Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
CAGL0L12936g2.152ON60060029320.0
TDEL0B051402.152ON59953017910.0
ZYRO0G06512g2.152ON60452617780.0
Kpol_1048.212.152ON59752717740.0
SAKL0E10956g2.152ON60054717510.0
YNL121C (TOM70)2.152ON61754517200.0
Smik_14.2072.152ON61754517010.0
Skud_14.2112.152ON61754516960.0
Kwal_33.147672.152ON59452616920.0
Suva_14.2192.152ON61753616910.0
KNAG0H035302.152ON61455216870.0
KLTH0B05170g2.152ON59352616770.0
TBLA0C055302.152ON61054416460.0
NCAS0B070102.152ON62554216430.0
TPHA0I015102.152ON60352716360.0
Ecym_82042.152ON59753116350.0
NCAS0G024802.152ON59651216150.0
KLLA0F24046g2.152ON60452615990.0
ABR131W2.152ON59453115940.0
KAFR0F007202.152ON60852715900.0
Skud_8.1782.152ON63853815730.0
Suva_15.3142.152ON64453815600.0
NDAI0F028102.152ON60954115410.0
YHR117W (TOM71)2.152ON63953815430.0
Smik_8.1952.152ON63553615410.0
CAGL0L04048g2.152ON58752714400.0
NDAI0B043402.152ON66452614150.0
NCAS0G008105.617ON5841291563e-10
Skud_15.1925.617ON5891251483e-09
SAKL0G07084g5.617ON585851474e-09
KLLA0A07062g5.617ON5811361448e-09
AEL224W5.617ON580801448e-09
Kwal_55.199355.617ON5931291422e-08
TBLA0E033005.617ON582851422e-08
ZYRO0A05676g5.617ON5721051422e-08
Suva_8.805.617ON586961393e-08
CAGL0H08195g5.617ON583851394e-08
TPHA0D028805.617ON5851311386e-08
Kpol_1032.86.21ON3431641356e-08
YOR027W (STI1)5.617ON5891251369e-08
Ecym_55825.617ON584851342e-07
KLTH0E02178g5.617ON593891332e-07
Kpol_1018.695.617ON590851305e-07
ACR005W6.21ON3271011285e-07
KLLA0B09966g8.506ON3701231278e-07
TBLA0A072706.21ON373951261e-06
Ecym_30256.21ON3181401251e-06
KNAG0B032005.617ON5791251261e-06
Smik_15.2055.617ON589851261e-06
TPHA0J003406.21ON3381101242e-06
NDAI0I022406.21ON350881232e-06
KLTH0F14542g3.481ON513951242e-06
TDEL0A048405.617ON576921243e-06
Kpol_513.28.506ON3741151223e-06
NDAI0D008106.21ON3491041204e-06
SAKL0E01210g6.21ON3231371205e-06
NDAI0F009105.617ON583851207e-06
NCAS0H008306.21ON3381521188e-06
Kwal_27.118908.506ON3341211188e-06
KAFR0L004106.21ON3311091171e-05
KAFR0C058905.617ON575851181e-05
Kpol_1037.266.21ON3421011171e-05
NDAI0B057903.481ON523951172e-05
KNAG0M011706.21ON3391631152e-05
KLTH0C11220g6.21ON3271381133e-05
Skud_2.2828.506ON385921143e-05
KLLA0D01155g6.21ON335681133e-05
Suva_3.956.328ON111701045e-05
Smik_2.2958.506ON385921125e-05
SAKL0H10934g8.506ON3801201117e-05
SAKL0F03102g3.481ON5131051127e-05
Kwal_55.211753.481ON511951117e-05
YBR155W (CNS1)8.506ON385921118e-05
KNAG0A079003.481ON512951119e-05
TPHA0E007407.412ON7461591111e-04
KNAG0A039508.506ON386921091e-04
TDEL0B013108.506ON3801211081e-04
AGL268C8.506ON379921082e-04
TBLA0G010506.21ON350891072e-04
CAGL0E02739g6.21ON343901072e-04
NCAS0F034903.481ON5121121082e-04
Kwal_56.224336.21ON3221401062e-04
KLTH0E11748g8.506ON378921062e-04
TBLA0C039503.481ON512951072e-04
KAFR0E029808.506ON380921063e-04
CAGL0H07425g8.506ON380961053e-04
NCAS0A112003.367ON9071311064e-04
TPHA0D032203.481ON5131061045e-04
CAGL0D05060g3.481ON510951046e-04
Suva_4.4058.506ON385921037e-04
KLLA0B10912g3.481ON512951037e-04
ZYRO0F08624g8.506ON379921028e-04
Kpol_1018.1067.412ON7531541039e-04
TPHA0D038606.328ON12088950.001
Skud_15.1686.21ON3481441010.001
KAFR0B066103.481ON511971010.001
Skud_7.4323.481ON5131061010.001
YOR007C (SGT2)6.21ON3461461000.001
KNAG0H006103.367ON9731291010.002
ZYRO0C16522g3.367ON9741011010.002
CAGL0D01364g3.367ON11481291000.002
NCAS0A00490singletonON6201181000.002
TPHA0M016303.367ON10431341000.002
TDEL0G044806.21ON343140980.002
NDAI0C052908.506ON37995980.002
Ecym_44133.481ON51091980.003
Suva_4.3613.367ON963138980.003
Kpol_505.413.481ON513106980.003
Smik_2.2543.367ON1020138980.004
YBR112C (CYC8)3.367ON966138980.004
TBLA0D004607.412ON835112980.004
KNAG0F040107.546ON141880980.004
Suva_7.4083.481ON51391970.004
NCAS0E024907.412ON809137970.004
TBLA0H033808.506ON37592960.004
KNAG0I025206.328ON11791900.004
Skud_2.2403.367ON984138970.005
KAFR0H008703.367ON88761970.005
Ecym_25598.506ON37092950.006
CAGL0C01903g7.412ON769159960.006
Kpol_172.23.367ON41894930.009
YCR060W (TAH1)6.328ON11158870.010
NCAS0B024008.506ON38092930.010
YGR123C (PPT1)3.481ON51391930.013
AAR083C3.481ON53897930.013
NCAS0A084201.456ON394208920.014
TPHA0M002706.21ON377105910.015
Skud_3.1356.328ON11859850.016
YBL084C (CDC27)7.412ON758187920.016
ZYRO0B03828g7.412ON727159920.017
Smik_6.2153.481ON51391910.018
KNAG0B022407.412ON739156910.025
NCAS0D026706.21ON351162900.025
TDEL0C027207.412ON700153900.029
YDR320C (SWA2)5.352ON668115900.031
TPHA0E011105.352ON693124890.034
Kpol_1050.1127.546ON136058890.045
KAFR0B002507.546ON1420133890.048
Suva_2.347.412ON763187880.050
TBLA0I023106.328ON11661810.061
Smik_2.367.412ON751187870.061
TDEL0E027505.352ON564127870.071
Smik_3.1596.328ON11567800.094
KLLA0E20857g7.412ON71098860.097
ZYRO0B04224g3.481ON51395850.098
Ecym_71427.412ON675110860.098
KLLA0C08910g6.328ON11559790.11
NDAI0E040407.412ON783138840.14
Ecym_20906.328ON17259800.17
TBLA0F012303.367ON1189120840.18
Kpol_1043.605.689ON706181830.20
NCAS0B025608.470ON57882820.22
NDAI0J001307.546ON140372830.24
NDAI0C043205.352ON706132820.25
ACR168W2.665ON707115820.28
TBLA0H015203.367ON689339810.35
TDEL0B076002.665ON752106810.35
Ecym_56372.665ON717102810.38
Kpol_339.135.352ON686113800.40
KLLA0B09262g3.367ON941105800.46
AGL294W7.412ON656110800.46
Skud_2.247.412ON769187790.58
KLTH0C06204g7.412ON627131790.59
NCAS0A153007.546ON139867790.61
TPHA0J027305.466ON563115790.64
Kpol_1028.516.328ON11763730.65
SAKL0A01672g6.328ON12862740.69
Kwal_34.160921.456ON39567780.76
Skud_15.2455.689ON75035780.83
Kwal_14.8742.665ON722137780.83
TPHA0G002407.546ON143081780.88
Suva_2.4108.470ON61192770.90
Smik_15.3135.466ON550113770.91
NDAI0I004406.328ON12867730.91
Kwal_27.107407.412ON628133771.1
SAKL0F16236g7.546ON140869771.1
KAFR0D023405.689ON69749771.1
ZYRO0D00572g2.665ON785107771.2
KAFR0B064005.466ON529117761.2
Smik_4.4918.470ON61292761.4
SAKL0F12936g7.412ON63244751.5
YOR132W (VPS17)5.466ON551113751.6
NDAI0G037103.5ON1121102761.6
Suva_8.1295.689ON74135751.6
SAKL0B07986g3.367ON880105751.7
SAKL0D11110g1.456ON432113742.0
YDR244W (PEX5)8.470ON61292742.1
Ecym_34593.367ON1115105742.3
KAFR0L018707.412ON712132742.3
Skud_15.2965.466ON545114732.6
ADL344W3.367ON910105742.6
Ecym_13661.456ON39284732.8
TPHA0L012108.470ON58881733.1
KAFR0A003002.637ON89389733.3
YOR080W (DIA2)5.689ON73235733.4
Skud_4.5068.470ON61192723.9
NDAI0C051308.470ON59077724.1
Suva_16.5217.546ON142482724.2
KLTH0F15202g5.466ON554115724.4
Skud_16.4937.546ON142569724.4
KLLA0E23453g8.544ON82667724.8
NDAI0A051003.367ON1007299715.1
Kwal_23.54087.546ON141069725.1
CAGL0K11209g8.470ON59098715.2
TBLA0A091705.689ON726105715.9
KLTH0H02068g7.313ON370114706.4
TBLA0B079705.72ON68773706.6
ACL164C5.443ON138943716.7
NDAI0F004005.689ON76449707.3
SAKL0G19712g2.665ON721238707.7
KAFR0C018505.352ON646109698.1
TBLA0B049907.546ON141049708.5
NCAS0F028705.352ON700115698.7
ZYRO0D05434gna 1ON42891699.0
KLTH0H14234g1.456ON39571689.8
SAKL0E06490g2.333ON376866810.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0L12936g
         (600 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0L12936g Chr12 (1382623..1384425) [1803 bp, 600 aa] {ON} sim...  1134   0.0  
TDEL0B05140 Chr2 complement(904626..906425) [1800 bp, 599 aa] {O...   694   0.0  
ZYRO0G06512g Chr7 complement(515759..517573) [1815 bp, 604 aa] {...   689   0.0  
Kpol_1048.21 s1048 complement(67975..69768) [1794 bp, 597 aa] {O...   687   0.0  
SAKL0E10956g Chr5 (916623..918425) [1803 bp, 600 aa] {ON} simila...   679   0.0  
YNL121C Chr14 complement(398684..400537) [1854 bp, 617 aa] {ON} ...   667   0.0  
Smik_14.207 Chr14 complement(378339..380192) [1854 bp, 617 aa] {...   659   0.0  
Skud_14.211 Chr14 complement(388749..390602) [1854 bp, 617 aa] {...   657   0.0  
Kwal_33.14767 s33 complement(809994..811778) [1785 bp, 594 aa] {...   656   0.0  
Suva_14.219 Chr14 complement(395316..397169) [1854 bp, 617 aa] {...   655   0.0  
KNAG0H03530 Chr8 (657450..659294) [1845 bp, 614 aa] {ON} Anc_2.1...   654   0.0  
KLTH0B05170g Chr2 (427608..429389) [1782 bp, 593 aa] {ON} simila...   650   0.0  
TBLA0C05530 Chr3 complement(1338666..1340498) [1833 bp, 610 aa] ...   638   0.0  
NCAS0B07010 Chr2 (1332351..1334228) [1878 bp, 625 aa] {ON} Anc_2...   637   0.0  
TPHA0I01510 Chr9 complement(342661..344472) [1812 bp, 603 aa] {O...   634   0.0  
Ecym_8204 Chr8 complement(419900..421693) [1794 bp, 597 aa] {ON}...   634   0.0  
NCAS0G02480 Chr7 complement(440105..441895) [1791 bp, 596 aa] {O...   626   0.0  
KLLA0F24046g Chr6 (2240454..2242268) [1815 bp, 604 aa] {ON} simi...   620   0.0  
ABR131W Chr2 (641631..643415) [1785 bp, 594 aa] {ON} Syntenic ho...   618   0.0  
KAFR0F00720 Chr6 complement(141181..143007) [1827 bp, 608 aa] {O...   617   0.0  
Skud_8.178 Chr8 (316128..318044) [1917 bp, 638 aa] {ON} YHR117W ...   610   0.0  
Suva_15.314 Chr15 (544646..546580) [1935 bp, 644 aa] {ON} YHR117...   605   0.0  
NDAI0F02810 Chr6 (690977..692806) [1830 bp, 609 aa] {ON} Anc_2.1...   598   0.0  
YHR117W Chr8 (342349..344268) [1920 bp, 639 aa] {ON}  TOM71Mitoc...   598   0.0  
Smik_8.195 Chr8 (318688..320595) [1908 bp, 635 aa] {ON} YHR117W ...   598   0.0  
CAGL0L04048g Chr12 (476407..478170) [1764 bp, 587 aa] {ON} simil...   559   0.0  
NDAI0B04340 Chr2 (1087851..1089845) [1995 bp, 664 aa] {ON} Anc_2...   549   0.0  
NCAS0G00810 Chr7 complement(138192..139946) [1755 bp, 584 aa] {O...    65   3e-10
Skud_15.192 Chr15 (340847..342616) [1770 bp, 589 aa] {ON} YOR027...    62   3e-09
SAKL0G07084g Chr7 (580004..581761) [1758 bp, 585 aa] {ON} highly...    61   4e-09
KLLA0A07062g Chr1 complement(636546..638291) [1746 bp, 581 aa] {...    60   8e-09
AEL224W Chr5 (207712..209454) [1743 bp, 580 aa] {ON} Syntenic ho...    60   8e-09
Kwal_55.19935 s55 (182767..184548) [1782 bp, 593 aa] {ON} YOR027...    59   2e-08
TBLA0E03300 Chr5 complement(827677..829425) [1749 bp, 582 aa] {O...    59   2e-08
ZYRO0A05676g Chr1 (459999..461717) [1719 bp, 572 aa] {ON} highly...    59   2e-08
Suva_8.80 Chr8 (142691..144451) [1761 bp, 586 aa] {ON} YOR027W (...    58   3e-08
CAGL0H08195g Chr8 complement(804418..806169) [1752 bp, 583 aa] {...    58   4e-08
TPHA0D02880 Chr4 (599288..601045) [1758 bp, 585 aa] {ON} Anc_5.6...    58   6e-08
Kpol_1032.8 s1032 complement(15762..16793) [1032 bp, 343 aa] {ON...    57   6e-08
YOR027W Chr15 (381053..382822) [1770 bp, 589 aa] {ON}  STI1Hsp90...    57   9e-08
Ecym_5582 Chr5 complement(1195544..1197298) [1755 bp, 584 aa] {O...    56   2e-07
KLTH0E02178g Chr5 (194914..196695) [1782 bp, 593 aa] {ON} highly...    56   2e-07
Kpol_1018.69 s1018 (197149..198921) [1773 bp, 590 aa] {ON} (1971...    55   5e-07
ACR005W Chr3 (363355..364338) [984 bp, 327 aa] {ON} Syntenic hom...    54   5e-07
KLLA0B09966g Chr2 complement(872760..873872) [1113 bp, 370 aa] {...    54   8e-07
TBLA0A07270 Chr1 complement(1811640..1812761) [1122 bp, 373 aa] ...    53   1e-06
Ecym_3025 Chr3 complement(50289..51245) [957 bp, 318 aa] {ON} si...    53   1e-06
KNAG0B03200 Chr2 complement(619530..621269) [1740 bp, 579 aa] {O...    53   1e-06
Smik_15.205 Chr15 (346899..348668) [1770 bp, 589 aa] {ON} YOR027...    53   1e-06
TPHA0J00340 Chr10 complement(76166..77182) [1017 bp, 338 aa] {ON...    52   2e-06
NDAI0I02240 Chr9 (512140..513192) [1053 bp, 350 aa] {ON} Anc_6.2...    52   2e-06
KLTH0F14542g Chr6 complement(1191800..1193341) [1542 bp, 513 aa]...    52   2e-06
TDEL0A04840 Chr1 (851520..853250) [1731 bp, 576 aa] {ON} Anc_5.6...    52   3e-06
Kpol_513.2 s513 (1962..3086) [1125 bp, 374 aa] {ON} (1962..3086)...    52   3e-06
NDAI0D00810 Chr4 complement(181659..182708) [1050 bp, 349 aa] {O...    51   4e-06
SAKL0E01210g Chr5 complement(93267..94238) [972 bp, 323 aa] {ON}...    51   5e-06
NDAI0F00910 Chr6 complement(223205..224956) [1752 bp, 583 aa] {ON}     51   7e-06
NCAS0H00830 Chr8 complement(151809..152825) [1017 bp, 338 aa] {O...    50   8e-06
Kwal_27.11890 s27 (990685..991689) [1005 bp, 334 aa] {ON} YBR155...    50   8e-06
KAFR0L00410 Chr12 complement(75459..76454) [996 bp, 331 aa] {ON}...    50   1e-05
KAFR0C05890 Chr3 (1165932..1167659) [1728 bp, 575 aa] {ON} Anc_5...    50   1e-05
Kpol_1037.26 s1037 complement(59590..60618) [1029 bp, 342 aa] {O...    50   1e-05
NDAI0B05790 Chr2 complement(1406039..1407610) [1572 bp, 523 aa] ...    50   2e-05
KNAG0M01170 Chr13 complement(211476..212495) [1020 bp, 339 aa] {...    49   2e-05
KLTH0C11220g Chr3 (920972..921955) [984 bp, 327 aa] {ON} similar...    48   3e-05
Skud_2.282 Chr2 (517201..518358) [1158 bp, 385 aa] {ON} YBR155W ...    49   3e-05
KLLA0D01155g Chr4 complement(104847..105854) [1008 bp, 335 aa] {...    48   3e-05
Suva_3.95 Chr3 (137419..137754) [336 bp, 111 aa] {ON} YCR060W (R...    45   5e-05
Smik_2.295 Chr2 (535786..536943) [1158 bp, 385 aa] {ON} YBR155W ...    48   5e-05
SAKL0H10934g Chr8 complement(945834..946976) [1143 bp, 380 aa] {...    47   7e-05
SAKL0F03102g Chr6 (258266..259807) [1542 bp, 513 aa] {ON} highly...    48   7e-05
Kwal_55.21175 s55 complement(716457..717992) [1536 bp, 511 aa] {...    47   7e-05
YBR155W Chr2 (549771..550928) [1158 bp, 385 aa] {ON}  CNS1TPR-co...    47   8e-05
KNAG0A07900 Chr1 complement(1258164..1259702) [1539 bp, 512 aa] ...    47   9e-05
TPHA0E00740 Chr5 complement(142456..144696) [2241 bp, 746 aa] {O...    47   1e-04
KNAG0A03950 Chr1 complement(529620..530780) [1161 bp, 386 aa] {O...    47   1e-04
TDEL0B01310 Chr2 complement(234307..235449) [1143 bp, 380 aa] {O...    46   1e-04
AGL268C Chr7 complement(205872..207011) [1140 bp, 379 aa] {ON} S...    46   2e-04
TBLA0G01050 Chr7 complement(262407..263459) [1053 bp, 350 aa] {O...    46   2e-04
CAGL0E02739g Chr5 complement(259023..260054) [1032 bp, 343 aa] {...    46   2e-04
NCAS0F03490 Chr6 complement(698757..700295) [1539 bp, 512 aa] {O...    46   2e-04
Kwal_56.22433 s56 complement(124778..125746) [969 bp, 322 aa] {O...    45   2e-04
KLTH0E11748g Chr5 (1043203..1044339) [1137 bp, 378 aa] {ON} simi...    45   2e-04
TBLA0C03950 Chr3 complement(950339..951877) [1539 bp, 512 aa] {O...    46   2e-04
KAFR0E02980 Chr5 (596891..598033) [1143 bp, 380 aa] {ON} Anc_8.5...    45   3e-04
CAGL0H07425g Chr8 (725307..726449) [1143 bp, 380 aa] {ON} highly...    45   3e-04
NCAS0A11200 Chr1 complement(2220419..2223142) [2724 bp, 907 aa] ...    45   4e-04
TPHA0D03220 Chr4 complement(662868..664409) [1542 bp, 513 aa] {O...    45   5e-04
CAGL0D05060g Chr4 complement(486065..487597) [1533 bp, 510 aa] {...    45   6e-04
Suva_4.405 Chr4 (719015..720172) [1158 bp, 385 aa] {ON} YBR155W ...    44   7e-04
KLLA0B10912g Chr2 (955948..957486) [1539 bp, 512 aa] {ON} simila...    44   7e-04
ZYRO0F08624g Chr6 (691992..693131) [1140 bp, 379 aa] {ON} simila...    44   8e-04
Kpol_1018.106 s1018 (280224..282485) [2262 bp, 753 aa] {ON} (280...    44   9e-04
TPHA0D03860 Chr4 (807913..808275) [363 bp, 120 aa] {ON} Anc_6.32...    41   0.001
Skud_15.168 Chr15 complement(298955..300001) [1047 bp, 348 aa] {...    44   0.001
KAFR0B06610 Chr2 (1372434..1373969) [1536 bp, 511 aa] {ON} Anc_3...    44   0.001
Skud_7.432 Chr7 complement(715852..717393) [1542 bp, 513 aa] {ON...    44   0.001
YOR007C Chr15 complement(338938..339978) [1041 bp, 346 aa] {ON} ...    43   0.001
KNAG0H00610 Chr8 (99931..102852) [2922 bp, 973 aa] {ON} Anc_3.36...    44   0.002
ZYRO0C16522g Chr3 complement(1281166..1284090) [2925 bp, 974 aa]...    44   0.002
CAGL0D01364g Chr4 (152033..155479) [3447 bp, 1148 aa] {ON} simil...    43   0.002
NCAS0A00490 Chr1 complement(76652..78514) [1863 bp, 620 aa] {ON}       43   0.002
TPHA0M01630 Chr13 complement(340500..343631) [3132 bp, 1043 aa] ...    43   0.002
TDEL0G04480 Chr7 (813648..814679) [1032 bp, 343 aa] {ON} Anc_6.2...    42   0.002
NDAI0C05290 Chr3 (1224979..1226118) [1140 bp, 379 aa] {ON} Anc_8...    42   0.002
Ecym_4413 Chr4 complement(856330..857862) [1533 bp, 510 aa] {ON}...    42   0.003
Suva_4.361 Chr4 complement(631697..632812,632933..633154,633188....    42   0.003
Kpol_505.41 s505 complement(91130..92671) [1542 bp, 513 aa] {ON}...    42   0.003
Smik_2.254 Chr2 complement(447517..450579) [3063 bp, 1020 aa] {O...    42   0.004
YBR112C Chr2 complement(462870..465770) [2901 bp, 966 aa] {ON}  ...    42   0.004
TBLA0D00460 Chr4 complement(113831..116338) [2508 bp, 835 aa] {O...    42   0.004
KNAG0F04010 Chr6 (757749..762005) [4257 bp, 1418 aa] {ON} Anc_7....    42   0.004
Suva_7.408 Chr7 complement(706942..708483) [1542 bp, 513 aa] {ON...    42   0.004
NCAS0E02490 Chr5 complement(493779..496208) [2430 bp, 809 aa] {O...    42   0.004
TBLA0H03380 Chr8 (829314..830441) [1128 bp, 375 aa] {ON} Anc_8.5...    42   0.004
KNAG0I02520 Chr9 complement(487699..488052) [354 bp, 117 aa] {ON...    39   0.004
Skud_2.240 Chr2 complement(431507..434461) [2955 bp, 984 aa] {ON...    42   0.005
KAFR0H00870 Chr8 (162118..164781) [2664 bp, 887 aa] {ON} Anc_3.3...    42   0.005
Ecym_2559 Chr2 (1089202..1090314) [1113 bp, 370 aa] {ON} similar...    41   0.006
CAGL0C01903g Chr3 complement(199487..201796) [2310 bp, 769 aa] {...    42   0.006
Kpol_172.2 s172 (4270..5523) [1254 bp, 418 aa] {ON} (4270..5523)...    40   0.009
YCR060W Chr3 (224399..224734) [336 bp, 111 aa] {ON}  TAH1Compone...    38   0.010
NCAS0B02400 Chr2 complement(402763..403905) [1143 bp, 380 aa] {O...    40   0.010
YGR123C Chr7 complement(736662..738203) [1542 bp, 513 aa] {ON}  ...    40   0.013
AAR083C Chr1 complement(492375..493991) [1617 bp, 538 aa] {ON} S...    40   0.013
NCAS0A08420 Chr1 complement(1667102..1668286) [1185 bp, 394 aa] ...    40   0.014
TPHA0M00270 Chr13 complement(53640..54773) [1134 bp, 377 aa] {ON...    40   0.015
Skud_3.135 Chr3 (208664..209020) [357 bp, 118 aa] {ON} YCR060W (...    37   0.016
YBL084C Chr2 complement(67169..69445) [2277 bp, 758 aa] {ON}  CD...    40   0.016
ZYRO0B03828g Chr2 (318153..320336) [2184 bp, 727 aa] {ON} simila...    40   0.017
Smik_6.215 Chr6 complement(354154..355695) [1542 bp, 513 aa] {ON...    40   0.018
KNAG0B02240 Chr2 complement(434466..436685) [2220 bp, 739 aa] {O...    40   0.025
NCAS0D02670 Chr4 complement(512529..513584) [1056 bp, 351 aa] {O...    39   0.025
TDEL0C02720 Chr3 (477529..479631) [2103 bp, 700 aa] {ON} Anc_7.4...    39   0.029
YDR320C Chr4 complement(1106095..1108101) [2007 bp, 668 aa] {ON}...    39   0.031
TPHA0E01110 Chr5 (228116..230197) [2082 bp, 693 aa] {ON} Anc_5.3...    39   0.034
Kpol_1050.112 s1050 (249717..252797,252855..252863,252906..25389...    39   0.045
KAFR0B00250 Chr2 complement(58608..62870) [4263 bp, 1420 aa] {ON...    39   0.048
Suva_2.34 Chr2 complement(63832..65304,65365..66183) [2292 bp, 7...    39   0.050
TBLA0I02310 Chr9 (528067..528417) [351 bp, 116 aa] {ON} Anc_6.32...    36   0.061
Smik_2.36 Chr2 complement(61159..63414) [2256 bp, 751 aa] {ON} Y...    38   0.061
TDEL0E02750 Chr5 (529920..531614) [1695 bp, 564 aa] {ON} Anc_5.3...    38   0.071
Smik_3.159 Chr3 (222475..222822) [348 bp, 115 aa] {ON} YCR060W (...    35   0.094
KLLA0E20857g Chr5 (1860517..1862649) [2133 bp, 710 aa] {ON} simi...    38   0.097
ZYRO0B04224g Chr2 (350069..351610) [1542 bp, 513 aa] {ON} highly...    37   0.098
Ecym_7142 Chr7 complement(287110..289137) [2028 bp, 675 aa] {ON}...    38   0.098
KLLA0C08910g Chr3 complement(781726..782073) [348 bp, 115 aa] {O...    35   0.11 
NDAI0E04040 Chr5 (900685..903036) [2352 bp, 783 aa] {ON} Anc_7.4...    37   0.14 
Ecym_2090 Chr2 complement(163340..163858) [519 bp, 172 aa] {ON} ...    35   0.17 
TBLA0F01230 Chr6 complement(304299..307868) [3570 bp, 1189 aa] {...    37   0.18 
Kpol_1043.60 s1043 (123502..125622) [2121 bp, 706 aa] {ON} (1235...    37   0.20 
NCAS0B02560 Chr2 complement(427447..429183) [1737 bp, 578 aa] {O...    36   0.22 
NDAI0J00130 Chr10 complement(10432..14643) [4212 bp, 1403 aa] {O...    37   0.24 
NDAI0C04320 Chr3 complement(983914..986034) [2121 bp, 706 aa] {O...    36   0.25 
ACR168W Chr3 (650615..652738) [2124 bp, 707 aa] {ON} Syntenic ho...    36   0.28 
TBLA0H01520 Chr8 (344716..346785) [2070 bp, 689 aa] {ON} Anc_3.3...    36   0.35 
TDEL0B07600 Chr2 (1331773..1334031) [2259 bp, 752 aa] {ON} Anc_2...    36   0.35 
Ecym_5637 Chr5 (1288532..1290685) [2154 bp, 717 aa] {ON} similar...    36   0.38 
Kpol_339.13 s339 complement(21257..23317) [2061 bp, 686 aa] {ON}...    35   0.40 
KLLA0B09262g Chr2 (814303..817128) [2826 bp, 941 aa] {ON} highly...    35   0.46 
AGL294W Chr7 (154711..156681) [1971 bp, 656 aa] {ON} Syntenic ho...    35   0.46 
Skud_2.24 Chr2 complement(50790..53099) [2310 bp, 769 aa] {ON} Y...    35   0.58 
KLTH0C06204g Chr3 complement(538533..540416) [1884 bp, 627 aa] {...    35   0.59 
NCAS0A15300 Chr1 (3006855..3011051) [4197 bp, 1398 aa] {ON}            35   0.61 
TPHA0J02730 Chr10 (603215..604906) [1692 bp, 563 aa] {ON} Anc_5....    35   0.64 
Kpol_1028.51 s1028 complement(123535..123888) [354 bp, 117 aa] {...    33   0.65 
SAKL0A01672g Chr1 complement(154932..155318) [387 bp, 128 aa] {O...    33   0.69 
Kwal_34.16092 s34 complement(198730..199917) [1188 bp, 395 aa] {...    35   0.76 
Skud_15.245 Chr15 (431002..433254) [2253 bp, 750 aa] {ON} YOR080...    35   0.83 
Kwal_14.874 s14 complement(90148..92316) [2169 bp, 722 aa] {ON} ...    35   0.83 
TPHA0G00240 Chr7 complement(37417..41709) [4293 bp, 1430 aa] {ON...    35   0.88 
Suva_2.410 Chr2 (729992..731827) [1836 bp, 611 aa] {ON} YDR244W ...    34   0.90 
Smik_15.313 Chr15 (534587..536239) [1653 bp, 550 aa] {ON} YOR132...    34   0.91 
NDAI0I00440 Chr9 complement(89650..90036) [387 bp, 128 aa] {ON} ...    33   0.91 
Kwal_27.10740 s27 complement(476617..478503) [1887 bp, 628 aa] {...    34   1.1  
SAKL0F16236g Chr6 (1313573..1317799) [4227 bp, 1408 aa] {ON} sim...    34   1.1  
KAFR0D02340 Chr4 complement(473431..475524) [2094 bp, 697 aa] {O...    34   1.1  
ZYRO0D00572g Chr4 complement(42511..44830,45510..45547) [2358 bp...    34   1.2  
KAFR0B06400 Chr2 complement(1324711..1326300) [1590 bp, 529 aa] ...    34   1.2  
Smik_4.491 Chr4 (895429..897267) [1839 bp, 612 aa] {ON} YDR244W ...    34   1.4  
SAKL0F12936g Chr6 (1016829..1018727) [1899 bp, 632 aa] {ON} simi...    33   1.5  
YOR132W Chr15 (573175..574830) [1656 bp, 551 aa] {ON}  VPS17Subu...    33   1.6  
NDAI0G03710 Chr7 complement(894337..897702) [3366 bp, 1121 aa] {...    34   1.6  
Suva_8.129 Chr8 (231888..234113) [2226 bp, 741 aa] {ON} YOR080W ...    33   1.6  
SAKL0B07986g Chr2 complement(675999..678641) [2643 bp, 880 aa] {...    33   1.7  
SAKL0D11110g Chr4 (920630..921928) [1299 bp, 432 aa] {ON} simila...    33   2.0  
YDR244W Chr4 (950563..952401) [1839 bp, 612 aa] {ON}  PEX5Peroxi...    33   2.1  
Ecym_3459 Chr3 (864878..868225) [3348 bp, 1115 aa] {ON} similar ...    33   2.3  
KAFR0L01870 Chr12 (345757..347895) [2139 bp, 712 aa] {ON} Anc_7....    33   2.3  
Skud_15.296 Chr15 (529599..531236) [1638 bp, 545 aa] {ON} YOR132...    33   2.6  
ADL344W Chr4 (103565..106297) [2733 bp, 910 aa] {ON} Syntenic ho...    33   2.6  
Ecym_1366 Chr1 (753035..754213) [1179 bp, 392 aa] {ON} similar t...    33   2.8  
TPHA0L01210 Chr12 (252106..253872) [1767 bp, 588 aa] {ON} Anc_8....    33   3.1  
KAFR0A00300 Chr1 complement(56363..59044) [2682 bp, 893 aa] {ON}...    33   3.3  
YOR080W Chr15 (474594..476792) [2199 bp, 732 aa] {ON}  DIA2Origi...    33   3.4  
Skud_4.506 Chr4 (905143..906978) [1836 bp, 611 aa] {ON} YDR244W ...    32   3.9  
NDAI0C05130 Chr3 (1193350..1195122) [1773 bp, 590 aa] {ON} Anc_8...    32   4.1  
Suva_16.521 Chr16 (895057..899331) [4275 bp, 1424 aa] {ON} YPR18...    32   4.2  
KLTH0F15202g Chr6 complement(1247894..1249558) [1665 bp, 554 aa]...    32   4.4  
Skud_16.493 Chr16 (854949..859226) [4278 bp, 1425 aa] {ON} YPR18...    32   4.4  
KLLA0E23453g Chr5 (2088516..2090996) [2481 bp, 826 aa] {ON} simi...    32   4.8  
NDAI0A05100 Chr1 (1157935..1160958) [3024 bp, 1007 aa] {ON} Anc_...    32   5.1  
Kwal_23.5408 s23 (1146253..1150485) [4233 bp, 1410 aa] {ON} YPR1...    32   5.1  
CAGL0K11209g Chr11 (1089300..1091072) [1773 bp, 590 aa] {ON} sim...    32   5.2  
TBLA0A09170 Chr1 complement(2276263..2278443) [2181 bp, 726 aa] ...    32   5.9  
KLTH0H02068g Chr8 complement(188834..189946) [1113 bp, 370 aa] {...    32   6.4  
TBLA0B07970 Chr2 (1887119..1889182) [2064 bp, 687 aa] {ON} Anc_5...    32   6.6  
ACL164C Chr3 complement(67792..71961) [4170 bp, 1389 aa] {ON} Sy...    32   6.7  
NDAI0F00400 Chr6 complement(96274..98568) [2295 bp, 764 aa] {ON}...    32   7.3  
SAKL0G19712g Chr7 (1697758..1699923) [2166 bp, 721 aa] {ON} simi...    32   7.7  
KAFR0C01850 Chr3 (369596..371536) [1941 bp, 646 aa] {ON} Anc_5.3...    31   8.1  
TBLA0B04990 Chr2 (1171599..1175831) [4233 bp, 1410 aa] {ON} Anc_...    32   8.5  
NCAS0F02870 Chr6 complement(573068..575170) [2103 bp, 700 aa] {O...    31   8.7  
ZYRO0D05434g Chr4 complement(469258..470544) [1287 bp, 428 aa] {...    31   9.0  
KLTH0H14234g Chr8 (1236691..1237878) [1188 bp, 395 aa] {ON} simi...    31   9.8  
SAKL0E06490g Chr5 complement(530588..531718) [1131 bp, 376 aa] {...    31   10.0 

