
           MASQFEGFVDIHSIFYSTFHPTEGSKVKFDFPPRSLENSGINFDSIKNYVIPKRALCHRL
Sbjct: 1   MASQFEGFVDIHSIFYSTFHPTEGSKVKFDFPPRSLENSGINFDSIKNYVIPKRALCHRL 60

Query: 61  ITFKYGNYRIACYPVTVNSSIYARXXXXXXXXXXXXXXCETSPYEPAIERLGKMFRVLEI 120
           ITFKYGNYRIACYPVTVNSSIYAR              CETSPYEPAIERLGKMFRVLEI
Sbjct: 61  ITFKYGNYRIACYPVTVNSSIYARNFFSFNFVFVFPFNCETSPYEPAIERLGKMFRVLEI 120

Query: 121 QNQILSKSENDTIMFNLKSADKNFNIDNDSSNYILGDDISSIMTTQQKDKYERLNNIISN 180
           QNQILSKSENDTIMFNLKSADKNFNIDNDSSNYILGDDISSIMTTQQKDKYERLNNIISN
Sbjct: 121 QNQILSKSENDTIMFNLKSADKNFNIDNDSSNYILGDDISSIMTTQQKDKYERLNNIISN 180

Query: 181 IKKKPSNFTISDLLMRLYQDLNTYSECLIPIDDGNAVDIKLFPLLTPPTPYISIEHVPIS 240
           IKKKPSNFTISDLLMRLYQDLNTYSECLIPIDDGNAVDIKLFPLLTPPTPYISIEHVPIS
Sbjct: 181 IKKKPSNFTISDLLMRLYQDLNTYSECLIPIDDGNAVDIKLFPLLTPPTPYISIEHVPIS 240

Query: 241 LVNLFKIVDVNWDPIMLTXXXXXXXXXXXXXXSQLSHNEESLVIECIRHLVYYRCIVLTD 300
           LVNLFKIVDVNWDPIMLT              SQLSHNEESLVIECIRHLVYYRCIVLTD
Sbjct: 241 LVNLFKIVDVNWDPIMLTIIPYINGINNIYRISQLSHNEESLVIECIRHLVYYRCIVLTD 300

Query: 301 IFEFSNVYAPTSSLRLFLLDPNMATECQSYVMLPINSKMNDLSLYPHHGKHSAFNGDIGS 360
           IFEFSNVYAPTSSLRLFLLDPNMATECQSYVMLPINSKMNDLSLYPHHGKHSAFNGDIGS
Sbjct: 301 IFEFSNVYAPTSSLRLFLLDPNMATECQSYVMLPINSKMNDLSLYPHHGKHSAFNGDIGS 360

Query: 361 RNNSVSTSLYSFNGNDSRPQSRSSSVDQSQTNFYKNKKQSESSISTGNSNNGQNIHKHLP 420
           RNNSVSTSLYSFNGNDSRPQSRSSSVDQSQTNFYKNKKQSESSISTGNSNNGQNIHKHLP
Sbjct: 361 RNNSVSTSLYSFNGNDSRPQSRSSSVDQSQTNFYKNKKQSESSISTGNSNNGQNIHKHLP 420

Query: 421 TRSLLFDLYRSLSQGITLKEWYMQNHKIIRDNRIDVRRFITFGVLRRIIYRCETYSVINS 480
           TRSLLFDLYRSLSQGITLKEWYMQNHKIIRDNRIDVRRFITFGVLRRIIYRCETYSVINS
Sbjct: 421 TRSLLFDLYRSLSQGITLKEWYMQNHKIIRDNRIDVRRFITFGVLRRIIYRCETYSVINS 480

Query: 481 TDHLQNLWKLNELENPISMENISKLQSNHIDSLAADEALMNAYKKLSLKVPSKGALKSHN 540
           TDHLQNLWKLNELENPISMENISKLQSNHIDSLAADEALMNAYKKLSLKVPSKGALKSHN
Sbjct: 481 TDHLQNLWKLNELENPISMENISKLQSNHIDSLAADEALMNAYKKLSLKVPSKGALKSHN 540

Query: 541 TSHSSFSLTPTAPEMENSQAKRNKRLSKVSFEALPEDRNGFRWGSNIKTPIQETTWKKLS 600
           TSHSSFSLTPTAPEMENSQAKRNKRLSKVSFEALPEDRNGFRWGSNIKTPIQETTWKKLS
Sbjct: 541 TSHSSFSLTPTAPEMENSQAKRNKRLSKVSFEALPEDRNGFRWGSNIKTPIQETTWKKLS 600

Query: 601 KMQRRIMLKALADAETLDKICVLLEMPRQNVVNILHELGELKLINC 646
           KMQRRIMLKALADAETLDKICVLLEMPRQNVVNILHELGELKLINC
Sbjct: 601 KMQRRIMLKALADAETLDKICVLLEMPRQNVVNILHELGELKLINC 646

>Skud_5.27 Chr5 (33530..35377) [1848 bp, 615 aa] {ON} YEL062W (REAL)
          Length = 615

 Score =  523 bits (1348), Expect = e-179,   Method: Compositional matrix adjust.
 Identities = 308/662 (46%), Positives = 402/662 (60%), Gaps = 65/662 (9%)

Query: 1   MASQFEGFVDIHSIFYSTFHPTEGSKVKFDFPPRSLENSGINFDSIKNYVIPKRALCHRL 60
           M S F+GFV IH+IFYS FHPTEGSK+K++FPP +L+N GINF++IKNY+IPK  LCH+L
Sbjct: 1   MQSYFQGFVPIHTIFYSVFHPTEGSKIKYEFPPNNLKNHGINFNTIKNYIIPKPILCHKL 60

Query: 61  ITFKYGNYRIACYPVTVNSSIYARXXXXXXXXXXXXXXCETSPYEPAIERLGKMFRVLEI 120
           ITFKYG YRI CYPVT+NS IYAR              CETSPYEPAI RLGKMF+VLE 
Sbjct: 61  ITFKYGTYRIVCYPVTINSPIYARNFFSFNFVFVFPYDCETSPYEPAITRLGKMFKVLEE 120

Query: 121 QNQILSKSENDTIMFNLKSADKNFNIDNDSSNYILGDDISSIMT----TQQKD----KYE 172
           QNQ+LSKSE D + F+LK A +N  I   ++      + SS  T    T  KD    +  
Sbjct: 121 QNQLLSKSEKDAVFFDLK-ALENSTITPSTAGAPTTSNPSSNTTPTYPTSDKDAKDLRSS 179

Query: 173 RLNNIISNIKKKPSNFTISDLLMRLYQDLNTYSECLIPIDDGNAVDIKLFPLLTPPTPYI 232
           R N++  ++    S+F+I DLLMR++QDLN YSECLIPID+GNAVDIK+FPLL PPT  +
Sbjct: 180 RYNDLTKDLGLPESSFSIQDLLMRIFQDLNNYSECLIPIDEGNAVDIKIFPLLRPPTTCV 239

Query: 233 SIEHVPISLVNLFKIVDVNWDPIMLTXXXXXXXXXXXXXXSQLSHNEESLVIECIRHLVY 292
           S+E VP+S VNL KI+DVNWDP M++              S+LS ++ SLVIECIRHL+Y
Sbjct: 240 SLEDVPLSSVNLKKIIDVNWDPTMMSIVPYIDGLNSIAKISKLSRSDPSLVIECIRHLIY 299

Query: 293 YRCIVLTDIFEFSNVYAPTSSLRLFLLDPNMATECQSYVMLPINSKMNDLSLYPHHGKHS 352
           Y+C+ L+DIF+FSN+YAP+S +R FL D  MA++CQSYV  P  SKM+ L L  +     
Sbjct: 300 YKCVTLSDIFQFSNIYAPSSLIRTFLTDQLMASDCQSYVAFPEISKMSSLPLSKNLDSAD 359

Query: 353 AFNGDIGSRNNSVSTSLYSFNGNDSRPQSRSSS--------VDQSQTNFYKNKKQSESSI 404
             +  +  R  S S+S+ S    DSR  S SS+        ++ S ++  K+ +QS++S+
Sbjct: 360 RDSPSLFVRRKSKSSSIPS--NPDSRTTSFSSNSKVSQNSSLNSSFSSVCKDWRQSQTSL 417

Query: 405 STGNSNNGQNIHKHLPTRSLLFDLYRSLSQGITLKEWYMQNHKIIRDNRIDVRRFITFGV 464
           S+ N     N ++ LPTRS LFDLYRSLSQG TLK WY   H I+++N IDVRRFITFG+
Sbjct: 418 SSSNLRANDNRNRFLPTRSCLFDLYRSLSQGRTLKSWYESKHAILKENNIDVRRFITFGL 477

Query: 465 LRRIIYRCETYSVINSTDHLQNLWKLNELENPISMENISKLQSNHIDSLAADEALMNAYK 524
            RRIIYRC ++ V+ + D               S E     +    DSL  D +L    +
Sbjct: 478 ERRIIYRCYSFPVMLNVD---------------SRERKEMTRMILKDSLNDDRSLKKKNQ 522

Query: 525 KLSLK-VPSKGALKSHNTSHSSFSLTPTAPEMENSQAKRNKRLSKVSFEALPEDRNGFRW 583
             S   V SK + + +N                     +++R SKVSFE         R 
Sbjct: 523 DASFSVVGSKNSGQPNNV--------------------KSERPSKVSFEMQ-------RA 555

Query: 584 GSNIKTPIQETTWKKLSKMQRRIMLKALADAETLDKICVLLEMPRQNVVNILHELGELKL 643
           GS       E T  KLS  + RI+  ++  AE+ D ICVLL   +  V N L+ELGE K+
Sbjct: 556 GS---LATGEATIPKLSDEEERILENSIRSAESFDNICVLLSKSKLEVENYLNELGEFKV 612

Query: 644 IN 645
           IN
Sbjct: 613 IN 614

>ZYRO0C07876g Chr3 (598500..600545) [2046 bp, 681 aa] {ON} similar
           to uniprot|P39923 Saccharomyces cerevisiae YEL062W NPR2
           Regulator of nitrogen permeases transcription is induced
           in response to proline and urea contains two PEST
           sequences
          Length = 681

 Score =  515 bits (1327), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 293/676 (43%), Positives = 405/676 (59%), Gaps = 41/676 (6%)

Query: 1   MASQFEGFVDIHSIFYSTFHPTEGSKVKFDFPPRSLENSGINFDSIKNYVIPKRALCHRL 60
           M  QFEGFV IH++FY+ FHPT+G++V++++PP +LE + INFD+IKNY+IPK  LCH+L
Sbjct: 15  MTDQFEGFVPIHTLFYAVFHPTKGTQVRYEYPPGNLEYNNINFDAIKNYIIPKPQLCHKL 74

Query: 61  ITFKYGNYRIACYPVTVNSSIYARXXXXXXXXXXXXXXCETSPYEPAIERLGKMFRVLEI 120
           +T KY  YRI CYPVTVNS  YAR              CETS YEPAI RLGKMFRVLE 
Sbjct: 75  LTLKYKGYRIVCYPVTVNSPYYARNFFSFNFVFVFPYDCETSSYEPAIARLGKMFRVLEE 134

Query: 121 QNQILSKSENDTIMFNLKSADKNFNIDNDSSNYILGDDISSIMTTQQKDKYERLNNIISN 180
           QNQILSK+END I F+ K AD     D      +  +     +T  Q     + N I+ +
Sbjct: 135 QNQILSKAENDPIYFDFKLADNTTEQDGK----LNAEKSFKGLTKSQGMALAKYNEIMKD 190

Query: 181 IKKKPSNFTISDLLMRLYQDLNTYSECLIPIDDGNAVDIKLFPLLTPPTPYISIEHVPIS 240
           ++ + S+F++ DL+MR++QDLN YSECLIPID+GNAVDIK+FPL TPP   ISIE VPIS
Sbjct: 191 LESEKSDFSVQDLVMRIFQDLNNYSECLIPIDEGNAVDIKIFPLKTPPNSCISIEDVPIS 250

Query: 241 LVNLFKIVDVNWDPIMLTXXXXXXXXXXXXXXSQLSHNEESLVIECIRHLVYYRCIVLTD 300
            VNL  I+DVNWDP ML               ++LS ++ SLV+EC++HLVYY C++L D
Sbjct: 251 TVNLKTIIDVNWDPTMLKIVPYIDGLNSISKIAKLSDSDVSLVLECVKHLVYYNCVILAD 310

Query: 301 IFEFSNVYAPTSSLRLFLLDPNMATECQSYVMLPINSKMNDLSLYPHHGKHSAFNGDIGS 360
           IF+FSN+YAPTS +R FL DP +A+ECQS+V L  +S ++++   P          D+  
Sbjct: 311 IFQFSNIYAPTSLIRQFLTDPTLASECQSHVTLAGHSSLSEM---PFERLRKFDLDDMDQ 367

Query: 361 RNNSVSTSLYSFNGNDSRPQSRSSSVDQSQTNFYKNKKQSESSISTGNSNNGQNIHKHLP 420
             N  S S  +   + S  +S+      +  N Y+  ++S+SS S+ N+N   ++ +HLP
Sbjct: 368 SKNQESGSRTTSMSSKSDSKSKRPFFYSAPRNPYRFNQRSQSSFSSTNTNVTHDLARHLP 427

Query: 421 TRSLLFDLYRSLSQGITLKEWYMQNHKIIRDNRIDVRRFITFGVLRRIIYRCETYSVINS 480
           T++ LFDLYR+LSQG+T++EWY  N++ I+ N IDVRRFITFGV++ +IYRC ++ V+  
Sbjct: 428 TKACLFDLYRTLSQGVTVREWYNLNYQTIKKNDIDVRRFITFGVIKGLIYRCFSFPVMKK 487

Query: 481 TDHLQNLWKLNELENPISMENISKLQSNHIDSL-----------------------AADE 517
                   KL+   N   +    K Q N  +S                         ADE
Sbjct: 488 MSIFDLAHKLHTAGNLNQVTKKGKGQKNLAESKYVFSTSDMKLGEGSKMHQNFSVDIADE 547

Query: 518 ALMNAYKKLSLKVPSKGALKSHNTS-----HSSFSLTPTAPEMENSQAKRNKRLSKVSFE 572
            L N YKKLS      G+   +  S      S  SL+  + +   S  K+ +R+SKV+F+
Sbjct: 548 VLRNVYKKLS-NTNEPGSRDDYPLSRIYREESHVSLSALSGD-NVSHPKKPERVSKVAFD 605

Query: 573 ALPEDRNGFRWGSNIKTPIQETTWKKLSKM---QRRIMLKALADAETLDKICVLLEMPRQ 629
              +D   +   S  K   +E    KL +    Q+ I+L+++A A+ LDKICV LE PR 
Sbjct: 606 MNKDDPVPYSL-SQQKGKNKEREAAKLDRAKNNQKIILLESIAAADCLDKICVKLEKPRH 664

Query: 630 NVVNILHELGELKLIN 645
            V  +LHELG+ K+IN
Sbjct: 665 EVEELLHELGDYKIIN 680

>Suva_5.5 Chr5 (10147..12006) [1860 bp, 619 aa] {ON} YEL062W (REAL)
          Length = 619

 Score =  504 bits (1299), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 299/672 (44%), Positives = 402/672 (59%), Gaps = 81/672 (12%)

Query: 1   MASQFEGFVDIHSIFYSTFHPTEGSKVKFDFPPRSLENSGINFDSIKNYVIPKRALCHRL 60
           M S F+GFV IH+IFYS FHPTEGSK+K++FPP +L++ GINF++IKNY+IPK  LCH+L
Sbjct: 1   MQSYFQGFVPIHTIFYSVFHPTEGSKIKYEFPPNNLKSHGINFNTIKNYIIPKPILCHKL 60

Query: 61  ITFKYGNYRIACYPVTVNSSIYARXXXXXXXXXXXXXXCETSPYEPAIERLGKMFRVLEI 120
           ITFKYG YRI CYPVT+NS IYAR              CETSPYEPAI RLGKMF+VLE 
Sbjct: 61  ITFKYGTYRIVCYPVTINSPIYARNFFSFNFVFVFPYDCETSPYEPAITRLGKMFKVLEE 120

Query: 121 QNQILSKSENDTIMFNLKSADKNF---------NIDNDSSNYILGDDISSIMTTQQKDKY 171
           QNQ+LSKSE D + F+LK+ + +             N SSN       +    T  KD  
Sbjct: 121 QNQLLSKSERDPVFFDLKAIENSLLTPSTAGPPATSNPSSN------TTPTHPTSDKDAK 174

Query: 172 ---------ERLNNIISNIKKKPSNFTISDLLMRLYQDLNTYSECLIPIDDGNAVDIKLF 222
                    E+ N+II ++    S F+I DLLMR++QDLN YSECLIPIDDGNAVDIK+F
Sbjct: 175 DLRSNRFNGEKYNDIIKDLGLPESTFSIQDLLMRIFQDLNNYSECLIPIDDGNAVDIKIF 234

Query: 223 PLLTPPTPYISIEHVPISLVNLFKIVDVNWDPIMLTXXXXXXXXXXXXXXSQLSHNEESL 282
           PLL PPT  +S+E VP+S VNL KI+DVNWDP M+               S+ SH++ SL
Sbjct: 235 PLLRPPTTCVSLEDVPLSSVNLKKIIDVNWDPTMMGIVPYIDGLNSIAKISKFSHSDPSL 294

Query: 283 VIECIRHLVYYRCIVLTDIFEFSNVYAPTSSLRLFLLDPNMATECQSYVMLPINSKMNDL 342
           VIECIRHL+YY+C+ L+DIF+FSN+YAP+S +R FL DP MAT+CQSYV  P  SK+++L
Sbjct: 295 VIECIRHLIYYKCVTLSDIFQFSNIYAPSSLIRNFLTDPLMATDCQSYVTFPEISKLSNL 354

Query: 343 SLYPHHGKHSAFNGDIGS---------RNNSVSTSLYSFNGNDSRPQSRSSSVDQSQTNF 393
              P +    + + D+ S          +   + +  + + + +   S++SS++ S ++ 
Sbjct: 355 ---PLNKNFDSVDQDLTSFSVRRKSKSSSVPSNPNSRTTSFSSTSKVSQNSSLNSSFSSV 411

Query: 394 YKNKKQSESSISTGNSNNGQNIHKHLPTRSLLFDLYRSLSQGITLKEWYMQNHKIIRDNR 453
            K+ +QS++S S+ N++     ++ LPTRS LFDLYRSLSQG TLK WY      +++N 
Sbjct: 412 SKDWRQSQTSCSSTNTHAISKRNQFLPTRSCLFDLYRSLSQGQTLKSWYELKFTTLKENN 471

Query: 454 IDVRRFITFGVLRRIIYRCETYSVINSTDHLQNLWKLNELENPISMENISKLQSNHIDSL 513
           ID+RRFITFG+ R IIYRC ++ V+                              H+ S 
Sbjct: 472 IDIRRFITFGLERSIIYRCYSFPVM-----------------------------IHVGSR 502

Query: 514 AADEALMNAYKKLSLKVPSKGALKSHNTSHSSFSLTPTAPEMENSQAKRNKRLSKVSFEA 573
              E    A K+ S +     +LK  + +H   SL+ T  +       +++R SKVSFE 
Sbjct: 503 DTKEMTPVATKEPSNE---DNSLKKRDYNH---SLSVTGSKSTTQTNVKSERPSKVSFEM 556

Query: 574 LPEDRNGFRWGSNIKTPIQETTWKKLSKMQRRIMLKALADAETLDKICVLLEMPRQNVVN 633
             +  N    G N K P       KLS  +++I+ K++  AE  DKICVLL   +Q V N
Sbjct: 557 --QRANSLATGKN-KIP-------KLSDEEKKILEKSIRSAENFDKICVLLGKSKQEVEN 606

Query: 634 ILHELGELKLIN 645
            L ELGE K+IN
Sbjct: 607 YLSELGEFKVIN 618

>TDEL0G04520 Chr7 (822826..824865) [2040 bp, 679 aa] {ON} Anc_6.17
           YEL062W
          Length = 679

 Score =  507 bits (1305), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 292/682 (42%), Positives = 414/682 (60%), Gaps = 41/682 (6%)

Query: 1   MASQFEGFVDIHSIFYSTFHPTEGSKVKFDFPPRSLENSGINFDSIKNYVIPKRALCHRL 60
           M  QFEGF+ IH+IFY+ FHPTEG+KV+++FPP +LE+  INFD+IKNY+IPK  LCH+L
Sbjct: 1   MGDQFEGFIPIHTIFYAVFHPTEGTKVRYEFPPGNLESHNINFDAIKNYIIPKPQLCHKL 60

Query: 61  ITFKYGNYRIACYPVTVNSSIYARXXXXXXXXXXXXXXCETSPYEPAIERLGKMFRVLEI 120
           +T KY NYRIA YPVTVNS IYAR              C+TSPYEPAI RLGKMF+VLE 
Sbjct: 61  LTLKYKNYRIASYPVTVNSPIYARNFFSFNFVFVFPYDCQTSPYEPAIARLGKMFKVLEE 120

Query: 121 QNQILSKSENDTIMFNLKSADKNFNIDNDSSNYILGDDISSIMTTQQKDKYERLNNIISN 180
           QN ILSK+E D I ++ K  +    I +D       +  S  ++  Q    E+ + I+++
Sbjct: 121 QNLILSKAEKDPIFYHFKQVE----IKDDQDAKSKPEKGSHNLSKSQAYASEKYHKIMTD 176

Query: 181 IKKKPSNFTISDLLMRLYQDLNTYSECLIPIDDGNAVDIKLFPLLTPPTPYISIEHVPIS 240
           I+   S F++ DL++R+YQDLN YSECLIPID+GNAVDIK+FP++TPP   ISIE VP+S
Sbjct: 177 IESADSTFSLKDLVLRVYQDLNNYSECLIPIDEGNAVDIKIFPMMTPPNSNISIEDVPVS 236

Query: 241 LVNLFKIVDVNWDPIMLTXXXXXXXXXXXXXXSQLSHNEESLVIECIRHLVYYRCIVLTD 300
            VNL K++DVNWDP ML               ++LS ++  LVIECI+HL+YY C++L D
Sbjct: 237 TVNLNKVIDVNWDPTMLKIVPYINGLNSISKIAKLSVSDPGLVIECIKHLIYYNCVLLAD 296

Query: 301 IFEFSNVYAPTSSLRLFLLDPNMATECQSYVMLPINSKMNDLSL-YPHHGKHSAFNGDIG 359
           IF+FSN+YAPTSSLR FL D  ++TECQSYV+   +S +  L     +H    + + ++ 
Sbjct: 297 IFQFSNIYAPTSSLRTFLTDSVLSTECQSYVVCEEDSTLPRLPFKRVNHSATESVDHELA 356

Query: 360 SRNNSVSTSLYSFNGNDSRPQSRSSSVDQ-----SQTNFYKNKKQSESSISTGNSNNGQN 414
             + S  TS        S  +   SS ++     S+ + Y+  K S+SS S+ N+N    
Sbjct: 357 DSHRSQRTSGSRTTSMSSNGKFFPSSNNEMPALISEESLYRTGKHSQSSFSSNNTNPSNM 416

Query: 415 IHKHLPTRSLLFDLYRSLSQGITLKEWYMQNHKIIRDNRIDVRRFITFGVLRRIIYRCET 474
           + ++LPT+S LFDLYRSLSQG +L+EWY  ++  IR NRIDVRRFITFGV+  +IYRC +
Sbjct: 417 LARYLPTKSCLFDLYRSLSQGTSLREWYGVHYGTIRANRIDVRRFITFGVINGLIYRCYS 476

Query: 475 YSVINSTD--------HLQNL----WKLNELENP----ISMENI------SKLQSNHIDS 512
           Y ++ + +        H +++     K N+ +NP     S  +I       + ++ H  +
Sbjct: 477 YPIMKNLEIFDLAKRLHREDISNHTVKHNKAKNPSKNIFSTSDIKFGVEYERQRNKHHKA 536

Query: 513 L---AADEALMNAYKKLSLKVPSKGALKSHNTSHSSF---SLTPTAPEMENS--QAKRNK 564
           L    ADE L N YKKLS+   +     S +     +   SL   A    N+  + + + 
Sbjct: 537 LNLDIADEVLRNVYKKLSVTNSTDTRPNSADPIARLYRERSLGSLADGSTNNIYRLQNSD 596

Query: 565 RLSKVSFEALPEDRNGFRWGSNIKTPIQETTWKKLSKMQRR-IMLKALADAETLDKICVL 623
           R SKVSF+   E  +  +  S+    ++     KL + +R  I+L+++  A++LD ICV 
Sbjct: 597 RPSKVSFDKQQEIGHISKGMSSSNDKVKMDEEAKLERRERDLILLESVEAADSLDTICVK 656

Query: 624 LEMPRQNVVNILHELGELKLIN 645
           LEM R +V  ++  LGE K+IN
Sbjct: 657 LEMSRYDVEALIQNLGEYKIIN 678

>Smik_5.25 Chr5 (36761..38452,38453..38605) [1845 bp, 615 aa] {ON}
           YEL062W (REAL)
          Length = 615

 Score =  501 bits (1291), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 305/665 (45%), Positives = 406/665 (61%), Gaps = 71/665 (10%)

Query: 1   MASQFEGFVDIHSIFYSTFHPTEGSKVKFDFPPRSLENSGINFDSIKNYVIPKRALCHRL 60
           M S F+GFV IH+IFYS FHPTEGSK+K++FPP +L+N GINF++IKNY+IPK  LCH+L
Sbjct: 1   MLSYFQGFVPIHTIFYSVFHPTEGSKIKYEFPPNNLKNHGINFNTIKNYIIPKPVLCHKL 60

Query: 61  ITFKYGNYRIACYPVTVNSSIYARXXXXXXXXXXXXXXCETSPYEPAIERLGKMFRVLEI 120
           ITFKYG YRI CYPVT+NS IYAR              CETSPYEPAI RLGKMF+VLE 
Sbjct: 61  ITFKYGTYRIVCYPVTINSPIYARNFFSFNFVFVFPYDCETSPYEPAITRLGKMFKVLEE 120