>CAGL0L12936g Chr12 (1382623..1384425) [1803 bp, 600 aa] {ON}
           similar to uniprot|P07213 Saccharomyces cerevisiae
           YNL121c TOM70 or uniprot|P38825 Saccharomyces cerevisiae
           YHR117w TOM7
          Length = 600

 Score = 1134 bits (2932), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 562/600 (93%), Positives = 562/600 (93%)

Query: 1   MALLKNRKXXXXXXXXXXXXXXXXXXXXXXXNVRATTEXXXXXXXXXXXXXXXATASEPA 60
           MALLKNRK                       NVRATTE               ATASEPA
Sbjct: 1   MALLKNRKAVVATVAAVATAAAAASAYYYYSNVRATTEKSKKDKKKKNKKKKKATASEPA 60

Query: 61  TSDKAYLTINGDEEKPDMAAMLASSEDQKKVYATALKDKGNALFKEKRFEDAIEFYNHAI 120
           TSDKAYLTINGDEEKPDMAAMLASSEDQKKVYATALKDKGNALFKEKRFEDAIEFYNHAI
Sbjct: 61  TSDKAYLTINGDEEKPDMAAMLASSEDQKKVYATALKDKGNALFKEKRFEDAIEFYNHAI 120

Query: 121 KLHEDPVFHSNISACYVSLGDLDKVVESSTRALELKPDYSKALLRRASAYENMGRYQDAM 180
           KLHEDPVFHSNISACYVSLGDLDKVVESSTRALELKPDYSKALLRRASAYENMGRYQDAM
Sbjct: 121 KLHEDPVFHSNISACYVSLGDLDKVVESSTRALELKPDYSKALLRRASAYENMGRYQDAM 180

Query: 181 FDISVLSLNGDFNGSSIEPMLERNLNKQALRVLKEDMGIDASVPQAEQPRERQELPSNTS 240
           FDISVLSLNGDFNGSSIEPMLERNLNKQALRVLKEDMGIDASVPQAEQPRERQELPSNTS
Sbjct: 181 FDISVLSLNGDFNGSSIEPMLERNLNKQALRVLKEDMGIDASVPQAEQPRERQELPSNTS 240

Query: 241 LSSFFGIFKPETEIPAYDESNEADVTLVRGLKALYGATSDGYQLADECFAKAAKLYREQL 300
           LSSFFGIFKPETEIPAYDESNEADVTLVRGLKALYGATSDGYQLADECFAKAAKLYREQL
Sbjct: 241 LSSFFGIFKPETEIPAYDESNEADVTLVRGLKALYGATSDGYQLADECFAKAAKLYREQL 300

Query: 301 ANNNDAAFKEKAATALEYLGIFDFLKNDLDNSEKNLKEALALHPRVNTYIYLALTMADRG 360
           ANNNDAAFKEKAATALEYLGIFDFLKNDLDNSEKNLKEALALHPRVNTYIYLALTMADRG
Sbjct: 301 ANNNDAAFKEKAATALEYLGIFDFLKNDLDNSEKNLKEALALHPRVNTYIYLALTMADRG 360

Query: 361 QSEDYFSYFEKAIALDPNNAAVYYHRGQMYFITQNYEKAGEDFKKSKESDPKNIFPYIQL 420
           QSEDYFSYFEKAIALDPNNAAVYYHRGQMYFITQNYEKAGEDFKKSKESDPKNIFPYIQL
Sbjct: 361 QSEDYFSYFEKAIALDPNNAAVYYHRGQMYFITQNYEKAGEDFKKSKESDPKNIFPYIQL 420

Query: 421 ACLAYRENKMAECEKLFEEARKTFPTAPEVPNFYAEILADKGDIDEAVKQYNIAYRLESL 480
           ACLAYRENKMAECEKLFEEARKTFPTAPEVPNFYAEILADKGDIDEAVKQYNIAYRLESL
Sbjct: 421 ACLAYRENKMAECEKLFEEARKTFPTAPEVPNFYAEILADKGDIDEAVKQYNIAYRLESL 480

Query: 481 QKQIHVGIAPLVGKATILARQPTPENFATISQLLEDACKADPRSEQAKVGLAQLRLQQEK 540
           QKQIHVGIAPLVGKATILARQPTPENFATISQLLEDACKADPRSEQAKVGLAQLRLQQEK
Sbjct: 481 QKQIHVGIAPLVGKATILARQPTPENFATISQLLEDACKADPRSEQAKVGLAQLRLQQEK 540

Query: 541 VDEAIELFEEAAKMARTVDEKLQAITFAEATKVQKRIRADPVVSKKVEETLAAYQAQNMF 600
           VDEAIELFEEAAKMARTVDEKLQAITFAEATKVQKRIRADPVVSKKVEETLAAYQAQNMF
Sbjct: 541 VDEAIELFEEAAKMARTVDEKLQAITFAEATKVQKRIRADPVVSKKVEETLAAYQAQNMF 600

>TDEL0B05140 Chr2 complement(904626..906425) [1800 bp, 599 aa] {ON}
           Anc_2.152 YHR117W
          Length = 599

 Score =  694 bits (1791), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 343/530 (64%), Positives = 424/530 (80%), Gaps = 11/530 (2%)

Query: 71  GDEEKPDMAAMLASSEDQKKVYATALKDKGNALFKEKRFEDAIEFYNHAIKLHEDPVFHS 130
           G   +P +  +   S++ ++ YATALKD+GN  FK+K +++A+++YN+A+ + +DPVF+S
Sbjct: 79  GQNGEPLLENIEELSQELRETYATALKDRGNEFFKKKDYDNALKYYNYALVVKKDPVFYS 138

Query: 131 NISACYVSLGDLDKVVESSTRALELKPDYSKALLRRASAYENMGRYQDAMFDISVLSLNG 190
           NISACYVSLG LDKVVE+ST+ALELKPDYSKALLRRASA E++  Y DAMFD+SVLSLNG
Sbjct: 139 NISACYVSLGQLDKVVENSTKALELKPDYSKALLRRASANESLENYADAMFDLSVLSLNG 198

Query: 191 DFNGSSIEPMLERNLNKQALRVLKEDMGIDASVPQAEQPRERQELPSNTSLSSFFGIFKP 250
           DFNGSSIEPMLERNLNKQA+ VLK+ +G + S          Q+LPSNT+L+SFFGIF P
Sbjct: 199 DFNGSSIEPMLERNLNKQAMFVLKDKLGNNVS----------QQLPSNTALASFFGIFPP 248

Query: 251 ETEIPAYDESNEADVTLVRGLKALYGATSDGYQLADECFAKAAKLYREQLAN-NNDAAFK 309
           ET    Y+E++EADV L  GL+ LY  +S+GY+LADE F K+A  +  +L+   +DA  K
Sbjct: 249 ETTFANYNENDEADVGLKNGLEDLYKRSSEGYKLADEAFVKSASFFTNKLSEFPDDAVLK 308

Query: 310 EKAATALEYLGIFDFLKNDLDNSEKNLKEALALHPRVNTYIYLALTMADRGQSEDYFSYF 369
           EK A ALE+ GIF FLKND   +  ++++A+ LHPR+N+YIY+AL MAD+GQ+E+Y+ YF
Sbjct: 309 EKTAIALEHNGIFKFLKNDPLEAHDDIEKAIQLHPRLNSYIYMALIMADKGQAEEYYQYF 368

Query: 370 EKAIALDPNNAAVYYHRGQMYFITQNYEKAGEDFKKSKESDPKNIFPYIQLACLAYRENK 429
           +KAIALDPN    YYHRGQMY+IT  YEKAG+DF K+KE D  NIFPYIQLACLAYRE+K
Sbjct: 369 DKAIALDPNYGPAYYHRGQMYYITGQYEKAGKDFDKAKECDENNIFPYIQLACLAYREDK 428

Query: 430 MAECEKLFEEARKTFPTAPEVPNFYAEILADKGDIDEAVKQYNIAYRLESLQKQIHVGIA 489
             +CE LF EA++ FPTAPEVPNFYAEIL DKGD++ A+KQY IA RLE     IHVG+A
Sbjct: 429 FDDCETLFSEAKRKFPTAPEVPNFYAEILGDKGDLEAALKQYEIAKRLEEALDGIHVGVA 488

Query: 490 PLVGKATILARQPTPENFATISQLLEDACKADPRSEQAKVGLAQLRLQQEKVDEAIELFE 549
           PLVGKAT+LARQP+ ENF   + LLE+AC+ DP SEQAKVGLAQL+LQQE+VDEAI LFE
Sbjct: 489 PLVGKATLLARQPSVENFREATLLLEEACRRDPTSEQAKVGLAQLKLQQEEVDEAINLFE 548

Query: 550 EAAKMARTVDEKLQAITFAEATKVQKRIRADPVVSKKVEETLAAYQAQNM 599
           EAA +ARTVDEKLQA TFAEA KVQKRI+ADPVVS K+EETLAAY+AQ M
Sbjct: 549 EAANLARTVDEKLQATTFAEAAKVQKRIKADPVVSAKIEETLAAYRAQGM 598

>ZYRO0G06512g Chr7 complement(515759..517573) [1815 bp, 604 aa] {ON}
           similar to uniprot|P07213 Saccharomyces cerevisiae
           YNL121C TOM70 Translocase of Outer Mitochondrial
           membrane 70 kDa mitochondrial specialized import
           receptor of the outer membrane
          Length = 604

 Score =  689 bits (1778), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 338/526 (64%), Positives = 427/526 (81%), Gaps = 11/526 (2%)

Query: 76  PDMAAMLASSEDQKKVYATALKDKGNALFKEKRFEDAIEFYNHAIKLHEDPVFHSNISAC 135
           P +  +   SE+QK+ ++TALKDKGN  FK+K +++A+++Y++A+ L +DPVF+SNISAC
Sbjct: 89  PKLDNVAEMSEEQKESWSTALKDKGNEFFKQKDYDNALKYYDYALTLKKDPVFYSNISAC 148

Query: 136 YVSLGDLDKVVESSTRALELKPDYSKALLRRASAYENMGRYQDAMFDISVLSLNGDFNGS 195
           YVS+  LDKVVE+ST+ALELKPDYSKALLRRASA E++  Y DAMFD+SVLSLNGDF GS
Sbjct: 149 YVSMNQLDKVVENSTKALELKPDYSKALLRRASANESLENYPDAMFDLSVLSLNGDFGGS 208

Query: 196 SIEPMLERNLNKQALRVLKEDMGIDASVPQAEQPRERQELPSNTSLSSFFGIFKPETEIP 255
           SIEPMLERNLNKQA+ VLK+ +G           ++ Q LPS+T+L+SFFGIF PETE  
Sbjct: 209 SIEPMLERNLNKQAMTVLKDKLG----------QQKNQLLPSDTALASFFGIFTPETEFA 258

Query: 256 AYDESNEADVTLVRGLKALYGATSDGYQLADECFAKAAKLY-REQLANNNDAAFKEKAAT 314
            YDE++EAD  L  GL+ LY  +S+GYQ ADE F++A   Y + +  N++DAA KEK A 
Sbjct: 259 NYDETSEADQKLKAGLENLYKRSSEGYQKADEFFSQAVDAYAKLREGNSDDAALKEKDAI 318

Query: 315 ALEYLGIFDFLKNDLDNSEKNLKEALALHPRVNTYIYLALTMADRGQSEDYFSYFEKAIA 374
           ALE+ GIF FLKND   + +++++A+ LHPRVN+YIY+AL MAD+G++E+Y+ +F+KAI 
Sbjct: 319 ALEHRGIFRFLKNDPLGAHEDVQKAIDLHPRVNSYIYMALIMADKGKAEEYYEFFDKAIK 378

Query: 375 LDPNNAAVYYHRGQMYFITQNYEKAGEDFKKSKESDPKNIFPYIQLACLAYRENKMAECE 434
           LDP NAAVYYHRGQMYFIT  YEKAG+DF K+K+ + +NIFPYIQLACLAYRENK  +CE
Sbjct: 379 LDPKNAAVYYHRGQMYFITAQYEKAGQDFDKAKQLNEENIFPYIQLACLAYRENKFDDCE 438

Query: 435 KLFEEARKTFPTAPEVPNFYAEILADKGDIDEAVKQYNIAYRLESLQKQIHVGIAPLVGK 494
            LF EA++ F TAPEVPNF+AEILADKGD+++A+KQY+IA RLE     IHVGI+PLVGK
Sbjct: 439 TLFSEAKRKFATAPEVPNFFAEILADKGDLEKALKQYDIAKRLEEAVDGIHVGISPLVGK 498

Query: 495 ATILARQPTPENFATISQLLEDACKADPRSEQAKVGLAQLRLQQEKVDEAIELFEEAAKM 554
           AT+LARQP+ ENF   ++LLE+AC  DPRSEQ KVGLAQL+LQQE +D+AI+LFEEAA +
Sbjct: 499 ATLLARQPSVENFIEATKLLEEACAKDPRSEQGKVGLAQLKLQQEDIDDAIKLFEEAASL 558

Query: 555 ARTVDEKLQAITFAEATKVQKRIRADPVVSKKVEETLAAYQAQNMF 600
           ARTVDEKLQA TFAEA KVQKRIRADP+VS K+EETLAAY+AQ + 
Sbjct: 559 ARTVDEKLQATTFAEAAKVQKRIRADPLVSAKIEETLAAYKAQGVI 604

>Kpol_1048.21 s1048 complement(67975..69768) [1794 bp, 597 aa] {ON}
           complement(67975..69768) [1794 nt, 598 aa]
          Length = 597

 Score =  687 bits (1774), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 336/527 (63%), Positives = 419/527 (79%), Gaps = 11/527 (2%)

Query: 75  KPDMAAMLASSEDQKKVYATALKDKGNALFKEKRFEDAIEFYNHAIKLHEDPVFHSNISA 134
           +PD+      +E+QK+ Y+ ALKDKGN  FKE+++EDA+++YN+A+ L +DPVF+SNISA
Sbjct: 81  EPDLKDSANFTEEQKETYSVALKDKGNQFFKEQKYEDALKYYNYALDLKQDPVFYSNISA 140

Query: 135 CYVSLGDLDKVVESSTRALELKPDYSKALLRRASAYENMGRYQDAMFDISVLSLNGDFNG 194
           CYVSLG+L+KVVESST+ALELKPDYSKALLRRASA EN+  + +AMFD+SVLSLNGDFN 
Sbjct: 141 CYVSLGNLEKVVESSTKALELKPDYSKALLRRASANENLENFAEAMFDLSVLSLNGDFNE 200

Query: 195 SSIEPMLERNLNKQALRVLKEDMGIDASVPQAEQPRERQELPSNTSLSSFFGIFKPETEI 254
           +SIEPMLERNLNKQA+RVLK+ M  DA          +Q+LPSNT L+SFFGIF PET +
Sbjct: 201 ASIEPMLERNLNKQAMRVLKDKMSSDA----------KQQLPSNTFLASFFGIFTPETTL 250

Query: 255 PAYDESNEADVTLVRGLKALYGATSDGYQLADECFAKAAKLYREQL-ANNNDAAFKEKAA 313
             +DESNEADV L+  L  LY   S+ Y +ADE F+KAA+ Y +QL AN +D   KEK A
Sbjct: 251 KNFDESNEADVELLNALVNLYKRKSESYLIADESFSKAAESYVKQLEANPDDEVLKEKTA 310

Query: 314 TALEYLGIFDFLKNDLDNSEKNLKEALALHPRVNTYIYLALTMADRGQSEDYFSYFEKAI 373
           TALEY GIF FLKND   S ++++ ++ LHPRVN YIY AL MAD+G+S++YF +F+KA+
Sbjct: 311 TALEYNGIFKFLKNDPLGSHEDIQRSIELHPRVNAYIYSALIMADKGESKNYFDFFDKAL 370

Query: 374 ALDPNNAAVYYHRGQMYFITQNYEKAGEDFKKSKESDPKNIFPYIQLACLAYRENKMAEC 433
            +DPN+A VYYHRGQM+F++Q YEKA  DF+K+KESD  NIFPYIQLACL Y E K  +C
Sbjct: 371 DVDPNSAPVYYHRGQMHFLSQQYEKAAADFEKAKESDSSNIFPYIQLACLTYHEGKFDDC 430

Query: 434 EKLFEEARKTFPTAPEVPNFYAEILADKGDIDEAVKQYNIAYRLESLQKQIHVGIAPLVG 493
           E LF EA++ FPTAPEVPNFYAE+L DKGD D A KQY+IA RLE     IHVG++PLVG
Sbjct: 431 ETLFSEAKRKFPTAPEVPNFYAEVLTDKGDFDAASKQYDIAKRLEESLDAIHVGVSPLVG 490

Query: 494 KATILARQPTPENFATISQLLEDACKADPRSEQAKVGLAQLRLQQEKVDEAIELFEEAAK 553
           KAT+LARQPT EN    + LLE+ACK D RSEQAK+GLAQL+LQQE++DEAI LFEEA+ 
Sbjct: 491 KATLLARQPTVENLLESTTLLEEACKMDSRSEQAKIGLAQLKLQQEEIDEAITLFEEASD 550

Query: 554 MARTVDEKLQAITFAEATKVQKRIRADPVVSKKVEETLAAYQAQNMF 600
           +AR ++EKLQA TFAEA+KVQK+IRADPVV+ K++ TLAAY+ Q + 
Sbjct: 551 LARNMEEKLQATTFAEASKVQKKIRADPVVNAKIQATLAAYREQGLI 597

>SAKL0E10956g Chr5 (916623..918425) [1803 bp, 600 aa] {ON} similar
           to uniprot|P07213 Saccharomyces cerevisiae YNL121C TOM70
           Translocase of Outer Mitochondrial membrane 70 kDa
           mitochondrial specialized import receptor of the outer
           membrane
          Length = 600

 Score =  679 bits (1751), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 346/547 (63%), Positives = 418/547 (76%), Gaps = 15/547 (2%)

Query: 55  TASEPATSDKAYLTINGDEEKPDMAAMLASSEDQKKVYATALKDKGNALFKEKRFEDAIE 114
           T+  P  S  AY      E K D    L  +++QK+ YA  LKDKGN  FKEK+F+DAI+
Sbjct: 68  TSGSPTAS--AYPVDENGEPKLDDIDQL--TDEQKEKYAMGLKDKGNEFFKEKKFDDAIK 123

Query: 115 FYNHAIKLHEDPVFHSNISACYVSLGDLDKVVESSTRALELKPDYSKALLRRASAYENMG 174
           +YN A++L +DPVF+SN SACYVS+G L+KVVE +T AL+LK DYSK LLRRASA E++G
Sbjct: 124 YYNLALELKKDPVFYSNRSACYVSMGQLEKVVEDTTAALKLKSDYSKCLLRRASANESLG 183

Query: 175 RYQDAMFDISVLSLNGDFNGSSIEPMLERNLNKQALRVLKEDMGIDASVPQAEQPRERQE 234
            Y DAMFD+S LSL GDFNG+SIEPMLERN+NKQA+ VLKE +          + ++   
Sbjct: 184 NYADAMFDLSALSLYGDFNGASIEPMLERNMNKQAMLVLKEKL----------EEKKDHR 233

Query: 235 LPSNTSLSSFFGIFKPETEIPAYDESNEADVTLVRGLKALYGATSDGYQLADECFAKAAK 294
           LPSNTSL+SFFGIF+PET    YDES EAD  L++GL  LY  TS+GY  ADE F KAA 
Sbjct: 234 LPSNTSLASFFGIFEPETSFENYDESVEADRLLLQGLTNLYKRTSEGYDTADESFTKAAA 293

Query: 295 LYREQLANN-NDAAFKEKAATALEYLGIFDFLKNDLDNSEKNLKEALALHPRVNTYIYLA 353
            Y+  L  +  +   K+KAA ALE++GIF FLKND  ++  +LK+AL  HPRVN+YIYLA
Sbjct: 294 AYKTLLEESPENEILKQKAAIALEHVGIFKFLKNDPLSAHDDLKQALEYHPRVNSYIYLA 353

Query: 354 LTMADRGQSEDYFSYFEKAIALDPNNAAVYYHRGQMYFITQNYEKAGEDFKKSKESDPKN 413
           L MAD+GQ+ +YF  F+KA+ LDPN AAVYYHRGQMYFITQ YE AG+DF K+KE +  N
Sbjct: 354 LIMADKGQATEYFENFDKALELDPNCAAVYYHRGQMYFITQQYENAGKDFDKAKECNENN 413

Query: 414 IFPYIQLACLAYRENKMAECEKLFEEARKTFPTAPEVPNFYAEILADKGDIDEAVKQYNI 473
           IFPYIQLACLAYRENK  +CE LF EAR+ FPTAPEVPNFYAEIL+DKGD+  A KQY I
Sbjct: 414 IFPYIQLACLAYRENKFEDCETLFSEARRKFPTAPEVPNFYAEILSDKGDLANAKKQYEI 473

Query: 474 AYRLESLQKQIHVGIAPLVGKATILARQPTPENFATISQLLEDACKADPRSEQAKVGLAQ 533
           A +LE     IHVGIAPLVGKAT+LAR+PT ENF   +Q  E+AC+ DPRSEQAK+GLAQ
Sbjct: 474 ARKLEDALDGIHVGIAPLVGKATLLAREPTVENFVEATQNFEEACEKDPRSEQAKIGLAQ 533

Query: 534 LRLQQEKVDEAIELFEEAAKMARTVDEKLQAITFAEATKVQKRIRADPVVSKKVEETLAA 593
           L+LQQE+VDEAI LFEEAA +AR+ DEKLQA TFAEATK+QK+IRADP++S K+EETLAA
Sbjct: 534 LKLQQEEVDEAITLFEEAADLARSFDEKLQATTFAEATKIQKKIRADPIISAKIEETLAA 593

Query: 594 YQAQNMF 600
           Y+AQ M 
Sbjct: 594 YRAQGMI 600

>YNL121C Chr14 complement(398684..400537) [1854 bp, 617 aa] {ON}
           TOM70Component of the TOM (translocase of outer
           membrane) complex responsible for recognition and
           initial import steps for all mitochondrially directed
           proteins; acts as a receptor for incoming precursor
           proteins
          Length = 617

 Score =  667 bits (1720), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 331/545 (60%), Positives = 418/545 (76%), Gaps = 14/545 (2%)

Query: 67  LTINGDEEKPDMAAMLASSEDQKKVYATALKDKGNALFKEKRFEDAIEFYNHAIKLHEDP 126
           ++ NG+   PD +     + ++K  YA ALKDKGN  F+ K+++DAI++YN A++L EDP
Sbjct: 76  VSSNGE---PDFSNKANFTAEEKDKYALALKDKGNQFFRNKKYDDAIKYYNWALELKEDP 132

Query: 127 VFHSNISACYVSLGDLDKVVESSTRALELKPDYSKALLRRASAYENMGRYQDAMFDISVL 186
           VF+SN+SACYVS+GDL KVVE ST+ALELKPDYSK LLRRASA E +G++ DAMFD+SVL
Sbjct: 133 VFYSNLSACYVSVGDLKKVVEMSTKALELKPDYSKVLLRRASANEGLGKFADAMFDLSVL 192

Query: 187 SLNGDFNGSSIEPMLERNLNKQALRVLKEDMG-IDASV---------PQAEQPRERQELP 236
           SLNGDFN +SIEPMLERNLNKQA+  LKE  G ID +          P  E+  +++ LP
Sbjct: 193 SLNGDFNDASIEPMLERNLNKQAMSKLKEKFGDIDTATATPTELSTQPAKERKDKQENLP 252

Query: 237 SNTSLSSFFGIFKPETEIPAYDESNEADVTLVRGLKALYGATSDGYQLADECFAKAAKLY 296
           S TS++SFFGIFKPE     YDESNEAD  L+ GL  LY  + + Y  ADE F KAA+L+
Sbjct: 253 SVTSMASFFGIFKPELTFANYDESNEADKELMNGLSNLYKRSPESYDKADESFTKAARLF 312

Query: 297 REQL-ANNNDAAFKEKAATALEYLGIFDFLKNDLDNSEKNLKEALALHPRVNTYIYLALT 355
            EQL  NN D   KEK A +LE+ GIF FLKND   + +++K+A+ L PRVN+YIY+AL 
Sbjct: 313 EEQLDKNNEDEKLKEKLAISLEHTGIFKFLKNDPLGAHEDIKKAIELFPRVNSYIYMALI 372

Query: 356 MADRGQSEDYFSYFEKAIALDPNNAAVYYHRGQMYFITQNYEKAGEDFKKSKESDPKNIF 415
           MADR  S +Y++YF+KA+ LD NN++VYYHRGQM FI QNY++AG+DF K+KE DP+NIF
Sbjct: 373 MADRNDSTEYYNYFDKALKLDSNNSSVYYHRGQMNFILQNYDQAGKDFDKAKELDPENIF 432

Query: 416 PYIQLACLAYRENKMAECEKLFEEARKTFPTAPEVPNFYAEILADKGDIDEAVKQYNIAY 475
           PYIQLACLAYRENK  +CE LF EA++ FP APEVPNF+AEIL DK D D+A+KQY++A 
Sbjct: 433 PYIQLACLAYRENKFDDCETLFSEAKRKFPEAPEVPNFFAEILTDKNDFDKALKQYDLAI 492

Query: 476 RLESLQKQIHVGIAPLVGKATILARQPTPENFATISQLLEDACKADPRSEQAKVGLAQLR 535
            LE+    I+VGIAPLVGKAT+L R PT ENF   + LLE A K DPRSEQAK+GLAQ++
Sbjct: 493 ELENKLDGIYVGIAPLVGKATLLTRNPTVENFIEATNLLEKASKLDPRSEQAKIGLAQMK 552

Query: 536 LQQEKVDEAIELFEEAAKMARTVDEKLQAITFAEATKVQKRIRADPVVSKKVEETLAAYQ 595
           LQQE +DEAI LFEE+A +ART++EKLQAITFAEA KVQ+RIR+DPV++KK++ETLA  +
Sbjct: 553 LQQEDIDEAITLFEESADLARTMEEKLQAITFAEAAKVQQRIRSDPVLAKKIQETLAKLR 612

Query: 596 AQNMF 600
            Q + 
Sbjct: 613 EQGLM 617

>Smik_14.207 Chr14 complement(378339..380192) [1854 bp, 617 aa] {ON}
           YNL121C (REAL)
          Length = 617

 Score =  659 bits (1701), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 329/545 (60%), Positives = 416/545 (76%), Gaps = 14/545 (2%)

Query: 67  LTINGDEEKPDMAAMLASSEDQKKVYATALKDKGNALFKEKRFEDAIEFYNHAIKLHEDP 126
           ++ NGD   PD +     + ++K  YA ALKDKGN  F+ K+++DAI++YN A++L +DP
Sbjct: 76  VSSNGD---PDFSNKANFTAEEKDRYALALKDKGNQFFRNKKYDDAIKYYNWALELKDDP 132

Query: 127 VFHSNISACYVSLGDLDKVVESSTRALELKPDYSKALLRRASAYENMGRYQDAMFDISVL 186
           VF+SN+SACYVS+GDL KVVE ST+ALELKPDYSK LLRRASA E +G + DAMFD+SVL
Sbjct: 133 VFYSNLSACYVSVGDLKKVVEMSTKALELKPDYSKVLLRRASANEGLGNFADAMFDLSVL 192

Query: 187 SLNGDFNGSSIEPMLERNLNKQALRVLKEDMG-IDASVP-----QAEQPRERQE----LP 236
           SLNGDFN +SIEPMLERNLNKQA+  LKE  G ID +         + P+E ++    LP
Sbjct: 193 SLNGDFNDASIEPMLERNLNKQAMSKLKEKFGDIDTATATPTELSTQAPKELKDKTENLP 252

Query: 237 SNTSLSSFFGIFKPETEIPAYDESNEADVTLVRGLKALYGATSDGYQLADECFAKAAKLY 296
           S TS++SFFGIFKPE     YDESNEAD  L+ GL  LY  + + Y  ADE F KA KL+
Sbjct: 253 SITSMASFFGIFKPELTFANYDESNEADKDLMNGLTNLYKRSPESYDKADESFTKAVKLF 312

Query: 297 REQL-ANNNDAAFKEKAATALEYLGIFDFLKNDLDNSEKNLKEALALHPRVNTYIYLALT 355
            EQL  NN D   KEK A +LE+ GIF FLKND   + +++K+A+ L PRVN+YIY+AL 
Sbjct: 313 DEQLDKNNEDEKSKEKLAISLEHTGIFKFLKNDPLGAHEDIKKAIELFPRVNSYIYMALI 372

Query: 356 MADRGQSEDYFSYFEKAIALDPNNAAVYYHRGQMYFITQNYEKAGEDFKKSKESDPKNIF 415
           MADR  S +Y++YF+KA+ LD NN++VYYHRGQM FI QNY++AG+DF K+KE DP+NIF
Sbjct: 373 MADRNDSTEYYNYFDKALKLDSNNSSVYYHRGQMNFILQNYDQAGKDFDKAKELDPENIF 432

Query: 416 PYIQLACLAYRENKMAECEKLFEEARKTFPTAPEVPNFYAEILADKGDIDEAVKQYNIAY 475
           PYIQLACLAYRENK  +CE LF EA++ FP APEVPNF+AEIL DK D ++A+KQY++A 
Sbjct: 433 PYIQLACLAYRENKFDDCETLFSEAKRKFPEAPEVPNFFAEILTDKNDFEKALKQYDLAI 492

Query: 476 RLESLQKQIHVGIAPLVGKATILARQPTPENFATISQLLEDACKADPRSEQAKVGLAQLR 535
            LE+    I+VGIAPLVGKAT+L R PT ENF   + LLE+A K DPRSEQAK+GLAQ++
Sbjct: 493 ELENKLDGIYVGIAPLVGKATLLTRNPTVENFIEATNLLEEASKLDPRSEQAKIGLAQMK 552

Query: 536 LQQEKVDEAIELFEEAAKMARTVDEKLQAITFAEATKVQKRIRADPVVSKKVEETLAAYQ 595
           LQQE +DEAI LFEE+A +ART++EKLQAITFAEA KVQKRIR+DP+++ K++ETLA  +
Sbjct: 553 LQQEDIDEAITLFEESADLARTMEEKLQAITFAEAAKVQKRIRSDPILAAKIQETLAKLR 612

Query: 596 AQNMF 600
            Q + 
Sbjct: 613 EQGLM 617

>Skud_14.211 Chr14 complement(388749..390602) [1854 bp, 617 aa] {ON}
           YNL121C (REAL)
          Length = 617

 Score =  657 bits (1696), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 326/545 (59%), Positives = 419/545 (76%), Gaps = 14/545 (2%)

Query: 67  LTINGDEEKPDMAAMLASSEDQKKVYATALKDKGNALFKEKRFEDAIEFYNHAIKLHEDP 126
           ++ NG+   PD +     + ++K  YA ALKDKGN  F+ K+++DAI++YN A++L EDP
Sbjct: 76  VSSNGE---PDFSKKANFTAEEKDKYALALKDKGNQYFRNKKYDDAIKYYNWALELKEDP 132