Query: 121 QNQILSKSENDTIMFNLKSADKNFNIDNDSSNYILGDDISSIMT----TQQKDKYE---- 172
           QNQ+LSKSE D + F+LK A +N  I   ++      + SS  T    T  KD  +    
Sbjct: 121 QNQLLSKSEKDPVFFDLK-ALENSTIAPSTACPPATSNTSSNTTPTHPTSDKDAKDLRNS 179

Query: 173 RLNNIISNIKKKPSNFTISDLLMRLYQDLNTYSECLIPIDDGNAVDIKLFPLLTPPTPYI 232
           R N+++ + +   S F+I DLLMR++QDLN YSECLIPID+GNAVDIK+FPLL PPT  +
Sbjct: 180 RYNDLVKDFELPESTFSIQDLLMRIFQDLNNYSECLIPIDEGNAVDIKIFPLLRPPTTCV 239

Query: 233 SIEHVPISLVNLFKIVDVNWDPIMLTXXXXXXXXXXXXXXSQLSHNEESLVIECIRHLVY 292
           S+E VP+S VNL KI+DVNWDP M+               S+LS+++ SLVIECIRHL+Y
Sbjct: 240 SLEDVPLSSVNLEKIIDVNWDPTMMNIVPYIDGLNSIAKISKLSNSDPSLVIECIRHLIY 299

Query: 293 YRCIVLTDIFEFSNVYAPTSSLRLFLLDPNMATECQSYVMLPINSKMNDLSLYPHHGKHS 352
           Y+C+ L+DIF+FSN+YAP+SS+R FL DP MA +CQ YV  P  SK++ L L       +
Sbjct: 300 YKCVTLSDIFQFSNIYAPSSSIRNFLTDPLMANDCQYYVTFPEVSKISSLPL-----NKN 354

Query: 353 AFNGDIGSRN-----NSVSTSLYSFNGNDSRPQSRSSSVDQSQTNF------YKNKKQSE 401
             +GD+ S +      S S+S+ S  G+ +   S +S V Q+ +        Y++ +QS+
Sbjct: 355 LTSGDLDSPSFSVRRKSKSSSIPSNPGSRTTSFSSTSKVSQNSSINSSFSSAYRDWRQSQ 414

Query: 402 SSISTGNSNNGQNIHKHLPTRSLLFDLYRSLSQGITLKEWYMQNHKIIRDNRIDVRRFIT 461
           +S S+ N +   N ++ LPTRS LFDLYRSLSQG TLK WY   + II+DN ID+RRFIT
Sbjct: 415 TSCSSSNIHISNNRNRFLPTRSCLFDLYRSLSQGQTLKAWYESKYMIIKDNNIDIRRFIT 474

Query: 462 FGVLRRIIYRCETYSVINSTDHLQNLWKLNELENPISMENISKLQSNHIDSLAADEALMN 521
           FG+ +RIIYR  +Y V         +  +   E   +   I+K      DS     +   
Sbjct: 475 FGLEKRIIYRSYSYPV---------MLSVGPRETKETAPIIAK------DSPNESNSSEK 519

Query: 522 AYKKLSLK-VPSKGALKSHNTSHSSFSLTPTAPEMENSQAKRNKRLSKVSFEALPEDRNG 580
            Y + S   + SK A+  +N                     ++ R SKVSF+        
Sbjct: 520 KYHEHSFSIIRSKNAVLFNNI--------------------KSGRPSKVSFD-------- 551

Query: 581 FRWGSNIKTPIQETTWKKLSKMQRRIMLKALADAETLDKICVLLEMPRQNVVNILHELGE 640
            +  S++ T   E+T  KLS  + RI+ +++  AE  DKICVLL  P+  V N L+ELGE
Sbjct: 552 MQKASSLIT--GESTIPKLSDDEERILEESVRSAENFDKICVLLGKPKLEVENYLNELGE 609

Query: 641 LKLIN 645
            K+IN
Sbjct: 610 FKIIN 614

>YEL062W Chr5 (34407..36254) [1848 bp, 615 aa] {ON}  NPR2Subunit of
           SEA (Seh1-associated), Npr2/3, and Iml1p complexes;
           Npr2/3 complex mediates downregulation of TORC1 activity
           upon amino acid limitation; SEA complex is a
           coatomer-related complex that associates dynamically
           with the vacuole; Iml1p complex (Iml1p-Npr2p-Npr3p) is
           required for non-nitrogen-starvation (NNS)-induced
           autophagy; Iml1p interacts primarily with phosphorylated
           Npr2p; homolog of human NPRL2; target of Grr1p; required
           for growth on urea and proline
          Length = 615

 Score =  498 bits (1283), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 297/660 (45%), Positives = 406/660 (61%), Gaps = 61/660 (9%)

Query: 1   MASQFEGFVDIHSIFYSTFHPTEGSKVKFDFPPRSLENSGINFDSIKNYVIPKRALCHRL 60
           M S F+GFV IH+IFYS FHPTEGSK+K++FPP +L+N GINF++ KNY+IPK  LCH+L
Sbjct: 1   MLSYFQGFVPIHTIFYSVFHPTEGSKIKYEFPPNNLKNHGINFNTFKNYIIPKPILCHKL 60

Query: 61  ITFKYGNYRIACYPVTVNSSIYARXXXXXXXXXXXXXXCETSPYEPAIERLGKMFRVLEI 120
           ITFKYG YRI CYPVT+NS IYAR              CETSPYEPAI RLGKMF+VLE 
Sbjct: 61  ITFKYGTYRIVCYPVTINSPIYARNFFSFNFVFVFPYDCETSPYEPAITRLGKMFKVLEE 120

Query: 121 QNQILSKSENDTIMFNLKSADKNF---NIDNDSSNYILGDDISSIMTTQQKD----KYER 173
           QNQ+LSKSE D + F+LK  + +    +    SS      + +    T +KD    +  R
Sbjct: 121 QNQLLSKSERDPVFFDLKVLENSTTTPSTAGPSSTPNPSSNTTPTHPTSEKDTKDMRSSR 180

Query: 174 LNNIISNIKKKPSNFTISDLLMRLYQDLNTYSECLIPIDDGNAVDIKLFPLLTPPTPYIS 233
            +++I ++    S F+I DLLMR++QDLN YSECLIPID+GNAVDIK+FPLL PPT  +S
Sbjct: 181 YSDLIKDLGLPQSAFSIQDLLMRIFQDLNNYSECLIPIDEGNAVDIKIFPLLRPPTTCVS 240

Query: 234 IEHVPISLVNLFKIVDVNWDPIMLTXXXXXXXXXXXXXXSQLSHNEESLVIECIRHLVYY 293
           +E VP+S VNL KI+DVNWDP M++              S+LS+++  LVIECIRHL+YY
Sbjct: 241 LEDVPLSSVNLKKIIDVNWDPTMMSIVPYIDGLNSIAKISKLSNSDPGLVIECIRHLIYY 300

Query: 294 RCIVLTDIFEFSNVYAPTSSLRLFLLDPNMATECQSYVMLPINSKMNDLSLYPHHGKHSA 353
           +C+ L+DIF+FSN+YAP+S +R FL DP MA++CQSYV  P  SK+++L L    G    
Sbjct: 301 KCVTLSDIFQFSNIYAPSSLIRNFLTDPLMASDCQSYVTFPEVSKISNLPLNKSLGSGDQ 360

Query: 354 FNGDIGSRNNSVSTSLYS------FNGNDSRPQSRSSSVDQSQTNFYKNKKQSESSISTG 407
            +     R  S S+S+ S       + + +   S++SS++ S ++ YK+ +QS++S S+ 
Sbjct: 361 DSPSFSVRRKSKSSSIPSNPDSRTTSFSSTSRVSQNSSLNSSFSSIYKDWRQSQTSCSSS 420

Query: 408 NSNNGQNIHKHLPTRSLLFDLYRSLSQGITLKEWYMQNHKIIRDNRIDVRRFITFGVLRR 467
           N +   N ++ LPTRS LFDLYRSLSQG TLK WY   + I+++N ID+RRFITFG+ +R
Sbjct: 421 NIHVINNRNRFLPTRSCLFDLYRSLSQGQTLKTWYESKYMILKENNIDIRRFITFGLEKR 480

Query: 468 IIYRCETYSVINSTDHLQNLWKLNELENPISMENISKLQSNHIDSLAADEALMNAYKKLS 527
           IIYRC ++ V                     M N    +   +  +   + L+N  K L 
Sbjct: 481 IIYRCYSFPV---------------------MINAGSREPKEMTPIITKD-LVNNDKLLE 518

Query: 528 LKVPSK--GALKSHNTSHSSFSLTPTAPEMENSQAKRNKRLSKVSFEALPEDRNGFRWGS 585
            +  +    A  S NT+ S  +L P  P             SKVSFE         +  S
Sbjct: 519 KRNHNHLLSATGSRNTAQSG-NLKPERP-------------SKVSFE--------MQRVS 556

Query: 586 NIKTPIQETTWKKLSKMQRRIMLKALADAETLDKICVLLEMPRQNVVNILHELGELKLIN 645
           ++ T   ++T  KLS  +  I+ +++ +AET DKICVLL  P+  V + L+ELGE K+IN
Sbjct: 557 SLAT--GKSTMPKLSDEEEGILEESIRNAETFDKICVLLSKPKLEVESYLNELGEFKVIN 614

>Kpol_1045.72 s1045 (167094..169181) [2088 bp, 695 aa] {ON}
           (167096..169183) [2088 nt, 696 aa]
          Length = 695

 Score =  490 bits (1261), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 304/704 (43%), Positives = 397/704 (56%), Gaps = 76/704 (10%)

Query: 5   FEGFVDIHSIFYSTFHPTEGSKVKFDFPPRSLENSGINFDSIKNYVIPKRALCHRLITFK 64
           F+GF  IH+IFYS FHPTEG KV + FPP +L+N  INFDSI++YVIPK  LC++L+T K
Sbjct: 4   FDGFEPIHTIFYSVFHPTEGPKVCYQFPPNNLDNYSINFDSIRSYVIPKPQLCNKLLTLK 63

Query: 65  YGNYRIACYPVTVNSSIYARXXXXXXXXXXXXXXCETSPYEPAIERLGKMFRVLEIQNQI 124
           YGNYRI  YP+T+N SIYAR              C+TSPYE  I +LGKMFRVLE Q+Q 
Sbjct: 64  YGNYRIIGYPITINCSIYARNNFSFNLVFVFPYECKTSPYESVIVKLGKMFRVLEEQSQF 123

Query: 125 LSKSENDTIMFNLKSADKNFNIDNDSS----------------NYILGDDISSIMTTQQK 168
           LSK+E D   F+ K A  + ++D DS                 N       S+  T  +K
Sbjct: 124 LSKAEKDLAYFDFK-AILHSSLDQDSKLKPEKDSSGNNNGNSNNSNNDQSNSANATDSKK 182

Query: 169 ------DKYERLNNIISNIKKKPSNFTISDLLMRLYQDLNTYSECLIPIDDGNAVDIKLF 222
                 +KY+ +   +SN     S+F+I D +MRLYQDLN YSECLIPID GNAVDIKLF
Sbjct: 183 NSSYLFEKYKEIQEFVSN---DESDFSIQDFIMRLYQDLNNYSECLIPIDAGNAVDIKLF 239

Query: 223 PLLTPPTPYISIEHVPISLVNLFKIVDVNWDPIMLTXXXXXXXXXXXXXXSQLSHNEESL 282
           PLL PP   ISIE VPIS VNL +I+DVNWDP ML               ++LS ++  L
Sbjct: 240 PLLRPPPATISIEDVPISRVNLKEIIDVNWDPTMLKIVPHIDGVNSIAKIAKLSDSDTVL 299

Query: 283 VIECIRHLVYYRCIVLTDIFEFSNVYAPTSSLRLFLLDPNMATECQSYVMLPINSKMNDL 342
           VIECI+H +YY C+V++DIF+FSN+YAPTS LR FL DP MATECQ+YV +P +S ++ L
Sbjct: 300 VIECIKHFIYYGCVVISDIFQFSNIYAPTSLLRNFLTDPLMATECQTYVTVPESSTLHQL 359

Query: 343 SLYPHHGKHSAFNGDIGSRNNSVSTSLYSFNGNDSRPQSRSSSVDQ----------SQTN 392
            L       S     + S  +       S NG DSR  S  SS             S+++
Sbjct: 360 PL------ESLSKLKLDSDGSDSQNLRKSKNGIDSRAASFVSSRGASSHNENSSLYSRSD 413

Query: 393 FYKNKKQSESSISTGNSNNGQNIHKHLPTRSLLFDLYRSLSQGITLKEWYMQNHKIIRDN 452
            Y N+ +SESSIS+ N+N+     K LPTRS LFDLYRSLSQG+TLKEWY +N   IR+N
Sbjct: 414 LYLNRHRSESSISSQNTNDLNGNVKQLPTRSTLFDLYRSLSQGVTLKEWYKENFFEIRNN 473

Query: 453 RIDVRRFITFGVLRRIIYRCETYSVINSTDHLQNLWKLNELEN--PISMENISKLQSNHI 510
            ID+R+FI FG++  ++YRC+++ V  + + +  + K  +++N      + + K  S  I
Sbjct: 474 GIDIRKFIIFGIINGLLYRCQSFPVTANFEEINKVKKFKDIQNRKETRKDKLQKQLSQDI 533

Query: 511 DSLA-----------------------ADEALMNAYKKLSLKVP----SKGALKSHNTSH 543
            S +                       AD  L N YKKL+LK      S  AL S     
Sbjct: 534 FSTSDIKVGEDLISGRNRRIQTLDLDIADSVLKNVYKKLTLKTEEENSSNRALNSQELEK 593

Query: 544 SSFSLTPTAPEMENSQAKRNKRLSKVSFEALPEDRNGFRWGSNIKTPIQE--TTWKKLSK 601
            S      +    +   KR   LSKVSF+   ++ N     S+      E     +KL K
Sbjct: 594 KSVQSLFESSNPYSKVPKRPGTLSKVSFQ---QNSNMQYSASSGDVTENEDINNLEKLRK 650

Query: 602 MQRRIMLKALADAETLDKICVLLEMPRQNVVNILHELGELKLIN 645
              +I+L+AL   E LDKICVLLE PR  V  +L  L + K+IN
Sbjct: 651 QNEQILLEALESTENLDKICVLLEKPRSEVEEMLKHLVDFKVIN 694

>Ecym_3021 Chr3 complement(40454..42478) [2025 bp, 674 aa] {ON}
           similar to Ashbya gossypii ACR009W
          Length = 674

 Score =  477 bits (1228), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 294/693 (42%), Positives = 401/693 (57%), Gaps = 68/693 (9%)

Query: 1   MASQFEGFVDIHSIFYSTFHPTEGSKVKFDFPPRSLENSGINFDSIKNYVIPKRALCHRL 60
           M++ F+GFV IHSIFYS FHPTEG+KV+F FPP SLENSGI+FD+IKNYVIPK  LC++L
Sbjct: 1   MSNHFDGFVPIHSIFYSLFHPTEGTKVRFQFPPDSLENSGISFDTIKNYVIPKPQLCNKL 60

Query: 61  ITFKYGNYRIACYPVTVNSSIYARXXXXXXXXXXXXXXCETSPYEPAIERLGKMFRVLEI 120
           +TFKYG+YR+ CYPV +N+S YAR                TSPYEPAI RLGKMFRVLE 
Sbjct: 61  LTFKYGSYRLVCYPVNINASYYARNSFSFDFVFVFPYDSATSPYEPAIGRLGKMFRVLEE 120

Query: 121 QNQILSKSENDTIMFNLKSADKNFNIDNDSSNYILGDDISS----IMTTQQKDKYERLNN 176
           Q+Q+LSK E D I ++LK+ D    +D +S      ++  +    I     +  +E+ + 
Sbjct: 121 QSQVLSKIERDPIYYHLKTQDVK-AVDQNSEEPESKNNPQNCNDKIRRGHHEHAFEKYHE 179

Query: 177 IISNIKKKPSNFTISDLLMRLYQDLNTYSECLIPIDDGNAVDIKLFPLLTPPTPYISIEH 236
           I+ +I       +I DL+ +LY+DLN YSECLIP+D GNA+DIKLFPLL PP    S+E 
Sbjct: 180 IMKHIAMNEKQLSIEDLITKLYEDLNNYSECLIPMDSGNAIDIKLFPLLAPPNSCFSVED 239

Query: 237 VPISLVNLFKIVDVNWDPIMLTXXXXXXXXXXXXXXSQLSHNEESLVIECIRHLVYYRCI 296
           VPI+ +NL   VDVNWDP M+               S+ S ++  LV+EC++HL+YY C+
Sbjct: 240 VPIAKLNLIDWVDVNWDPTMVKIVPYINGINSIAKISKYSDSDVGLVMECVKHLIYYDCV 299

Query: 297 VLTDIFEFSNVYAPTSSLRLFLLDPNMATECQSYVMLPINSKMNDLSLYPHHGKHSAFNG 356
           VL D+F+FSN+YAPTS L  FL DP++A ECQ YV   I+S+ ++L   P  G+ +A + 
Sbjct: 300 VLVDMFQFSNIYAPTSQLSEFLTDPSIARECQLYV---ISSEDSELHQLPFEGRPNANH- 355

Query: 357 DIGSRNNSVST----SLYSFNGNDSRPQSRSSSVDQSQTNFYKNKKQSESSI--STGNS- 409
              SRN + ST    +L      + RP+S SS+ + +Q         SE SI  S+ NS 
Sbjct: 356 ---SRNPTASTITFGTLKRTIYTNPRPESFSSNTEFAQKPNANTSLPSEPSITHSSKNSE 412

Query: 410 ----NNGQNIHKHLPTRSLLFDLYRSLSQGITLKEWYMQNHKIIRDNRIDVRRFITFGVL 465
               NN   +++ LPTRS LFDLYRSLSQG T+K+WY  N ++IR NRIDVRRFITFGV 
Sbjct: 413 FNHENNKGILNRTLPTRSCLFDLYRSLSQGQTMKDWYKMNFEVIRKNRIDVRRFITFGVF 472

Query: 466 RRIIYRCETYSVINSTDHLQNLWKLNELENPISMENISKLQSNHIDSL------------ 513
           R++IYRC +Y V  S   L  L + +    P +  +     SN++ S             
Sbjct: 473 RKLIYRCYSYPVAKSIGTLDMLKRFDYASLPNNFMSPKNNNSNNVFSTADICVDFGEPSQ 532

Query: 514 -----------AADEALMNAYKKLSLKVPSKGALKSHNTSHSSFSLTPTAPEMENSQAKR 562
                      AADE L +AYKKLSL       L    T     SL     E + S    
Sbjct: 533 FRKKPLVPNTDAADEVLRDAYKKLSLNERLPNPL-DQITRSKKLSL-----ENDASANVD 586

Query: 563 NKRLS-------KVSFEALPEDR---NGFRWGSNIKTPIQETTWKKLSKMQRRIMLKALA 612
           N++LS       KV F+   +DR     F +    +     +T  K  + Q+ ++LK++ 
Sbjct: 587 NRKLSSSTSGTAKVLFDM--KDRLSNKDFEY----RDQNAASTELKRKRQQQFLLLKSIK 640

Query: 613 DAETLDKICVLLEMPRQNVVNILHELGELKLIN 645
           + ++ DKI + LE+ +Q V  +L   GE  +IN
Sbjct: 641 NVDSFDKIAIKLEINKQEVEELLKATGEYNIIN 673

>SAKL0E01100g Chr5 complement(83492..85624) [2133 bp, 710 aa] {ON}
           similar to uniprot|P39923 Saccharomyces cerevisiae
           YEL062W NPR2 Regulator of nitrogen permeases
           transcription is induced in response to proline and urea
           contains two PEST sequences
          Length = 710

 Score =  477 bits (1227), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 285/716 (39%), Positives = 402/716 (56%), Gaps = 78/716 (10%)

Query: 1   MASQFEGFVDIHSIFYSTFHPTEGSKVKFDFPPRSLENSGINFDSIKNYVIPKRALCHRL 60
           M+S F+GFV IH++FYS FHPTEG+KV++ FPP +LEN+ INFD+IKNYVIPK  LC++L
Sbjct: 1   MSSHFDGFVPIHTVFYSVFHPTEGTKVRYQFPPTNLENNDINFDTIKNYVIPKPQLCNKL 60

Query: 61  ITFKYGNYRIACYPVTVNSSIYARXXXXXXXXXXXXXXCETSPYEPAIERLGKMFRVLEI 120
           +TFKYG YR+ACYPV VN+S YAR              C TSPYEPA+ RLGKMFRVLE 
Sbjct: 61  LTFKYGPYRLACYPVNVNASYYARNSFNFNFVFVFPYNCATSPYEPAVARLGKMFRVLEE 120

Query: 121 QNQILSKSENDTIMFNLKSADKNFN-----IDNDSSNYILGDDISSIMTTQQKDK----- 170
           Q+QILSK+END + F+LKS + + N     +D   S+     +  + +   Q  K     
Sbjct: 121 QSQILSKAENDPVYFHLKSQESSTNSSSHPVDQGGSDRPKDTEQGTGLNNSQDSKEQGKI 180

Query: 171 ------YERLNNIISNIKKKPSNFTISDLLMRLYQDLNTYSECLIPIDDGNAVDIKLFPL 224
                  E+ + I+ +++K     +I DL+ +LYQDLN YSEC IPID GN+VDIKLFPL
Sbjct: 181 EGQGAAIEKYHEIMDDLEKGKKRLSIEDLITKLYQDLNNYSECFIPIDSGNSVDIKLFPL 240

Query: 225 LTPPTPYISIEHVPISLVNLFKIVDVNWDPIMLTXXXXXXXXXXXXXXSQLSHNEESLVI 284
           L PP   +S E VPIS VNL K++DVNWDP ML               ++ S ++  LVI
Sbjct: 241 LAPPNSCLSFEDVPISTVNLAKLIDVNWDPTMLKIVPFINGVNSIAKIAKFSSSDTDLVI 300

Query: 285 ECIRHLVYYRCIVLTDIFEFSNVYAPTSSLRLFLLDPNMATECQSYVM--------LPIN 336
           EC++HL+YY C+VL DIF+FSN+YA TS +  FL DP +A+ECQ+YV         LP  
Sbjct: 301 ECVKHLIYYNCVVLADIFQFSNIYASTSLISEFLTDPTLASECQTYVTSSDLELYRLPFE 360

Query: 337 SKMNDLSLYPHHGKHSAFN-GDIGSRNNSVSTSLYSFNGNDSRPQSRSSSVDQSQTNFYK 395
           S+ N LS++    ++S+     +G RN+   T+   +    S   +R ++   S  +   
Sbjct: 361 SRPNLLSMHSSRKQNSSSTIHTVGVRNSPNRTNSLDY---PSELSTRRNNFSSSSASSLM 417

Query: 396 NKKQSESSISTGNSNNGQNIHKHLPTRSLLFDLYRSLSQGITLKEWYMQNHKIIRDNRID 455
             +      +TG++ + Q     LPT+S LFDLYRSL QG T+KEWY  N +IIRDN ID
Sbjct: 418 RVRDRSGQSTTGSAVDEQESRLLLPTKSCLFDLYRSLHQGETVKEWYKINFEIIRDNHID 477

Query: 456 VRRFITFGVLRRIIYRCETYSVINSTDHLQNLWKLNELENPISMENISKLQ-----SNHI 510
           VRRFITFG++R +IYRC  Y V+ +   L+ L  L    +  S+    K +     +N++
Sbjct: 478 VRRFITFGIVRGLIYRCYAYPVMKNLGALEMLKTLKSASDSRSLRRKLKFREKKNFTNNV 537

Query: 511 DSLA----------------------------ADEALMNAYKKLSLKVPS---------- 532
            S A                            A+E L +AYKKLS+ + S          
Sbjct: 538 FSTADIKVDLEHSPGGAPAEIFNRKHTSNVDMAEEVLKDAYKKLSI-IESMDDNLYHVHN 596

Query: 533 -KGALKSHNTSHSSFSLTPTAPEMENSQAKRNKRLSKVSFEALPEDRNGFRWGSNIKTPI 591
               L  H++  SS   +       +S    ++  SKV+FE   + R+ ++   + K   
Sbjct: 597 PMSRLYGHDSGESSTKGSRKGSRKGSSSTMESETRSKVAFE---KGRSPWQVEEDEKKER 653

Query: 592 QE--TTWKKLSKMQRRIMLKALADAETLDKICVLLEMPRQNVVNILHELGELKLIN 645
            E  +   K  + +  ++LK++   +T DKIC+ LE  R+ V  +L E+G   +IN
Sbjct: 654 TEEVSNLLKEKRHEEFLLLKSVKSVDTFDKICMRLEKDREEVEQLLKEMGHYNIIN 709

>KLLA0D01067g Chr4 complement(94114..96096) [1983 bp, 660 aa] {ON}
           similar to uniprot|P39923 Saccharomyces cerevisiae
           YEL062W NPR2 Regulator of nitrogen permeases
           transcription is induced in response to proline and urea
           contains two PEST sequences
          Length = 660

 Score =  466 bits (1200), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 282/682 (41%), Positives = 399/682 (58%), Gaps = 60/682 (8%)

Query: 1   MASQFEGFVDIHSIFYSTFHPTEGSKVKFDFPPRSLENSGINFDSIKNYVIPKRALCHRL 60
           M S F+GFV IH++FY+ FHPTEGSKV+F FPP SLEN  I+FD+IKNY+IPK  LC++L
Sbjct: 1   MTSTFDGFVPIHTVFYTLFHPTEGSKVRFQFPPNSLENGKIDFDTIKNYIIPKPQLCNKL 60

Query: 61  ITFKYGNYRIACYPVTVNSSIYARXXXXXXXXXXXXXXCETSPYEPAIERLGKMFRVLEI 120
           +TFKYG YRI CYPV VN+  YAR              C TSPYEPAI RLGKMF+VLE 
Sbjct: 61  LTFKYGEYRIVCYPVNVNARYYARNSFNFNFVFVFPYDCATSPYEPAIARLGKMFKVLEE 120