Query: 127 VFHSNISACYVSLGDLDKVVESSTRALELKPDYSKALLRRASAYENMGRYQDAMFDISVL 186
           VF+SN+SACYVS+GDL KVVE ST+ALE+KPDYSK LLRRASA E +G + DAMFD+SVL
Sbjct: 133 VFYSNLSACYVSVGDLKKVVEMSTKALEIKPDYSKVLLRRASANEGLGNFADAMFDLSVL 192

Query: 187 SLNGDFNGSSIEPMLERNLNKQALRVLKEDMG-IDASVP-----QAEQPRERQE----LP 236
           SLNGDFN +SIEPMLERNLNKQA+  LKE  G +DA+         + P+ER++    LP
Sbjct: 193 SLNGDFNDASIEPMLERNLNKQAMSRLKEKFGDVDAATATPTELSTQPPKERKDKQENLP 252

Query: 237 SNTSLSSFFGIFKPETEIPAYDESNEADVTLVRGLKALYGATSDGYQLADECFAKAAKLY 296
           S TS++SFFGIFKPE     YDE N+AD  L+ GL  LY  + + Y  ADE F KAAKL+
Sbjct: 253 SITSMASFFGIFKPELTFANYDEFNKADKELMDGLANLYKRSPESYDRADESFTKAAKLF 312

Query: 297 REQL-ANNNDAAFKEKAATALEYLGIFDFLKNDLDNSEKNLKEALALHPRVNTYIYLALT 355
            EQL  +N D   KEK A +LE+ GIF FLKND   + +++K+A+ L PRVN+YIY+AL 
Sbjct: 313 EEQLDKSNEDEKLKEKLAISLEHTGIFKFLKNDPLGAHEDIKKAIELFPRVNSYIYMALI 372

Query: 356 MADRGQSEDYFSYFEKAIALDPNNAAVYYHRGQMYFITQNYEKAGEDFKKSKESDPKNIF 415
           MADR  S +Y++YF+KA+ L+PNN++VYYHRGQM FI QNY++AG+DF K+KE DP+NIF
Sbjct: 373 MADRNDSTEYYNYFDKALKLNPNNSSVYYHRGQMNFILQNYDQAGKDFDKAKELDPENIF 432

Query: 416 PYIQLACLAYRENKMAECEKLFEEARKTFPTAPEVPNFYAEILADKGDIDEAVKQYNIAY 475
           PYIQLACLAYRENK  +CE LF EA++ FP APEVPNF+AEIL DK D D+A+KQY++A 
Sbjct: 433 PYIQLACLAYRENKFDDCETLFSEAKRKFPEAPEVPNFFAEILTDKNDFDKALKQYDLAI 492

Query: 476 RLESLQKQIHVGIAPLVGKATILARQPTPENFATISQLLEDACKADPRSEQAKVGLAQLR 535
            LE+   +I+VGIAPLVGKAT+L R PT ENF   + LLE A K DPRSEQAK+GLAQ++
Sbjct: 493 ELENKLDRIYVGIAPLVGKATLLTRNPTVENFVEATNLLEKASKLDPRSEQAKIGLAQMK 552

Query: 536 LQQEKVDEAIELFEEAAKMARTVDEKLQAITFAEATKVQKRIRADPVVSKKVEETLAAYQ 595
           LQQE +DEAI LFEE+A +ART++EKLQAITFAEA KVQ++IR+DP+++ K++ETLA  +
Sbjct: 553 LQQEDIDEAIMLFEESADLARTMEEKLQAITFAEAAKVQQKIRSDPILAAKIQETLAKLR 612

Query: 596 AQNMF 600
            Q + 
Sbjct: 613 EQGLM 617

>Kwal_33.14767 s33 complement(809994..811778) [1785 bp, 594 aa] {ON}
           YHR117W (TOM71) - 71-kDa component of the protein
           translocase of the outer membrane of mitochondria
           [contig 101] FULL
          Length = 594

 Score =  656 bits (1692), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 323/526 (61%), Positives = 414/526 (78%), Gaps = 11/526 (2%)

Query: 75  KPDMAAMLASSEDQKKVYATALKDKGNALFKEKRFEDAIEFYNHAIKLHEDPVFHSNISA 134
           +PD+  +   S ++K  +A  LKDKGN  FK K+FEDA+++Y+ AI++ EDPVF+SN SA
Sbjct: 78  EPDLGKVDELSAEEKDKFAMGLKDKGNEFFKNKQFEDALKYYSLAIEVKEDPVFYSNRSA 137

Query: 135 CYVSLGDLDKVVESSTRALELKPDYSKALLRRASAYENMGRYQDAMFDISVLSLNGDFNG 194
           CYVSLG  +KVVE +T AL+LKPDYSK LLRRASA E++G++ DAMFD+S +SL GDFNG
Sbjct: 138 CYVSLGQQEKVVEDTTAALKLKPDYSKCLLRRASANESLGKFADAMFDLSAVSLYGDFNG 197

Query: 195 SSIEPMLERNLNKQALRVLKEDMGIDASVPQAEQPRERQELPSNTSLSSFFGIFKPETEI 254
           SSIEP+LERN+NKQA+ VLKE +          + ++  +LPSNTSL+SFFGIF+PET  
Sbjct: 198 SSIEPLLERNMNKQAMLVLKEKL----------EKQQEYKLPSNTSLASFFGIFQPETSF 247

Query: 255 PAYDESNEADVTLVRGLKALYGATSDGYQLADECFAKAAKLYREQLANNN-DAAFKEKAA 313
             YDE++EAD  L+ GL  LY  TS GY+ AD  F+KA   Y+  L +N+ DA+ K+KAA
Sbjct: 248 ENYDENSEADKALLDGLTNLYKRTSGGYEAADAAFSKARDEYKTLLEHNSEDASLKQKAA 307

Query: 314 TALEYLGIFDFLKNDLDNSEKNLKEALALHPRVNTYIYLALTMADRGQSEDYFSYFEKAI 373
            ALE++GIF FLKND  ++ ++LK+A+   PR NTYIY+AL MAD+GQ+ +YF  FEKA+
Sbjct: 308 IALEHVGIFKFLKNDPISAHEDLKKAVEYFPRPNTYIYMALIMADKGQATEYFDNFEKAL 367

Query: 374 ALDPNNAAVYYHRGQMYFITQNYEKAGEDFKKSKESDPKNIFPYIQLACLAYRENKMAEC 433
            LDPN AAVYYHRGQM+FITQ +E+AG+DF+K+KE +  NIFPYIQLACL YRE K ++ 
Sbjct: 368 ELDPNCAAVYYHRGQMHFITQQFEQAGKDFEKAKELNESNIFPYIQLACLTYREGKFSDS 427

Query: 434 EKLFEEARKTFPTAPEVPNFYAEILADKGDIDEAVKQYNIAYRLESLQKQIHVGIAPLVG 493
           E LF EAR+ FPT+PEVPNFYAE L+DKGDI  A K+Y+IA +LES    IHVG++PL+G
Sbjct: 428 ETLFSEARRKFPTSPEVPNFYAETLSDKGDIAGAKKEYDIAAKLESALDGIHVGVSPLIG 487

Query: 494 KATILARQPTPENFATISQLLEDACKADPRSEQAKVGLAQLRLQQEKVDEAIELFEEAAK 553
           KAT+L+R+P+ ENF   ++L E AC+ DPRSEQAK+GLAQL+LQQE +DEAI LFEEAA 
Sbjct: 488 KATLLSREPSVENFIEATRLFEQACENDPRSEQAKIGLAQLKLQQEDIDEAIALFEEAAD 547

Query: 554 MARTVDEKLQAITFAEATKVQKRIRADPVVSKKVEETLAAYQAQNM 599
           +AR+ DEKLQA TFAEATK+QK+IRADP+VS K+EETLAAY+AQ M
Sbjct: 548 LARSFDEKLQATTFAEATKIQKKIRADPIVSAKIEETLAAYRAQGM 593

>Suva_14.219 Chr14 complement(395316..397169) [1854 bp, 617 aa] {ON}
           YNL121C (REAL)
          Length = 617

 Score =  655 bits (1691), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 327/536 (61%), Positives = 411/536 (76%), Gaps = 11/536 (2%)

Query: 76  PDMAAMLASSEDQKKVYATALKDKGNALFKEKRFEDAIEFYNHAIKLHEDPVFHSNISAC 135
           PD +     + ++K  YA ALKDKGN  F+ K+++DAI++YN A++L EDPVF+SN+SAC
Sbjct: 82  PDFSKKADFTAEEKDKYALALKDKGNQYFRNKKYDDAIKYYNWALELKEDPVFYSNLSAC 141

Query: 136 YVSLGDLDKVVESSTRALELKPDYSKALLRRASAYENMGRYQDAMFDISVLSLNGDFNGS 195
           YVS+GDL KVVE ST+ALELKPDYSK LLRRASA E +G + DAMFD+SVLSLNGDFN +
Sbjct: 142 YVSVGDLKKVVEMSTKALELKPDYSKVLLRRASANEGLGNFADAMFDLSVLSLNGDFNDA 201

Query: 196 SIEPMLERNLNKQALRVLKEDMG-IDASVP-----QAEQPRERQE----LPSNTSLSSFF 245
           SIEPMLERNLNKQA+  LKE  G IDA+         + P+ER++    LPS TS++SFF
Sbjct: 202 SIEPMLERNLNKQAMSRLKEKFGDIDAATATPTELSTQPPKERKDKQESLPSVTSMASFF 261

Query: 246 GIFKPETEIPAYDESNEADVTLVRGLKALYGATSDGYQLADECFAKAAKLYREQL-ANNN 304
           GIFKPE      DESNEAD  L+ GL  LY  + D Y  ADE F KA KL+ +QL  +N 
Sbjct: 262 GIFKPELTFANCDESNEADKELMNGLANLYKRSPDSYDRADESFTKAVKLFEDQLDKDNE 321

Query: 305 DAAFKEKAATALEYLGIFDFLKNDLDNSEKNLKEALALHPRVNTYIYLALTMADRGQSED 364
           D   KEK A +LE+ GIF FLKND   + +++ +A+ L PRVN+YIY+AL MADR  S +
Sbjct: 322 DEKVKEKLAISLEHTGIFKFLKNDPLGAHEDITKAIDLFPRVNSYIYMALIMADRNDSTE 381

Query: 365 YFSYFEKAIALDPNNAAVYYHRGQMYFITQNYEKAGEDFKKSKESDPKNIFPYIQLACLA 424
           Y++YF+KA+ LD NN++VYYHRGQM FI QNY++AG+DF K+KE DP+NIFPYIQLACLA
Sbjct: 382 YYNYFDKALKLDLNNSSVYYHRGQMNFILQNYDQAGKDFDKAKELDPENIFPYIQLACLA 441

Query: 425 YRENKMAECEKLFEEARKTFPTAPEVPNFYAEILADKGDIDEAVKQYNIAYRLESLQKQI 484
           YRENK  +CE LF EA++ FP APEVPNF+AEIL DK D D+A+KQY++A  LE+  + I
Sbjct: 442 YRENKFDDCETLFSEAKRKFPEAPEVPNFFAEILTDKNDFDKALKQYDLAIELENKLEGI 501

Query: 485 HVGIAPLVGKATILARQPTPENFATISQLLEDACKADPRSEQAKVGLAQLRLQQEKVDEA 544
           +VGIAPLVGKAT+L R PT ENF   + LLE A K DPRSEQAK+GLAQ++LQQE +DEA
Sbjct: 502 YVGIAPLVGKATLLTRNPTVENFIEATNLLEKASKLDPRSEQAKIGLAQMKLQQEDIDEA 561

Query: 545 IELFEEAAKMARTVDEKLQAITFAEATKVQKRIRADPVVSKKVEETLAAYQAQNMF 600
           I LFEE+A +ART++EKLQAITFAEA KVQ+RIR+DPV++ K++ETLA  + Q + 
Sbjct: 562 IALFEESADLARTMEEKLQAITFAEAAKVQQRIRSDPVLATKIQETLAKLREQGLM 617

>KNAG0H03530 Chr8 (657450..659294) [1845 bp, 614 aa] {ON} Anc_2.152
           YHR117W
          Length = 614

 Score =  654 bits (1687), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 332/552 (60%), Positives = 414/552 (75%), Gaps = 19/552 (3%)

Query: 57  SEPATSDKAY-LTINGDEEKPDMAAMLASSEDQKKVYATALKDKGNALFKEKRFEDAIEF 115
           +E AT    Y +T +G+   PD++ + + + +Q++ YA ALKDKGN LFKEK  E+AI++
Sbjct: 72  TELATETPVYPITASGE---PDLSQLDSYTPEQRETYALALKDKGNELFKEKAVEEAIKY 128

Query: 116 YNHAIKLHEDPVFHSNISACYVSLGDLDKVVESSTRALELKPDYSKALLRRASAYENMGR 175
           Y  A++  +DPVF++NISACYVSL D +KV+E+  +ALELKPDYSK LLRRA+ YENM  
Sbjct: 129 YQWALEFKKDPVFYANISACYVSLNDFEKVLENCNKALELKPDYSKVLLRRANTYENMEN 188

Query: 176 YQDAMFDISVLSLNGDFNGSSIEPMLERNLNKQALRVLKEDMGIDASVPQAEQPRERQEL 235
           + DAMFD+SVLSLN DF+G+SIEPMLERNLNKQA+++LKE +       +  Q +  Q L
Sbjct: 189 FADAMFDLSVLSLNNDFSGASIEPMLERNLNKQAMKMLKERL-------ENTQDKFEQPL 241

Query: 236 PSNTSLSSFFGIFKPETEIPAYDESNEADVTLVRGLKALYGATSDGYQLADECFAKAAKL 295
           PS+TS++SFFGIFKPETE   YDE+ EAD TL  GL  L+ AT  G+  AD CF +A   
Sbjct: 242 PSDTSMASFFGIFKPETEFKGYDETCEADRTLQTGLLELFAATHVGFVKADTCFNEAVNQ 301

Query: 296 YREQLANNNDAA-----FKEKAATALEYLGIFDFLKNDLDNSEKNLKEALALHPRVNTYI 350
           YRE  +  +D         EK A ALEY GIF FLKND+  ++  + EA+ L PRVN+YI
Sbjct: 302 YRELFSKASDEEKLAQNLNEKFAIALEYSGIFKFLKNDVIGAQAAVNEAIKLFPRVNSYI 361

Query: 351 YLALTMADRGQSEDYFSYFEKAIALDPNNAAVYYHRGQMYFITQNYEKAGEDFKKSKESD 410
           YLALT AD G+S +Y + F+KA+ L+PN++A YYHRGQ+YFITQ+Y+KA  DF K+KE D
Sbjct: 362 YLALTSADNGESSEYVTNFDKALELNPNSSATYYHRGQLYFITQDYQKAKADFLKAKELD 421

Query: 411 PKNIFPYIQLACLAYRENKMAECEKLFEEARKTFPTAPEVPNFYAEILADKGDIDEAVKQ 470
             NIF YIQLACL YRE  M EC+KLF+EAR+ FP APEVP FYAEILADKGD  +A KQ
Sbjct: 422 NDNIFAYIQLACLCYREGDMDECKKLFDEAREKFPVAPEVPTFYAEILADKGDFSDAAKQ 481

Query: 471 YNIAYRLE---SLQKQIHVGIAPLVGKATILARQPTPENFATISQLLEDACKADPRSEQA 527
           Y++A RLE   S +  I VG+APLVGKAT+LARQP+PENFA  + L E+ACK DPRSEQA
Sbjct: 482 YDMAKRLEEAISAKTGIRVGVAPLVGKATVLARQPSPENFAEATTLFEEACKRDPRSEQA 541

Query: 528 KVGLAQLRLQQEKVDEAIELFEEAAKMARTVDEKLQAITFAEATKVQKRIRADPVVSKKV 587
           KVGLAQL LQQE VD AI++FEEAA +ART DEKLQA+TFAEA KVQK+IRADP++  KV
Sbjct: 542 KVGLAQLLLQQEDVDSAIKMFEEAADLARTTDEKLQAVTFAEAAKVQKKIRADPIIRAKV 601

Query: 588 EETLAAYQAQNM 599
           EE LA Y+AQ M
Sbjct: 602 EEALAEYRAQGM 613

>KLTH0B05170g Chr2 (427608..429389) [1782 bp, 593 aa] {ON} similar
           to uniprot|P07213 Saccharomyces cerevisiae YNL121C TOM70
           Translocase of Outer Mitochondrial membrane 70 kDa
           mitochondrial specialized import receptor of the outer
           membrane
          Length = 593

 Score =  650 bits (1677), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 321/526 (61%), Positives = 409/526 (77%), Gaps = 11/526 (2%)

Query: 75  KPDMAAMLASSEDQKKVYATALKDKGNALFKEKRFEDAIEFYNHAIKLHEDPVFHSNISA 134
           +PD++ +   S++QK  YA  LKDKGN  FK K++++AI++Y+ AI++ EDPVF+SN SA
Sbjct: 77  EPDLSNLAELSDEQKDKYAMGLKDKGNEFFKNKKYDEAIQYYSWAIEVKEDPVFYSNRSA 136

Query: 135 CYVSLGDLDKVVESSTRALELKPDYSKALLRRASAYENMGRYQDAMFDISVLSLNGDFNG 194
           CYVSLG  +KVVE +T AL+LKPDYSK LLRRASA E++G + DAMFD+S +SL GDF+G
Sbjct: 137 CYVSLGQQEKVVEDTTAALKLKPDYSKCLLRRASANESLGNFADAMFDLSAVSLYGDFSG 196

Query: 195 SSIEPMLERNLNKQALRVLKEDMGIDASVPQAEQPRERQELPSNTSLSSFFGIFKPETEI 254
           +SIEP+LERN+NKQ++ VLKE +          + ++  +LPSNTSL+SFFGIF+PET  
Sbjct: 197 ASIEPLLERNMNKQSMLVLKEKL----------EKQQEYKLPSNTSLASFFGIFQPETTF 246

Query: 255 PAYDESNEADVTLVRGLKALYGATSDGYQLADECFAKAAKLYREQLANN-NDAAFKEKAA 313
             YD+++EAD  L+ GL  LY  T+DGY+ AD  FAKA   ++  L  N  DA  K KAA
Sbjct: 247 ENYDDNSEADKYLLEGLTNLYKRTADGYETADLSFAKARDAFKVLLEQNPEDADLKRKAA 306

Query: 314 TALEYLGIFDFLKNDLDNSEKNLKEALALHPRVNTYIYLALTMADRGQSEDYFSYFEKAI 373
            ALE++GIF FLKND  ++ ++LK+A+   PR NTYIY+AL MAD+GQ+ +YF  FEKA+
Sbjct: 307 IALEHVGIFKFLKNDPISAHEDLKKAVEYFPRPNTYIYMALIMADKGQATEYFDNFEKAL 366

Query: 374 ALDPNNAAVYYHRGQMYFITQNYEKAGEDFKKSKESDPKNIFPYIQLACLAYRENKMAEC 433
            LDP+ AAVYYHRGQMYFITQ +E+AG+DF+K+KE    NIFPYIQLACL YRE K  + 
Sbjct: 367 KLDPSCAAVYYHRGQMYFITQQFEQAGKDFEKAKELSESNIFPYIQLACLTYREGKFDDS 426

Query: 434 EKLFEEARKTFPTAPEVPNFYAEILADKGDIDEAVKQYNIAYRLESLQKQIHVGIAPLVG 493
           E LF EAR+ FPTAPEVPNFYAE L+DKGD+  A KQY+IA +LE     IHVG++PL+G
Sbjct: 427 ETLFSEARRKFPTAPEVPNFYAETLSDKGDLAGARKQYDIAAKLEDALDGIHVGVSPLIG 486

Query: 494 KATILARQPTPENFATISQLLEDACKADPRSEQAKVGLAQLRLQQEKVDEAIELFEEAAK 553
           KAT+L+R+P+ ENF   +QL E AC+ DPRSEQAK+GLAQL+LQQE +DEAI LFEEAA 
Sbjct: 487 KATLLSREPSVENFVEATQLFEKACQNDPRSEQAKIGLAQLKLQQEDIDEAIALFEEAAD 546

Query: 554 MARTVDEKLQAITFAEATKVQKRIRADPVVSKKVEETLAAYQAQNM 599
           +AR+ DEKLQA TFAEATK+QK+IRADPVVS K+EETLAAY+AQ M
Sbjct: 547 LARSFDEKLQATTFAEATKIQKKIRADPVVSAKIEETLAAYRAQGM 592

>TBLA0C05530 Chr3 complement(1338666..1340498) [1833 bp, 610 aa]
           {ON} Anc_2.152 YHR117W
          Length = 610

 Score =  638 bits (1646), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 313/544 (57%), Positives = 413/544 (75%), Gaps = 12/544 (2%)

Query: 59  PATSDKAYLTINGDEEKPDMAAMLASSEDQKKVYATALKDKGNALFKEKRFEDAIEFYNH 118
           PAT+D   +    D  +P++      +E++K+ Y+ ALKDKGN+LFK  +FE+AI++YN 
Sbjct: 77  PATTDGKPIYPVRDNGEPNLDNKDQFTEEEKEKYSIALKDKGNSLFKADKFEEAIKYYNW 136

Query: 119 AIKLHEDPVFHSNISACYVSLGDLDKVVESSTRALELKPDYSKALLRRASAYENMGRYQD 178
           AI+L E+P+F+SN+SACYVSL  L+++++   +ALELKPDYSK LLRRA+A E +  Y D
Sbjct: 137 AIELKENPIFYSNLSACYVSLNKLEEIIKYCNKALELKPDYSKVLLRRANANEKLENYAD 196

Query: 179 AMFDISVLSLNGDFNGSSIEPMLERNLNKQALRVLKEDMGIDASVPQAEQPRERQELPSN 238
           AMFD+SVLSLNGD+NG+SIEP+LERNLNKQA+ VLK+ +          +  +  +LPS+
Sbjct: 197 AMFDLSVLSLNGDYNGASIEPILERNLNKQAMSVLKDKL----------KNSKDDQLPSD 246

Query: 239 TSLSSFFGIFKPETEIPAYDESNEADVTLVRGLKALYGATSDGYQLADECFAKAAKLYRE 298
           TSLS+FFGIFKPE     YDE+N+AD  L+ GL  L+   S+ Y +AD+ F  A +LY +
Sbjct: 247 TSLSAFFGIFKPELSFENYDETNDADKELLNGLTHLFKRQSESYLIADKSFMNALELYIK 306

Query: 299 QLANN-NDAAFKEKAATALEYLGIFDFLKNDLDNSEKNLKEALALHPRVNTYIYLALTMA 357
           QL    +D   K KA+ A EY GIF+FLKNDL  + +N+ +++ L+PR+N+YIY AL +A
Sbjct: 307 QLEETPDDTDLKVKASIAYEYAGIFNFLKNDLSGATENIDKSIKLNPRINSYIYRALIIA 366

Query: 358 DRGQSEDYFSYFEKAIALDPNNAAVYYHRGQMYFITQNYEKAGEDFKKSKESDPKNIFPY 417
           D+G+S+DY  YF+KA+ LD  + AVYYHR Q+ F+TQ++ KA  DF+K+KE DP NIFPY
Sbjct: 367 DKGESQDYLDYFDKALKLDDKSCAVYYHRAQLNFVTQDFAKAAVDFEKAKECDPTNIFPY 426

Query: 418 IQLACLAYRENKMAECEKLFEEARKTFPTAPEVPNFYAEILADKGDIDEAVKQYNIAYRL 477
           IQLACL YRENK  +CE LF EA++ FPT PEVPNFYAE+L DKGD D A+K Y  A RL
Sbjct: 427 IQLACLTYRENKFDDCETLFSEAKRKFPTLPEVPNFYAEVLTDKGDFDNAMKNYETARRL 486

Query: 478 ESLQKQ-IHVGIAPLVGKATILARQPTPENFATISQLLEDACKADPRSEQAKVGLAQLRL 536
           E   K  IHVG+APL+GKAT+LAR+PT EN A   +LLE+A + DPRSEQAK+GLAQL+L
Sbjct: 487 EEASKDGIHVGVAPLIGKATLLAREPTLENLAAADKLLEEANRIDPRSEQAKIGLAQLKL 546

Query: 537 QQEKVDEAIELFEEAAKMARTVDEKLQAITFAEATKVQKRIRADPVVSKKVEETLAAYQA 596
           Q+E++DE+I LFEE+A +ART++EKLQA TFAEA KVQK IRADP++SKK+EETLAAY+A
Sbjct: 547 QKEEIDESIRLFEESADLARTMEEKLQATTFAEAAKVQKMIRADPIISKKIEETLAAYRA 606

Query: 597 QNMF 600
           QN F
Sbjct: 607 QNSF 610

>NCAS0B07010 Chr2 (1332351..1334228) [1878 bp, 625 aa] {ON}
           Anc_2.152
          Length = 625

 Score =  637 bits (1643), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 319/542 (58%), Positives = 407/542 (75%), Gaps = 6/542 (1%)

Query: 60  ATSDKAYLTINGDEEKPDMAAMLASSEDQKKVYATALKDKGNALFKEKRFEDAIEFYNHA 119
           AT+D        D   PDM  + +   +++K  +  LKDKGN  FK K + +AI++YN A
Sbjct: 89  ATADVLTSYPTNDSNDPDMIQITSLPLEEQKKISMQLKDKGNKYFKAKDYTNAIKYYNLA 148

Query: 120 IKLHEDPVFHSNISACYVSLGDLDKVVESSTRALELKPDYSKALLRRASAYENMGRYQDA 179
           + L++DP+F+SNISACYVSLG LDKV+ESST+ALEL P+YSKALLRRASA E++  Y DA
Sbjct: 149 LDLNKDPIFYSNISACYVSLGQLDKVIESSTKALELNPNYSKALLRRASANESLENYSDA 208

Query: 180 MFDISVLSLNGDFNGSSIEPMLERNLNKQALRVLKEDMGIDASVPQAEQPRERQELPSNT 239
           +FD+SVLSLNGD++G+SIEP+LERNLNKQA++VL E M            +E+Q LPS T
Sbjct: 209 LFDLSVLSLNGDYSGASIEPILERNLNKQAIKVLNERMN-----KMTGSNKEQQLLPSTT 263

Query: 240 SLSSFFGIFKPETEIPAYDESNEADVTLVRGLKALYGATSDGYQLADECFAKAAKLYREQ 299
           SL SFFGIF PE     Y+E+++ADV L+ GL  L+  T  GY  AD+ F KA+ L+ E+
Sbjct: 264 SLVSFFGIFDPELTFQNYNENDQADVELLTGLTNLFKRTDQGYLDADKNFVKASSLFMEE 323

Query: 300 LANN-NDAAFKEKAATALEYLGIFDFLKNDLDNSEKNLKEALALHPRVNTYIYLALTMAD 358
           LA N  D    EK A ALEY GIF FLKNDL  ++ ++++A+   PRVN+Y+YLAL  AD
Sbjct: 324 LAKNPKDKHLLEKTAIALEYNGIFRFLKNDLLGAQTDIEKAIGFFPRVNSYLYLALISAD 383

Query: 359 RGQSEDYFSYFEKAIALDPNNAAVYYHRGQMYFITQNYEKAGEDFKKSKESDPKNIFPYI 418
           +  S++Y  YF+KA+ L+P++ +VYYHRGQ+YFITQ+Y KA  +F+K+KE D  NIFPYI
Sbjct: 384 KSTSQEYSKYFDKALELNPDSLSVYYHRGQLYFITQDYPKAKVEFEKAKELDETNIFPYI 443

Query: 419 QLACLAYRENKMAECEKLFEEARKTFPTAPEVPNFYAEILADKGDIDEAVKQYNIAYRLE 478
           QLACLAYREN    C+KLF+E R+ FPT PEVP FYAEILADKGD   A+KQY+IA RLE
Sbjct: 444 QLACLAYRENDFDRCQKLFDETRQKFPTYPEVPTFYAEILADKGDFALAIKQYDIATRLE 503

Query: 479 SLQKQIHVGIAPLVGKATILARQPTPENFATISQLLEDACKADPRSEQAKVGLAQLRLQQ 538
             QK IHVGIAPLVGKAT+LARQP   N    +QL+E AC+ DPRSEQA VGLAQL+LQ 
Sbjct: 504 KAQKNIHVGIAPLVGKATVLARQPNLLNLKEATQLMEKACEIDPRSEQAIVGLAQLKLQN 563

Query: 539 EKVDEAIELFEEAAKMARTVDEKLQAITFAEATKVQKRIRADPVVSKKVEETLAAYQAQN 598
           E+VD AIELFE+AA ++RT+DEK+QA+TFAEA K+QKRIRADPV+S KV+E LA+Y++Q 
Sbjct: 564 EEVDLAIELFEKAADLSRTMDEKIQAMTFAEAAKIQKRIRADPVISAKVDEALASYRSQG 623

Query: 599 MF 600
           + 
Sbjct: 624 VI 625

>TPHA0I01510 Chr9 complement(342661..344472) [1812 bp, 603 aa] {ON}
           Anc_2.152 YHR117W
          Length = 603

 Score =  634 bits (1636), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 313/527 (59%), Positives = 409/527 (77%), Gaps = 11/527 (2%)

Query: 75  KPDMAAMLASSEDQKKVYATALKDKGNALFKEKRFEDAIEFYNHAIKLHEDPVFHSNISA 134
           +PD++   + S++ K+ YA ALKDKGN  FK++ FE+A+++YN+A+ L +DPVF+SNISA
Sbjct: 87  EPDLSGKDSFSDELKEKYAMALKDKGNDYFKKQDFENALKYYNYALTLKQDPVFYSNISA 146

Query: 135 CYVSLGDLDKVVESSTRALELKPDYSKALLRRASAYENMGRYQDAMFDISVLSLNGDFNG 194
           CYVSLG L+KVVESST AL+LK DYSKALLRRASAYE++  Y DAM D+SVLSLNGDFNG
Sbjct: 147 CYVSLGQLEKVVESSTEALKLKHDYSKALLRRASAYESLANYVDAMVDLSVLSLNGDFNG 206

Query: 195 SSIEPMLERNLNKQALRVLKEDMGIDASVPQAEQPRERQELPSNTSLSSFFGIFKPETEI 254
           +SIEPMLERNLNKQA++VLKE +             + Q LPSNTSL+SFFG+FKPE  +
Sbjct: 207 ASIEPMLERNLNKQAMQVLKEKIA----------ENKPQLLPSNTSLASFFGVFKPEVSL 256

Query: 255 PAYDESNEADVTLVRGLKALYGATSDGYQLADECFAKAAKLYREQLANNNDAA-FKEKAA 313
             ++E++E++  L+ GL  LY  T+DGY +ADE F KA KL  ++   N +    KEK A
Sbjct: 257 NNFNENSESEKELLNGLTNLYSRTNDGYLVADESFQKAVKLLEKEYEENKENNDIKEKYA 316

Query: 314 TALEYLGIFDFLKNDLDNSEKNLKEALALHPRVNTYIYLALTMADRGQSEDYFSYFEKAI 373
            ALEY GI  FLKND  ++  ++++A+ + PRVN+YIY +L +AD+G++E+    F+ AI
Sbjct: 317 IALEYNGILKFLKNDPLDAHNDIQKAIFIFPRVNSYIYNSLILADKGETEESIKNFDAAI 376

Query: 374 ALDPNNAAVYYHRGQMYFITQNYEKAGEDFKKSKESDPKNIFPYIQLACLAYRENKMAEC 433
            LD  NAA YYHRGQ+YF+TQ YEKAG DF K+KE D  NI PYIQLACLAY+ENK  +C
Sbjct: 377 NLDATNAATYYHRGQLYFLTQQYEKAGIDFDKAKELDESNILPYIQLACLAYKENKFNDC 436

Query: 434 EKLFEEARKTFPTAPEVPNFYAEILADKGDIDEAVKQYNIAYRLESLQKQIHVGIAPLVG 493
           E LF EAR+ FPTAPEVPNFYA++L ++ + D+A+KQY+I+ +LE   + IHVGIAP++G
Sbjct: 437 ETLFSEARRKFPTAPEVPNFYADVLLERNEFDKALKQYDISKKLEEAVEGIHVGIAPMIG 496

Query: 494 KATILARQPTPENFATISQLLEDACKADPRSEQAKVGLAQLRLQQEKVDEAIELFEEAAK 553
           KAT+LAR P  EN    ++L E+ACK DPRSEQAK+GLAQL+LQQE+VDEAI LFEEAA 
Sbjct: 497 KATLLARNPIVENLLESTELFEEACKLDPRSEQAKIGLAQLKLQQEEVDEAIALFEEAAF 556

Query: 554 MARTVDEKLQAITFAEATKVQKRIRADPVVSKKVEETLAAYQAQNMF 600
           +AR +DEKLQA TFAEA+KVQK++R+DPV+++K++ETLAAYQ Q + 
Sbjct: 557 LARNMDEKLQATTFAEASKVQKKVRSDPVINQKIQETLAAYQQQGLM 603

>Ecym_8204 Chr8 complement(419900..421693) [1794 bp, 597 aa] {ON}
           similar to Ashbya gossypii ABR131W
          Length = 597

 Score =  634 bits (1635), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 310/531 (58%), Positives = 409/531 (77%), Gaps = 14/531 (2%)