Query: 121 QNQILSKSENDTIMFNLKSADKNFNIDNDSSNYILGDDISSIMTTQQKDKYERLNNIISN 180
           Q+QILSKSE + + F LKS D N    +     I   + + I +T   D  E+   II  
Sbjct: 121 QSQILSKSEQNPVYFQLKSNDSNAADQSTEMGSITISEHTDIKST--GDDGEKYLEIIKE 178

Query: 181 IKKKPSNFTISDLLMRLYQDLNTYSECLIPIDDGNAVDIKLFPLLTPPTPYISIEHVPIS 240
           + K   +  I DLLM+L+ DLN YSECLIPID+GN++DIKLFP+ TPP+  IS+E VPI+
Sbjct: 179 LAKNQKSLIIEDLLMKLFLDLNNYSECLIPIDEGNSIDIKLFPVRTPPSSNISVEDVPIA 238

Query: 241 LVNLFKIVDVNWDPIMLTXXXXXXXXXXXXXXSQLSHNEESLVIECIRHLVYYRCIVLTD 300
           +VNL  I+DVNWDP M+               +  + ++  LV ECI+HL+YY C++L+D
Sbjct: 239 VVNLSDIIDVNWDPTMVKIVPYINGINSVAQIAVSARSDVELVQECIKHLMYYNCVILSD 298

Query: 301 IFEFSNVYAPTSSLRLFLLDPNMATECQSYV--------MLPINSKMNDLSLYPHHGKHS 352
           IF+FSN+YAPTS +  FL +P +A  CQ +V        +LP   + N+  +YP  G+  
Sbjct: 299 IFQFSNIYAPTSEIHNFLTNPAVAKACQLFVQGDSLKQSLLPFEGRPNN--IYP-TGRKQ 355

Query: 353 AFNGDIGSRNNSVSTSLYSFNGNDSRPQSRSSSVDQSQTNFYKNKKQSESSISTGNSNNG 412
           A    + SR    + +  + + +  R   R+     S +++++      +S++TG +   
Sbjct: 356 ASTSTVHSRRRDSNDTATTGSTSSVRDTHRNYLSSSSTSSYFRAHASENTSLATGEN--- 412

Query: 413 QNIHKHLPTRSLLFDLYRSLSQGITLKEWYMQNHKIIRDNRIDVRRFITFGVLRRIIYRC 472
             + + LPTRS LFDLY+SLSQG T+K+WY QN +IIRDNRIDVR+ I FG+ RR+IYR 
Sbjct: 413 -QMKRILPTRSCLFDLYKSLSQGKTVKDWYKQNFEIIRDNRIDVRKLIMFGITRRLIYRV 471

Query: 473 ETYSVINST---DHLQNL--------WKLNELENPISMENI----SKLQSNHIDSL-AAD 516
            +Y ++ +    D L++L        +     +N  S  +I    +K + N  D L AAD
Sbjct: 472 NSYPIVKNVGTWDILKSLVSKEPKTHYGSGSSKNIFSAADIKVVDTKEEGNQSDKLDAAD 531

Query: 517 EALMNAYKKLSLK--VP---SKGALKSHNTSHSSFSLTPTAPEMENSQAKRNKRLSKVSF 571
           E L + Y+KLSLK  VP   SK A + ++ S S+ + T +     +S + +     KVSF
Sbjct: 532 ELLKSLYQKLSLKQDVPNTMSKFA-RYYDDSPSNNAFTESTSRKSSSGSHQ-----KVSF 585

Query: 572 EALPEDRNGFRWGSNIKTPIQ--------ETTWKKLSKMQRRIMLKALADAETLDKICVL 623
           +        F      KT  +        +    K  K +  I+L++L++AET DK+C  
Sbjct: 586 D--------FGTAGQQKTVTEVPDLGDGEKVEVWKKKKEEELILLESLSNAETFDKVCTK 637

Query: 624 LEMPRQNVVNILHELGELKLIN 645
           L+  R  V  +L +LG   ++N
Sbjct: 638 LKKSRHEVELLLKDLGHYNIVN 659

>KNAG0M01140 Chr13 complement(204691..206475) [1785 bp, 594 aa] {ON}
           Anc_6.17 YEL062W
          Length = 594

 Score =  448 bits (1153), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 280/659 (42%), Positives = 373/659 (56%), Gaps = 78/659 (11%)

Query: 1   MASQFEGFVDIHSIFYSTFHPTEGSKVKFDFPPRSLENSGINFDSIKNYVIPKRALCHRL 60
           M S+FEGFV IH++FY+ FHPTEGSKV + FPP +L++  INFD+IKNY+IPK  LCHRL
Sbjct: 1   MMSKFEGFVPIHTLFYTIFHPTEGSKVCYQFPPGNLQHYDINFDAIKNYIIPKPQLCHRL 60

Query: 61  ITFKYGNYRIACYPVTVNSSIYARXXXXXXXXXXXXXXCETSPYEPAIERLGKMFRVLEI 120
           +T KYGNYRI  YPV V SS YAR              C TSPYEPAI RLGKMFRVLE 
Sbjct: 61  LTMKYGNYRIVSYPVAVQSSSYARNYFRFNFVFVFPYECATSPYEPAITRLGKMFRVLEE 120

Query: 121 QNQILSKSENDTIMFNLKSADKNFNIDNDSSNY---ILGDDISSIMTTQQKDKYERLNNI 177
           Q+Q+LS++E D  +F     DK    DN+S+     +    IS   +     K E   ++
Sbjct: 121 QSQVLSRAERDDSLFK---GDK-LPFDNNSAKNQAPLTHALISKTKSFSPDKKTEGDIHL 176

Query: 178 ISNIKKKPSNFTISDLLMRLYQDLNTYSECLIPIDDGNAVDIKLFPLLTPPTP-YISIEH 236
           IS          + DL+MR+YQDLN YSECLIPID+GNA+DIK+FPL+ PPT  ++SIE 
Sbjct: 177 IS----------VQDLIMRIYQDLNNYSECLIPIDEGNAIDIKIFPLINPPTSVHLSIED 226

Query: 237 VPISLVNLFKIVDVNWDPIMLTXXXXXXXXXXXXXXSQLSHNEESLVIECIRHLVYYRCI 296
           VP+ +V L KI+D+NWDP M++              ++LS ++  LVIECI+HL+YY+C+
Sbjct: 227 VPMLVVKLKKIIDLNWDPTMVSILPFINGVNSILNIARLSDSDPELVIECIKHLIYYKCV 286

Query: 297 VLTDIFEFSNVYAPTSSLRLFLLDPNMATECQSYVMLPINSKMNDLSLYPHHGKHSAFNG 356
           ++TDIF+FSN+YAP+S +  FL DP MA +CQ YV LP +S++  + L            
Sbjct: 287 IITDIFQFSNIYAPSSLINEFLTDPTMAYDCQEYVTLPKSSRLIHMPLQ---------TS 337

Query: 357 DIGSRNNSVSTSLYSFNGNDSRPQSRSSSVDQSQTNFY--KNKKQSESSISTGNSNNGQN 414
             GSRNN    S  S +         +S    + + FY   NKK+SESS+S+  +     
Sbjct: 338 VPGSRNNKHKKS-NSLSSTGVLSWQSNSQYSNNSSEFYSMSNKKRSESSLSSEGTPGAGR 396

Query: 415 IHKH---LPTRSLLFDLYRSLSQGITLKEWYMQNHKIIRDNRIDVRRFITFGVLRRIIYR 471
              H    PTR +LFDLYRSLSQGITL++WY  N   IR N IDVR+FI FG +++IIYR
Sbjct: 397 SDDHTIYYPTRMVLFDLYRSLSQGITLEKWYTTNFTTIRSNYIDVRKFIQFGTIKKIIYR 456

Query: 472 CETYSVINSTDHLQNLWKLNELENPISMENISKLQSNHIDSLAADEALMNAYKKLSLKVP 531
             +Y V            L +  N I  + + K                    K++ K P
Sbjct: 457 VLSYPV------------LEKRRNSIIAKQMGK-------------------SKMAEKAP 485

Query: 532 -SKGALKSHNTSHSSFSLTPTAPEMENSQAKRNKRLSKVSFEALPE---DRNGFRWGSNI 587
            SK A  S  TS   F        + NS      R SKVSFE   E   +R  F      
Sbjct: 486 HSKNAFFS--TSDIKFD---DGDRLFNSLY---ARFSKVSFEKRRENARERKSFDAVGGT 537

Query: 588 KTPIQETTWKKLSKMQRRIMLKALADAETLDKICVLLEMPRQNVVNILHELGELKLINC 646
               +ET    L+K ++  +L AL + E+ DKICV L   R  + N++ ++GE ++INC
Sbjct: 538 NGADKETMI--LTKEEKLQLLGALDNLESFDKICVQLGRSRVEIANLIADIGEYRVINC 594

>NDAI0D00860 Chr4 (193625..195625) [2001 bp, 666 aa] {ON} Anc_6.17
           YEL062W
          Length = 666

 Score =  440 bits (1132), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 280/703 (39%), Positives = 378/703 (53%), Gaps = 108/703 (15%)

Query: 4   QFEGFVDIHSIFYSTFHPTEGSKVKFDFPPRSLENSGINFDSIKNYVIPKRALCHRLITF 63
            FEGF+ IH+IFYS FHPTEG+KV+++FPP +L  S I+FD+IKNY+IPK+ LC++L+TF
Sbjct: 12  HFEGFMPIHTIFYSIFHPTEGTKVRYEFPPSNLAASDIHFDAIKNYIIPKKQLCNKLLTF 71

Query: 64  KYGNYRIACYPVTVNSSIYARXXXXXXXXXXXXXXCETSPYEPAIERLGKMFRVLEIQNQ 123
           KY NYRI  YP+T+NS  YAR              CETSPYEPAI RLGKMF+VLE QNQ
Sbjct: 72  KYANYRIVSYPITINSDFYARNFFSFNFVFVFPYDCETSPYEPAIARLGKMFKVLEEQNQ 131

Query: 124 ILSKSENDTIMFNLKSADKNF--------NIDNDSS-NYILGDDISSIMTT-QQKDKYER 173
           ILSK+END I F  KS    +        N DND   N  L    ++I +T QQ+    R
Sbjct: 132 ILSKAENDPIYF--KSDYTPYQPTLIIPTNNDNDGKRNKKLMKKENTIFSTRQQRSNSNR 189

Query: 174 L-----------------------NNIISNIKKKPSNFTISDLLMRLYQDLNTYSECLIP 210
           +                        N I       S  ++ DL+MR+YQDLN YSECLIP
Sbjct: 190 ILEENSNSNSNSNSNSNGNENDNNYNTIEQYLNNNSRISVQDLIMRIYQDLNNYSECLIP 249

Query: 211 IDDGNAVDIKLFPLLTPPTP-YISIEHVPISLVNLFKIVDVNWDPIMLTXXXXXXXXXXX 269
           IDDGN VDIK+FPLL PP    +SIE VP+SLV+L KI DVNWDP ML            
Sbjct: 250 IDDGNNVDIKIFPLLKPPPANSLSIEDVPMSLVDLTKITDVNWDPTMLKLIPFINGINDI 309

Query: 270 XXXSQLSHNEESLVIECIRHLVYYRCIVLTDIFEFSNVYAPTSSLRLFLLDPNMATECQS 329
              S+LS++   LVIECI+HL+YY C+++TDIF+FSN Y+ TS +  FL DPNMAT CQ+
Sbjct: 310 SKISKLSNSSPMLVIECIKHLIYYNCVIITDIFQFSNTYSTTSLISTFLTDPNMATLCQN 369

Query: 330 YVMLPINSKMNDLSLY--------------PHHGKHS---AFNGDIGSRNNSVSTSLYSF 372
           YV+LP+ SK+  L  +               HH +H    +F   I S N   S S    
Sbjct: 370 YVVLPLGSKLTRLPFHIETETSVQSSSAYRHHHNRHEKTPSFGSSITSNNGRSSFSA--- 426

Query: 373 NGNDSRPQSRSSSVDQSQTNFYKNKKQSESSISTGNSNNGQNIHKHLPTRSLLFDLYRSL 432
              D R QS +S    +          + + IST           HLPT+  LF+LYRSL
Sbjct: 427 ---DDRKQSETSLNSSNDP-------SNSNLISTA----------HLPTKMSLFELYRSL 466

Query: 433 SQGITLKEWYMQNHKIIRDNRIDVRRFITFGVLRRIIYRCETYSVINSTDHLQNLWKLNE 492
           +Q   LK WY  N+  I +N ID+R+FI FG+++ +IYRC +Y ++ +            
Sbjct: 467 NQRTDLKNWYKLNYTTIIENNIDIRKFIKFGIIKGLIYRCHSYPIVITP----------V 516

Query: 493 LENPISMENISKLQSNHIDSLA------ADEALMNAYKKLSLKVPSKGALKSHNTSHSSF 546
           +  P S ++ S   S+   S +        +  ++ +  L   VPS G   + +    SF
Sbjct: 517 VSAPESAKSTSPFVSSSGISSSVDSKQHTQKGPISRFPGLGSHVPSSGVRDTRDKLMKSF 576

Query: 547 SLTPTAPEMENSQAKRNKRLSKVSFE---ALPEDRNGFRWGSNIKTPIQETTWKKLSKMQ 603
                       + ++ K  SKVSF    A   D N     S+      + +  +L+  Q
Sbjct: 577 Y----------EKLEKGKNHSKVSFSDKIAFQNDENDHSATSSDN---DDKSKSQLTLKQ 623

Query: 604 RRIMLKALADAETLDKICVLLEMPRQNVVNILHELGELKLINC 646
           R I+L ++++ + +DKICV L  PR  +   L E G+ K+INC
Sbjct: 624 RNILLDSISNMDNMDKICVKLGRPRSQIEEWLSEFGDYKVINC 666

>TPHA0J00310 Chr10 complement(68890..70917) [2028 bp, 675 aa] {ON}
           Anc_6.17 YEL062W
          Length = 675

 Score =  437 bits (1125), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 294/709 (41%), Positives = 399/709 (56%), Gaps = 97/709 (13%)

Query: 1   MASQFEGFVDIHSIFYSTFHPTEGSKVKFDFPPRSLENSGINFDSIKNYVIPKRALCHRL 60
           M + F+GFV IH IFYS FHPTEG+KV ++FPP +L  SGINFD+IKNYVIPK  LCH+L
Sbjct: 1   MNNSFDGFVPIHGIFYSVFHPTEGTKVSYEFPPSNLVKSGINFDAIKNYVIPKPQLCHKL 60

Query: 61  ITFKYGNYRIACYPVTVNSSIYARXXXXXXXXXXXXXXCETSPYEPAIERLGKMFRVLEI 120
           +T KY NYRI  YP+ +NSS+YAR              CETSPYEP +ERLGKMF  LE 
Sbjct: 61  LTLKYNNYRIVGYPIIINSSLYARNNFSFNLVFVFPYECETSPYEPVVERLGKMFCELEG 120

Query: 121 QNQILSKSENDTIMF------NLKSADK-NFNIDND---SSNYILGDDISSIMTT----Q 166
           Q Q LSK E D   F      NL   DK N   DN+    +N ++   IS+I TT     
Sbjct: 121 QCQFLSKCEKDMAYFDFKLISNLIDQDKSNTEPDNNILSKTNSMILPTISNIDTTVGSTN 180

Query: 167 QKDK---------YERLNNIISNIKKKPSNFTISDLLMRLYQDLNTYSECLIPIDDGNAV 217
            +DK         + + N I + IK      +++D+LMR++QDLN+YSEC IPIDDGNA+
Sbjct: 181 TQDKANSKEVEYLFSKYNVIQNYIKNDKMQLSMNDILMRVFQDLNSYSECYIPIDDGNAI 240

Query: 218 DIKLFPLLTPPTPYISIEHVPISLVNLFKIVDVNWDPIMLTXXXXXXXXXXXXXXSQLSH 277
           DIKLFP L PP   IS+E VPI  VNL KI+DVNWDP ML               + LS+
Sbjct: 241 DIKLFPTLMPPIDSISVEDVPIPTVNLNKIIDVNWDPTMLKIVPYIDGLNSIFKIANLSN 300

Query: 278 NEESLVIECIRHLVYYRCIVLTDIFEFSNVYAPTSSLRLFLLDPNMATECQSYVMLPINS 337
           ++  LVIECIRH VYY C++L+DIF+FSN+YAPTSS+  FL DP +ATECQ YV  P +S
Sbjct: 301 SDAMLVIECIRHFVYYGCVILSDIFQFSNIYAPTSSITDFLTDPTLATECQIYVTSPEDS 360

Query: 338 KMNDL---------------SLYPHHGKHSAFNGDIGSRNNSVSTSLYSFNGNDSRPQSR 382
            ++ L               S+  H    S+   ++ S+ +S  +     N + + P   
Sbjct: 361 LLSALPFKKGRKMVKNRRSASIASHFTSSSSLRQNLNSKASSFISDEGHHNDDTAYPNHD 420

Query: 383 SSSVDQSQTNFYKNKKQSESSISTGNSNNGQNIHKHLPTRSLLFDLYRSLSQGITLKEWY 442
           S          Y+N+++SESS S+GN++       +LPT+S LFDLYRSLSQG+ L+EWY
Sbjct: 421 S---------IYENRRRSESSFSSGNNDEMHQNRNYLPTKSTLFDLYRSLSQGVKLEEWY 471

Query: 443 MQNHKIIRDNRIDVRRFITFGVLRRIIYRC---------ETYSVINSTDHLQ-------- 485
             N   IRDN ID+RRFI FG+++RIIYRC         E +S +N   +LQ        
Sbjct: 472 QINFNSIRDNFIDIRRFIIFGIIKRIIYRCHSYPLPKNYEAFSKLNDLKNLQNGPKIVKN 531

Query: 486 -------NLWKLNELENPISMENISKLQSNHIDSLAADEALMNAYKKLSLKVPSKGALKS 538
                  N++  ++++  + +   +K + + +D   AD  L N YKKLS    + G    
Sbjct: 532 KSQSYTYNIFSTSDIKFGVDLYTDTKKKLHTLDVDVADRVLNNVYKKLS----TNGR--- 584

Query: 539 HNTSHSSFSLTPTAPEMENSQAKRNKRLSKVSFEALPEDRNGFRWGSNIKTPIQETTWKK 598
                      PT      S   + +  SKV+F+    D +     +N+   I+ T + +
Sbjct: 585 -----------PTT-----SINGQGQHPSKVAFKNQSYDNDLPGLMNNLG--IEATKFSR 626

Query: 599 LSKMQRRI-MLKALADAETLDKICVLLEMPRQNVVNILHELGELKLINC 646
              +  +I +L AL  AE LD IC  LE+ R+ V  +L+EL E ++INC
Sbjct: 627 EININDKIYLLDALQSAENLDNICSNLELSREEVETLLNELTEYRIINC 675

>NCAS0H00870 Chr8 (158877..160715) [1839 bp, 612 aa] {ON} Anc_6.17
           YEL062W
          Length = 612

 Score =  435 bits (1118), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 269/681 (39%), Positives = 380/681 (55%), Gaps = 115/681 (16%)

Query: 3   SQFEGFVDIHSIFYSTFHPTEGSKVKFDFPPRSLENSGINFDSIKNYVIPKRALCHRLIT 62
           + FEGF+ IH+IFYS FHPTEG+KV ++FPP++L N  INFD+IKNY+IPK  LC+RL+T
Sbjct: 10  NHFEGFMPIHTIFYSIFHPTEGTKVCYEFPPKNLSNFHINFDTIKNYIIPKNQLCNRLLT 69

Query: 63  FKYGNYRIACYPVTVNSSIYARXXXXXXXXXXXXXXCETSPYEPAIERLGKMFRVLEIQN 122
           FKY NYRI  YP+T+N+  YAR              CETSPYEP+I RLGKMF++LE Q+
Sbjct: 70  FKYENYRIVSYPITINAPYYARNFFSFNFVFVFPYECETSPYEPSIARLGKMFKILEEQS 129

Query: 123 QILSKSENDTIMFNLKSADKNFNIDNDSSNYILGDDISSI---MTTQQKDKYERL----- 174
           QILSK+END I F               S+Y+  +  ++I   ++   ++K         
Sbjct: 130 QILSKAENDPIYF--------------KSDYVPTEPTTTIIPQISPSHRNKRNNDHNDNN 175

Query: 175 ------NNIISNIKKKPSNFTISDLLMRLYQDLNTYSECLIPIDDGNAVDIKLFPLLTPP 228
                  +     +   + F++ DL+MR+YQDLN YSECLIPID GN ++IK+FPLL PP
Sbjct: 176 DGSRFETDFFGEEEDGVTKFSVQDLIMRIYQDLNNYSECLIPIDKGNDINIKVFPLLKPP 235

Query: 229 TPY-ISIEHVPISLVNLFKIVDVNWDPIMLTXXXXXXXXXXXXXXSQLSHNEESLVIECI 287
             + IS+E VP+SL+NL  ++DVNWDP ML               ++L+  +  LVIECI
Sbjct: 236 PNHLISLEDVPMSLINLNNVIDVNWDPTMLNIVPYINGVNDISKIAKLTKADPLLVIECI 295

Query: 288 RHLVYYRCIVLTDIFEFSNVYAPTSSLRLFLLDPNMATECQSYVMLPINSKMNDLSL--- 344
           +HLVYY C+++TDIF+FSNVYAPTS +  FL D  MAT+CQ+YV+LPI SK++ L     
Sbjct: 296 KHLVYYNCVIITDIFQFSNVYAPTSLICSFLTDQEMATQCQNYVVLPIGSKLSHLPFENN 355

Query: 345 ---YPHHGKHSAFNGDIGSRNNSVSTSLYSFNGNDSRPQSRSSSVDQSQTNFYKNKKQSE 401
               P   KHS       S + SV++  +S+             +D  Q      K ++ 
Sbjct: 356 GNKQPSTPKHSRTTSLSSSMSGSVNSHEHSY-------------MDTIQ------KSETS 396

Query: 402 SSISTGNSNNGQNIHKHLPTRSLLFDLYRSLSQGITLKEWYMQNHKIIRDNRIDVRRFIT 461
            S+S+ + NN      HLPT++ LFDLYRSLS G+TL+ WY  N  II +N +DVR+FI 
Sbjct: 397 LSLSSTDPNNPHFELAHLPTKACLFDLYRSLSYGVTLRSWYQSNATIITENNVDVRKFIK 456

Query: 462 FGVLRRIIYRCETYSVIN--STDHLQNLWKLNELE--------------NPISMENISKL 505
           FG++R +IYRC +Y +    S + +Q + +LN+++              +     + S  
Sbjct: 457 FGIIRGLIYRCHSYPIPQRPSNEGIQRIERLNDIDAHRLQIRSSGSAARSNSGSGSGSSA 516

Query: 506 QSNHIDSLAADEALMNAYKKLSLKVPSKGALKSHNTSHSSFSLTPTAPEMENSQAKRNKR 565
             + I+   ADE L N YKKL                                     +R
Sbjct: 517 SPSSINVDGADELLKNVYKKL-------------------------------------ER 539

Query: 566 LSKVSFEALPEDRNGFRWGSNIKTPIQETTWKKLSKMQRRIMLKALADAETLDKICVLLE 625
            SKVSF  + +++N      ++KT  ++     ++K +R ++LK++   E LDKICV L 
Sbjct: 540 HSKVSF--MDKEKN-----ESMKTD-EKGRPSTMTKEERSVLLKSIESLENLDKICVKLG 591

Query: 626 MPRQNVVNILHELGELKLINC 646
             RQ V   L ELG  K+I C
Sbjct: 592 KSRQQVERWLDELGNYKIITC 612

>Kwal_56.22411 s56 complement(115007..117076) [2070 bp, 689 aa] {ON}
           YEL062W (NPR2) - Non-membrane-embedded, PEST
           sequence-containing protein [contig 185] FULL
          Length = 689

 Score =  436 bits (1122), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 269/699 (38%), Positives = 388/699 (55%), Gaps = 63/699 (9%)

Query: 1   MASQFEGFVDIHSIFYSTFHPTEGSKVKFDFPPRSLENSGINFDSIKNYVIPKRALCHRL 60
           M+  F+GFV +H I Y+ FHPTEG+KV+  FPP  LE S I FD+IKNYVIPK  LC++L
Sbjct: 1   MSGHFDGFVPVHCILYTIFHPTEGTKVRHQFPPGCLEASDITFDTIKNYVIPKPQLCNKL 60

Query: 61  ITFKYGNYRIACYPVTVNSSIYARXXXXXXXXXXXXXXCETSPYEPAIERLGKMFRVLEI 120
           +TFKYG++R+ CYPV V +  YAR              C TSPYE AI RLGKMF VLE 
Sbjct: 61  LTFKYGSFRLVCYPVNVIAPYYARNSFSFDFVFVFPYDCATSPYESAIARLGKMFTVLEE 120

Query: 121 QNQILSKSENDTIMFNLKSAD--KNFNIDNDSSNYILGDDISSIMTTQQKDKY--ERLNN 176
           Q+QILSK+EN  + F LK+ D  K+ N +  + N + G   ++  +  +   Y  E+ + 
Sbjct: 121 QSQILSKAENSHVYFQLKTRDSHKHTNQEPVNDNELQGTLKNNEASQSESHGYAFEKYHE 180

Query: 177 IISNIKKKPSNFTISDLLMRLYQDLNTYSECLIPIDDGNAVDIKLFPLLTPPTPYISIEH 236
           I+ ++       ++ DL+ ++Y+DLN YSECLIPID GNAVDIKLFPLL+PP+  +S E 
Sbjct: 181 ILKDLNGPNKRISVEDLITKIYRDLNNYSECLIPIDSGNAVDIKLFPLLSPPSSCLSFED 240

Query: 237 VPISLVNLFKIVDVNWDPIMLTXXXXXXXXXXXXXXSQLSHNEESLVIECIRHLVYYRCI 296
           VP+  VNL K++DVNWDP ML               ++LS ++ +LV+ECIRHL+YY C+
Sbjct: 241 VPMPTVNLAKLIDVNWDPTMLKIVPYINGTNSIAKVAKLSDSDCNLVVECIRHLLYYNCV 300

Query: 297 VLTDIFEFSNVYAPTSSLRLFLLDPNMATECQSYVMLPINSKMNDLSLYPHHGKHSAFNG 356
           +L DIF+F N+YAPTS L  FL +P +ATECQ YV L  ++ ++DL  +      + +N 
Sbjct: 301 ILADIFQFQNIYAPTSELSRFLTNPALATECQIYVTLDESTHISDLP-FERKPSRTTYN- 358