Query: 70  NGDEEKPDMAAMLASSEDQKKVYATALKDKGNALFKEKRFEDAIEFYNHAIKLHEDPVFH 129
           NG+   PD++ + + +E+QK+ Y+ A+KDKGN  FKEK++E+AI++Y+ A++L +DPVF+
Sbjct: 78  NGE---PDLSGVDSFTEEQKERYSMAMKDKGNECFKEKKYEEAIKYYSCALRLKKDPVFY 134

Query: 130 SNISACYVSLGDLDKVVESSTRALELKPDYSKALLRRASAYENMGRYQDAMFDISVLSLN 189
           SN SAC+V L  L+KVVE +T ALELKPDYSK LLRRA+A E++G + DAM D+S +SL 
Sbjct: 135 SNRSACWVPLNKLEKVVEDTTAALELKPDYSKCLLRRATANESLGNFADAMLDLSAVSLY 194

Query: 190 GDFNGSSIEPMLERNLNKQALRVLKEDMGIDASVPQAEQPRERQELPSNTSLSSFFGIFK 249
           G +N  SIEP+LERN+NKQA++VLK  +  D S         + +LPSNTSL+SFFGIF 
Sbjct: 195 GGYNSQSIEPVLERNMNKQAMQVLKRKLA-DGS---------KHQLPSNTSLASFFGIFP 244

Query: 250 PETEIPAYDESNEADVTLVRGLKALYGATSDGYQLADECFAKAAKLYR-EQLANNNDAAF 308
            ET    YDE +EAD  L++GL+ L    +  Y+++DE F KAA L      A++ D A 
Sbjct: 245 SETSFANYDEQSEADNFLLKGLRCLSERKTGSYEMSDEYFNKAADLLSLSHQADSEDPAL 304

Query: 309 KEKAATALEYLGIFDFLKNDLDNSEKNLKEALALHPRVNTYIYLALTMADRGQSEDYFSY 368
           + K A ALE++GIF FLKN+   + K L++A+ LHPR N+YIY+AL MAD+GQ+++Y  Y
Sbjct: 305 RMKLAIALEHVGIFKFLKNEPLEAYKLLQKAVDLHPRPNSYIYMALIMADKGQTDEYLQY 364

Query: 369 FEKAIALDPNNAAVYYHRGQMYFITQNYEKAGEDFKKSKESDPKNIFPYIQLACLAYREN 428
           F+KA+ L PN++AVYYHRGQMYF+TQ +EK+G+DF K+KE +P NIFPYIQLACLAYREN
Sbjct: 365 FDKALELAPNSSAVYYHRGQMYFVTQQFEKSGKDFDKAKECNPDNIFPYIQLACLAYREN 424

Query: 429 KMAECEKLFEEARKTFPTAPEVPNFYAEILADKGDIDEAVKQYNIAYRLESLQKQIHVGI 488
           K  +CE LF EAR+ FPTAPEVPNFYAEIL+DKGD++ A+K+Y  A +LE  Q+ IHVG+
Sbjct: 425 KFEDCETLFSEARRKFPTAPEVPNFYAEILSDKGDLESALKEYEFARKLEDAQEGIHVGV 484

Query: 489 APLVGKATILARQPTPENFATISQLLEDACKADPRSEQAKVGLAQLRLQQEKVDEAIELF 548
           APLVGKAT+LARQ    +FA  + L E+ACK DPRSEQAK+GLAQL+LQQE+VDEAI+LF
Sbjct: 485 APLVGKATVLARQSHSGDFAEATALFEEACKKDPRSEQAKIGLAQLKLQQEQVDEAIQLF 544

Query: 549 EEAAKMARTVDEKLQAITFAEATKVQKRIRADPVVSKKVEETLAAYQAQNM 599
           EEA  +AR  +EKLQA TFAEA K+QKRIRADP++S K++ETL AY+ Q +
Sbjct: 545 EEATDLARAFEEKLQATTFAEAAKIQKRIRADPIMSAKIQETLEAYRVQGV 595

>NCAS0G02480 Chr7 complement(440105..441895) [1791 bp, 596 aa] {ON}
           Anc_2.152
          Length = 596

 Score =  626 bits (1615), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 306/512 (59%), Positives = 393/512 (76%), Gaps = 10/512 (1%)

Query: 89  KKVYATALKDKGNALFKEKRFEDAIEFYNHAIKLHEDPVFHSNISACYVSLGDLDKVVES 148
           K+ +A ALK+KGNALFK+K FE+AI++Y  A+ L EDPV++SNISACY SL + +KV+E 
Sbjct: 91  KEEWAGALKEKGNALFKKKDFENAIKYYTFALSLKEDPVYYSNISACYSSLLNYEKVIEM 150

Query: 149 STRALELKPDYSKALLRRASAYENMGRYQDAMFDISVLSLNGDFNGSSIEPMLERNLNKQ 208
           +T+AL L+PDYSK L+RRA+AYE +G + DAMFD+SV SLN D + +SIEP+LERNLN+Q
Sbjct: 151 ATKALALRPDYSKVLVRRANAYEKLGNFGDAMFDLSVCSLNTDMSDASIEPILERNLNQQ 210

Query: 209 ALRVLKEDMGIDASVPQAEQPRERQELPSNTSLSSFFGIFKPETEIPAYDESNEADVTLV 268
           A+ VL   +G+           ++ +LPSNT+L+SFFGIFKPE     YD++ E D  L+
Sbjct: 211 AMFVLNTKLGV---------TDKKSQLPSNTALTSFFGIFKPELSFANYDDTCEGDKELL 261

Query: 269 RGLKALYGATSDGYQLADECFAKAAKLYREQLANN-NDAAFKEKAATALEYLGIFDFLKN 327
            GLK LY  T++GY+ AD  F KA + + +QL+   +D   KEK A ALE+ GIF FLKN
Sbjct: 262 NGLKNLYRCTAEGYETADLSFTKATEYFLKQLSETPDDETVKEKTAIALEHQGIFKFLKN 321

Query: 328 DLDNSEKNLKEALALHPRVNTYIYLALTMADRGQSEDYFSYFEKAIALDPNNAAVYYHRG 387
           +   + +++K+AL LHPR+N+YIY+AL +AD+G +++YF+ +EKA+ LD  NAA+YYHRG
Sbjct: 322 NPLEAHEDIKKALELHPRINSYIYMALILADKGDTDNYFANYEKAMKLDDKNAALYYHRG 381

Query: 388 QMYFITQNYEKAGEDFKKSKESDPKNIFPYIQLACLAYRENKMAECEKLFEEARKTFPTA 447
           QMYFITQ YEKAGEDF K+KE DP+NIFPYIQLACL+YRENK  +CE LF EAR+ FP +
Sbjct: 382 QMYFITQQYEKAGEDFDKAKELDPENIFPYIQLACLSYRENKFDDCETLFSEARRKFPNS 441

Query: 448 PEVPNFYAEILADKGDIDEAVKQYNIAYRLESLQKQIHVGIAPLVGKATILARQPTPENF 507
            EVPNFYAEILADKGD D A+K+Y  A  LE  Q  +HVGIAPLVGKAT+L R PT ENF
Sbjct: 442 SEVPNFYAEILADKGDFDAALKEYERAIELEKKQDAVHVGIAPLVGKATLLVRTPTVENF 501

Query: 508 ATISQLLEDACKADPRSEQAKVGLAQLRLQQEKVDEAIELFEEAAKMARTVDEKLQAITF 567
              + LLE+A K DPRSEQAK+ L QL+LQQE +DEAIELFE AA +ART +EKLQA TF
Sbjct: 502 VEATSLLEEAVKEDPRSEQAKISLGQLKLQQEDIDEAIELFESAATLARTFEEKLQATTF 561

Query: 568 AEATKVQKRIRADPVVSKKVEETLAAYQAQNM 599
           AEA K+QKRIRADP +S K++ET+AA +A + 
Sbjct: 562 AEAAKIQKRIRADPKMSAKIQETIAALRASDF 593

>KLLA0F24046g Chr6 (2240454..2242268) [1815 bp, 604 aa] {ON} similar
           to uniprot|P07213 Saccharomyces cerevisiae YNL121C TOM70
           Translocase of Outer Mitochondrial membrane 70 kDa
           mitochondrial specialized import receptor of the outer
           membrane
          Length = 604

 Score =  620 bits (1599), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 305/526 (57%), Positives = 399/526 (75%), Gaps = 9/526 (1%)

Query: 75  KPDMAAMLASSEDQKKVYATALKDKGNALFKEKRFEDAIEFYNHAIKLHEDPVFHSNISA 134
           +PD++     + +Q   YA ALKDKGN  FK K FE AIE+Y  AI L EDPVF+SN SA
Sbjct: 86  QPDLSKKDEFTPEQVDKYALALKDKGNEFFKAKDFEKAIEYYTLAISLKEDPVFYSNRSA 145

Query: 135 CYVSLGDLDKVVESSTRALELKPDYSKALLRRASAYENMGRYQDAMFDISVLSLNGDFNG 194
            YVS+ + +KVVE +T AL+LKPDYSK  LRRASAYEN+G++ DAMFD+S +SL G+++G
Sbjct: 146 AYVSINNFEKVVEDTTAALKLKPDYSKCWLRRASAYENLGQFSDAMFDLSAVSLLGEYSG 205

Query: 195 SSIEPMLERNLNKQALRVLKEDMGIDASVPQAEQPRERQELPSNTSLSSFFGIFKPETEI 254
            S+E +LERN+NKQA +VL E +         E   +   LPSNTSL+SFFGIF PET  
Sbjct: 206 QSVEQLLERNMNKQATKVLGEKL--------KENQGKESPLPSNTSLASFFGIFNPETSF 257

Query: 255 PAYDESNEADVTLVRGLKALYGATSDGYQLADECFAKAAKLYREQLANNND-AAFKEKAA 313
             YD  NEADV L +GL+ LY   +  Y+LADE F KAA+LY+++L ++ D  + K+KAA
Sbjct: 258 DDYDGENEADVELKKGLENLYKCQTGCYELADEEFTKAAELYKKELESSPDNESLKKKAA 317

Query: 314 TALEYLGIFDFLKNDLDNSEKNLKEALALHPRVNTYIYLALTMADRGQSEDYFSYFEKAI 373
            A E++GIF F KND   +  NL+E+L+L+PR +TYIY+AL MAD+G++  Y  YF+KA+
Sbjct: 318 IAFEHVGIFKFFKNDPITAHINLEESLSLNPRPSTYIYMALIMADKGEANQYKEYFDKAL 377

Query: 374 ALDPNNAAVYYHRGQMYFITQNYEKAGEDFKKSKESDPKNIFPYIQLACLAYRENKMAEC 433
            LDPN +AVYYHRGQM+F+ +N+++AG DF K+KE +P+NIF YIQ ACLA+R+++  +C
Sbjct: 378 ELDPNCSAVYYHRGQMHFVVENFKEAGADFDKAKELNPENIFAYIQCACLAFRDDRFDDC 437

Query: 434 EKLFEEARKTFPTAPEVPNFYAEILADKGDIDEAVKQYNIAYRLESLQKQIHVGIAPLVG 493
           E LF EAR+ FPTAPEVPNFYAEILA K  +D A+KQY+IA +LE     IHVGIAP++G
Sbjct: 438 ETLFSEARRKFPTAPEVPNFYAEILAAKNSLDAAIKQYDIAIKLEDALPGIHVGIAPMIG 497

Query: 494 KATILARQPTPENFATISQLLEDACKADPRSEQAKVGLAQLRLQQEKVDEAIELFEEAAK 553
           KAT L R PT ENF   S+L E+ACK DPRSEQAK+GLAQL+LQQE++D+AI+LFE+AA 
Sbjct: 498 KATALIRNPTVENFVEASELFEEACKIDPRSEQAKIGLAQLKLQQEEIDDAIQLFEDAAD 557

Query: 554 MARTVDEKLQAITFAEATKVQKRIRADPVVSKKVEETLAAYQAQNM 599
           ++R+ DEKLQA TFAEATKVQK+IRADP +  K++E +AAY+AQ +
Sbjct: 558 LSRSFDEKLQATTFAEATKVQKKIRADPFIKGKIDEAIAAYRAQGL 603

>ABR131W Chr2 (641631..643415) [1785 bp, 594 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YNL121C (TOM70) and
           YHR117W (TOM71)
          Length = 594

 Score =  618 bits (1594), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 305/531 (57%), Positives = 401/531 (75%), Gaps = 14/531 (2%)

Query: 70  NGDEEKPDMAAMLASSEDQKKVYATALKDKGNALFKEKRFEDAIEFYNHAIKLHEDPVFH 129
           NG+   PD++ M   +E+QK+ YA ALKDKGN  FK++R+E+AI+FY+ A+KL EDPVF+
Sbjct: 75  NGE---PDLSGMATFTEEQKEKYAMALKDKGNECFKDQRYEEAIKFYDCALKLKEDPVFY 131

Query: 130 SNISACYVSLGDLDKVVESSTRALELKPDYSKALLRRASAYENMGRYQDAMFDISVLSLN 189
           SN SACYV L  L+KVVE +T AL+LKPDYSK LLRRA+A E++G Y DAM D+S +SL 
Sbjct: 132 SNRSACYVPLNKLEKVVEDTTAALKLKPDYSKCLLRRATANESLGNYADAMLDLSAVSLY 191

Query: 190 GDFNGSSIEPMLERNLNKQALRVLKEDMGIDASVPQAEQPRERQELPSNTSLSSFFGIFK 249
           G ++  +IEP+LERN+NKQA++VLK+ +             E+ ELPSNTSL+SFF IF 
Sbjct: 192 GGYSSQTIEPVLERNMNKQAMQVLKQKLS----------GGEKHELPSNTSLASFFRIFP 241

Query: 250 PETEIPAYDESNEADVTLVRGLKALYGATSDGYQLADECFAKAA-KLYREQLANNNDAAF 308
            ET +  YDE++EAD  L++GL AL+   +  Y++ADE F  A  K      AN ++AA 
Sbjct: 242 SETSLENYDETSEADRILLKGLCALHARQAGSYEIADEAFTDAVEKFTAAHEANPDNAAL 301

Query: 309 KEKAATALEYLGIFDFLKNDLDNSEKNLKEALALHPRVNTYIYLALTMADRGQSEDYFSY 368
           K+K A ALE++GI  FLKN+   +   L++A+ L PR N+YIY+ L MAD+GQ+++Y   
Sbjct: 302 KQKLAIALEHVGILKFLKNEPLEAHNLLQKAIDLFPRPNSYIYMGLIMADKGQADEYAQN 361

Query: 369 FEKAIALDPNNAAVYYHRGQMYFITQNYEKAGEDFKKSKESDPKNIFPYIQLACLAYREN 428
           FEKA+ LDP ++A YYHR QM F+ Q +++AG+DF K+KE DP  ++PYIQLACLAYRE 
Sbjct: 362 FEKALELDPKSSAAYYHRAQMNFVIQQFDQAGKDFDKAKECDPSRVYPYIQLACLAYREK 421

Query: 429 KMAECEKLFEEARKTFPTAPEVPNFYAEILADKGDIDEAVKQYNIAYRLESLQKQIHVGI 488
           K  +CE LF EAR+ FPTAPEVPNFYAEIL+DKGD + A+K+Y+ A +LE  Q+ IHVG+
Sbjct: 422 KFDDCETLFSEARRRFPTAPEVPNFYAEILSDKGDFENALKEYDFARKLEDAQEGIHVGV 481

Query: 489 APLVGKATILARQPTPENFATISQLLEDACKADPRSEQAKVGLAQLRLQQEKVDEAIELF 548
           APLVGKA +LARQP+  NFA  ++L E AC+ DPRSEQAK+GLAQL+LQQE+VDEAI+LF
Sbjct: 482 APLVGKAALLARQPSASNFAEATKLFELACEKDPRSEQAKIGLAQLKLQQEEVDEAIKLF 541

Query: 549 EEAAKMARTVDEKLQAITFAEATKVQKRIRADPVVSKKVEETLAAYQAQNM 599
           E AA ++R  +EKLQA TFAEA K+QKRIRADPV+S K++ETL AY+AQ M
Sbjct: 542 EAAADLSRAFEEKLQATTFAEAAKIQKRIRADPVMSAKIQETLDAYRAQGM 592

>KAFR0F00720 Chr6 complement(141181..143007) [1827 bp, 608 aa] {ON}
           Anc_2.152 YHR117W
          Length = 608

 Score =  617 bits (1590), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 306/527 (58%), Positives = 391/527 (74%), Gaps = 11/527 (2%)

Query: 75  KPDMAAMLASSEDQKKVYATALKDKGNALFKEKRFEDAIEFYNHAIKLHEDPVFHSNISA 134
           +PD   +   + DQK  +A  LKDKGN  FKEK +E+A++FY+ A+ L +DPVF+SN+SA
Sbjct: 90  EPDFTGVDNLTADQKDKWAIELKDKGNEYFKEKDYENALKFYDFALILKKDPVFYSNMSA 149

Query: 135 CYVSLGDLDKVVESSTRALELKPDYSKALLRRASAYENMGRYQDAMFDISVLSLNGDFNG 194
           CYVSL +LDKV+E ST+ALELKPDYSKALLRRA+A E +  Y DAMFD+SVLSLN DFNG
Sbjct: 150 CYVSLNELDKVIEMSTKALELKPDYSKALLRRATANEQLENYSDAMFDLSVLSLNNDFNG 209

Query: 195 SSIEPMLERNLNKQALRVLKEDMGIDASVPQAEQP-RERQELPSNTSLSSFFGIFKPETE 253
           ++IEPMLERNLNKQA++VL +         +++ P +   ELPSNTS++SFF IF PE  
Sbjct: 210 ATIEPMLERNLNKQAIKVLDQ---------KSKNPSKNESELPSNTSMASFFSIFTPEIS 260

Query: 254 IPAYDESNEADVTLVRGLKALYGATSDGYQLADECFAKAAKLYREQLANNNDA-AFKEKA 312
             +YDE ++AD  L+ GLK LY A +  Y++A+  F K+ +LY+  L +  D     +K 
Sbjct: 261 FDSYDEESDADKELLNGLKELYSAKTGCYEIAESSFNKSMELYKILLESTEDKETISKKF 320

Query: 313 ATALEYLGIFDFLKNDLDNSEKNLKEALALHPRVNTYIYLALTMADRGQSEDYFSYFEKA 372
           A ALEY+GIF+FL+NDL  ++    ++++  PRVN+YIYLAL  AD+ + ++   YF++A
Sbjct: 321 AIALEYVGIFNFLRNDLVTAQDLFNQSISASPRVNSYIYLALISADKNEKDESNKYFDEA 380

Query: 373 IALDPNNAAVYYHRGQMYFITQNYEKAGEDFKKSKESDPKNIFPYIQLACLAYRENKMAE 432
           + LDPN + +YYHRGQ+ F+TQ+Y  A  DF K+KE D  NIFPYIQLACL+YRE    +
Sbjct: 381 LKLDPNCSPIYYHRGQLNFVTQDYVNAKNDFLKAKELDENNIFPYIQLACLSYREGDFED 440

Query: 433 CEKLFEEARKTFPTAPEVPNFYAEILADKGDIDEAVKQYNIAYRLESLQKQIHVGIAPLV 492
           C+  FE ARK FP APE+P F  EILADKGD+D A KQY    RLE+ QK IHVGIAPL+
Sbjct: 441 CQNQFELARKKFPVAPEIPTFLGEILADKGDLDLAAKQYEFGIRLENTQKSIHVGIAPLI 500

Query: 493 GKATILARQPTPENFATISQLLEDACKADPRSEQAKVGLAQLRLQQEKVDEAIELFEEAA 552
           GKAT LARQPTPENF+  S+LL+DA + DPRSEQA VGLAQL+LQ+E VD AIELFE+A+
Sbjct: 501 GKATALARQPTPENFSEASKLLQDAVEKDPRSEQAIVGLAQLKLQEEDVDTAIELFEKAS 560

Query: 553 KMARTVDEKLQAITFAEATKVQKRIRADPVVSKKVEETLAAYQAQNM 599
             +R++DEKLQA TFAEA KVQKRIRADPV+  KVEETLA Y AQ  
Sbjct: 561 DYSRSMDEKLQATTFAEAAKVQKRIRADPVIKAKVEETLAQYHAQGF 607

>Skud_8.178 Chr8 (316128..318044) [1917 bp, 638 aa] {ON} YHR117W
           (REAL)
          Length = 638

 Score =  610 bits (1573), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 303/538 (56%), Positives = 397/538 (73%), Gaps = 18/538 (3%)

Query: 75  KPDMAAMLASSEDQKKVYATALKDKGNALFKEKRFEDAIEFYNHAIKLH-EDPVFHSNIS 133
           +PDMA +      Q++ YA  LKDKGN  F  K F+DAI++Y HAI+L   DPVF+SN+S
Sbjct: 107 EPDMAQLRGLPLSQRQEYAVQLKDKGNHFFTSKNFDDAIKYYQHAIELDPNDPVFYSNMS 166

Query: 134 ACYVSLGDLDKVVESSTRALELKPDYSKALLRRASAYENMGRYQDAMFDISVLSLNGDFN 193
           ACY+S GDL+KVVE +T+ALE+KPD+SKALLRRASA E++G + DAMFD+SVLSLNGDF+
Sbjct: 167 ACYISTGDLNKVVEYTTKALEIKPDHSKALLRRASANESLGNFTDAMFDLSVLSLNGDFD 226

Query: 194 GSSIEPMLERNLNKQALRVLKEDMGIDASVPQAEQPRERQELPSNTSLSSFFGIFKPETE 253
           G+SIEPMLERNLNKQA++VL      +A++ +    R  + LPSNTSL+SFFGIF P+ E
Sbjct: 227 GASIEPMLERNLNKQAMKVL------NANLSKNSGDRGSEILPSNTSLASFFGIFDPDLE 280

Query: 254 IPAYDESNEADVT---LVRGLKALYGATSDGYQLADECFAKAAKLYREQL-ANNNDAAFK 309
           I      +  D     L+  L+ LY ATS+GY +A+  F KA   Y   L A+  D A +
Sbjct: 281 ISRVSSISPPDTAHDMLLEALQRLYSATSEGYLIANALFTKATDAYHSLLSASRVDGAIR 340

Query: 310 EKAATALEYLGIFDFLKNDLDNSEKNLKEALALHPRVNTYIYLALTMADRGQSEDYFSYF 369
             AA A  Y GIF FLKNDL +++  L+E++ LHP  N+YI++ALT+AD+  S+++FS+F
Sbjct: 341 GNAALAFCYKGIFQFLKNDLLDAQALLQESINLHPTPNSYIFMALTLADKENSQEFFSFF 400

Query: 370 EKAIALDPNNAAVYYHRGQMYFITQNYEKAGEDFKKSKESDPKNIFPYIQLACLAYRENK 429
           +KAI LDP  +  YYHRGQMYFI Q+Y  A  DF+K++  +P NI+PYIQLACL Y++ K
Sbjct: 401 QKAIDLDPEYSPTYYHRGQMYFILQDYVNAKMDFQKAQSLNPGNIYPYIQLACLLYKQGK 460

Query: 430 MAECEKLFEEARKTFPTAPEVPNFYAEILADKGDIDEAVKQYNIAYRLESLQKQIHVGIA 489
            +E EKLF E +  FPT PEVP F+AEIL DKGD + A+KQY+IA RL+ +Q++IHVGI 
Sbjct: 461 FSESEKLFNETKLKFPTLPEVPTFFAEILTDKGDYNTAIKQYDIAKRLQEVQRKIHVGIG 520

Query: 490 PLVGKATILARQPTP-------ENFATISQLLEDACKADPRSEQAKVGLAQLRLQQEKVD 542
           PL+GKATILARQ T        E F    +LL +AC  DPRSEQAK+GLAQL+LQ EK+D
Sbjct: 521 PLIGKATILARQSTQDPTQLDEEKFNMAIELLTEACDLDPRSEQAKIGLAQLKLQMEKID 580

Query: 543 EAIELFEEAAKMARTVDEKLQAITFAEATKVQKRIRADPVVSKKVEETLAAYQAQNMF 600
           +AIELF+++A +ART+DEKLQA TFAEA K+QKR+RADP++S K+E+TLA+Y+A  M 
Sbjct: 581 DAIELFQDSATLARTMDEKLQATTFAEAAKIQKRLRADPIISAKMEQTLASYRANGMI 638

>Suva_15.314 Chr15 (544646..546580) [1935 bp, 644 aa] {ON} YHR117W
           (REAL)
          Length = 644

 Score =  605 bits (1560), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 305/538 (56%), Positives = 392/538 (72%), Gaps = 18/538 (3%)

Query: 75  KPDMAAMLASSEDQKKVYATALKDKGNALFKEKRFEDAIEFYNHAIKLH-EDPVFHSNIS 133
           +PDM  +   S  Q++ +A  LKDKGN  F  K F DAI++Y +AI+L   DPVF+SNIS
Sbjct: 113 EPDMDRLRGLSAPQRQAFAVQLKDKGNHFFTAKSFGDAIKYYQYAIELDPNDPVFYSNIS 172

Query: 134 ACYVSLGDLDKVVESSTRALELKPDYSKALLRRASAYENMGRYQDAMFDISVLSLNGDFN 193
           ACY+S GDLDKVVE +T+ALE+KPD+SKALLRRASA E++G + DAMFD+SVLSLNGDF+
Sbjct: 173 ACYISTGDLDKVVEYTTKALEIKPDHSKALLRRASANESLGNFTDAMFDLSVLSLNGDFD 232

Query: 194 GSSIEPMLERNLNKQALRVLKEDMGIDASVPQAEQPRERQELPSNTSLSSFFGIFKPETE 253
           G+SIEPMLERNLNKQA++VL E      S+ +    +  Q LPSNTSL+SFFGIF P+ E
Sbjct: 233 GTSIEPMLERNLNKQAMKVLNE------SLLKNGDDKSSQILPSNTSLASFFGIFDPDLE 286

Query: 254 IPAYDES---NEADVTLVRGLKALYGATSDGYQLADECFAKAAKLYREQL-ANNNDAAFK 309
               +     + A  TL   L++LY ATS+GY +AD+   KA   Y   L AN  D   +
Sbjct: 287 TSRVNTGSLLDSASATLSEALQSLYSATSEGYLIADDLLTKATDEYHSLLRANKEDRVIR 346

Query: 310 EKAATALEYLGIFDFLKNDLDNSEKNLKEALALHPRVNTYIYLALTMADRGQSEDYFSYF 369
           E AA A  Y GIF FLKNDL +++  L+E++ LHP  N+Y+++ALT+AD+  S+++F +F
Sbjct: 347 ENAALAFCYAGIFQFLKNDLLDAQALLQESINLHPTPNSYVFMALTVADKENSQEFFKFF 406

Query: 370 EKAIALDPNNAAVYYHRGQMYFITQNYEKAGEDFKKSKESDPKNIFPYIQLACLAYRENK 429
           + AI LDP     YYHRGQMYFI Q+Y  A  DF+K++  +P N++PYIQLACL Y+++K
Sbjct: 407 QNAIDLDPEYPPTYYHRGQMYFILQDYINAKSDFQKAQSLNPGNVYPYIQLACLLYKQDK 466

Query: 430 MAECEKLFEEARKTFPTAPEVPNFYAEILADKGDIDEAVKQYNIAYRLESLQKQIHVGIA 489
            +E E LF EA+  FP  PEVP FYAEIL DKGD + A+KQY+IA RLE +QK+IHVGI 
Sbjct: 467 FSEAESLFNEAKLKFPILPEVPTFYAEILTDKGDFNPAIKQYDIAKRLEEVQKKIHVGIG 526

Query: 490 PLVGKATILARQ----PTP---ENFATISQLLEDACKADPRSEQAKVGLAQLRLQQEKVD 542
           PL+GKATILARQ    PT    E F    +LL  AC+ DPRSEQAK+GLAQL LQ EK+D
Sbjct: 527 PLIGKATILARQSSQDPTQLDEEKFNMAIELLTKACELDPRSEQAKIGLAQLELQMEKID 586

Query: 543 EAIELFEEAAKMARTVDEKLQAITFAEATKVQKRIRADPVVSKKVEETLAAYQAQNMF 600
            AI+LF+E+A +ART+DEKLQA TFAEA K+QKR+RADP++S K+E+TLA Y+AQ M 
Sbjct: 587 VAIKLFQESATLARTMDEKLQATTFAEAAKIQKRLRADPIISAKMEQTLANYRAQGMI 644

>NDAI0F02810 Chr6 (690977..692806) [1830 bp, 609 aa] {ON} Anc_2.152
           YHR117W
          Length = 609

 Score =  598 bits (1541), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 297/541 (54%), Positives = 400/541 (73%), Gaps = 14/541 (2%)

Query: 59  PATSDKAYLTINGDEEKPDMAAMLASSEDQKKVYATALKDKGNALFKEKRFEDAIEFYNH 118
           P T    YL  +  E  P+++ + + +E+ K  +A ALKDKGN LFK  +FEDAI++Y++
Sbjct: 78  PTTKKPIYLVDSNGE--PNLSDIDSLTEETKNEWAMALKDKGNELFKTSKFEDAIKYYHY 135

Query: 119 AIKLHEDPVFHSNISACYVSLGDLDKVVESSTRALELKPDYSKALLRRASAYENMGRYQD 178
           A+KL +DP+++SNISACY SL   +KV+E +T+AL+L+P +SK L+RRA AYE MG + D
Sbjct: 136 ALKLKDDPIYYSNISACYASLLQYEKVIEYATKALKLRPTFSKVLMRRALAYEAMGNFGD 195

Query: 179 AMFDISVLSLNGDFNGSSIEPMLERNLNKQALRVLKEDMGIDASVPQAEQPRERQELPSN 238
           AMFDIS  SLNGD N +SIEP+LER LNKQA  VLKE +  +          + Q LPS+
Sbjct: 196 AMFDISACSLNGDMNDASIEPILERILNKQAEFVLKEKISAN----------KEQNLPSS 245

Query: 239 TSLSSFFGIFKPETEIPAYDESNEADVTLVRGLKALYGATSDGYQLADECFAKAAKLYRE 298
           T L+SFF +FKPET    Y+ESNEAD  L+ GL  LY  + +G+Q+AD+ F KAA+L+++
Sbjct: 246 TPLASFFRVFKPETSFANYEESNEADRELMNGLTNLYKNSEEGFQIADKSFLKAAELFKD 305

Query: 299 QLANNND-AAFKEKAATALEYLGIFDFLKNDLDNSEKNLKEALALHPRVNTYIYLALTMA 357
           QL+ N D  A KEK A ALEY GI  ++KN+   +  ++K A+ LHPRVN+YIY +L  +
Sbjct: 306 QLSQNKDNEAIKEKTAIALEYSGILYYMKNETLKAHDSIKSAIELHPRVNSYIYQSLIGS 365

Query: 358 DRGQSEDYFSYFEKAIALDPNNAAVYYHRGQMYFITQNYEKAGEDFKKSKESDPKNIFPY 417
           D   + +Y   F+KA+ L+PNN A+YYHRGQ YFI Q YEKAG+DF K KE D  NIF Y
Sbjct: 366 DSTTTSEYLQNFDKALELEPNNPAIYYHRGQSYFIAQQYEKAGKDFDKVKELDENNIFAY 425

Query: 418 IQLACLAYRENKMAECEKLFEEARKTFPTAPEVPNFYAEILADKGDIDEAVKQYNIAYRL 477
           IQLACLAYRE+K  +CE LF EAR+ FPTAPEVPNF+AE+LAD+G+ ++A+K+++ A  L
Sbjct: 426 IQLACLAYRESKFDDCETLFSEARRKFPTAPEVPNFFAEVLADRGESEKAMKEFDKAIEL 485

Query: 478 ES-LQKQIHVGIAPLVGKATILARQPTPENFATISQLLEDACKADPRSEQAKVGLAQLRL 536
           E+   ++IHVGIAPL+GKAT+L  +PT ENF    QLL++AC  DPRSEQA++GLAQL+L
Sbjct: 486 EAKTPEEIHVGIAPLIGKATLLISKPTVENFVEGIQLLQEACDKDPRSEQARLGLAQLKL 545

Query: 537 QQEKVDEAIELFEEAAKMARTVDEKLQAITFAEATKVQKRIRADPVVSKKVEETLAAYQA 596
           QQE +DEAI+LFEEAA++A++ +EKLQA TFAEA K+QKRIRADP +  K+ +T+   ++
Sbjct: 546 QQEDIDEAIQLFEEAAELAKSYEEKLQATTFAEAAKIQKRIRADPAMDAKIRQTIEQMRS 605

Query: 597 Q 597
           Q
Sbjct: 606 Q 606

>YHR117W Chr8 (342349..344268) [1920 bp, 639 aa] {ON}
           TOM71Mitochondrial outer membrane protein with
           similarity to Tom70p; probable minor component of the
           TOM (translocase of outer membrane) complex responsible
           for recognition and import of mitochondrially directed
           proteins
          Length = 639

 Score =  598 bits (1543), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 297/538 (55%), Positives = 396/538 (73%), Gaps = 19/538 (3%)

Query: 75  KPDMAAMLASSEDQKKVYATALKDKGNALFKEKRFEDAIEFYNHAIKLH-EDPVFHSNIS 133
           +PD+A +   S  Q++ YA  LK++GN  F  K F +AI++Y +AI+L   +PVF+SNIS
Sbjct: 109 EPDIAQLKGLSPSQRQAYAVQLKNRGNHFFTAKNFNEAIKYYQYAIELDPNEPVFYSNIS 168

Query: 134 ACYVSLGDLDKVVESSTRALELKPDYSKALLRRASAYENMGRYQDAMFDISVLSLNGDFN 193
           ACY+S GDL+KV+E +T+ALE+KPD+SKALLRRASA E++G + DAMFD+SVLSLNGDF+
Sbjct: 169 ACYISTGDLEKVIEFTTKALEIKPDHSKALLRRASANESLGNFTDAMFDLSVLSLNGDFD 228

Query: 194 GSSIEPMLERNLNKQALRVLKEDMGIDASVPQAEQPRERQELPSNTSLSSFFGIFKPETE 253
           G+SIEPMLERNLNKQA++VL E++  D       + R  Q LPSNTSL+SFFGIF    E
Sbjct: 229 GASIEPMLERNLNKQAMKVLNENLSKD-------EGRGSQVLPSNTSLASFFGIFDSHLE 281

Query: 254 IPAYDESNEADVT---LVRGLKALYGATSDGYQLADECFAKAAKLYREQL-ANNNDAAFK 309
           + + + S+  D     L   L+ LY AT +GY +A++   K+  +Y   L AN  D   +
Sbjct: 282 VSSVNTSSNYDTAYALLSDALQRLYSATDEGYLVANDLLTKSTDMYHSLLSANTVDDPLR 341

Query: 310 EKAATALEYLGIFDFLKNDLDNSEKNLKEALALHPRVNTYIYLALTMADRGQSEDYFSYF 369
           E AA AL Y GIF FLKN+L +++  L+E++ LHP  N+YI+LALT+AD+  S+++F +F
Sbjct: 342 ENAALALCYTGIFHFLKNNLLDAQVLLQESINLHPTPNSYIFLALTLADKENSQEFFKFF 401

Query: 370 EKAIALDPNNAAVYYHRGQMYFITQNYEKAGEDFKKSKESDPKNIFPYIQLACLAYRENK 429
           +KA+ L+P     YYHRGQMYFI Q+Y+ A EDF+K++  +P+N++PYIQLACL Y++ K
Sbjct: 402 QKAVDLNPEYPPTYYHRGQMYFILQDYKNAKEDFQKAQSLNPENVYPYIQLACLLYKQGK 461

Query: 430 MAECEKLFEEARKTFPTAPEVPNFYAEILADKGDIDEAVKQYNIAYRLESLQKQIHVGIA 489
             E E  F E +  FPT PEVP F+AEIL D+GD D A+KQY+IA RLE +Q++IHVGI 
Sbjct: 462 FTESEAFFNETKLKFPTLPEVPTFFAEILTDRGDFDTAIKQYDIAKRLEEVQEKIHVGIG 521

Query: 490 PLVGKATILARQ----PTP---ENFATISQLLEDACKADPRSEQAKVGLAQLRLQQEKVD 542
           PL+GKATILARQ    PT    E F    +LL  AC+ DPRSEQAK+GLAQL+LQ EK+D
Sbjct: 522 PLIGKATILARQSSQDPTQLDEEKFNAAIKLLTKACELDPRSEQAKIGLAQLKLQMEKID 581

Query: 543 EAIELFEEAAKMARTVDEKLQAITFAEATKVQKRIRADPVVSKKVEETLAAYQAQNMF 600
           EAIELFE++A +ART+DEKLQA TFAEA K+QKR+RADP++S K+E TLA Y+A+ M 
Sbjct: 582 EAIELFEDSAILARTMDEKLQATTFAEAAKIQKRLRADPIISAKMELTLARYRAKGML 639

>Smik_8.195 Chr8 (318688..320595) [1908 bp, 635 aa] {ON} YHR117W
           (REAL)
          Length = 635

 Score =  598 bits (1541), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 302/536 (56%), Positives = 388/536 (72%), Gaps = 18/536 (3%)

Query: 75  KPDMAAMLASSEDQKKVYATALKDKGNALFKEKRFEDAIEFYNHAIKLH-EDPVFHSNIS 133
           +PD++ +   +  QK+ YA  LK+KGN  F  K F +AI++Y  AI+L   DPVF+SNIS
Sbjct: 106 EPDISQLKGLTLSQKQTYAVQLKNKGNHFFTTKNFTEAIKYYQCAIELDPNDPVFYSNIS 165

Query: 134 ACYVSLGDLDKVVESSTRALELKPDYSKALLRRASAYENMGRYQDAMFDISVLSLNGDFN 193
           ACY+S GDL+KV+E +T+ALE+KPD+SKALLRRASA E++G + DAMFD+SVLSLNGDF+
Sbjct: 166 ACYISTGDLNKVLEYTTKALEIKPDHSKALLRRASANESLGNFTDAMFDLSVLSLNGDFD 225

Query: 194 GSSIEPMLERNLNKQALRVLKEDMGIDASVPQAEQPRERQELPSNTSLSSFFGIFKPETE 253
           G+SIEPMLERNLNKQA++VL E++            R  Q LPSNTSL+SFFGIF P+ E
Sbjct: 226 GASIEPMLERNLNKQAMKVLNENLS-------KGDGRGSQLLPSNTSLTSFFGIFDPDLE 278

Query: 254 IPAYDESNEADVT---LVRGLKALYGATSDGYQLADECFAKAAKLYREQLANNNDAAFKE 310
           I   + S+  D     L   L+ LY AT++GY  AD+ F  A   Y   LA+  D   KE
Sbjct: 279 ISRVNNSSHFDTAYALLSDALQKLYSATNEGYLTADKLFTSATDAYHSLLASQVDGPLKE 338

Query: 311 KAATALEYLGIFDFLKNDLDNSEKNLKEALALHPRVNTYIYLALTMADRGQSEDYFSYFE 370
            AA A  Y GIF FLKN+L  ++  L+E++ LHP  N+YI+LALT+AD+  S+++F YF+
Sbjct: 339 NAALAFCYTGIFHFLKNNLLGAQALLQESINLHPTPNSYIFLALTLADKENSQEFFKYFQ 398

Query: 371 KAIALDPNNAAVYYHRGQMYFITQNYEKAGEDFKKSKESDPKNIFPYIQLACLAYRENKM 430
           KAI LD      YYHRGQMYFI Q+Y  A  DF+K++   P+NI+PYIQLACL Y++ K 
Sbjct: 399 KAIDLDSEYPPTYYHRGQMYFILQDYVNAKADFQKAQNLYPENIYPYIQLACLLYKQGKF 458

Query: 431 AECEKLFEEARKTFPTAPEVPNFYAEILADKGDIDEAVKQYNIAYRLESLQKQIHVGIAP 490
            E E LF E +  FPT PEVP F+AEIL DKGD   A+KQY+IA RLE +Q++IHVGI P
Sbjct: 459 TESEALFNETKLKFPTLPEVPAFFAEILTDKGDFSTAIKQYDIAKRLEEVQEKIHVGIGP 518

Query: 491 LVGKATILARQ----PTP---ENFATISQLLEDACKADPRSEQAKVGLAQLRLQQEKVDE 543
           L+GKATILARQ    PT    E F T   LL  AC+ DPRSEQAK+GLAQL+LQ EK+D+
Sbjct: 519 LIGKATILARQSSQDPTQLDEEKFNTAIALLTKACELDPRSEQAKIGLAQLKLQMEKIDD 578

Query: 544 AIELFEEAAKMARTVDEKLQAITFAEATKVQKRIRADPVVSKKVEETLAAYQAQNM 599
           AIELF+++A +ART+DEKLQA TFAEA K+QKR+RADP++S K+E TLA+Y+A+ M
Sbjct: 579 AIELFQDSAILARTMDEKLQATTFAEAAKIQKRLRADPIISAKMEMTLASYRAKGM 634

>CAGL0L04048g Chr12 (476407..478170) [1764 bp, 587 aa] {ON} similar
           to uniprot|P07213 Saccharomyces cerevisiae YNL121c TOM70
           or uniprot|P38825 Saccharomyces cerevisiae YHR117w TOM7
          Length = 587

 Score =  559 bits (1440), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 280/527 (53%), Positives = 371/527 (70%), Gaps = 13/527 (2%)

Query: 66  YLTINGDEEKPDMAAMLASSEDQKKVYATALKDKGNALFKEKRFEDAIEFYNHAIKLHED 125
           YL IN   ++PD+  M  +   +K  YA+ LK +GNA FK K +E+AI +Y  A++L  D
Sbjct: 62  YLMIN---DEPDIELMKLAETAEKNEYASELKKRGNAYFKVKDYENAINYYKFALQLKND 118

Query: 126 PVFHSNISACYVSLGDLDKVVESSTRALELKPDYSKALLRRASAYENMGRYQDAMFDISV 185
           PVF+SN++ACY+SL    + +E+ ++ALEL PDYSK LL+RA+ YEN+G++ DA+ D++ 
Sbjct: 119 PVFYSNMAACYISLEHNKEAIEACSKALELNPDYSKVLLKRAAVYENIGKFADALLDLTA 178

Query: 186 LSLNGDFNGSSIEPMLERNLNKQALRVLKEDMGIDASVPQAEQPRERQELPSNTSLSSFF 245
           +SLNGD+N ++I+P++ER LNKQA+  LK+ +         E   + + LPS TS+++FF
Sbjct: 179 VSLNGDYNDATIQPIVERVLNKQAMMALKDHL---------EASEKNKVLPSYTSMAAFF 229

Query: 246 GIFKPETEIPAYDESNEADVTLVRGLKALYGATSDGYQLADECFAKAAKLYREQLANN-N 304
           G+F  ET+IP +D + E+D  L   L  LY  T +GY   D  F KA +LY+ +L N+  
Sbjct: 230 GVFDAETDIPGHDATEESDKILSDALTHLYSQTKEGYDRCDSEFTKATELYKAKLENDRT 289

Query: 305 DAAFKEKAATALEYLGIFDFLKNDLDNSEKNLKEALALHPRVNTYIYLALTMADRGQSED 364
           ++   EKAA A E+  I  FLKND   + + + EA+ LHPR  +YIYL L MAD+G  E+
Sbjct: 290 NSVTNEKAAIAFEHTAILSFLKNDPLTARELVDEAIKLHPRPKSYIYLGLLMADKGLDEE 349

Query: 365 YFSYFEKAIALDPNNAAVYYHRGQMYFITQNYEKAGEDFKKSKESDPKNIFPYIQLACLA 424
           Y+S F+KAI LDPN AA+YYHRGQM FI Q YEKAGEDF K+KE DP NIFPYIQLAC++
Sbjct: 350 YYSNFQKAIDLDPNMAAIYYHRGQMNFIIQKYEKAGEDFDKAKECDPTNIFPYIQLACMS 409

Query: 425 YRENKMAECEKLFEEARKTFPTAPEVPNFYAEILADKGDIDEAVKQYNIAYRLESLQKQI 484
           YRE    +CE LF EAR+ FP APEVPNF+AEIL+DKG+I++A  +Y+ A  LES  + I
Sbjct: 410 YREGHFDDCETLFSEARRKFPDAPEVPNFFAEILSDKGEIEKAAAEYDKAIELESKSENI 469

Query: 485 HVGIAPLVGKATILARQPTPENFATISQLLEDACKADPRSEQAKVGLAQLRLQQEKVDEA 544
           HVGIAPLVGKAT L + PT ENF     L E A   DPRSE+AK+GLAQ +LQQE +D+A
Sbjct: 470 HVGIAPLVGKATTLLKYPTVENFIEADDLFEQANNEDPRSEKAKMGLAQCKLQQEDLDDA 529

Query: 545 IELFEEAAKMARTVDEKLQAITFAEATKVQKRIRADPVVSKKVEETL 591
           I LFEEAA + RT+DEKLQA TFAEATKVQ R+RAD  +  K  + L
Sbjct: 530 IRLFEEAAILCRTLDEKLQATTFAEATKVQMRVRADERLQAKTMKAL 576

>NDAI0B04340 Chr2 (1087851..1089845) [1995 bp, 664 aa] {ON}
           Anc_2.152 YHR117W
          Length = 664

 Score =  549 bits (1415), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 277/526 (52%), Positives = 382/526 (72%), Gaps = 15/526 (2%)

Query: 81  MLASSEDQKKVYATALKDKGNALFKEKRFEDAIEFYNHAIKLHEDPVFHSNISACYVSLG 140
           ++A++E+ K  +A  LK+KGN  FK K  E+AI++Y +A++L +DPVF+SNISACY ++ 
Sbjct: 146 LIANNENLKSKFAKELKNKGNQYFKSKDNENAIKYYEYALRLDQDPVFYSNISACYFAMN 205

Query: 141 DLDKVVESSTRALELKPDYSKALLRRASAYENMGRYQDAMFDISVLSLNGDFNGSSIEPM 200
            LDKV+ESS +ALELKPDYSKALLRRA+AYE +G  ++A++D S+LSL G+++G  +EP+
Sbjct: 206 QLDKVIESSNKALELKPDYSKALLRRANAYEALGNNKEALYDFSILSLFGEYSGQYLEPL 265

Query: 201 LERNLNKQALRVLKEDMGIDASVPQAEQPRERQELPSNTSLSSFFGIFKPETEIPAYDES 260
           L R L+K +  VL+  +          +  +   L S+++L SFFGIF PET I  Y+  
Sbjct: 266 LNRILDKVSTDVLRAKLD--------NKKTDNFILLSDSALVSFFGIFPPETTITNYNPD 317

Query: 261 NEADVTLVRGLKALYGATSDGYQLADECFAKAAKLYREQLA----NNNDAAFKEKAATAL 316
           +EAD  LV+GL+AL   TS+G+  AD+ F KA +L+ E+L     N+ ++   EK A AL
Sbjct: 318 DEADKELVQGLEALAKKTSEGFLDADKHFIKANELFMEKLLSSEDNDENSGLLEKVAIAL 377

Query: 317 EYLGIFDFLKNDLDNSEKNLKEALALHPRVNTYIYLALTMADRGQSE---DYFSYFEKAI 373
           EY G+F FLK DL  SE +L++A+ L+PR N+YIY+A+ +AD+   +   DYF YF+KA 
Sbjct: 378 EYSGVFKFLKFDLLGSETDLQKAIDLYPRPNSYIYMAMLVADKNNDKNDLDYFKYFDKAT 437

Query: 374 ALDPNNAAVYYHRGQMYFITQNYEKAGEDFKKSKESDPKNIFPYIQLACLAYRENKMAEC 433
            L+PN A  YYHRGQ+  + Q +++A   F K+KE D  N++PYIQLAC+AY  +   +C
Sbjct: 438 TLNPNFAPTYYHRGQLLLVNQKFDEAETFFLKAKELDDSNVYPYIQLACVAYYNSTFKKC 497

Query: 434 EKLFEEARKTFPTAPEVPNFYAEILADKGDIDEAVKQYNIAYRLESLQKQIHVGIAPLVG 493
           ++LF+EAR  FPT PEVP FYAEILADKG+++ A+KQY+IAYRLE+  K IHVGIAPL+G
Sbjct: 498 QELFDEARTKFPTLPEVPTFYAEILADKGELEAAMKQYDIAYRLETAYKYIHVGIAPLIG 557

Query: 494 KATILARQPTPENFATISQLLEDACKADPRSEQAKVGLAQLRLQQEKVDEAIELFEEAAK 553
           KA  LAR PT ENF T+++LLE AC+ DPRSEQAK+ LAQL+LQ E +D AI LFEE A 
Sbjct: 558 KAAALARIPTQENFDTMTELLEKACELDPRSEQAKISLAQLKLQTEDIDTAIALFEETAD 617

Query: 554 MARTVDEKLQAITFAEATKVQKRIRADPVVSKKVEETLAAYQAQNM 599
           +ART  +KLQA TFAEA K+QKRI+ +P+ + K+EETLA Y+A  +
Sbjct: 618 LARTYQDKLQATTFAEAAKIQKRIKENPIYAAKIEETLATYRADGI 663

>NCAS0G00810 Chr7 complement(138192..139946) [1755 bp, 584 aa] {ON}
           Anc_5.617
          Length = 584

 Score = 64.7 bits (156), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 43/129 (33%), Positives = 63/129 (48%), Gaps = 3/129 (2%)

Query: 93  ATALKDKGNALFKEKRFEDAIEFYNHAIKLHEDP--VFHSNISACYVSLGDLDKVVESST 150
           A  LK KGNA F  K F  AIE++  AI     P  V +SN SACY SL    + +  + 
Sbjct: 4   ADELKQKGNAAFASKDFTGAIEYFTEAIAASTTPNHVLYSNRSACYTSLKQFQEALNDAQ 63

Query: 151 RALELKPDYSKALLRRASAYENMGRYQDAMFDISVLSLNGDFNGSSIEPMLERNLNKQAL 210
           + +++ PD+SK   R  +A+  +G   DA  +    +L  D N  +    LE+    Q  
Sbjct: 64  QCVKINPDWSKGYNRMGAAHLGLGDLDDAESNYKK-ALELDSNNKAASEGLEQVHRVQES 122

Query: 211 RVLKEDMGI 219
           R  + D G+
Sbjct: 123 RKSRPDFGM 131

 Score = 45.8 bits (107), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 27/78 (34%), Positives = 42/78 (53%), Gaps = 7/78 (8%)

Query: 100 GNALFKEKRFEDAIEFYNHAIKLHEDPVFHSNISACYVSLGDLDKVVESSTRAL----EL 155
           GN L+K  +F++AI  YN A  LH+D  + +N SA     GD +  + +   A+    EL
Sbjct: 263 GNKLYKSHKFDEAIAEYNKAWDLHKDITYLNNRSAAEFEKGDFETAMNTLNEAVEQGREL 322

Query: 156 KPDY---SKALLRRASAY 170
           + DY   +K+  R  +AY
Sbjct: 323 RADYKLIAKSFARMGNAY 340

 Score = 34.3 bits (77), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 20/71 (28%), Positives = 37/71 (52%), Gaps = 1/71 (1%)

Query: 100 GNALFKEKRFEDAIEFYNHAIK-LHEDPVFHSNISACYVSLGDLDKVVESSTRALELKPD 158
           G   F +  + +A++ Y   IK   ED   +SN +A    L    + ++   +A+E  P+
Sbjct: 397 GKEYFTKSDWPNAVKAYTEMIKRAPEDARGYSNRAAALAKLMSFPEAIKDCEKAIEKDPN 456

Query: 159 YSKALLRRASA 169
           + +A LR+A+A
Sbjct: 457 FVRAYLRKATA 467

>Skud_15.192 Chr15 (340847..342616) [1770 bp, 589 aa] {ON} YOR027W
           (REAL)
          Length = 589

 Score = 61.6 bits (148), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 39/125 (31%), Positives = 62/125 (49%), Gaps = 3/125 (2%)

Query: 97  KDKGNALFKEKRFEDAIEFYNHAIKLHEDP--VFHSNISACYVSLGDLDKVVESSTRALE 154
           K +GNA F  K ++ AIE +  AI++ E P  V  SN SACY SL      +  +   ++
Sbjct: 9   KQQGNAAFTAKNYDGAIELFTKAIEVSETPSHVLFSNRSACYTSLKKFSDALNDANECVK 68

Query: 155 LKPDYSKALLRRASAYENMGRYQDAMFDISVLSLNGDFNGSSIEPMLERNLNKQALRVLK 214
           + P +SK   R  +A+  +G   +A  D    +L  D N  + +  LE+    Q  R  +
Sbjct: 69  INPSWSKGYNRLGAAHLGLGDLDEAESDYKK-ALELDANNKAAKDGLEQVHRTQQARQAQ 127

Query: 215 EDMGI 219
            D+G+
Sbjct: 128 PDLGL 132

 Score = 54.3 bits (129), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 33/96 (34%), Positives = 52/96 (54%), Gaps = 7/96 (7%)

Query: 86  EDQKKVYATALKDKGNALFKEKRFEDAIEFYNHAIKLHEDPVFHSNISACYVSLGDLDKV 145
           ED  K  A   K +GN  +K  +F++AIE YN A +LH+D  + +N +A     GD + V
Sbjct: 255 EDNSKAEADNEKAEGNKFYKAHQFDEAIEHYNRAWELHKDITYLNNRAAAEYEKGDYETV 314

Query: 146 VESSTRALE----LKPDY---SKALLRRASAYENMG 174
           + +   A+E    ++ DY   SK+  R  +AY  +G
Sbjct: 315 IATLNDAVEKGRDMRADYKVISKSFARIGNAYHKLG 350

 Score = 31.2 bits (69), Expect = 8.3,   Method: Compositional matrix adjust.
 Identities = 19/71 (26%), Positives = 35/71 (49%), Gaps = 1/71 (1%)

Query: 100 GNALFKEKRFEDAIEFYNHAIK-LHEDPVFHSNISACYVSLGDLDKVVESSTRALELKPD 158
           G   F +  + +A++ Y   IK   ED   +SN +A    L    + +    +A+E  P+
Sbjct: 403 GKEYFTKSDWPNAVKAYTEMIKRAPEDARGYSNRAAALAKLMSFPEAIADCNKAIEKDPN 462

Query: 159 YSKALLRRASA 169
           + +A +R A+A
Sbjct: 463 FVRAYIRMAAA 473

>SAKL0G07084g Chr7 (580004..581761) [1758 bp, 585 aa] {ON} highly
           similar to uniprot|P15705 Saccharomyces cerevisiae
           YOR027W STI1 Heat shock protein also induced by
           canavanine and entry into stationary phase
          Length = 585

 Score = 61.2 bits (147), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 32/85 (37%), Positives = 48/85 (56%), Gaps = 2/85 (2%)

Query: 97  KDKGNALFKEKRFEDAIEFYNHAIKLHEDP--VFHSNISACYVSLGDLDKVVESSTRALE 154
           K +GNA F  K FE AIE +  AI++ E P  V +SN SACY S    +K +E + + + 
Sbjct: 7   KQQGNAAFAAKDFEKAIELFTKAIEVSEKPNHVLYSNRSACYTSTKQFNKALEDAKQCVN 66

Query: 155 LKPDYSKALLRRASAYENMGRYQDA 179
           + P +SK   R  +A+  +G   +A
Sbjct: 67  INPAWSKGYNRVGAAHFGLGDLDEA 91

 Score = 49.7 bits (117), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 30/98 (30%), Positives = 55/98 (56%), Gaps = 7/98 (7%)

Query: 90  KVYATALKDKGNALFKEKRFEDAIEFYNHAIKLHEDPVFHSNISACYVSLGDLDKVVESS 149
           K  A A K +GN  +K ++F++AIE Y+ A +LH+D  + +N +A     G+ +  +++ 
Sbjct: 256 KAKADAEKAEGNKFYKARKFDEAIEHYSKAWELHKDITYLNNRAAAEYEKGEYETAIKTL 315

Query: 150 TRAL----ELKPDY---SKALLRRASAYENMGRYQDAM 180
           T A+    EL+ DY   SK+  R  ++Y  +   + A+
Sbjct: 316 TEAVEQGRELRADYKVISKSFARIGNSYHKLNELKKAI 353

 Score = 35.0 bits (79), Expect = 0.52,   Method: Compositional matrix adjust.
 Identities = 26/123 (21%), Positives = 47/123 (38%), Gaps = 27/123 (21%)

Query: 90  KVYATALKDKGNALFKEKRFEDAIEFYNHAIKLHEDPVFHSNISAC-------------- 135
           KV + +    GN+  K    + AIEFY  ++  H  P   + +  C              
Sbjct: 330 KVISKSFARIGNSYHKLNELKKAIEFYQKSLTEHRTPEILTKLRNCEKELKKQETEAYID 389

Query: 136 -------------YVSLGDLDKVVESSTRALELKPDYSKALLRRASAYENMGRYQDAMFD 182
                        Y + GD    V+S T  ++  P+ ++    RA+A   +  + +A+ D
Sbjct: 390 PEKAEEARLQGKEYFTKGDWPNAVKSYTEMIKRAPEDARGYSNRAAALSKLMSFPEAIKD 449

Query: 183 ISV 185
            +V
Sbjct: 450 CNV 452

 Score = 32.3 bits (72), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 36/128 (28%), Positives = 56/128 (43%), Gaps = 11/128 (8%)

Query: 383 YYHRGQMYFITQNYEKAGEDFKKSKE--SDPKNIFPYIQLACLAYRENKMAECEKLFEEA 440
           Y  +G   F  +++EKA E F K+ E    P ++    + AC  Y   K  +  K  E+A
Sbjct: 6   YKQQGNAAFAAKDFEKAIELFTKAIEVSEKPNHVLYSNRSAC--YTSTK--QFNKALEDA 61

Query: 441 RKTFPTAPEVPNFYAEILADK---GDIDEAVKQYNIAYRLESLQKQIHVGIAPLVGKATI 497
           ++     P     Y  + A     GD+DEA + Y  A  L+S  K    G+  +    T 
Sbjct: 62  KQCVNINPAWSKGYNRVGAAHFGLGDLDEAEQGYKKALELDSANKAAQDGLEQV--HKTQ 119

Query: 498 LARQPTPE 505
            +RQ  P+
Sbjct: 120 QSRQQQPD 127

>KLLA0A07062g Chr1 complement(636546..638291) [1746 bp, 581 aa] {ON}
           highly similar to uniprot|P15705 Saccharomyces
           cerevisiae YOR027W STI1 Heat shock protein also induced
           by canavanine and entry into stationary phase
          Length = 581

 Score = 60.1 bits (144), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 46/136 (33%), Positives = 70/136 (51%), Gaps = 12/136 (8%)

Query: 54  ATASEPATSDKAYLTINGDEE--KPDMAAMLASSEDQKKVYATALKDKGNALFKEKRFED 111
           AT SEP    KA        E  KP+   M     D  K  A A K +GN L+K+++F++
Sbjct: 217 ATKSEPKAEPKAEPKAEPKVETKKPEPEPMEV---DDDKSKAEAAKAEGNKLYKQRKFDE 273

Query: 112 AIEFYNHAIKLHEDPVFHSNISACYVSLGDLDKVVESSTRAL----ELKPDY---SKALL 164
           AIE YN A + H D  + +N +A     GD +  +E+ T+A+    EL+ DY   SK+  
Sbjct: 274 AIEKYNEAWETHNDITYLNNRAAAEYEKGDYEAAIETLTKAVEQGRELRADYKVISKSFA 333

Query: 165 RRASAYENMGRYQDAM 180
           R  ++Y  +G  + A+
Sbjct: 334 RMGNSYHKLGDLKKAI 349

 Score = 53.5 bits (127), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 29/89 (32%), Positives = 46/89 (51%), Gaps = 2/89 (2%)

Query: 93  ATALKDKGNALFKEKRFEDAIEFYNHAIKLHEDP--VFHSNISACYVSLGDLDKVVESST 150
           A   K +GN  F  K +  AIE +  AI++ E P  V  SN SACY S  D  K ++ + 
Sbjct: 3   ADQFKQEGNQAFASKDYAKAIELFTKAIEVSEQPNHVLFSNRSACYASNKDFVKALDDAN 62

Query: 151 RALELKPDYSKALLRRASAYENMGRYQDA 179
             +++ P ++K   R  +A+  +G   +A
Sbjct: 63  ECVKINPSWAKGYNRLGAAHYGLGDLDEA 91

>AEL224W Chr5 (207712..209454) [1743 bp, 580 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOR027W (STI1)
          Length = 580

 Score = 60.1 bits (144), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 30/80 (37%), Positives = 46/80 (57%), Gaps = 2/80 (2%)

Query: 97  KDKGNALFKEKRFEDAIEFYNHAIKLHEDP--VFHSNISACYVSLGDLDKVVESSTRALE 154
           K +GN+ F  K FE AIE +  AI++ E P  V +SN SACY S+    + +  +   + 
Sbjct: 8   KKEGNSAFAAKDFEKAIELFGKAIEVSEQPNHVLYSNRSACYASMRKFREALADAQECVR 67

Query: 155 LKPDYSKALLRRASAYENMG 174
           +KPD+SK   R  +A+  +G
Sbjct: 68  IKPDWSKGHNRLGAAHYGLG 87

 Score = 43.9 bits (102), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 26/81 (32%), Positives = 47/81 (58%), Gaps = 7/81 (8%)

Query: 97  KDKGNALFKEKRFEDAIEFYNHAIKLHEDPVFHSNISACYVSLGDLDKVVESSTRAL--- 153
           K KGN L+K+++F++AI  Y  A  LH+D  + +N +A     GD +  +++  +A+   
Sbjct: 258 KAKGNELYKKRQFDEAIANYEKAWDLHKDITYLNNRAAAEYEKGDYESAIKTLEKAVEEG 317

Query: 154 -ELKPDY---SKALLRRASAY 170
            EL+ DY   +K+  R  +A+
Sbjct: 318 RELRADYKVIAKSFARLGNAH 338

>Kwal_55.19935 s55 (182767..184548) [1782 bp, 593 aa] {ON} YOR027W
           (STI1) - Heat shock protein also induced by canavanine
           and entry into stationary phase [contig 159] FULL
          Length = 593

 Score = 59.3 bits (142), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 41/129 (31%), Positives = 63/129 (48%), Gaps = 3/129 (2%)

Query: 93  ATALKDKGNALFKEKRFEDAIEFYNHAIKLHEDP--VFHSNISACYVSLGDLDKVVESST 150
           A   K +GNA F  K FE A E ++ AI+  E P  V +SN SACY SL    + +E + 
Sbjct: 3   AEEFKKQGNAAFVAKDFEKAAELFSKAIESSETPNHVLYSNRSACYTSLKKFKEALEDAE 62

Query: 151 RALELKPDYSKALLRRASAYENMGRYQDAMFDISVLSLNGDFNGSSIEPMLERNLNKQAL 210
             +++ P +SK   R  +A   +G   DA  +    +L  D +  + +  LE+    Q  
Sbjct: 63  ECVKINPTWSKGYNRVGAAQYGLGNLDDAEKEYKK-ALEIDSSNKAAQEGLEQVQKTQNA 121

Query: 211 RVLKEDMGI 219
           R  + D+G 
Sbjct: 122 RQQQPDLGF 130

 Score = 54.7 bits (130), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 35/102 (34%), Positives = 55/102 (53%), Gaps = 7/102 (6%)

Query: 86  EDQKKVYATALKDKGNALFKEKRFEDAIEFYNHAIKLHEDPVFHSNISACYVSLGDLDKV 145
           E   K  A A K +GN  +K ++F++AIE YN A  LH D  + +N SA     GD ++ 
Sbjct: 260 EQDSKAKADAEKAEGNKYYKARKFDEAIEHYNKAWDLHRDVTYLNNRSAAEYEKGDYEQA 319

Query: 146 VESSTRAL----ELKPDY---SKALLRRASAYENMGRYQDAM 180
           +++ T A+    E++ DY   SK+  R  +AY  M   + A+
Sbjct: 320 IKTLTEAVDQGREMRADYKLISKSFARIGNAYLKMDDLKKAI 361

 Score = 35.0 bits (79), Expect = 0.55,   Method: Compositional matrix adjust.
 Identities = 35/125 (28%), Positives = 58/125 (46%), Gaps = 5/125 (4%)

Query: 383 YYHRGQMYFITQNYEKAGEDFKKSKESD--PKNIFPYIQLACLAYRENKMAECEKLFEEA 440
           +  +G   F+ +++EKA E F K+ ES   P ++    + AC    + K  E  +  EE 
Sbjct: 6   FKKQGNAAFVAKDFEKAAELFSKAIESSETPNHVLYSNRSACYTSLK-KFKEALEDAEEC 64

Query: 441 RKTFPTAPEVPNFYAEILADKGDIDEAVKQYNIAYRLESLQKQIHVGIAPLVGKATILAR 500
            K  PT  +  N         G++D+A K+Y  A  ++S  K    G+  +  + T  AR
Sbjct: 65  VKINPTWSKGYNRVGAAQYGLGNLDDAEKEYKKALEIDSSNKAAQEGLEQV--QKTQNAR 122

Query: 501 QPTPE 505
           Q  P+
Sbjct: 123 QQQPD 127

 Score = 31.6 bits (70), Expect = 7.5,   Method: Compositional matrix adjust.
 Identities = 26/106 (24%), Positives = 44/106 (41%), Gaps = 6/106 (5%)

Query: 99  KGNALFKEKRFEDAIEFYNHAIK-LHEDPVFHSNISACYVSLGDLDKVVESSTRALELKP 157
           +G   F +  +  A+  Y   IK   ED   +SN +A    L      ++    A+   P
Sbjct: 407 QGKEFFTKGDWPSAVSAYTEMIKRAPEDARGYSNRAAVLAKLMSFPDAIKDCDVAISKDP 466

Query: 158 DYSKALLRRASAYENMGRYQDAMFDISV-----LSLNGDFNGSSIE 198
           ++ +A +R+ASA   +  +  AM  +       L +N   N   IE
Sbjct: 467 NFVRAYIRKASAQIAVREFAPAMETLDAARAKDLEINKGANAREIE 512

>TBLA0E03300 Chr5 complement(827677..829425) [1749 bp, 582 aa] {ON}
           Anc_5.617 YOR027W
          Length = 582

 Score = 59.3 bits (142), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 32/85 (37%), Positives = 49/85 (57%), Gaps = 2/85 (2%)

Query: 97  KDKGNALFKEKRFEDAIEFYNHAIKLHEDP--VFHSNISACYVSLGDLDKVVESSTRALE 154
           KD+GNA F  K +++AIE +  AI++ E P  V +SN SACY S     K +E +   ++
Sbjct: 9   KDQGNAAFVAKNYDEAIEKFTKAIEVSETPNHVLYSNRSACYTSKKQFVKGLEDANECVK 68