Query: 357 DIGSRNNSVSTSLYSFNGNDS-RPQSRSSSVDQSQTNFYKNKKQSE-------SSISTGN 408
           +I  RN+S +  +       S +  S ++ +DQS  N Y  +  +        S  S GN
Sbjct: 359 NIPVRNSSSTLDVQRKGREMSIKESSFTAGIDQSGRNQYTPQSHTSSIQCHNVSDASLGN 418

Query: 409 SNNGQNIHKHLPTRSLLFDLYRSLSQGITLKEWYMQNHKIIRDNRIDVRRFITFGVLRRI 468
           S  G N      ++S LFD+YRSLSQG T+KEWY  + + IR  RIDVRRFITFGV+  +
Sbjct: 419 SEGGFNNKVFFTSKSCLFDMYRSLSQGQTVKEWYKTHFEKIRAARIDVRRFITFGVIHGL 478

Query: 469 IYRCETYSVINSTDHLQNL---------------W----------KLNELENPISME-NI 502
           +YRC ++ ++ +  +L+ +               W           L+  E  I +E + 
Sbjct: 479 LYRCYSFPIMKNVGYLEVVKALGLSDGDSSTEGKWLSGNSEPTNNVLSAAEIRIGLESSS 538

Query: 503 SKLQS---NHI-DSLAADEALMNAYKKLSLKVPSKGALKSHNTSHSSFSLTPTAPEMENS 558
           SKL+    NH  ++  A++ L + Y+KL        AL  +    SS S  P      N 
Sbjct: 539 SKLRERRFNHFSNADTAEDILNDVYRKL--------ALNENKVEQSSQSGNPMMRMFGNC 590

Query: 559 QAKRNKRLS--KVSFEALPEDRN--GFRWGSNIKTPIQETTWK----KLSKMQRR---IM 607
               +   S   V   A  + RN   F     + +   E   K    +L + +R+   ++
Sbjct: 591 SDDSSGETSVKDVVSTAGSDTRNTVAFDVRRLVNSATAEDRKKGEVMRLEEDKRKDELLL 650

Query: 608 LKALADAETLDKICVLLEMPRQNVVNILHELGELKLINC 646
           LK++ D E  DKIC  L   R+ V  +L +LG   +++C
Sbjct: 651 LKSVRDVENFDKICTRLGRDREEVEKMLEDLGPYNVVHC 689

>KLTH0C11308g Chr3 (929710..931782) [2073 bp, 690 aa] {ON} similar
           to uniprot|P39923 Saccharomyces cerevisiae YEL062W NPR2
           Regulator of nitrogen permeases transcription is induced
           in response to proline and urea contains two PEST
           sequences
          Length = 690

 Score =  433 bits (1113), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 277/704 (39%), Positives = 382/704 (54%), Gaps = 86/704 (12%)

Query: 1   MASQFEGFVDIHSIFYSTFHPTEGSKVKFDFPPRSLENSGINFDSIKNYVIPKRALCHRL 60
           M+  F+GFV +H IFYS FHPTEG+KV+  FP   LE S I FD+IKNYVIPK  LC++L
Sbjct: 1   MSGHFDGFVPVHGIFYSVFHPTEGTKVRHQFPSGCLELSDITFDTIKNYVIPKPQLCNKL 60

Query: 61  ITFKYGNYRIACYPVTVNSSIYARXXXXXXXXXXXXXXCETSPYEPAIERLGKMFRVLEI 120
           +TFKYG +R+ CYPV V +  YAR              C TSPYEPAIERLGKMF VLE 
Sbjct: 61  LTFKYGPFRLVCYPVNVVAPYYARNSFSFDFVFVFPYDCATSPYEPAIERLGKMFTVLEE 120

Query: 121 QNQILSKSENDTIMFNLKSADKNFNIDNDSSNYILGD---DISSIMTTQ-QKDKYERLNN 176
           Q+QILSK+EN ++ F LK+ +   + + +++         DI  I   + Q     +   
Sbjct: 121 QSQILSKAENSSVYFQLKARNTQKHGNTETAKGTEQPSSLDIGEIAQPENQGYASAKYYE 180

Query: 177 IISNIKKKPSNFTISDLLMRLYQDLNTYSECLIPIDDGNAVDIKLFPLLTPPTPYISIEH 236
           I+ +++       I DL+ ++Y+DLN YSECLIPID GNAVDIKLFPLL+PP+   SIE 
Sbjct: 181 ILKDLEGPSKKIAIGDLITKIYRDLNDYSECLIPIDSGNAVDIKLFPLLSPPSSCFSIED 240

Query: 237 VPISLVNLFKIVDVNWDPIMLTXXXXXXXXXXXXXXSQLSHNEESLVIECIRHLVYYRCI 296
           VPIS VNL K++DVNWDP ML               ++ S ++ +LV+ECI+HL+YY C+
Sbjct: 241 VPISTVNLAKLIDVNWDPTMLKIVPHINGINSIAKVAKFSDSDVNLVVECIKHLIYYNCV 300

Query: 297 VLTDIFEFSNVYAPTSSLRLFLLDPNMATECQSYVMLPINSKMNDLSLYPHHGKHSAFNG 356
           +LTDIF+FSN+YA T+ L  FL +P +A ECQ YV    ++ + +L      G   +  G
Sbjct: 301 ILTDIFQFSNIYASTNELSRFLTEPTLAAECQIYVAYNESAHLPNLPF--ERGPSRSGQG 358

Query: 357 DIGSRN------------------NSVSTSL-YSFNGNDSRPQSRSSSVDQSQTNFYKNK 397
           +I  R+                  NS ++ + +  N +   PQSRSSS+    T      
Sbjct: 359 NIRDRSSNGTLDILRKGKQTPLRENSFNSGMDFLSNKHQHTPQSRSSSIPYHNT------ 412

Query: 398 KQSESSISTGNSNNGQNIHKHLP--TRSLLFDLYRSLSQGITLKEWYMQNHKIIRDNRID 455
               S  S GNS+ G    K +P  ++S LFDLYRSL+QG T++EWY  + + IR  RID
Sbjct: 413 ----SDASFGNSDAGLK-GKLMPFTSKSCLFDLYRSLTQGQTIREWYKTHFEKIRAARID 467

Query: 456 VRRFITFGVLRRIIYRCETYSV------------INSTDH-----LQNLWKLNE-LENPI 497
           VRRFITFGVL  +IYR  +Y V            + +T+H      ++L K N+ L N +
Sbjct: 468 VRRFITFGVLHGLIYRSYSYPVLRNIGFAESVEALGATNHSRYAKYKHLLKTNQPLNNVL 527

Query: 498 SMENI------------SKLQSNHIDSLAADEALMNAYKKLSLKVPSKGALKSHNT---- 541
           S  +I            S+    H  + AA+E L + Y+KL+L       +   N     
Sbjct: 528 SAADIRIGLENAGFKARSEKLKQHSTADAAEEVLSDVYRKLALSDKKTDHVAQGNNPISK 587

Query: 542 ---SHSSFSLTPTAPEMENSQAKRNKRLSKVSFEA---LPEDRNGFRWGSNIKTPIQETT 595
               +S  S   +  E  NS     K  +KV+F+    L       R  S I   I+E  
Sbjct: 588 VFGRNSEDSTDISTRESANSMGSDIK--NKVAFDVRKTLATSSADERRRSEILRSIEEKR 645

Query: 596 WKKLSKMQRRIMLKALADAETLDKICVLLEMPRQNVVNILHELG 639
            ++L      I+LK++      DKIC LL   R+ V ++L ELG
Sbjct: 646 NEEL------ILLKSVRSVHNFDKICTLLGKDRERVESMLSELG 683

>ACR009W Chr3 (371964..374006) [2043 bp, 680 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YEL062W (NPR2)
          Length = 680

 Score =  431 bits (1108), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 276/706 (39%), Positives = 374/706 (52%), Gaps = 95/706 (13%)

Query: 1   MASQFEGFVDIHSIFYSTFHPTEGSKVKFDFPPRSLENSGINFDSIKNYVIPKRALCHRL 60
           M ++F+GFV IH IFY+ FHPTEG+KV+F FP  SLE SGI FD+IKNYVIPK  LC++L
Sbjct: 8   MPNKFDGFVPIHCIFYALFHPTEGTKVRFQFPSDSLEKSGIRFDTIKNYVIPKSQLCNKL 67

Query: 61  ITFKYGNYRIACYPVTVNSSIYARXXXXXXXXXXXXXXCETSPYEPAIERLGKMFRVLEI 120
           +TFK+G+YR+ CYPV + +  YAR                TSPYEPAI RL KM RVLE 
Sbjct: 68  VTFKFGSYRLVCYPVNIKAPYYARNSFSFNLVFVFPYDSATSPYEPAIARLAKMLRVLEE 127

Query: 121 QNQILSKSENDTIMFNLKS----ADKNFNIDNDSSNYILGDDISSIMTTQQKDKYERLNN 176
           Q+Q+LSK E D + + LK+    A +    ++DS       D  S        KY   + 
Sbjct: 128 QSQMLSKVERDPVYYQLKTGETKAAEQKTEESDSKAKTHNLDKKSRAQHNATTKY---HE 184

Query: 177 IISNIKKKPSNFTISDLLMRLYQDLNTYSECLIPIDDGNAVDIKLFPLLTPPTPYISIEH 236
           I+ +I     N  I DL+ +LY+DLN YSECLIP+D GNA+DIKLFPLLTPP   +S E 
Sbjct: 185 IMKHINSDEKNLYIEDLITKLYEDLNNYSECLIPMDSGNAIDIKLFPLLTPPNSCLSFED 244

Query: 237 VPISLVNLFKIVDVNWDPIMLTXXXXXXXXXXXXXXSQLSHNEESLVIECIRHLVYYRCI 296
           VPI+ VNL  +VDVNWDP ML               S+ S +   LV+ECI+HLVYY C+
Sbjct: 245 VPIAKVNLMNLVDVNWDPTMLKIVPFINGINSIAKISKCSDSAVELVMECIKHLVYYDCV 304

Query: 297 VLTDIFEFSNVYAPTSSLRLFLLDPNMATECQSYVM---------LPINSKMNDLSLYPH 347
            L D+F+FSN+YAPT+ LR FL D  +  ECQ YV+         LP  S+ N      H
Sbjct: 305 ALVDMFQFSNIYAPTNLLRDFLFDFILPRECQVYVVSSEDCEIHRLPFESRPNG----GH 360

Query: 348 HGKHSAFNGDIGSRNNSVSTSL---YSFNGNDSRPQSRSSSVDQSQT----NFYKNKKQS 400
               +A    + +   + ST+    +S N   S+  S  SS+ QS T    ++Y N+ ++
Sbjct: 361 SRNQTASTNTVYTLRRTTSTNRADSFSSNAEFSQKSSGISSLAQSFTQSNKDYYYNRSRN 420

Query: 401 ESSISTGNSNNGQNIHKHLPTRSLLFDLYRSLSQGITLKEWYMQNHKIIRDNRIDVRRFI 460
             S          N  + LPTR +LFDLYRSL+QG TLKEWY  N+  IR+N+IDVRR I
Sbjct: 421 LES----------NCKRTLPTRRVLFDLYRSLTQGQTLKEWYKANYSAIRENQIDVRRLI 470

Query: 461 TFGVLRRIIYRCETYSVINSTDHLQNLWKLNELE--------------NPISMENI---- 502
            FGV  R+IYRC +Y V  S   L+ L + + +               N  S  +I    
Sbjct: 471 IFGVFHRLIYRCYSYPVAKSIGTLELLKRFDYVSTTDNFIPTGTSAGNNVFSTSDIRVDF 530

Query: 503 -SKLQSNHI-----DSLAADEALMNAYKKLSLK---------------VPS--KGALKSH 539
               +S +I      S  A+E L   Y+KLS+K                PS  + A+K  
Sbjct: 531 DGSSRSRNIPPFLNSSDVAEEVLRETYQKLSIKDILNDSIDPIAKGYQAPSDNEAAMKGT 590

Query: 540 NTSHSSFSLTPTAPEMENSQAKRNKRLSKVSFEALPEDRNGFRWGSNIKTPIQETTWKKL 599
           +   S  +L  T    +     RN+ +SK          N  R   N   P+      K 
Sbjct: 591 SRKQSMSTLNTTRITFD----IRNRHVSK---------DNEHREQQNEDIPL----LLKK 633

Query: 600 SKMQRRIMLKALADAETLDKICVLLEMPRQNVVNILHELGELKLIN 645
            ++Q  ++L+++   ++ DKI V LEM +  V  +L   GE  ++N
Sbjct: 634 KRLQEFLLLQSVKSVDSFDKIAVRLEMNKHEVERLLKGTGEYNIVN 679

>TBLA0G01010 Chr7 complement(253690..255822) [2133 bp, 710 aa] {ON}
           Anc_6.17 YEL062W
          Length = 710

 Score =  424 bits (1090), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 224/489 (45%), Positives = 308/489 (62%), Gaps = 47/489 (9%)