Query: 155 LKPDYSKALLRRASAYENMGRYQDA 179
           + P +SK   R  +A+  MG   +A
Sbjct: 69  INPTWSKGYNRVGAAHFGMGDLDEA 93

 Score = 58.5 bits (140), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 43/134 (32%), Positives = 68/134 (50%), Gaps = 8/134 (5%)

Query: 54  ATASEPATSDKAYLTINGDEEKPDMAAMLASSEDQKKVYATALKDKGNALFKEKRFEDAI 113
           A  SEP    K   T    E  P+     ++ ED+ K+ A A K +GN L+K  +F++AI
Sbjct: 217 APKSEPVPEPKKE-TPKKSETVPEPKEEASTPEDESKIAADAEKAEGNKLYKAHKFDEAI 275

Query: 114 EFYNHAIKLHEDPVFHSNISACYVSLGDLDKVVESSTRAL----ELKPDY---SKALLRR 166
           E YN A +LH D  + +N SA     GD    +E+   A+    E++ DY   +K+  R 
Sbjct: 276 EHYNKAWELHNDITYLNNRSAAEFEKGDYQTAIETLHEAVEKGREMRADYKLVAKSFTRI 335

Query: 167 ASAYENMGRYQDAM 180
           A++Y  +   + A+
Sbjct: 336 ANSYMKLNDIKSAI 349

 Score = 38.9 bits (89), Expect = 0.038,   Method: Compositional matrix adjust.
 Identities = 34/125 (27%), Positives = 54/125 (43%), Gaps = 9/125 (7%)

Query: 383 YYHRGQMYFITQNYEKAGEDFKKSKE--SDPKNIFPYIQLACLAYRENKMAECEKLFEEA 440
           Y  +G   F+ +NY++A E F K+ E    P ++    + AC   ++    +  K  E+A
Sbjct: 8   YKDQGNAAFVAKNYDEAIEKFTKAIEVSETPNHVLYSNRSACYTSKK----QFVKGLEDA 63

Query: 441 RKTFPTAPEVPNFYAEILA---DKGDIDEAVKQYNIAYRLESLQKQIHVGIAPLVGKATI 497
            +     P     Y  + A     GD+DEA K Y  A  L+S  K  H G++ +      
Sbjct: 64  NECVKINPTWSKGYNRVGAAHFGMGDLDEAEKAYKKALELDSSNKAAHDGLSQVTRAQEA 123

Query: 498 LARQP 502
              QP
Sbjct: 124 RHSQP 128

>ZYRO0A05676g Chr1 (459999..461717) [1719 bp, 572 aa] {ON} highly
           similar to uniprot|P15705 Saccharomyces cerevisiae
           YOR027W STI1 Heat shock protein also induced by
           canavanine and entry into stationary phase
          Length = 572

 Score = 59.3 bits (142), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 39/105 (37%), Positives = 58/105 (55%), Gaps = 7/105 (6%)

Query: 73  EEKPDMAAMLASSEDQKKVYATALKDKGNALFKEKRFEDAIEFYNHAIKLHEDPVFHSNI 132
           E K +  AM    E   +V A A K +GN L+K ++FE+AIE YN A +LH+D  + +N 
Sbjct: 226 EPKQEPEAMEVDEEPNSRVAAEAEKAEGNKLYKARQFEEAIEHYNKAWELHKDITYLNNR 285

Query: 133 SACYVSLGDLDKVVESSTRAL----ELKPDY---SKALLRRASAY 170
           SA     GD D  +++   A+    EL+ DY   +K+  R  +AY
Sbjct: 286 SAAEFEKGDYDTAIKTLNDAVEQGRELRADYKTIAKSFARIGNAY 330

 Score = 47.8 bits (112), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 26/79 (32%), Positives = 43/79 (54%), Gaps = 2/79 (2%)

Query: 93  ATALKDKGNALFKEKRFEDAIEFYNHAIKLHEDP--VFHSNISACYVSLGDLDKVVESST 150
           A   K +GNA F  K +  AI+ +  AI++ E P  V +SN SACY S    ++ ++ + 
Sbjct: 3   ADEFKQQGNAAFLAKDYVKAIDLFTKAIEVSETPNHVLYSNRSACYASNKKFEEALKDAE 62

Query: 151 RALELKPDYSKALLRRASA 169
             +++ P +SK   R  +A
Sbjct: 63  ECVKISPSWSKGYNRVGAA 81

 Score = 32.3 bits (72), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 17/72 (23%), Positives = 37/72 (51%), Gaps = 1/72 (1%)

Query: 99  KGNALFKEKRFEDAIEFYNHAIK-LHEDPVFHSNISACYVSLGDLDKVVESSTRALELKP 157
           +G   F +  + +A++ Y   +K   +D    SN +A    L    + +E   +A+ + P
Sbjct: 386 QGKEFFTKGDWPNAVKAYTEMVKRAPQDARGFSNRAAALAKLMSFPEAIEDCNKAVSIDP 445

Query: 158 DYSKALLRRASA 169
           ++ +A +R+A+A
Sbjct: 446 NFVRAYIRKATA 457

>Suva_8.80 Chr8 (142691..144451) [1761 bp, 586 aa] {ON} YOR027W
           (REAL)
          Length = 586

 Score = 58.2 bits (139), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 35/96 (36%), Positives = 53/96 (55%), Gaps = 7/96 (7%)

Query: 86  EDQKKVYATALKDKGNALFKEKRFEDAIEFYNHAIKLHEDPVFHSNISACYVSLGDLDKV 145
           ED  KV A   K +GN  +K ++FE+AIE YN A +LH D  + +N +A     GD +  
Sbjct: 252 EDDSKVEADKEKAEGNKFYKARQFEEAIEHYNKAWELHRDITYLNNRAAAEYEKGDYETA 311

Query: 146 VESSTRAL----ELKPDY---SKALLRRASAYENMG 174
           + + T A+    E++ DY   SK+  R  +AY  +G
Sbjct: 312 IATLTDAVEQGREMRADYKVISKSFARIGNAYHKLG 347

 Score = 57.4 bits (137), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 30/85 (35%), Positives = 46/85 (54%), Gaps = 2/85 (2%)

Query: 97  KDKGNALFKEKRFEDAIEFYNHAIKLHEDP--VFHSNISACYVSLGDLDKVVESSTRALE 154
           K +GNA F  K +  AI+ +  AI++ E P  V +SN SACY SL      +  +T  ++
Sbjct: 9   KQQGNAAFTAKDYGKAIDLFTKAIEVSEAPNHVLYSNRSACYTSLKKFTDALNDATECVK 68

Query: 155 LKPDYSKALLRRASAYENMGRYQDA 179
           + P +SK   R  +A+  +G   DA
Sbjct: 69  INPSWSKGYNRLGAAHLGLGDLDDA 93

 Score = 33.5 bits (75), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 19/71 (26%), Positives = 36/71 (50%), Gaps = 1/71 (1%)

Query: 100 GNALFKEKRFEDAIEFYNHAIKLH-EDPVFHSNISACYVSLGDLDKVVESSTRALELKPD 158
           G   F +  + +A++ Y   IK   ED   +SN +A    L    + +    +A+E  P+
Sbjct: 400 GKEYFTKSDWPNAVKAYTEMIKRSPEDARGYSNRAAALAKLMSFPEAIADCNKAIEKDPN 459

Query: 159 YSKALLRRASA 169
           + +A +R+A+A
Sbjct: 460 FVRAYIRKATA 470

>CAGL0H08195g Chr8 complement(804418..806169) [1752 bp, 583 aa] {ON}
           highly similar to uniprot|P15705 Saccharomyces
           cerevisiae YOR027w STI1
          Length = 583

 Score = 58.2 bits (139), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 30/85 (35%), Positives = 49/85 (57%), Gaps = 2/85 (2%)

Query: 97  KDKGNALFKEKRFEDAIEFYNHAIKLHEDP--VFHSNISACYVSLGDLDKVVESSTRALE 154
           K +GNA F  K +E AI+ ++ AI++ E P  VF+SN SACY SL    + +  +   ++
Sbjct: 8   KQQGNAAFVAKDYEKAIDLFSKAIEVSETPNHVFYSNRSACYASLKKFPEALNDAEECVK 67

Query: 155 LKPDYSKALLRRASAYENMGRYQDA 179
           + P +SK   R  +A+  +G   +A
Sbjct: 68  INPTWSKGYNRLGAAHLGLGDLDEA 92

 Score = 39.3 bits (90), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 26/91 (28%), Positives = 45/91 (49%), Gaps = 13/91 (14%)

Query: 100 GNALFKEKRFEDAIEFYNHAIKLHEDPVFHSNISACYVSLGD-------LDKVVESSTRA 152
           GN  +K ++F++AI  Y+ A  LH+D  + +N SA     GD       LD+ VE   + 
Sbjct: 263 GNKAYKARQFDEAIAHYDAAWNLHQDITYLNNRSAAEFEKGDAETALKTLDEAVE---KG 319

Query: 153 LELKPDY---SKALLRRASAYENMGRYQDAM 180
            E++ DY   +K+  R  + +      + A+
Sbjct: 320 REMRTDYKLIAKSFARMGNVHHKTNNLKKAI 350

 Score = 35.0 bits (79), Expect = 0.53,   Method: Compositional matrix adjust.
 Identities = 37/125 (29%), Positives = 55/125 (44%), Gaps = 5/125 (4%)

Query: 383 YYHRGQMYFITQNYEKAGEDFKKSKE--SDPKNIFPYIQLACLAYRENKMAECEKLFEEA 440
           Y  +G   F+ ++YEKA + F K+ E    P ++F   + AC A  + K  E     EE 
Sbjct: 7   YKQQGNAAFVAKDYEKAIDLFSKAIEVSETPNHVFYSNRSACYASLK-KFPEALNDAEEC 65

Query: 441 RKTFPTAPEVPNFYAEILADKGDIDEAVKQYNIAYRLESLQKQIHVGIAPLVGKATILAR 500
            K  PT  +  N         GD+DEA   Y  A  L+   +    G+  +  K T  +R
Sbjct: 66  VKINPTWSKGYNRLGAAHLGLGDLDEAEGSYKKALELDGSNQAAKDGLDQV--KRTQESR 123

Query: 501 QPTPE 505
           Q  P+
Sbjct: 124 QGMPD 128

 Score = 34.3 bits (77), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 20/71 (28%), Positives = 37/71 (52%), Gaps = 1/71 (1%)

Query: 100 GNALFKEKRFEDAIEFYNHAIK-LHEDPVFHSNISACYVSLGDLDKVVESSTRALELKPD 158
           G   F +  + +A++ Y   IK   ED   +SN +A    L    + +E   +A+E  P+
Sbjct: 397 GKDYFTKGDWPNAVKAYTEMIKRAPEDARGYSNRAAALSKLMSFPEAIEDCNKAIEKDPN 456

Query: 159 YSKALLRRASA 169
           + +A +R+A+A
Sbjct: 457 FIRAYIRKATA 467

>TPHA0D02880 Chr4 (599288..601045) [1758 bp, 585 aa] {ON} Anc_5.617
           YOR027W
          Length = 585

 Score = 57.8 bits (138), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 43/131 (32%), Positives = 68/131 (51%), Gaps = 11/131 (8%)

Query: 60  ATSDKAYLTINGDEEKPDMAA----MLASSEDQKKVYATALKDKGNALFKEKRFEDAIEF 115
           AT +    T+   +EK  +AA    M     D +K  A A KD+GN L+K  +F++AIE 
Sbjct: 221 ATKETKTETVPESKEKEPVAANPENMEVDDADVQKKLADAEKDEGNKLYKAHKFDEAIEH 280

Query: 116 YNHAIKLHEDPVFHSNISACYVSLGDLDKVVESSTRAL----ELKPDY---SKALLRRAS 168
           Y+ A +LH D  + +N +A     GD +  +++   A+    EL+ DY   +KA  R  +
Sbjct: 281 YDKAWELHNDITYLNNKAAAQYEKGDYETTIKTLEDAIEKGRELRADYKIIAKAFTRMGN 340

Query: 169 AYENMGRYQDA 179
           AYE +   + A
Sbjct: 341 AYEKLNDLKKA 351

 Score = 54.3 bits (129), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 35/125 (28%), Positives = 60/125 (48%), Gaps = 3/125 (2%)

Query: 97  KDKGNALFKEKRFEDAIEFYNHAIKLHEDP--VFHSNISACYVSLGDLDKVVESSTRALE 154
           K +GN  F  K +E A++ ++ AI++  +P  V +SN SACY SL      +  +    +
Sbjct: 9   KQQGNTAFSAKEYEKAVDLFSKAIEVSPEPNHVLYSNRSACYTSLKKFTDALNDANECTK 68

Query: 155 LKPDYSKALLRRASAYENMGRYQDAMFDISVLSLNGDFNGSSIEPMLERNLNKQALRVLK 214
           + P +SK   R  +A+  +G   +A       +L  D +    +  LE+    Q  R  +
Sbjct: 69  INPTWSKGYNRVGAAHYGLGDLDEAEKSYKK-ALELDASNKVAQEGLEQVKRTQEARKAQ 127

Query: 215 EDMGI 219
            DMG+
Sbjct: 128 PDMGL 132

 Score = 38.9 bits (89), Expect = 0.039,   Method: Compositional matrix adjust.
 Identities = 28/102 (27%), Positives = 50/102 (49%), Gaps = 3/102 (2%)

Query: 99  KGNALFKEKRFEDAIEFYNHAI-KLHEDPVFHSNISACYVSLGDLDKVVESSTRALELKP 157
           +G   F + ++ DA++ Y   I +  +D   +SN +A    L    + +    +ALE  P
Sbjct: 398 QGKDFFNKGQWPDAVKAYTEMIARAPDDARAYSNRAAALSKLMSFPEAISDCEKALEKDP 457

Query: 158 DYSKALLRRASAYENMGRYQDAM--FDISVLSLNGDFNGSSI 197
           ++ KA +R+A+A   +  Y  A+   DI+        NGS+I
Sbjct: 458 NFVKAYIRKATAQIAIKEYSSALETLDIARSKDTELNNGSNI 499

 Score = 31.6 bits (70), Expect = 6.7,   Method: Compositional matrix adjust.
 Identities = 35/124 (28%), Positives = 50/124 (40%), Gaps = 3/124 (2%)

Query: 383 YYHRGQMYFITQNYEKAGEDFKKSKESDPK-NIFPYIQLACLAYRENKMAECEKLFEEAR 441
           Y  +G   F  + YEKA + F K+ E  P+ N   Y   +       K  +      E  
Sbjct: 8   YKQQGNTAFSAKEYEKAVDLFSKAIEVSPEPNHVLYSNRSACYTSLKKFTDALNDANECT 67

Query: 442 KTFPTAPEVPNFYAEILADKGDIDEAVKQYNIAYRLESLQKQIHVGIAPLVGKATILARQ 501
           K  PT  +  N         GD+DEA K Y  A  L++  K    G+  +  K T  AR+
Sbjct: 68  KINPTWSKGYNRVGAAHYGLGDLDEAEKSYKKALELDASNKVAQEGLEQV--KRTQEARK 125

Query: 502 PTPE 505
             P+
Sbjct: 126 AQPD 129

>Kpol_1032.8 s1032 complement(15762..16793) [1032 bp, 343 aa] {ON}
           complement(15762..16793) [1032 nt, 344 aa]
          Length = 343

 Score = 56.6 bits (135), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 51/164 (31%), Positives = 84/164 (51%), Gaps = 8/164 (4%)

Query: 85  SEDQKKVYATALKDKGNALFKEKRFEDAIEFYNHAIKLH-EDPVFHSNISACYVSLGDLD 143
           SED+KK  A ALK +GN     K ++ AI+ Y+ AI+++  +P ++SN +A Y  + D  
Sbjct: 91  SEDKKK-EAEALKLEGNKQMSLKNYKSAIDKYSKAIEIYPSNPFYYSNRAAAYQMIEDFT 149

Query: 144 KVVESSTRALELKPDYSKALLRRASAYENMGRYQDAMFDI-SVLSLNGDFNGSSIEPMLE 202
             V  +  A++L P YSKA  R  +A    G  +DA+     VL L GD    S E M  
Sbjct: 150 NAVLDANTAIKLDPTYSKAYSRLGAAKLAEGNNEDAVHAFKKVLELEGD---KSTEVM-- 204

Query: 203 RNLNKQALRVLKEDMGIDASVPQAEQPRERQELPSNTSLSSFFG 246
           +N  + A ++++  + ++ +VP    P         T +++  G
Sbjct: 205 KNDYENAKKLVQTFVTLNKNVPDPSGPPPLNTTDVLTDIATVLG 248

>YOR027W Chr15 (381053..382822) [1770 bp, 589 aa] {ON}  STI1Hsp90
           cochaperone, interacts with the Ssa group of the
           cytosolic Hsp70 chaperones and activates Ssa1p ATPase
           activity; interacts with Hsp90 chaperones and inhibits
           their ATPase activity; homolog of mammalian Hop
          Length = 589

 Score = 57.0 bits (136), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 36/125 (28%), Positives = 63/125 (50%), Gaps = 3/125 (2%)

Query: 97  KDKGNALFKEKRFEDAIEFYNHAIKLHEDP--VFHSNISACYVSLGDLDKVVESSTRALE 154
           K +GNA F  K ++ AIE +  AI++ E P  V +SN SACY SL      +  +   ++
Sbjct: 9   KQQGNAAFTAKDYDKAIELFTKAIEVSETPNHVLYSNRSACYTSLKKFSDALNDANECVK 68

Query: 155 LKPDYSKALLRRASAYENMGRYQDAMFDISVLSLNGDFNGSSIEPMLERNLNKQALRVLK 214
           + P +SK   R  +A+  +G   +A  +    +L  D +  + +  L++    Q  R  +
Sbjct: 69  INPSWSKGYNRLGAAHLGLGDLDEAESNYKK-ALELDASNKAAKEGLDQVHRTQQARQAQ 127

Query: 215 EDMGI 219
            D+G+
Sbjct: 128 PDLGL 132

 Score = 53.1 bits (126), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 31/96 (32%), Positives = 53/96 (55%), Gaps = 7/96 (7%)

Query: 86  EDQKKVYATALKDKGNALFKEKRFEDAIEFYNHAIKLHEDPVFHSNISACYVSLGDLDKV 145
           ED  K+ A   K +GN  +K ++F++AIE YN A +LH+D  + +N +A     G+ +  
Sbjct: 255 EDDSKIEADKEKAEGNKFYKARQFDEAIEHYNKAWELHKDITYLNNRAAAEYEKGEYETA 314

Query: 146 VESSTRAL----ELKPDY---SKALLRRASAYENMG 174
           + +   A+    E++ DY   SK+  R  +AY  +G
Sbjct: 315 ISTLNDAVEQGREMRADYKVISKSFARIGNAYHKLG 350

 Score = 33.5 bits (75), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 21/82 (25%), Positives = 40/82 (48%), Gaps = 1/82 (1%)

Query: 100 GNALFKEKRFEDAIEFYNHAIK-LHEDPVFHSNISACYVSLGDLDKVVESSTRALELKPD 158
           G   F +  + +A++ Y   IK   ED   +SN +A    L    + +    +A+E  P+
Sbjct: 403 GKEYFTKSDWPNAVKAYTEMIKRAPEDARGYSNRAAALAKLMSFPEAIADCNKAIEKDPN 462

Query: 159 YSKALLRRASAYENMGRYQDAM 180
           + +A +R+A+A   +  Y  A+
Sbjct: 463 FVRAYIRKATAQIAVKEYASAL 484

>Ecym_5582 Chr5 complement(1195544..1197298) [1755 bp, 584 aa] {ON}
           similar to Ashbya gossypii AEL224W
          Length = 584

 Score = 56.2 bits (134), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 30/85 (35%), Positives = 49/85 (57%), Gaps = 2/85 (2%)

Query: 97  KDKGNALFKEKRFEDAIEFYNHAIKLHEDP--VFHSNISACYVSLGDLDKVVESSTRALE 154
           K +GNA F  K F+ A+E + +AI+  E+P  V +SN S  Y SL   D+ +  +T  ++
Sbjct: 8   KKEGNAAFVAKDFKRAVELFTNAIQESEEPNHVLYSNRSGAYASLKKFDEALSDATECVK 67

Query: 155 LKPDYSKALLRRASAYENMGRYQDA 179
           +K D+SK   R  +A+  +G   +A
Sbjct: 68  IKADWSKGHNRLGAAHFGLGNLDEA 92

 Score = 41.6 bits (96), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 25/81 (30%), Positives = 45/81 (55%), Gaps = 7/81 (8%)

Query: 97  KDKGNALFKEKRFEDAIEFYNHAIKLHEDPVFHSNISACYVSLGDLDKVVESSTRAL--- 153
           K +GN L+K+++F++AI  Y  A  L +D  + +N +A     GD +  +++   A+   
Sbjct: 262 KAEGNQLYKQRKFDEAIAKYEEAWNLQKDITYLNNRAAAEYEKGDYNSAIKTLNEAVEQG 321

Query: 154 -ELKPDY---SKALLRRASAY 170
            EL+ DY   +K+  R  +AY
Sbjct: 322 RELRADYKVIAKSFARLGNAY 342

 Score = 32.3 bits (72), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 25/101 (24%), Positives = 47/101 (46%), Gaps = 3/101 (2%)

Query: 100 GNALFKEKRFEDAIEFYNHAI-KLHEDPVFHSNISACYVSLGDLDKVVESSTRALELKPD 158
           G   F +  +  A++ Y+  I +   D   +SN +A    L      ++   +A+E+ P 
Sbjct: 399 GKEYFTKGDWPSAVKAYSEMIMRAPHDARGYSNRAAALSKLMSFPDAIKDCDKAIEIDPS 458

Query: 159 YSKALLRRASAYENMGRYQDAM--FDISVLSLNGDFNGSSI 197
           + +A +R+A+A   +  Y  A+   D++        NGSSI
Sbjct: 459 FVRAYIRKATAQIAVQEYSAAIETLDVARTKDAEVNNGSSI 499

>KLTH0E02178g Chr5 (194914..196695) [1782 bp, 593 aa] {ON} highly
           similar to uniprot|P15705 Saccharomyces cerevisiae
           YOR027W STI1 Heat shock protein also induced by
           canavanine and entry into stationary phase
          Length = 593

 Score = 55.8 bits (133), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 30/89 (33%), Positives = 48/89 (53%), Gaps = 2/89 (2%)

Query: 93  ATALKDKGNALFKEKRFEDAIEFYNHAIKLHEDP--VFHSNISACYVSLGDLDKVVESST 150
           A   K +GNA F  K +E A E +  AI+  E P  V +SN SAC+ SL   ++ +  + 
Sbjct: 3   AEEFKKQGNAAFVAKDYEKASELFTKAIEASEAPNHVLYSNRSACFTSLKKFNEALNDAN 62

Query: 151 RALELKPDYSKALLRRASAYENMGRYQDA 179
             +++ P +SK   R  +AY  +G+  +A
Sbjct: 63  ECVKINPAWSKGYNRVGAAYFGLGKLDEA 91

 Score = 54.7 bits (130), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 34/102 (33%), Positives = 57/102 (55%), Gaps = 7/102 (6%)

Query: 86  EDQKKVYATALKDKGNALFKEKRFEDAIEFYNHAIKLHEDPVFHSNISACYVSLGDLDKV 145
           E   K  A A K +GN  +K ++F++AIE YN A  LH+D  + +N SA     GD ++ 
Sbjct: 260 EQDSKKNADAEKAEGNKFYKARKFDEAIEHYNKAWDLHKDVTYLNNRSAAEYEKGDYEQA 319

Query: 146 VESSTRAL----ELKPDY---SKALLRRASAYENMGRYQDAM 180
           +++ T A+    E++ DY   SK+  R  +AY  +  ++ A+
Sbjct: 320 IKTLTEAVEQGREMRADYKLISKSFARIGNAYLKLEDFKKAI 361

 Score = 33.1 bits (74), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 26/121 (21%), Positives = 48/121 (39%), Gaps = 28/121 (23%)

Query: 100 GNALFKEKRFEDAIEFYNHAIKLHEDPVFHSNISAC------------------------ 135
           GNA  K + F+ AIEFY  ++  H  P   + +  C                        
Sbjct: 348 GNAYLKLEDFKKAIEFYQKSLTEHRTPDILTKLRNCEKEQKVREAQAYIDPEKAEEARLQ 407

Query: 136 ---YVSLGDLDKVVESSTRALELKPDYSKALLRRASAYENMGRYQDAMFDISVLSLNGDF 192
              Y + GD    V++ T   +  P+ ++    RA+A   +  + +A+ D   ++++ D 
Sbjct: 408 GKEYFTKGDWPNAVKAYTEMTKRAPEDARGYSNRAAALAKLMSFPEAIKDCD-MAISKDP 466

Query: 193 N 193
           N
Sbjct: 467 N 467

>Kpol_1018.69 s1018 (197149..198921) [1773 bp, 590 aa] {ON}
           (197149..198921) [1773 nt, 591 aa]
          Length = 590

 Score = 54.7 bits (130), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 29/85 (34%), Positives = 47/85 (55%), Gaps = 2/85 (2%)

Query: 97  KDKGNALFKEKRFEDAIEFYNHAIKLHEDP--VFHSNISACYVSLGDLDKVVESSTRALE 154
           K +GNA F  K ++ AI+ ++ AI + E P  V +SN SACY SL      ++ +   ++
Sbjct: 9   KQQGNAAFVAKDYDKAIDLFSKAIDVSEQPNHVLYSNRSACYTSLKKFVNALKDAEECVK 68

Query: 155 LKPDYSKALLRRASAYENMGRYQDA 179
           + P +SK   R  +A+  MG   +A
Sbjct: 69  INPSWSKGYNRVGAAHFGMGDLDEA 93

 Score = 41.2 bits (95), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 24/88 (27%), Positives = 45/88 (51%), Gaps = 7/88 (7%)

Query: 100 GNALFKEKRFEDAIEFYNHAIKLHEDPVFHSNISACYVSLGDLDKVV----ESSTRALEL 155
           GN L+K ++F++A+  YN A + H D  + +N SA     GD +  +    E+  +  E+
Sbjct: 270 GNKLYKARQFDEAVAKYNEAWEAHNDITYLNNRSAAEFEKGDYETSIKTLEEAVEKGREM 329

Query: 156 KPDY---SKALLRRASAYENMGRYQDAM 180
           + DY   +K+  R  + Y  +   + A+
Sbjct: 330 RADYKVIAKSFARMGNCYTKLNDLKKAI 357

 Score = 33.1 bits (74), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 19/71 (26%), Positives = 37/71 (52%), Gaps = 1/71 (1%)

Query: 100 GNALFKEKRFEDAIEFYNHAIK-LHEDPVFHSNISACYVSLGDLDKVVESSTRALELKPD 158
           G   F +  + +A++ Y   IK   ED   +SN +A    L    + ++   +A+E  P+
Sbjct: 404 GKDYFTKGDWPNAVKAYTEMIKRAPEDARGYSNRAAVLSKLMSFPEAIDDCNKAIEKDPN 463

Query: 159 YSKALLRRASA 169
           + +A +R+A+A
Sbjct: 464 FVRAYIRKATA 474

>ACR005W Chr3 (363355..364338) [984 bp, 327 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOR007C (SGT2)
          Length = 327

 Score = 53.9 bits (128), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 37/101 (36%), Positives = 56/101 (55%), Gaps = 2/101 (1%)

Query: 93  ATALKDKGNALFKEKRFEDAIEFYNHAIK-LHEDPVFHSNISACYVSLGDLDKVVESSTR 151
           A ALK +GN     K +E AI+ Y  AI+ L  D V+++N +A Y SL   +K VE + +
Sbjct: 90  AEALKLEGNRAMAAKDYETAIQKYTAAIEVLPTDAVYYANRAAAYSSLQQYEKAVEDAEK 149

Query: 152 ALELKPDYSKALLRRASAYENMGRYQDAMFDIS-VLSLNGD 191
           A ++   YSK   R   A   +GR+++A+     VL + GD
Sbjct: 150 ATKVDSSYSKGFSRLGYAKYALGRHEEALEAYKRVLDIEGD 190

>KLLA0B09966g Chr2 complement(872760..873872) [1113 bp, 370 aa] {ON}
           similar to uniprot|P33313 Saccharomyces cerevisiae
           YBR155W CNS1 cyclophilin seven suppressor component of
           Hsp90p chaperone machinery
          Length = 370

 Score = 53.5 bits (127), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 35/123 (28%), Positives = 63/123 (51%), Gaps = 6/123 (4%)

Query: 69  INGDEEKPDMAAMLASS-EDQKKVYATALKDKGNALFKEKRFEDAIEFYNHAIKLHEDPV 127
           ++ DE   ++ A+ A + E +    AT  K++GN L+K KRF+DA   Y  A+ +  D +
Sbjct: 45  LDPDESNVELEALKAMAYEGEPHEIATNFKNQGNDLYKGKRFKDARAMYLKALDVKCDVL 104

Query: 128 -----FHSNISACYVSLGDLDKVVESSTRALELKPDYSKALLRRASAYENMGRYQDAMFD 182
                 + N++AC + + +    +     AL+L     KA  R   AY  +GR++D++  
Sbjct: 105 SINESLYLNLAACELEIKNYRSCINYCREALKLNAKNVKAFFRIGKAYLELGRFEDSLEA 164

Query: 183 ISV 185
           + V
Sbjct: 165 VQV 167

>TBLA0A07270 Chr1 complement(1811640..1812761) [1122 bp, 373 aa]
           {ON} Anc_6.21 YOR007C
          Length = 373

 Score = 53.1 bits (126), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 30/95 (31%), Positives = 52/95 (54%), Gaps = 1/95 (1%)

Query: 87  DQKKVYATALKDKGNALFKEKRFEDAIEFYNHAI-KLHEDPVFHSNISACYVSLGDLDKV 145
           D+ K  A   KD+GN L   + ++ AIE Y +AI K   DP+++SN S  Y+ + D +  
Sbjct: 131 DKDKQIADTFKDEGNRLMFSEDYKKAIECYTNAISKYPCDPIYYSNRSVAYLKVNDYESA 190

Query: 146 VESSTRALELKPDYSKALLRRASAYENMGRYQDAM 180
           +  +   + +  ++SKA +R A+      +Y DA+
Sbjct: 191 INDANFCISIDANFSKAYIRLANIKVQQHQYIDAL 225

>Ecym_3025 Chr3 complement(50289..51245) [957 bp, 318 aa] {ON}
           similar to Ashbya gossypii ACR005W
          Length = 318

 Score = 52.8 bits (125), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 43/140 (30%), Positives = 64/140 (45%), Gaps = 13/140 (9%)

Query: 54  ATASEPATSDKAYLTINGDEEKPDMAAMLASSEDQKKVYATALKDKGNALFKEKRFEDAI 113
           + ASEP  S       N D   P++A             A  LK +GN  F  K FE A+
Sbjct: 68  SGASEPTLSSSEPTGNNTDAHAPEVAE-----------RAENLKLEGNKAFAAKDFEGAV 116

Query: 114 EFYNHAIKLH-EDPVFHSNISACYVSLGDLDKVVESSTRALELKPDYSKALLRRASAYEN 172
           + Y  AI+L   + VF+ N +A Y S    ++ V  +  A+ + P YS+   R   A   
Sbjct: 117 KKYTEAIELMPNNAVFYGNRAAAYSSFKKFEEAVRDAESAVRINPSYSRGYSRLGLAKYA 176

Query: 173 MGRYQDAMFDI-SVLSLNGD 191
           +G+ ++AM     VL + GD
Sbjct: 177 LGKPEEAMEAYKKVLDIEGD 196

>KNAG0B03200 Chr2 complement(619530..621269) [1740 bp, 579 aa] {ON}
           Anc_5.617 YOR027W
          Length = 579

 Score = 53.1 bits (126), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 33/125 (26%), Positives = 64/125 (51%), Gaps = 3/125 (2%)

Query: 97  KDKGNALFKEKRFEDAIEFYNHAIKLHEDP--VFHSNISACYVSLGDLDKVVESSTRALE 154
           K +GN+ F  K++++A++ +  AI++ E P  V +SN SA Y S    ++ ++ +    +
Sbjct: 9   KQQGNSAFAAKKYDEAVDLFTKAIEVSETPNHVLYSNRSASYASEQKFNEALKDALECTK 68

Query: 155 LKPDYSKALLRRASAYENMGRYQDAMFDISVLSLNGDFNGSSIEPMLERNLNKQALRVLK 214
           + P ++K   R  +A+  MG   DA       +L  D N    +  +E+    Q+ R  +
Sbjct: 69  INPSWAKGYTREGAAHFGMGNLDDAEASYKK-ALELDANNKIAKEGIEQIQRVQSQRQAQ 127

Query: 215 EDMGI 219
            D+G+
Sbjct: 128 PDLGL 132

 Score = 49.3 bits (116), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 37/119 (31%), Positives = 61/119 (51%), Gaps = 11/119 (9%)

Query: 73  EEKPDMAAMLASS----EDQKKVYATALKDKGNALFKEKRFEDAIEFYNHAIKLHEDPVF 128
           E+KP  A   A S    +D+ KV A   K +GN  +K + F++AI  YN A +L  +  +
Sbjct: 227 EQKPKEAEPEAESMDVDQDESKVAAEEAKVEGNKAYKARNFDEAIACYNKAWELDNNITY 286

Query: 129 HSNISACYVSLGDLDKVVESSTRAL----ELKPDY---SKALLRRASAYENMGRYQDAM 180
            +N SA     G+ D  + +   A+    E++ DY   +K+  R  +AY  MG  ++A+
Sbjct: 287 LNNRSAAEFEKGEYDTAINTLNEAIEKGREMRADYKIIAKSFARIGNAYVKMGNLKEAI 345

 Score = 31.6 bits (70), Expect = 6.3,   Method: Compositional matrix adjust.
 Identities = 19/71 (26%), Positives = 34/71 (47%), Gaps = 1/71 (1%)

Query: 100 GNALFKEKRFEDAIEFYNHAIK-LHEDPVFHSNISACYVSLGDLDKVVESSTRALELKPD 158
           G   F +  +  A++ Y   IK   ED   +SN +A    L      +    +A+E  P+
Sbjct: 392 GKEYFTKGDWPSAVKAYTEMIKRAPEDARGYSNRAAALSKLMSFPDAISDCNKAIEKDPN 451

Query: 159 YSKALLRRASA 169
           + +A +R+A+A
Sbjct: 452 FVRAYIRKATA 462

>Smik_15.205 Chr15 (346899..348668) [1770 bp, 589 aa] {ON} YOR027W
           (REAL)
          Length = 589

 Score = 53.1 bits (126), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 27/85 (31%), Positives = 45/85 (52%), Gaps = 2/85 (2%)

Query: 97  KDKGNALFKEKRFEDAIEFYNHAIKLHEDP--VFHSNISACYVSLGDLDKVVESSTRALE 154
           K +GN+ F  K ++ AIE +  AI++ + P  V +SN SACY SL      +  +   + 
Sbjct: 9   KQQGNSAFTAKDYDKAIELFTKAIEVSKTPNHVLYSNRSACYASLKKFSDALNDAKECIN 68

Query: 155 LKPDYSKALLRRASAYENMGRYQDA 179
           + P +SK   R  +A+  +G   +A
Sbjct: 69  INPSWSKGYNRLGAAHLGLGDLDEA 93

 Score = 49.3 bits (116), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 30/96 (31%), Positives = 50/96 (52%), Gaps = 7/96 (7%)

Query: 86  EDQKKVYATALKDKGNALFKEKRFEDAIEFYNHAIKLHEDPVFHSNISACYVSLGDLDKV 145
           ED  K  A   K +GN  +K ++F++AIE YN A +LH D  + +N +A     G+    
Sbjct: 255 EDDSKAEADKEKAEGNKFYKARQFDEAIEHYNKAWELHRDITYLNNRAAAEYEKGEYKTA 314

Query: 146 VESSTRAL----ELKPDY---SKALLRRASAYENMG 174
           + +   A+    E++ DY   S++  R  +AY  +G
Sbjct: 315 IATLNDAVEQGREMRADYKVISRSFARIGNAYHKLG 350

 Score = 33.1 bits (74), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 38/143 (26%), Positives = 60/143 (41%), Gaps = 13/143 (9%)

Query: 379 NAAVYYHRGQMYFITQNYEKAGEDFKKSKE--SDPKNIFPYIQLACLAYRENKMAECEKL 436
           NA  Y  +G   F  ++Y+KA E F K+ E    P ++    + AC A     + +    
Sbjct: 4   NADEYKQQGNSAFTAKDYDKAIELFTKAIEVSKTPNHVLYSNRSACYA----SLKKFSDA 59

Query: 437 FEEARKTFPTAPEVPNFYAEILADK---GDIDEAVKQYNIAYRLESLQKQIHVGIAPLVG 493
             +A++     P     Y  + A     GD+DEA   Y  A  L++  K    G+  +  
Sbjct: 60  LNDAKECININPSWSKGYNRLGAAHLGLGDLDEAENNYKKALELDASNKAAKDGLDQV-- 117

Query: 494 KATILARQPTPENFATISQLLED 516
             T  ARQ  P+    ++QL  D
Sbjct: 118 HRTQQARQAQPD--LGLTQLFAD 138

 Score = 32.7 bits (73), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 19/71 (26%), Positives = 36/71 (50%), Gaps = 1/71 (1%)

Query: 100 GNALFKEKRFEDAIEFYNHAIK-LHEDPVFHSNISACYVSLGDLDKVVESSTRALELKPD 158
           G   F +  + +A++ Y   IK   ED   +SN +A    L    + +    +A+E  P+
Sbjct: 403 GKDYFTKSDWPNAVKAYTEMIKRAPEDARGYSNRAAALAKLMSFPEAIADCNKAIEKDPN 462

Query: 159 YSKALLRRASA 169
           + +A +R+A+A
Sbjct: 463 FVRAYIRKATA 473

>TPHA0J00340 Chr10 complement(76166..77182) [1017 bp, 338 aa] {ON}
           Anc_6.21 YOR007C
          Length = 338

 Score = 52.4 bits (124), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 36/110 (32%), Positives = 60/110 (54%), Gaps = 2/110 (1%)

Query: 84  SSEDQKKVYATALKDKGNALFKEKRFEDAIEFYNHAIK-LHEDPVFHSNISACYVSLGDL 142
           ++++++K  A  LK +GN     K +E AI+ Y+ AI+ L  + V+++N +A Y SL   
Sbjct: 84  AADEEQKATAEGLKLEGNKAMATKDYESAIKKYSEAIEVLPTNAVYYANRAAAYSSLKKY 143

Query: 143 DKVVESSTRALELKPDYSKALLRRASAYENMGRYQDAMFDI-SVLSLNGD 191
           D  V  +  A+++ P YSK   R   A    G+ +DA+     VL + GD
Sbjct: 144 DDAVNDAESAIKVNPTYSKGYSRLGFAKFAQGKVEDALDAYKKVLDIEGD 193

 Score = 30.8 bits (68), Expect = 8.8,   Method: Compositional matrix adjust.
 Identities = 38/163 (23%), Positives = 68/163 (41%), Gaps = 12/163 (7%)

Query: 272 KALYGATSDGYQLADECFAKAAKLYREQLANNNDAAFKEKAATALEYLGIFDFLKNDLDN 331
           K + G  +D   +A +C A+A +  R+ +        K+   +A    G+  FL     N
Sbjct: 23  KEVSGDNADSLNVAMDCIAEAFEFERDSV--------KDTVKSAFNGNGLTSFLSGSATN 74

Query: 332 S-EKNLKEALALHPRVNTYIYLALTMADRGQSEDYFSYFEK---AIALDPNNAAVYYHRG 387
             + N+ +  A   +  T   L L       ++DY S  +K   AI + P NA  Y +R 
Sbjct: 75  DIQVNIADDAADEEQKATAEGLKLEGNKAMATKDYESAIKKYSEAIEVLPTNAVYYANRA 134

Query: 388 QMYFITQNYEKAGEDFKKSKESDPKNIFPYIQLACLAYRENKM 430
             Y   + Y+ A  D + + + +P     Y +L    + + K+
Sbjct: 135 AAYSSLKKYDDAVNDAESAIKVNPTYSKGYSRLGFAKFAQGKV 177

>NDAI0I02240 Chr9 (512140..513192) [1053 bp, 350 aa] {ON} Anc_6.21
           YOR007C
          Length = 350

 Score = 52.0 bits (123), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 30/88 (34%), Positives = 47/88 (53%)

Query: 93  ATALKDKGNALFKEKRFEDAIEFYNHAIKLHEDPVFHSNISACYVSLGDLDKVVESSTRA 152
           A ALK +GN    E ++E+AI+ Y  AI+  ++  ++SN S  Y  LG  +  V  +T A
Sbjct: 82  AEALKKEGNEAMIEGQYEEAIKKYTEAIQFSKNVAYYSNRSLAYSKLGRYEDAVNDATLA 141

Query: 153 LELKPDYSKALLRRASAYENMGRYQDAM 180
           + + P +SKA  R   A     + +D M
Sbjct: 142 INIDPSFSKAYSRLGYAKCCQDKLEDGM 169

>KLTH0F14542g Chr6 complement(1191800..1193341) [1542 bp, 513 aa]
           {ON} highly similar to uniprot|P53043 Saccharomyces
           cerevisiae YGR123C
          Length = 513

 Score = 52.4 bits (124), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 29/95 (30%), Positives = 53/95 (55%), Gaps = 1/95 (1%)

Query: 93  ATALKDKGNALFKEKRFEDAIEFYNHAIKLHE-DPVFHSNISACYVSLGDLDKVVESSTR 151
           A   K++GNA  KEK++ +A+E+Y+ AI+L +   +F SN +   + L +    +E   +
Sbjct: 12  ALEFKNQGNAFIKEKKYPEAVEYYSKAIELDDTQSIFFSNRAFSRLKLDNFLTALEDCNK 71

Query: 152 ALELKPDYSKALLRRASAYENMGRYQDAMFDISVL 186
           ++EL P   KA+ RR  +Y  +  +  A  D+  +
Sbjct: 72  SIELDPKNIKAIHRRGLSYVGLLEFSKARKDLKTI 106

 Score = 32.7 bits (73), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 19/47 (40%), Positives = 24/47 (51%)

Query: 368 YFEKAIALDPNNAAVYYHRGQMYFITQNYEKAGEDFKKSKESDPKNI 414
           Y+ KAI LD   +  + +R        N+  A ED  KS E DPKNI
Sbjct: 34  YYSKAIELDDTQSIFFSNRAFSRLKLDNFLTALEDCNKSIELDPKNI 80

>TDEL0A04840 Chr1 (851520..853250) [1731 bp, 576 aa] {ON} Anc_5.617
           YOR027W
          Length = 576

 Score = 52.4 bits (124), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 30/92 (32%), Positives = 52/92 (56%), Gaps = 7/92 (7%)

Query: 90  KVYATALKDKGNALFKEKRFEDAIEFYNHAIKLHEDPVFHSNISACYVSLGDLDKVVESS 149
           +V A   K +GN  +K ++F++AIE YN A +LH+D  + +N +A     GD +  + + 
Sbjct: 245 QVAAEEEKAEGNKFYKARKFDEAIEHYNKAWELHKDITYLNNRAAAEYEKGDYETAIATL 304

Query: 150 TRAL----ELKPDY---SKALLRRASAYENMG 174
           T A+    E++ DY   +K+  R  +AY  +G
Sbjct: 305 TNAVDEGREMRADYKVIAKSFARIGNAYHKLG 336

 Score = 52.0 bits (123), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 29/85 (34%), Positives = 45/85 (52%), Gaps = 2/85 (2%)

Query: 97  KDKGNALFKEKRFEDAIEFYNHAIKLHEDP--VFHSNISACYVSLGDLDKVVESSTRALE 154
           K +GNA F  K +E A E +  AI + E P  V +SN SACY SL    + ++ +   ++
Sbjct: 8   KQQGNAAFVAKDYEKAAELFGKAIDVSEQPNHVLYSNRSACYTSLKKFAEGLKDAEECVK 67

Query: 155 LKPDYSKALLRRASAYENMGRYQDA 179
           + P +SK   R  +A   +   +DA
Sbjct: 68  INPGWSKGYNRVGAAQFGLNNLEDA 92

>Kpol_513.2 s513 (1962..3086) [1125 bp, 374 aa] {ON} (1962..3086)
           [1125 nt, 375 aa]
          Length = 374

 Score = 51.6 bits (122), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 37/115 (32%), Positives = 55/115 (47%), Gaps = 6/115 (5%)

Query: 93  ATALKDKGNALFKEKRFEDAIEFYNHAI--KLHEDPV---FHSNISACYVSLGDLDKVVE 147
           A   K++GN L+K KRF DA E YN AI  K  +D +    ++N +AC + L +  + + 
Sbjct: 74  AGNFKNQGNDLYKVKRFRDARELYNKAIDVKCDDDKINESLYANRAACELELKNYRRCIN 133

Query: 148 SSTRALELKPDYSKALLRRASAYENMGRYQDAMFDISVLSLNGDFNGSSIEPMLE 202
               AL L P   K   R A A+  + ++ D    I    L  D    S+  +LE
Sbjct: 134 DCKMALSLNPKNIKCYFRMAKAFLAIEKFDDCKEAIQ-FGLKFDLENKSLLNLLE 187

>NDAI0D00810 Chr4 complement(181659..182708) [1050 bp, 349 aa] {ON}
           Anc_6.21 YOR007C
          Length = 349

 Score = 50.8 bits (120), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 33/104 (31%), Positives = 58/104 (55%), Gaps = 2/104 (1%)

Query: 90  KVYATALKDKGNALFKEKRFEDAIEFYNHAIK-LHEDPVFHSNISACYVSLGDLDKVVES 148
           K  A A K +GN     K F  A+E Y  AIK L  + ++++N +A + SL + ++ ++ 
Sbjct: 98  KANAEAFKLEGNKAMAMKDFHLAVEKYTEAIKILPTNAIYYANRAAAHSSLKEFEEAIKD 157

Query: 149 STRALELKPDYSKALLRRASAYENMGRYQDAMFDI-SVLSLNGD 191
           +  A+++ P YSK   R A A   +G++++A+     VL + GD
Sbjct: 158 AESAIKIDPSYSKGYSRLAFAKYGLGKHEEALESYKKVLDIEGD 201

>SAKL0E01210g Chr5 complement(93267..94238) [972 bp, 323 aa] {ON}
           similar to uniprot|Q12118 Saccharomyces cerevisiae
           YOR007C SGT2 Glutamine-rich cytoplasmic protein of
           unknown function contains tetratricopeptide (TPR)
           repeats which often mediate protein-protein interactions
           conserved in human and C. elegans
          Length = 323

 Score = 50.8 bits (120), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 41/137 (29%), Positives = 74/137 (54%), Gaps = 7/137 (5%)

Query: 90  KVYATALKDKGNALFKEKRFEDAIEFYNHAIK-LHEDPVFHSNISACYVSLGDLDKVVES 148
           K  A  LK +GN     K FE AI+ Y  AI+ L  + V+++N +A Y SL   ++ V+ 
Sbjct: 94  KAKAEDLKLQGNKAMASKDFETAIKKYTEAIEVLPSNAVYYANRAAAYSSLKKYEESVQD 153

Query: 149 STRALELKPDYSKALLRRASAYENMGRYQDAMFDI-SVLSLNGDFNGSSIEPMLERNLNK 207
           +  A+++ P YSK   R   A   +G+ ++A+    +VL + GD        +++R+  +
Sbjct: 154 AESAIKVNPSYSKGYSRLGFAKYALGKPEEALEAYKTVLDIEGD----KATDVMKRDY-E 208

Query: 208 QALRVLKEDMGIDASVP 224
            A R +++ + ++ SVP
Sbjct: 209 TAKRKVEQSLNLEKSVP 225

>NDAI0F00910 Chr6 complement(223205..224956) [1752 bp, 583 aa] {ON}
          Length = 583

 Score = 50.8 bits (120), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 28/85 (32%), Positives = 44/85 (51%), Gaps = 2/85 (2%)

Query: 97  KDKGNALFKEKRFEDAIEFYNHAIKLHEDP--VFHSNISACYVSLGDLDKVVESSTRALE 154
           K +GNA F  K F  AIE +  AI++   P  V +SN SA Y S     + +  +T  ++
Sbjct: 9   KQQGNAAFTSKDFNKAIELFTKAIEVSPTPNHVLYSNRSAAYTSAKQFQEALNDATECVK 68

Query: 155 LKPDYSKALLRRASAYENMGRYQDA 179
           + P +SK   R  +A   +G  ++A
Sbjct: 69  INPTWSKGYNRLGAAEFGLGNLEEA 93

 Score = 47.8 bits (112), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 31/92 (33%), Positives = 49/92 (53%), Gaps = 7/92 (7%)

Query: 90  KVYATALKDKGNALFKEKRFEDAIEFYNHAIKLHEDPVFHSNISACYVSLGDLDKVV--- 146
           K+ A   K +GN L+K  +F++AIE YN A  L++D  + +N SA     GD +  +   
Sbjct: 252 KLEADEAKVEGNKLYKAHKFDEAIEQYNKAWALNKDITYLNNRSAAEFEKGDFETAIATL 311

Query: 147 -ESSTRALELKPDY---SKALLRRASAYENMG 174
            E+  +  EL+ DY   +K+  R  +AY   G
Sbjct: 312 NEAVDQGRELRADYKIIAKSFARIGNAYHKKG 343

 Score = 32.0 bits (71), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 20/82 (24%), Positives = 42/82 (51%), Gaps = 1/82 (1%)

Query: 100 GNALFKEKRFEDAIEFYNHAIK-LHEDPVFHSNISACYVSLGDLDKVVESSTRALELKPD 158
           G   F +  + +A++ Y+  IK   ED   +SN +A    L    + ++    A++  P+
Sbjct: 396 GKEYFTKGDWPNAVKAYSEMIKRAPEDARGYSNRAAALSKLMSFPEAIKDCDNAIKKDPN 455

Query: 159 YSKALLRRASAYENMGRYQDAM 180
           + +A +R+A+A   +  Y +A+
Sbjct: 456 FVRAYIRKATAQIAIKEYANAL 477

>NCAS0H00830 Chr8 complement(151809..152825) [1017 bp, 338 aa] {ON}
           Anc_6.21 YOR007C
          Length = 338

 Score = 50.1 bits (118), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 43/152 (28%), Positives = 77/152 (50%), Gaps = 8/152 (5%)

Query: 90  KVYATALKDKGNALFKEKRFEDAIEFYNHAIK-LHEDPVFHSNISACYVSLGDLDKVVES 148
           K  A + K +GN     K +  AIE Y+ AIK L  + ++++N +A Y S+ + D  ++ 
Sbjct: 96  KATAESFKLEGNKAMAAKDYRLAIEKYSEAIKTLPTNVIYYANRAAAYSSVKEYDNAIKD 155

Query: 149 STRALELKPDYSKALLRRASAYENMGRYQDAM-FDISVLSLNGDFNGSSIEPMLERNLNK 207
           + +A+E+ P YSK   R A A   + + ++A+ +   VL + GD       P ++R+   
Sbjct: 156 AEKAIEIDPAYSKGYSRLAFAKYALNKPEEALEYYKKVLDMEGD----KATPAMKRDFEM 211

Query: 208 QALRVLKEDMGIDASVPQAEQP-RERQELPSN 238
              RV +  M ++ S     +P R   + P+N
Sbjct: 212 AKNRV-ESSMNLEKSSTTTPEPSRSAGQQPAN 242

>Kwal_27.11890 s27 (990685..991689) [1005 bp, 334 aa] {ON} YBR155W
           (CNS1) - component of Hsp90p chaperone machinery [contig
           27] FULL
          Length = 334

 Score = 50.1 bits (118), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 34/121 (28%), Positives = 61/121 (50%), Gaps = 6/121 (4%)

Query: 93  ATALKDKGNALFKEKRFEDAIEFYNHAIKLHEDP-----VFHSNISACYVSLGDLDKVVE 147
           A   K++GN L+K KR++DA E YN  I++  D         SN +AC + L +  + V 
Sbjct: 78  AENFKNQGNELYKVKRYKDAREIYNKGIEIKCDSNKINESLFSNRAACELELKNYRRCVN 137

Query: 148 SSTRALELKPDYSKALLRRASAYENMGRYQDAMFDISVLSLNGDFNGSSIEPMLERNLNK 207
              +AL+  P   K   R A A+  + + +DA   I    L  D   ++++ +L++ + +
Sbjct: 138 DCRQALQFNPTNIKCFYRIARAFFLLDKCEDAKEAIE-FGLKLDSESAALKALLQKVIKR 196

Query: 208 Q 208
           +
Sbjct: 197 E 197

>KAFR0L00410 Chr12 complement(75459..76454) [996 bp, 331 aa] {ON}
           Anc_6.21 YOR007C
          Length = 331

 Score = 49.7 bits (117), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 35/109 (32%), Positives = 59/109 (54%), Gaps = 2/109 (1%)

Query: 85  SEDQKKVYATALKDKGNALFKEKRFEDAIEFYNHAIKLH-EDPVFHSNISACYVSLGDLD 143
           ++++ KV A  LK +GN     K F+ AI  Y+ AI +   + ++++N +A Y SL D +
Sbjct: 91  NDEETKVKAEKLKLEGNKAMAMKDFDLAIAKYSEAISISPNNAIYYANRAAAYSSLKDFE 150

Query: 144 KVVESSTRALELKPDYSKALLRRASAYENMGRYQDAMFDI-SVLSLNGD 191
           K  E +  A+ + P+YSK   R   A   + + ++A+     VL L GD
Sbjct: 151 KATEDAESAIRVDPNYSKGYSRLGFAKYALNKPEEALEAYKKVLDLEGD 199

 Score = 37.4 bits (85), Expect = 0.094,   Method: Compositional matrix adjust.
 Identities = 22/65 (33%), Positives = 33/65 (50%)

Query: 369 FEKAIALDPNNAAVYYHRGQMYFITQNYEKAGEDFKKSKESDPKNIFPYIQLACLAYREN 428
           + +AI++ PNNA  Y +R   Y   +++EKA ED + +   DP     Y +L    Y  N
Sbjct: 122 YSEAISISPNNAIYYANRAAAYSSLKDFEKATEDAESAIRVDPNYSKGYSRLGFAKYALN 181

Query: 429 KMAEC 433
           K  E 
Sbjct: 182 KPEEA 186

>KAFR0C05890 Chr3 (1165932..1167659) [1728 bp, 575 aa] {ON}
           Anc_5.617 YOR027W
          Length = 575

 Score = 50.1 bits (118), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 24/85 (28%), Positives = 48/85 (56%), Gaps = 2/85 (2%)

Query: 97  KDKGNALFKEKRFEDAIEFYNHAIKLHEDP--VFHSNISACYVSLGDLDKVVESSTRALE 154
           K +GN  F  K ++ AI+ +  AI++ E P  V +SN SA Y S    ++ +  +   ++
Sbjct: 9   KQEGNTAFVAKDYQKAIDAFTKAIEVSETPNHVLYSNRSAAYTSSKQYEQALSDADECIK 68

Query: 155 LKPDYSKALLRRASAYENMGRYQDA 179
           + P ++K   R+ +A + + +Y++A
Sbjct: 69  INPSWAKGYTRKGAALQGLHKYEEA 93

 Score = 44.3 bits (103), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 27/88 (30%), Positives = 48/88 (54%), Gaps = 7/88 (7%)

Query: 90  KVYATALKDKGNALFKEKRFEDAIEFYNHAIKLHEDPVFHSNISACYVSLGDLDKVVESS 149
           ++ A   K +GN  +K ++F++AI  YN A +  +D  + +N SA     GD +  +++ 
Sbjct: 248 RIEADKAKAEGNKAYKARQFDEAISHYNQAWETFKDITYLNNRSAAEYEKGDYETCIKTL 307

Query: 150 TRAL----ELKPDY---SKALLRRASAY 170
           T A+    EL+ DY   +K+  R  +AY
Sbjct: 308 TEAVENARELRTDYKIVAKSFARMGNAY 335

>Kpol_1037.26 s1037 complement(59590..60618) [1029 bp, 342 aa] {ON}
           complement(59590..60618) [1029 nt, 343 aa]
          Length = 342

 Score = 49.7 bits (117), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 37/101 (36%), Positives = 53/101 (52%), Gaps = 2/101 (1%)

Query: 93  ATALKDKGNALFKEKRFEDAIEFYNHAI-KLHEDPVFHSNISACYVSLGDLDKVVESSTR 151
           A ALK +GN     K +E AI+ Y  AI  L  + V+ +N +A Y SL   D+ VE +  
Sbjct: 100 AEALKLEGNKAMAGKDYELAIKKYTEAIATLPTNAVYFANRAAAYSSLKKYDEAVEDANS 159

Query: 152 ALELKPDYSKALLRRASAYENMGRYQDAMFDI-SVLSLNGD 191
           A+++ P YSK   R   A    G+ +DA+     VL + GD
Sbjct: 160 AIKINPTYSKGYSRLGFAKFAQGKAEDALEAYKKVLDIEGD 200

>NDAI0B05790 Chr2 complement(1406039..1407610) [1572 bp, 523 aa]
           {ON} Anc_3.481
          Length = 523

 Score = 49.7 bits (117), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 30/95 (31%), Positives = 50/95 (52%), Gaps = 1/95 (1%)

Query: 93  ATALKDKGNALFKEKRFEDAIEFYNHAIKLHE-DPVFHSNISACYVSLGDLDKVVESSTR 151
           A  LK++GN   KEK++  A+E+Y  AI+L     +F SN +   + L +    ++    
Sbjct: 13  AIDLKNEGNKYIKEKKYTKAVEYYTKAIELDSTQSIFFSNRALAQLKLDNFQSCLDDCNS 72

Query: 152 ALELKPDYSKALLRRASAYENMGRYQDAMFDISVL 186
           ALEL P   KA  RR  +   +  ++ A  D+S++
Sbjct: 73  ALELDPKNIKAYHRRGLSQLGLLHFKKAKNDLSIV 107

 Score = 31.2 bits (69), Expect = 9.4,   Method: Compositional matrix adjust.
 Identities = 20/67 (29%), Positives = 31/67 (46%), Gaps = 5/67 (7%)

Query: 368 YFEKAIALDPNNAAVYYHRGQMYFITQNYEKAGEDFKKSKESDPKNIFPY-----IQLAC 422
           Y+ KAI LD   +  + +R        N++   +D   + E DPKNI  Y      QL  
Sbjct: 35  YYTKAIELDSTQSIFFSNRALAQLKLDNFQSCLDDCNSALELDPKNIKAYHRRGLSQLGL 94

Query: 423 LAYRENK 429
           L +++ K
Sbjct: 95  LHFKKAK 101

>KNAG0M01170 Chr13 complement(211476..212495) [1020 bp, 339 aa] {ON}
           Anc_6.21 YOR007C
          Length = 339

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 51/163 (31%), Positives = 78/163 (47%), Gaps = 18/163 (11%)

Query: 70  NGDEEKPDMAAMLASSED-QKKVYATALKDKGNALFKEKRFEDAIEFYNHAIK-LHEDPV 127
           N DE K +   +    ED + K  A ALK +GN     K ++ A+E Y  AIK L  + V
Sbjct: 77  NTDECKTETVKINIPQEDAETKAKAEALKLEGNKAVASKDYDLAVEKYTEAIKILPTNAV 136

Query: 128 FHSNISACYVSLGDLDKVVESSTRALELKPDYSKALLRRASAYENMGRYQDAMFDIS--- 184
           + +N +A Y +  + D+ V+ +  A++L P YSK   R A A     +Y    F+ S   
Sbjct: 137 YFANRAAAYTNSQNYDEAVKDAEEAIKLDPAYSKGYSRLAYA-----KYVQENFEESLEA 191

Query: 185 ---VLSLNGDFNGSSIEPMLERNLNKQALRVLKEDMGIDASVP 224
              VL + GD    S   + +R       RV +E + ++ SVP
Sbjct: 192 YKKVLEIEGD----SATEVTKRGYETAKKRV-EESLNLEKSVP 229

 Score = 31.6 bits (70), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 23/67 (34%), Positives = 36/67 (53%), Gaps = 3/67 (4%)

Query: 362 SEDYFSYFEK---AIALDPNNAAVYYHRGQMYFITQNYEKAGEDFKKSKESDPKNIFPYI 418
           S+DY    EK   AI + P NA  + +R   Y  +QNY++A +D +++ + DP     Y 
Sbjct: 114 SKDYDLAVEKYTEAIKILPTNAVYFANRAAAYTNSQNYDEAVKDAEEAIKLDPAYSKGYS 173

Query: 419 QLACLAY 425
           +LA   Y
Sbjct: 174 RLAYAKY 180

>KLTH0C11220g Chr3 (920972..921955) [984 bp, 327 aa] {ON} similar to
           uniprot|Q12118 Saccharomyces cerevisiae YOR007C SGT2
           Glutamine-rich cytoplasmic protein of unknown function
           contains tetratricopeptide (TPR) repeats which often
           mediate protein-protein interactions conserved in human
           and C. elegans
          Length = 327

 Score = 48.1 bits (113), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 44/138 (31%), Positives = 73/138 (52%), Gaps = 5/138 (3%)

Query: 90  KVYATALKDKGNALFKEKRFEDAIEFYNHAIK-LHEDPVFHSNISACYVSLGDLDKVVES 148
           K  A ALK +GN     K FE AI  Y+ AI+ L  + V+ +N +A Y SL    + VE 
Sbjct: 95  KAKAEALKLEGNKAMATKDFEHAISKYSEAIRTLPSNAVYFANRAAAYSSLKKYAEAVED 154

Query: 149 STRALELKPDYSKALLRRASAYENMGRYQDAMFDISVLSLNGDFNGSSIEPMLERNLNKQ 208
           +  A+++ P YSK   R   A   +GR ++A+ D     L  D  GS+    ++R+ +  
Sbjct: 155 AEAAIKVNPSYSKGYSRLGFAQYALGRPEEAL-DAYKKVL--DIEGSNATDAMKRDYD-T 210

Query: 209 ALRVLKEDMGIDASVPQA 226
           A++ +++ + ++ S P A
Sbjct: 211 AMKKVEQSLNVERSAPAA 228

>Skud_2.282 Chr2 (517201..518358) [1158 bp, 385 aa] {ON} YBR155W
           (REAL)
          Length = 385

 Score = 48.5 bits (114), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 26/92 (28%), Positives = 48/92 (52%), Gaps = 5/92 (5%)

Query: 93  ATALKDKGNALFKEKRFEDAIEFYNHAIKLHEDPVF-----HSNISACYVSLGDLDKVVE 147
           A   K +GN L+K KRF+DA E Y   + +  +  F      +N +AC + L +  + +E
Sbjct: 83  AGGFKKQGNELYKAKRFKDARELYIKGLNVECEDKFINESLFANKAACELELKNYRRCIE 142

Query: 148 SSTRALELKPDYSKALLRRASAYENMGRYQDA 179
             ++AL + P  +K   R + A+  + + ++A
Sbjct: 143 DCSKALSINPKNTKCYYRTSKAFFQLNKLEEA 174

>KLLA0D01155g Chr4 complement(104847..105854) [1008 bp, 335 aa] {ON}
           similar to uniprot|Q12118 Saccharomyces cerevisiae
           YOR007C SGT2 Glutamine-rich cytoplasmic protein of
           unknown function contains tetratricopeptide (TPR)
           repeats which often mediate protein-protein interactions
           conserved in human and C. elegans
          Length = 335

 Score = 48.1 bits (113), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 25/68 (36%), Positives = 42/68 (61%), Gaps = 1/68 (1%)

Query: 99  KGNALFKEKRFEDAIEFYNHAIKLH-EDPVFHSNISACYVSLGDLDKVVESSTRALELKP 157
           +GN     K+F++AIE Y  AI++   + V++SN +A Y SL   ++ V+ + +A+E+ P
Sbjct: 101 QGNKAMAAKKFDEAIEKYTAAIEVSPSNAVYYSNRAAAYSSLKQYEQAVKDAEQAIEVDP 160

Query: 158 DYSKALLR 165
            YSK   R
Sbjct: 161 TYSKGFSR 168

 Score = 32.0 bits (71), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 20/65 (30%), Positives = 32/65 (49%)

Query: 369 FEKAIALDPNNAAVYYHRGQMYFITQNYEKAGEDFKKSKESDPKNIFPYIQLACLAYREN 428
           +  AI + P+NA  Y +R   Y   + YE+A +D +++ E DP     + +L    Y  N
Sbjct: 118 YTAAIEVSPSNAVYYSNRAAAYSSLKQYEQAVKDAEQAIEVDPTYSKGFSRLGFAKYALN 177

Query: 429 KMAEC 433
           K  E 
Sbjct: 178 KPEEA 182

>Suva_3.95 Chr3 (137419..137754) [336 bp, 111 aa] {ON} YCR060W
           (REAL)
          Length = 111

 Score = 44.7 bits (104), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 23/70 (32%), Positives = 39/70 (55%), Gaps = 1/70 (1%)

Query: 97  KDKGNALFKEKRFEDAIEFYNHAIKLH-EDPVFHSNISACYVSLGDLDKVVESSTRALEL 155
           K++GN L+K+  + DAI  Y+  I    ++PV HSN +   + LG+  + +E+  + L+L
Sbjct: 8   KEEGNELYKQGLYRDAIGCYDRLIAAQPQNPVGHSNKAMALIKLGEHAQAIEACQQGLQL 67

Query: 156 KPDYSKALLR 165
                 A LR
Sbjct: 68  AASPQHAALR 77

>Smik_2.295 Chr2 (535786..536943) [1158 bp, 385 aa] {ON} YBR155W
           (REAL)
          Length = 385

 Score = 47.8 bits (112), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 28/92 (30%), Positives = 49/92 (53%), Gaps = 5/92 (5%)

Query: 93  ATALKDKGNALFKEKRFEDAIEFYNHAIKLH-EDPVFH----SNISACYVSLGDLDKVVE 147
           A   K +GN L+K KRF+DA E Y   I +  ED   +    +N +AC + L +  + +E
Sbjct: 83  AENFKKQGNELYKAKRFKDARELYTKGIAVECEDKSINESLFANRAACELELKNYRRCIE 142