Query: 1   MASQFEGFVDIHSIFYSTFHPTEGSKVKFDFPPRSLENSGINFDSIKNYVIPKRALCHRL 60
           M   FEGFV IH++FYS FHPTEG+KV+++FPP +L+   INFD+IKNY+IPK  LCH+L
Sbjct: 1   MIDHFEGFVPIHTVFYSIFHPTEGTKVRYEFPPGNLQTYNINFDTIKNYIIPKPQLCHKL 60

Query: 61  ITFKYGNYRIACYPVTVNSSIYARXXXXXXXXXXXXXXCETSPYEPAIERLGKMFRVLEI 120
           +T KYG+YR+  YPVT+NSS+YAR              CETSPYEP I RLGKMFRVLE 
Sbjct: 61  LTLKYGDYRLVSYPVTINSSLYARNFFSFNFVFVFPINCETSPYEPIIARLGKMFRVLEE 120

Query: 121 QNQILSKSENDTIMFNLKSADKNFNIDNDSSNYILGDDISSIMTTQQKDKYERLNNIISN 180
           QNQ+LS++END++ F             D+S+ +L  +  SIM   +       +    +
Sbjct: 121 QNQLLSRAENDSVYF-------------DNSHSLLSSEQDSIMHQDKNTSILGFSRKRFS 167

Query: 181 IKKKP--------------SNFTISDLLMRLYQDLNTYSECLIPIDDGNAVDIKLFPLLT 226
             K+P              SNF++ DL+MR++QDLN YSECLIPID+GN+VDIK+FP + 
Sbjct: 168 FSKRPTDLSLSEYPDNESGSNFSVQDLIMRIFQDLNNYSECLIPIDEGNSVDIKIFPSMV 227

Query: 227 PPTPYISIEHVPISLVNLFKIVDVNWDPIMLTXXXXXXXXXXXXXXSQLSHNEESLVIEC 286
           PP+  IS E VP+++V+L  ++DVNWDP ML               + LS+++   V+EC
Sbjct: 228 PPSISISYEDVPVAMVDLSHVMDVNWDPTMLKIVPFIDSINSISRIAALSNSDVDFVVEC 287

Query: 287 IRHLVYYRCIVLTDIFEFSNVYAPTSSLRLFLLDPNMATECQSYVMLPINSKMNDLSLYP 346
           IRHLVYY+ ++L+DIF+F+N+YAPTS LR FL D N+AT+CQ+YV LP NS    L L  
Sbjct: 288 IRHLVYYQLVILSDIFQFTNIYAPTSRLRDFLTDINLATDCQTYVCLPKNSNFGKLPL-- 345

Query: 347 HHGKHSAFNGDIGSRNNSVSTSLYSFN---GNDSRPQSRSSSVDQSQTNFYKNKKQSESS 403
                 + N D+   +NS  +++Y  N    ND R +            +YK +    S 
Sbjct: 346 ----EKSINTDLDEYSNS-GSAIYPNNEILENDDRLR---------WPMYYKPRNSQSSL 391

Query: 404 ISTGNSNNGQNIHKHLPTRSLLFDLYRSLSQGITLKEWYMQNHKIIRDNRIDVRRFITFG 463
            S  +S N +    +LPT+S LFDLYRSLSQG  L +WY +++ +I  N+ID+RRFITFG
Sbjct: 392 SSGISSGN-ERTSNYLPTKSCLFDLYRSLSQGTVLHDWYNEHYSLIHFNKIDIRRFITFG 450

Query: 464 VLRRIIYRC 472
           ++R ++YRC
Sbjct: 451 LVRGLLYRC 459

 Score = 51.6 bits (122), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 39/144 (27%), Positives = 73/144 (50%), Gaps = 13/144 (9%)

Query: 510 IDSLAADEALMNAYKKLSL--KVPSKGALKSHNTSHSSFSLTPTAPEMENSQAKRNKRLS 567
           ++S  AD+ L + ++KL+     P    +K    +   FS         +S        +
Sbjct: 573 LNSGIADKVLSDIHRKLAKFDDTPRSPIVKRKEDTFRDFSNGSNIVGYGSSNTG-----N 627

Query: 568 KVSFEALPEDRNGFRWGSNIKTPIQETTWKKLSKMQ-----RRIMLKALADAETLDKICV 622
           KVSF  L  D +  +   +   PI +++   +++ Q     RR++L++L +A+ +DKIC+
Sbjct: 628 KVSFN-LSRDSDTTQNNLDHMNPILDSSKDIIAQQQEKNHIRRLLLESLREADNMDKICI 686

Query: 623 LLEMPRQNVVNILHELGELKLINC 646
            L+ PR+ V  +L E+G+  +INC
Sbjct: 687 KLQKPRKEVEELLSEIGDYVIINC 710

>KAFR0L00380 Chr12 complement(69525..71147) [1623 bp, 540 aa] {ON}
           Anc_6.17 YEL062W
          Length = 540

 Score =  400 bits (1029), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 224/481 (46%), Positives = 292/481 (60%), Gaps = 53/481 (11%)

Query: 1   MASQFEGFVDIHSIFYSTFHPTEGSKVKFDFPPRSLENSGINFDSIKNYVIPKRALCHRL 60
           M +QFEGF  IH+IF+S FHPTEGSKV + FPP +L+   INFDSIKN+VIPK  LCHRL
Sbjct: 1   MNTQFEGFEPIHTIFFSIFHPTEGSKVCYQFPPENLQAYNINFDSIKNFVIPKPQLCHRL 60

Query: 61  ITFKYGNYRIACYPVTVNSSIYARXXXXXXXXXXXXXXCETSPYEPAIERLGKMFRVLEI 120
           +T +Y NYR+  YPV V+SS YAR              C+T PYEPAIERLGKMF+ LE 
Sbjct: 61  LTLEYKNYRLVSYPVNVSSSSYARNFFSFNFVFIFSYDCQTLPYEPAIERLGKMFKTLEE 120

Query: 121 QNQILSKSENDTIMFNLKSADKNFNIDNDSSNYILGDDISSIMTTQQKDKYERLNNIISN 180
           Q+QILSKS+  +  F                    G+D+  + T                
Sbjct: 121 QSQILSKSQRTSAFFKD------------------GEDVDFVDT---------------- 146

Query: 181 IKKKPSNFTISDLLMRLYQDLNTYSECLIPIDDGNAVDIKLFPLLTPPTPY-ISIEHVPI 239
                  F+I DLLMRLYQDLN YSECLIPID+GN ++IK+FP+L PPT   ISIE VP+
Sbjct: 147 ------KFSIQDLLMRLYQDLNNYSECLIPIDEGNEINIKIFPVLKPPTSVQISIEDVPL 200

Query: 240 SLVNLFKIVDVNWDPIMLTXXXXXXXXXXXXXXSQLSHNEESLVIECIRHLVYYRCIVLT 299
           S+VNL KIVD+NWDP ML+              S LS ++ +LVIECI+HL+YY C+++T
Sbjct: 201 SIVNLDKIVDLNWDPTMLSILPFIDGVNSITNISHLSDSDPNLVIECIKHLIYYNCVIIT 260

Query: 300 DIFEFSNVYAPTSSLRLFLLDPNMATECQSYVMLPINSKMNDLSLYPHHGKHSAFNGDIG 359
           DIF+FSN+YAP+S +  FL DP +A  CQSYV+LP  SK+NDL L          N D+ 
Sbjct: 261 DIFQFSNIYAPSSLINNFLRDPMIAFNCQSYVVLPPGSKINDLPLASEQDDEIN-NSDMT 319

Query: 360 SRNNSVSTSLYSFNGNDSRPQSRSSSVDQSQTNFYKNKKQSESSIST--GNSNNGQNIHK 417
            +  S S S +S   +     +R S           +  QS S++S+  G  +N +   +
Sbjct: 320 QKALSSSRSSFSSYFSHKSAYARVSET--------AHHHQSTSTLSSSEGQQDNPRQ-GQ 370

Query: 418 HLPTRSLLFDLYRSLSQGITLKEWYMQNHKIIRDNRIDVRRFITFGVLRRIIYRCETYSV 477
            LP++  LFDLYRSL+ G T++ WY QN   I++N IDVR+FI FGV+ +IIYR   Y +
Sbjct: 371 VLPSKCTLFDLYRSLNYGCTVEAWYKQNFSTIKENHIDVRKFIKFGVINKIIYRVHQYPI 430

Query: 478 I 478
           +
Sbjct: 431 M 431

 Score = 34.3 bits (77), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 16/49 (32%), Positives = 27/49 (55%)

Query: 597 KKLSKMQRRIMLKALADAETLDKICVLLEMPRQNVVNILHELGELKLIN 645
           + L + ++ I+  AL   E+ D+IC  L   +  V +I+ E+GE   IN
Sbjct: 491 RNLGESEKNILFNALERHESFDRICSKLGKSKNEVESIISEIGEYMTIN 539

>Kwal_27.9804 s27 (69307..70728) [1422 bp, 473 aa] {ON} YDL017W
           (CDC7) - serine/threonine protein kinase [contig 43]
           FULL
          Length = 473

 Score = 34.3 bits (77), Expect = 0.97,   Method: Compositional matrix adjust.
 Identities = 40/151 (26%), Positives = 63/151 (41%), Gaps = 19/151 (12%)

Query: 498 SMENISKLQSNHIDSLAADEALMNAYKKLSLKVPSKGALKSHNTSHSSFSLTPTAPEMEN 557
            M N+      ++  L A  A  NA K LSL+  S G   +    H++ +L         
Sbjct: 196 GMRNLEHYCPCNVLDLEAHSAGRNAIK-LSLEGRSAGP--NSALPHTTNALVDLTKGYPK 252

Query: 558 SQAKRNKRLSKVSFEALPEDRNGFRWGSNIKTPIQETT----WKK----LSKMQRRI-ML 608
           + A+RNKR ++           GFR    +    Q+TT    W      LS + RR  M 
Sbjct: 253 NDARRNKRANRAG-------TRGFRAPEVLMKCSQQTTAIDIWSVGVILLSFLSRRFPMF 305

Query: 609 KALADAETLDKICVLLEMPRQNVVNILHELG 639
           ++L D ++L ++C +    +      LH LG
Sbjct: 306 QSLDDTDSLLELCCVFGTRKMKKCAALHGLG 336

>TPHA0G02360 Chr7 (477456..480974) [3519 bp, 1172 aa] {ON} Anc_2.411
           YLR032W
          Length = 1172

 Score = 33.5 bits (75), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 21/73 (28%), Positives = 40/73 (54%), Gaps = 6/73 (8%)

Query: 100 ETSPYEPAIERLGKMFRVLEIQNQILS------KSENDTIMFNLKSADKNFNIDNDSSNY 153
           E   Y+ AI ++  +  V+E+ ++ +S      K+E+  I+ +L+  D   N D D+SN 
Sbjct: 333 ENREYQTAIVKIFSLLNVIEVIDENVSFLDSDDKNEDSAIIIDLEGNDGTTNTDIDNSNI 392

Query: 154 ILGDDISSIMTTQ 166
           ++ D+I S   +Q
Sbjct: 393 VVRDNIESSQLSQ 405

>KNAG0F01160 Chr6 (207614..210967) [3354 bp, 1117 aa] {ON} Anc_2.58
           YNL192W
          Length = 1117

 Score = 33.1 bits (74), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 19/64 (29%), Positives = 30/64 (46%), Gaps = 2/64 (3%)

Query: 7   GFVDIHSIFYST--FHPTEGSKVKFDFPPRSLENSGINFDSIKNYVIPKRALCHRLITFK 64
           GF+ +    +S   F    G  ++  F    LE+ G NF S   Y+   R LC  ++T K
Sbjct: 658 GFITVLPGAFSAYRFEAVRGQPLEKYFYGEGLEDKGFNFFSSNMYLAEDRILCFEIVTKK 717

Query: 65  YGNY 68
           + N+
Sbjct: 718 HSNW 721

>TPHA0B00440 Chr2 complement(93810..98177) [4368 bp, 1455 aa] {ON}
           Anc_4.340 YML072C
          Length = 1455

 Score = 32.0 bits (71), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 24/91 (26%), Positives = 44/91 (48%), Gaps = 11/91 (12%)

Query: 293 YRCIVLTDIFEFSNVY-APTSSLRLFLLDPNMATECQS------YVMLPINSKMNDLSLY 345
           ++ + ++D F     Y  P  SL + + D N+ TE Q       +  + IN K++  S Y
Sbjct: 717 WKPLCVSDEFSVMKTYQKPIGSLIIEVSDTNIKTELQGVGDIDPFFTISINHKLSYKSKY 776

Query: 346 PHHGKHSAFNGDI----GSRNNSVSTSLYSF 372
               KH+ FN +I     ++N  V+ ++Y +
Sbjct: 777 VSDTKHAVFNENIYLPYNNKNQLVTIAVYDY 807

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.133    0.386 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 69,684,220
Number of extensions: 3169728
Number of successful extensions: 19952
Number of sequences better than 10.0: 236
Number of HSP's gapped: 20545
Number of HSP's successfully gapped: 262
Length of query: 646
Length of database: 53,481,399
Length adjustment: 116
Effective length of query: 530
Effective length of database: 40,180,143
Effective search space: 21295475790
Effective search space used: 21295475790
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 69 (31.2 bits)