Query: 148 SSTRALELKPDYSKALLRRASAYENMGRYQDA 179
             ++AL + P   K   R + A+ ++ + ++A
Sbjct: 143 DCSKALTINPKNIKCYYRTSKAFFSLSKLEEA 174

>SAKL0H10934g Chr8 complement(945834..946976) [1143 bp, 380 aa] {ON}
           similar to uniprot|P33313 Saccharomyces cerevisiae
           YBR155W CNS1 cyclophilin seven suppressor component of
           Hsp90p chaperone machinery
          Length = 380

 Score = 47.4 bits (111), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 31/120 (25%), Positives = 61/120 (50%), Gaps = 6/120 (5%)

Query: 93  ATALKDKGNALFKEKRFEDAIEFYNHAIKLH--EDPVFHS---NISACYVSLGDLDKVVE 147
           A   K++GN L++ +R++DA E YN  +++H  +D +  S   N +AC + L +  + + 
Sbjct: 80  AENFKNQGNDLYRARRYKDARELYNKGVEVHCDDDAINESLFLNRAACELELKNHRRCIN 139

Query: 148 SSTRALELKPDYSKALLRRASAYENMGRYQDAMFDISVLSLNGDFNGSSIEPMLERNLNK 207
               AL   P   K   R   A+ ++ + ++A   I    L  D N +++  +L++ + K
Sbjct: 140 DCKEALRYNPKNVKCFYRMGRAFFSLNKLEEAKEAIE-FGLRFDSNNAALGALLDKIVKK 198

>SAKL0F03102g Chr6 (258266..259807) [1542 bp, 513 aa] {ON} highly
           similar to uniprot|P53043 Saccharomyces cerevisiae
           YGR123C
          Length = 513

 Score = 47.8 bits (112), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 32/105 (30%), Positives = 51/105 (48%), Gaps = 3/105 (2%)

Query: 83  ASSEDQKKVYATALKDKGNALFKEKRFEDAIEFYNHAIKL-HEDPVFHSNISACYVSLGD 141
           AS ED  K  A   K++GN   K K F  A E Y+ AI+L     ++ SN +  ++ L +
Sbjct: 4   ASDEDVNK--ALEFKNQGNVFIKGKNFSKAAELYSKAIELDGTQSIYFSNRAFAHLKLDN 61

Query: 142 LDKVVESSTRALELKPDYSKALLRRASAYENMGRYQDAMFDISVL 186
               +    +A+EL P   KA  RR  +Y  +  +  A  D+ ++
Sbjct: 62  FQTALNDCNKAIELDPKNVKAYHRRGLSYIGLLEFNKARKDLKIV 106

 Score = 31.2 bits (69), Expect = 7.8,   Method: Compositional matrix adjust.
 Identities = 17/44 (38%), Positives = 24/44 (54%), Gaps = 3/44 (6%)

Query: 371 KAIALDPNNAAVYYHRGQMYFITQNYEKAGEDFK---KSKESDP 411
           KAI LDP N   Y+ RG  Y     + KA +D K   ++K ++P
Sbjct: 71  KAIELDPKNVKAYHRRGLSYIGLLEFNKARKDLKIVLRAKPNEP 114

>Kwal_55.21175 s55 complement(716457..717992) [1536 bp, 511 aa] {ON}
           YGR123C (PPT1) - serine/threonine phosphatase [contig
           295] FULL
          Length = 511

 Score = 47.4 bits (111), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 29/95 (30%), Positives = 53/95 (55%), Gaps = 1/95 (1%)

Query: 93  ATALKDKGNALFKEKRFEDAIEFYNHAIKLHE-DPVFHSNISACYVSLGDLDKVVESSTR 151
           A   K++GNA  KEK++++A+E+Y+ AI+L +   ++ SN +   + L +     E   +
Sbjct: 10  ALEFKNQGNAYVKEKKYQEAVEYYSKAIELDDTQSIYFSNRAFSRLRLDNFLTAQEDCDK 69

Query: 152 ALELKPDYSKALLRRASAYENMGRYQDAMFDISVL 186
           A+ L P   KA+ RR  +Y  +  +  A  D+ V+
Sbjct: 70  AIALDPKNIKAIHRRGLSYVGLLEFFKARKDLRVV 104

>YBR155W Chr2 (549771..550928) [1158 bp, 385 aa] {ON}
           CNS1TPR-containing co-chaperone; binds both Hsp82p
           (Hsp90) and Ssa1p (Hsp70) and stimulates the ATPase
           activity of SSA1, ts mutants reduce Hsp82p function
           while over expression suppresses the phenotypes of an
           HSP82 ts allele and a cpr7 deletion
          Length = 385

 Score = 47.4 bits (111), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 27/92 (29%), Positives = 49/92 (53%), Gaps = 5/92 (5%)

Query: 93  ATALKDKGNALFKEKRFEDAIEFYNHAIKLH-EDP----VFHSNISACYVSLGDLDKVVE 147
           A   K +GN L+K KRF+DA E Y+  + +  ED       ++N +AC + L +  + +E
Sbjct: 83  AENFKKQGNELYKAKRFKDARELYSKGLAVECEDKSINESLYANRAACELELKNYRRCIE 142

Query: 148 SSTRALELKPDYSKALLRRASAYENMGRYQDA 179
             ++AL + P   K   R + A+  + + ++A
Sbjct: 143 DCSKALTINPKNVKCYYRTSKAFFQLNKLEEA 174

>KNAG0A07900 Chr1 complement(1258164..1259702) [1539 bp, 512 aa]
           {ON} Anc_3.481 YGR123C
          Length = 512

 Score = 47.4 bits (111), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 28/95 (29%), Positives = 49/95 (51%), Gaps = 1/95 (1%)

Query: 93  ATALKDKGNALFKEKRFEDAIEFYNHAIKLHE-DPVFHSNISACYVSLGDLDKVVESSTR 151
           A   KD+GN   K + ++ AIE Y  AI+L     +F+SN +  ++ L +    +     
Sbjct: 12  ALKFKDEGNVYIKSQDYQKAIELYTKAIELDSTSSIFYSNRALAHLKLDNFQSALHDCND 71

Query: 152 ALELKPDYSKALLRRASAYENMGRYQDAMFDISVL 186
           A++L  +  KA  RR  AY  +  ++ A  D+++L
Sbjct: 72  AIKLDNNNIKAYHRRGLAYVGLLEFRKAKNDLTIL 106

>TPHA0E00740 Chr5 complement(142456..144696) [2241 bp, 746 aa] {ON}
           Anc_7.412 YBL084C
          Length = 746

 Score = 47.4 bits (111), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 40/159 (25%), Positives = 70/159 (44%), Gaps = 1/159 (0%)

Query: 327 NDLDNSEKNLKEALALHP-RVNTYIYLALTMADRGQSEDYFSYFEKAIALDPNNAAVYYH 385
           +  D +++  ++A+A  P   N Y  L +     GQ E+   +FEKA +++P N  +   
Sbjct: 576 DSFDVAKRCYRKAIACDPGHYNAYYGLGMVSMKLGQYEEALLFFEKARSINPINVVLVCC 635

Query: 386 RGQMYFITQNYEKAGEDFKKSKESDPKNIFPYIQLACLAYRENKMAECEKLFEEARKTFP 445
            G         EKA + ++ + E  P +     + A L Y   +     K FEE +   P
Sbjct: 636 GGVALEKLSYQEKALQYYELACELQPSSSLATFKRAHLLYSMGRYTLALKFFEELKHVAP 695

Query: 446 TAPEVPNFYAEILADKGDIDEAVKQYNIAYRLESLQKQI 484
               V     +I +  G   +A+K+Y IA  L+   +Q+
Sbjct: 696 DEATVHFLLGQIYSILGRKKDAIKEYTIALNLDPKGRQL 734

 Score = 38.1 bits (87), Expect = 0.075,   Method: Compositional matrix adjust.
 Identities = 27/109 (24%), Positives = 50/109 (45%), Gaps = 1/109 (0%)

Query: 338 EALALHPRV-NTYIYLALTMADRGQSEDYFSYFEKAIALDPNNAAVYYHRGQMYFITQNY 396
           E +  +PR+  T+  L   ++ +    +    FEKA  +DP  A  Y  +G  Y  + ++
Sbjct: 519 ELITSNPRIPETWCCLGNFLSLQKNHHEAIKAFEKATQVDPKFAYAYTLQGHEYTSSDSF 578

Query: 397 EKAGEDFKKSKESDPKNIFPYIQLACLAYRENKMAECEKLFEEARKTFP 445
           + A   ++K+   DP +   Y  L  ++ +  +  E    FE+AR   P
Sbjct: 579 DVAKRCYRKAIACDPGHYNAYYGLGMVSMKLGQYEEALLFFEKARSINP 627

>KNAG0A03950 Chr1 complement(529620..530780) [1161 bp, 386 aa] {ON}
           Anc_8.506 YBR155W
          Length = 386

 Score = 46.6 bits (109), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 29/92 (31%), Positives = 47/92 (51%), Gaps = 5/92 (5%)

Query: 93  ATALKDKGNALFKEKRFEDAIEFYNHAIKLH-EDPVFH----SNISACYVSLGDLDKVVE 147
           A   K++ N L+K KRF DA E Y   IK+  ED   +    +N +AC + L +    V 
Sbjct: 85  AENFKNQANDLYKVKRFRDARELYTKGIKVFCEDKSINESLFANRAACELELKNYRSCVA 144

Query: 148 SSTRALELKPDYSKALLRRASAYENMGRYQDA 179
              +A+E+ P   K   R   A+  +G++++A
Sbjct: 145 DCQKAMEINPMNLKCFYRMGKAFLALGKFKEA 176

>TDEL0B01310 Chr2 complement(234307..235449) [1143 bp, 380 aa] {ON}
           Anc_8.506 YBR155W
          Length = 380

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 32/121 (26%), Positives = 57/121 (47%), Gaps = 6/121 (4%)

Query: 93  ATALKDKGNALFKEKRFEDAIEFYNHAIKLHEDPV-----FHSNISACYVSLGDLDKVVE 147
           A   K++GN L+K KRF+DA E YN  I++  D        ++N +AC + + +  + + 
Sbjct: 78  AGNFKNQGNDLYKAKRFKDARELYNKGIEIKCDDTSINESLYANRAACELEIKNYRRCLN 137

Query: 148 SSTRALELKPDYSKALLRRASAYENMGRYQDAMFDISVLSLNGDFNGSSIEPMLERNLNK 207
               AL+  P   K   R   A+  +   ++A   +    L  D +   ++ +L+  L K
Sbjct: 138 DCKTALQYNPKNLKCYYRMGKAFLALELLEEAQKSVE-FGLQVDSSNKPLQSLLDIVLKK 196

Query: 208 Q 208
           Q
Sbjct: 197 Q 197

>AGL268C Chr7 complement(205872..207011) [1140 bp, 379 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YBR155W
           (CNS1)
          Length = 379

 Score = 46.2 bits (108), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 29/92 (31%), Positives = 45/92 (48%), Gaps = 5/92 (5%)

Query: 93  ATALKDKGNALFKEKRFEDAIEFYNHAIKLHEDPVFHS-----NISACYVSLGDLDKVVE 147
           A   K++GN L+K KRF DA   YN  I++  D    S     N +AC + L +  + + 
Sbjct: 77  AENFKNQGNDLYKVKRFRDARVMYNKGIEVKCDDAGISELLLLNRAACELELKNYRRCIN 136

Query: 148 SSTRALELKPDYSKALLRRASAYENMGRYQDA 179
               AL+L P   KA  R   A+  + + ++A
Sbjct: 137 DCREALKLNPKNPKAFFRIGKAFLQLDKLEEA 168

>TBLA0G01050 Chr7 complement(262407..263459) [1053 bp, 350 aa] {ON}
           Anc_6.21 YOR007C
          Length = 350

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 30/89 (33%), Positives = 50/89 (56%), Gaps = 1/89 (1%)

Query: 93  ATALKDKGNALFKEKRFEDAIEFYNHAIKL-HEDPVFHSNISACYVSLGDLDKVVESSTR 151
           A ALK +GN     K +  A+E YN AIKL     V+++N +A Y S    D+ ++ +  
Sbjct: 103 AEALKLEGNKAMAAKDYNLAVEKYNAAIKLVPTKAVYYANRAAAYSSQEKYDEAIKDAES 162

Query: 152 ALELKPDYSKALLRRASAYENMGRYQDAM 180
           A++++P++SK   R   A    G+ Q+A+
Sbjct: 163 AIKVEPNWSKGYSRLGFAKFAQGKSQEAL 191

>CAGL0E02739g Chr5 complement(259023..260054) [1032 bp, 343 aa] {ON}
           similar to uniprot|Q12118 Saccharomyces cerevisiae
           YOR007c SGT2
          Length = 343

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 30/90 (33%), Positives = 50/90 (55%), Gaps = 1/90 (1%)

Query: 77  DMAAMLASSEDQKKVYATALKDKGNALFKEKRFEDAIEFYNHAIK-LHEDPVFHSNISAC 135
           D+   + + + + K  A ALK +GN     K FE AI  Y+ AI+ L  + ++++N +A 
Sbjct: 77  DVKVNIPAEDAETKAKAEALKLEGNKAMAGKDFELAIAKYSEAIEVLPTNAIYYANRAAA 136

Query: 136 YVSLGDLDKVVESSTRALELKPDYSKALLR 165
           + SL   D+ V  + +A+E+ P YSK   R
Sbjct: 137 HSSLKQYDEAVVDAEKAIEIDPAYSKGYSR 166

>NCAS0F03490 Chr6 complement(698757..700295) [1539 bp, 512 aa] {ON}
           Anc_3.142 YDL047W
          Length = 512

 Score = 46.2 bits (108), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 34/112 (30%), Positives = 56/112 (50%), Gaps = 9/112 (8%)

Query: 78  MAAMLASSEDQKKVYATALKDKGNALFKEKRFEDAIEFYNHAIKLHEDP---VFHSNISA 134
           M +  A +++Q    A A K++GN   KE+ +  AIE Y+ AI+L  DP   +F SN + 
Sbjct: 1   MTSAFADAKEQ----AVAFKNEGNTYIKEQNYMKAIELYSQAIEL--DPTQSIFFSNRAL 54

Query: 135 CYVSLGDLDKVVESSTRALELKPDYSKALLRRASAYENMGRYQDAMFDISVL 186
             + L +    +     AL L P   KA  RR  ++  + + + A  D+ V+
Sbjct: 55  AQLKLDNFQSCMNDCDVALRLDPKNIKAYHRRGLSHLGLLQCKKARNDLQVV 106

>Kwal_56.22433 s56 complement(124778..125746) [969 bp, 322 aa] {ON}
           YOR007C (SGT2) - small glutamine-rich tetratricopeptide
           repeat containing protein [contig 185] FULL
          Length = 322

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 38/140 (27%), Positives = 74/140 (52%), Gaps = 5/140 (3%)

Query: 88  QKKVYATALKDKGNALFKEKRFEDAIEFYNHAIK-LHEDPVFHSNISACYVSLGDLDKVV 146
           + K  A +LK +GN     K FE A+  Y+ AI+ L  + V+++N +A + SL   ++ V
Sbjct: 92  ETKAKAESLKLEGNKAMAAKDFEQAVLKYSEAIQVLPTNAVYYANRAAAHSSLKKYEEAV 151

Query: 147 ESSTRALELKPDYSKALLRRASAYENMGRYQDAMFDISVLSLNGDFNGSSIEPMLERNLN 206
           + +  A+++ P YSK   R   A   +G+ ++A+ D     L  D  G +    ++R+ +
Sbjct: 152 KDAEDAIKVNPSYSKGYSRLGFAQYALGKPEEAL-DAYKKVL--DIEGEAATDAMKRDYD 208

Query: 207 KQALRVLKEDMGIDASVPQA 226
             A++ + + + ++ S P A
Sbjct: 209 T-AMKKVGQSLNVEKSAPAA 227

>KLTH0E11748g Chr5 (1043203..1044339) [1137 bp, 378 aa] {ON} similar
           to uniprot|P33313 Saccharomyces cerevisiae YBR155W CNS1
           cyclophilin seven suppressor component of Hsp90p
           chaperone machinery
          Length = 378

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 29/92 (31%), Positives = 45/92 (48%), Gaps = 5/92 (5%)

Query: 93  ATALKDKGNALFKEKRFEDAIEFYNHAIKLHED-----PVFHSNISACYVSLGDLDKVVE 147
           A   K++GN L++ KR++DA E YN  I +  D         SN +AC + L +  + V 
Sbjct: 78  AENFKNQGNDLYRAKRYKDAREIYNRGIDIKCDDSKVNESLFSNRAACELELKNYRRCVN 137

Query: 148 SSTRALELKPDYSKALLRRASAYENMGRYQDA 179
              RAL+      K   R A A+  + + +DA
Sbjct: 138 DCKRALQYNVKNIKCYYRIAKAFLLLNKLEDA 169

>TBLA0C03950 Chr3 complement(950339..951877) [1539 bp, 512 aa] {ON}
           Anc_3.481 YGR123C
          Length = 512

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 26/95 (27%), Positives = 49/95 (51%), Gaps = 1/95 (1%)

Query: 93  ATALKDKGNALFKEKRFEDAIEFYNHAIKLHED-PVFHSNISACYVSLGDLDKVVESSTR 151
           A   K++GN   K + +  AIE Y  AIKL +   ++ SN +  ++ + +    +    +
Sbjct: 12  ALEFKNRGNDAIKTQDYPGAIELYTEAIKLDDTVSIYFSNRAMGHLKMDNFQSGINDCDK 71

Query: 152 ALELKPDYSKALLRRASAYENMGRYQDAMFDISVL 186
           ALE+ P   KA  RR  +Y  +  +++A  D+ ++
Sbjct: 72  ALEIDPKNIKAYHRRGMSYIGLLEFKNAQKDLKIV 106

 Score = 31.2 bits (69), Expect = 8.5,   Method: Compositional matrix adjust.
 Identities = 20/72 (27%), Positives = 30/72 (41%), Gaps = 10/72 (13%)

Query: 370 EKAIALDPNNAAVYYHRGQMYFITQNYEKAGEDFKKSKESDPKNIFPYIQLACLAYRENK 429
           +KA+ +DP N   Y+ RG  Y     ++ A +D K    S P +          A  +  
Sbjct: 70  DKALEIDPKNIKAYHRRGMSYIGLLEFKNAQKDLKIVLASKPND----------ATAKRG 119

Query: 430 MAECEKLFEEAR 441
           +  CEK   E R
Sbjct: 120 LDVCEKFIREER 131

>KAFR0E02980 Chr5 (596891..598033) [1143 bp, 380 aa] {ON} Anc_8.506
           YBR155W
          Length = 380

 Score = 45.4 bits (106), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 26/92 (28%), Positives = 42/92 (45%), Gaps = 5/92 (5%)

Query: 93  ATALKDKGNALFKEKRFEDAIEFYNHAIKLHEDPV-----FHSNISACYVSLGDLDKVVE 147
           A   K++GN L+K KRF DA E Y   I++  D        ++N +AC + L +    + 
Sbjct: 78  AENFKNQGNDLYKVKRFRDAREIYTKGIEMKCDVAKINESLYANRAACQLELKNFRSCIS 137

Query: 148 SSTRALELKPDYSKALLRRASAYENMGRYQDA 179
               AL   P   K   R   A+  + +++ A
Sbjct: 138 DCKTALTYNPKNIKCYFRMGKAFTAINKFESA 169

>CAGL0H07425g Chr8 (725307..726449) [1143 bp, 380 aa] {ON} highly
           similar to uniprot|P33313 Saccharomyces cerevisiae
           YBR155w CNS1
          Length = 380

 Score = 45.1 bits (105), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 29/96 (30%), Positives = 48/96 (50%), Gaps = 5/96 (5%)

Query: 93  ATALKDKGNALFKEKRFEDAIEFYNHAI--KLHEDPV---FHSNISACYVSLGDLDKVVE 147
           A   K +GN L+K KRF DA E Y+  I  K   + +    ++N +AC + + +  + + 
Sbjct: 81  AENFKKQGNDLYKVKRFRDARELYSKGIDVKCQVNTINESLYANRAACELEIKNYRRCIN 140

Query: 148 SSTRALELKPDYSKALLRRASAYENMGRYQDAMFDI 183
              +AL+L P   K   R A A+  + R  +A+  I
Sbjct: 141 DCKQALQLNPKNIKCYYRIAKAFTALERLDEALESI 176

>NCAS0A11200 Chr1 complement(2220419..2223142) [2724 bp, 907 aa]
           {ON} Anc_3.367
          Length = 907

 Score = 45.4 bits (106), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 32/131 (24%), Positives = 60/131 (45%), Gaps = 12/131 (9%)

Query: 366 FSYFEKAIALDPNNAAVYYHRGQMYFITQNYEKAGEDFKKSKESDPKNIFPYIQLACLAY 425
            +Y  K++ +DPN++  +YH G+++ I  +Y  A + F+++   D +N   +  +  L Y
Sbjct: 292 LNYLLKSLEVDPNDSTTWYHLGRVHMIRNDYTAAYDAFQQAVNRDSRNPIFWCSIGVLYY 351

Query: 426 RENKMAECEKLFEEARKTFPTAPEV----PNFYAEILADKGDIDEAVKQ--------YNI 473
           + ++  +    +  A +  P   EV       Y        D  +A KQ         +I
Sbjct: 352 QISQYRDALDAYTRAIRLNPYISEVWYDLGTLYETCNNQLNDALDAYKQAARLDPENVHI 411

Query: 474 AYRLESLQKQI 484
             RLESL +Q+
Sbjct: 412 RKRLESLTQQL 422

>TPHA0D03220 Chr4 complement(662868..664409) [1542 bp, 513 aa] {ON}
           Anc_3.481 YGR123C
          Length = 513

 Score = 44.7 bits (104), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 35/106 (33%), Positives = 56/106 (52%), Gaps = 4/106 (3%)

Query: 84  SSEDQKKVYATAL--KDKGNALFKEKRFEDAIEFYNHAIKLHE-DPVFHSNISACYVSLG 140
           SS  Q+ + ATAL  K+KGN   K+  ++ AIEFY+ AI L     ++ SN +  ++   
Sbjct: 2   SSPSQEDI-ATALDFKNKGNEYIKKSDYDSAIEFYSKAIALDSTQSIYFSNRALAHLKQD 60

Query: 141 DLDKVVESSTRALELKPDYSKALLRRASAYENMGRYQDAMFDISVL 186
           +    V     AL+L P   KA  RR  +Y  +  ++ A  D++V+
Sbjct: 61  NFYSAVVDCDNALKLDPKNIKAYHRRGLSYVGILEFRKAKNDLNVV 106

>CAGL0D05060g Chr4 complement(486065..487597) [1533 bp, 510 aa] {ON}
           highly similar to uniprot|P53043 Saccharomyces
           cerevisiae YGR123c PPT1 protein ser/thr phosphatase
          Length = 510

 Score = 44.7 bits (104), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 30/95 (31%), Positives = 50/95 (52%), Gaps = 1/95 (1%)

Query: 93  ATALKDKGNALFKEKRFEDAIEFYNHAIKLHE-DPVFHSNISACYVSLGDLDKVVESSTR 151
           A   K++GNA  K + +  AIE Y+ AI+L +   V+ SN + C++ L +     +   +
Sbjct: 9   ALEYKNEGNACVKVQDYAKAIEKYDKAIELDDTQSVYFSNRALCHLKLDNFQCASQDCDK 68

Query: 152 ALELKPDYSKALLRRASAYENMGRYQDAMFDISVL 186
           AL L P   KA  RR  A   +  ++ A  D++V+
Sbjct: 69  ALALDPKNVKAYHRRGLACVGLLEFKKARADLTVV 103

 Score = 35.0 bits (79), Expect = 0.53,   Method: Compositional matrix adjust.
 Identities = 21/65 (32%), Positives = 34/65 (52%), Gaps = 2/65 (3%)

Query: 369 FEKAIALDPNNAAVYYHRGQMYFITQNYEKAGEDFKKSKESDPKNIFPYIQ--LACLAYR 426
           ++KAI LD   +  + +R   +    N++ A +D  K+   DPKN+  Y +  LAC+   
Sbjct: 32  YDKAIELDDTQSVYFSNRALCHLKLDNFQCASQDCDKALALDPKNVKAYHRRGLACVGLL 91

Query: 427 ENKMA 431
           E K A
Sbjct: 92  EFKKA 96

>Suva_4.405 Chr4 (719015..720172) [1158 bp, 385 aa] {ON} YBR155W
           (REAL)
          Length = 385

 Score = 44.3 bits (103), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 28/92 (30%), Positives = 47/92 (51%), Gaps = 5/92 (5%)

Query: 93  ATALKDKGNALFKEKRFEDAIEFYNHAIKLH-EDPVFH----SNISACYVSLGDLDKVVE 147
           A   K +GN L+K KRF+DA E Y   + +  ED   +    +N +AC + L +  K VE
Sbjct: 83  AENFKKQGNELYKAKRFKDARELYTKGVAVECEDKSINESLFANRAACELELKNYRKCVE 142

Query: 148 SSTRALELKPDYSKALLRRASAYENMGRYQDA 179
              +AL + P   K   R + ++  + + ++A
Sbjct: 143 DCGKALTINPKNIKCYYRISKSFFQLRKLEEA 174

>KLLA0B10912g Chr2 (955948..957486) [1539 bp, 512 aa] {ON} similar
           to uniprot|P53043 Saccharomyces cerevisiae YGR123C
          Length = 512

 Score = 44.3 bits (103), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 29/95 (30%), Positives = 52/95 (54%), Gaps = 1/95 (1%)

Query: 93  ATALKDKGNALFKEKRFEDAIEFYNHAIKLH-EDPVFHSNISACYVSLGDLDKVVESSTR 151
           A  LK++GN   KEK +  A E+Y  AI+   E+ + +SN +   + L +    ++ + R
Sbjct: 13  ALELKNEGNKFVKEKLYAKAAEYYTKAIEHDPENTILYSNRAFTNLKLDNFQSSLDDAKR 72

Query: 152 ALELKPDYSKALLRRASAYENMGRYQDAMFDISVL 186
           A+EL  +  KA  RRA +Y  +  ++ A  D+ ++
Sbjct: 73  AIELDNNNLKAYHRRAMSYIGLLEFRKARKDLIIV 107

>ZYRO0F08624g Chr6 (691992..693131) [1140 bp, 379 aa] {ON} similar
           to uniprot|P33313 Saccharomyces cerevisiae YBR155W CNS1
           cyclophilin seven suppressor component of Hsp90p
           chaperone machinery
          Length = 379

 Score = 43.9 bits (102), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 27/92 (29%), Positives = 47/92 (51%), Gaps = 5/92 (5%)

Query: 93  ATALKDKGNALFKEKRFEDAIEFYNHA--IKLHEDPVFHS---NISACYVSLGDLDKVVE 147
           A   K++ N L+K KRF++A E Y     IK ++D V  S   N++AC + + +  + + 
Sbjct: 78  AENFKNQANDLYKAKRFKEAREVYKKGIEIKCNDDKVNESLFANLAACELEIKNFRRCIN 137

Query: 148 SSTRALELKPDYSKALLRRASAYENMGRYQDA 179
              +AL+  P   K   R A A+  + +  +A
Sbjct: 138 LCQKALQFNPKNMKCYYRIAKAFYQLNKLDEA 169

>Kpol_1018.106 s1018 (280224..282485) [2262 bp, 753 aa] {ON}
           (280224..282485) [2262 nt, 754 aa]
          Length = 753

 Score = 44.3 bits (103), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 42/154 (27%), Positives = 70/154 (45%), Gaps = 2/154 (1%)

Query: 327 NDLDNSEKNL-KEALALHPR-VNTYIYLALTMADRGQSEDYFSYFEKAIALDPNNAAVYY 384
           ND  ++ KN  ++ALA  P+  N Y  L ++    GQ ++   +FEKA +++P N  +  
Sbjct: 582 NDSFDTAKNCYRKALACDPQHYNAYYGLGMSCMKLGQYDEALLHFEKARSINPINVILIC 641

Query: 385 HRGQMYFITQNYEKAGEDFKKSKESDPKNIFPYIQLACLAYRENKMAECEKLFEEARKTF 444
             G      Q  EKA   ++ + E  P +     + A L Y   + +   + FEE  K  
Sbjct: 642 CCGVALEKLQYQEKALSYYELACELQPSSSLANFKRAHLLYSMGRYSVALQYFEELTKLA 701

Query: 445 PTAPEVPNFYAEILADKGDIDEAVKQYNIAYRLE 478
           P    V     ++    G   +AVK++ IA  L+
Sbjct: 702 PDEATVHFLLGQLYQILGRKKDAVKEFTIAMNLD 735

 Score = 36.6 bits (83), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 25/98 (25%), Positives = 44/98 (44%)

Query: 348 TYIYLALTMADRGQSEDYFSYFEKAIALDPNNAAVYYHRGQMYFITQNYEKAGEDFKKSK 407
           T+  +   ++ +   ED    FEKA  +DPN A  Y  +G  +    +++ A   ++K+ 
Sbjct: 537 TWCCMGNFLSLQKDHEDAIKAFEKATQVDPNFAYAYTLQGHEHSSNDSFDTAKNCYRKAL 596

Query: 408 ESDPKNIFPYIQLACLAYRENKMAECEKLFEEARKTFP 445
             DP++   Y  L     +  +  E    FE+AR   P
Sbjct: 597 ACDPQHYNAYYGLGMSCMKLGQYDEALLHFEKARSINP 634

 Score = 32.0 bits (71), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 35/167 (20%), Positives = 63/167 (37%), Gaps = 13/167 (7%)

Query: 387 GQMYFITQNYEKAGEDFKKSKESDPKNIFPYIQLACLAYRENKMAECEKLFEEARKTFPT 446
           G+++F   NY+ +   F   ++  P  +      + L +  +   +   L  E     P 
Sbjct: 474 GKLHFELVNYDVSLHYFTNLRKLQPTRVSDLEIYSTLLWHLHDKVKLSILANELVMNIPN 533

Query: 447 APEVPNFYAEILADKGDIDEAVKQYNIAYRLESLQKQIHVGIAPLVGKATILARQPTPEN 506
           AP+        L+ + D ++A+K +  A +++           P    A  L       N
Sbjct: 534 APQTWCCMGNFLSLQKDHEDAIKAFEKATQVD-----------PNFAYAYTLQGHEHSSN 582

Query: 507 --FATISQLLEDACKADPRSEQAKVGLAQLRLQQEKVDEAIELFEEA 551
             F T       A   DP+   A  GL    ++  + DEA+  FE+A
Sbjct: 583 DSFDTAKNCYRKALACDPQHYNAYYGLGMSCMKLGQYDEALLHFEKA 629

>TPHA0D03860 Chr4 (807913..808275) [363 bp, 120 aa] {ON} Anc_6.328
           YCR060W
          Length = 120

 Score = 41.2 bits (95), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 27/88 (30%), Positives = 42/88 (47%), Gaps = 6/88 (6%)

Query: 97  KDKGNALFKEKRFEDAIEFYNHAIKLH-EDPVFHSNISACYVSLGDLDKVVESSTRALEL 155
           K++GN  FKE  ++ A E Y   + +  E+P+ +SN +   + LG   +VVE   + L  
Sbjct: 7   KEEGNRNFKEGSYKVAAELYQKCVDIEPENPIGYSNKAMALIKLGRYTEVVELCRKGLTF 66

Query: 156 KPD-----YSKALLRRASAYENMGRYQD 178
            P+     Y K   R   A +NM    D
Sbjct: 67  TPNTTDTVYKKLNYRLEMALKNMKHVND 94

>Skud_15.168 Chr15 complement(298955..300001) [1047 bp, 348 aa] {ON}
           YOR007C (REAL)
          Length = 348

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 42/144 (29%), Positives = 75/144 (52%), Gaps = 9/144 (6%)

Query: 90  KVYATALKDKGNALFKEKRFEDAIEFYNHAIK-LHEDPVFHSNISACYVSLGDLDKVVES 148
           K  A  LK +GN     K +E AI  Y  AIK L  + ++++N +A + SL   D+ VE 
Sbjct: 99  KAKAEDLKMQGNKAMANKDYELAINKYTEAIKVLPTNAIYYANRAAAHSSLKGYDEAVED 158

Query: 149 STRALELKPDYSKALLRRASAYENMGRYQDAMFDI-SVLSLNGDFNGSSIEPMLERNLNK 207
           +  A+ + P Y +   R   A    G+ ++A+     VL + GD   ++ E M +R+  +
Sbjct: 159 AESAISIDPTYFRGYSRLGFAKYAQGKPEEALEAYKKVLDIEGD---NATEAM-KRDY-E 213

Query: 208 QALRVLKEDMGIDASVPQAEQPRE 231
            A + +++ + ++ +VP  EQ R+
Sbjct: 214 SAKKKVEQSLNLEKTVP--EQSRD 235

>KAFR0B06610 Chr2 (1372434..1373969) [1536 bp, 511 aa] {ON}
           Anc_3.481 YGR123C
          Length = 511

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 30/97 (30%), Positives = 49/97 (50%), Gaps = 5/97 (5%)

Query: 93  ATALKDKGNALFKEKRFEDAIEFYNHAIKLHEDP---VFHSNISACYVSLGDLDKVVESS 149
           AT+ KD+GN   K++ F+ A E Y  AI+   DP   +F+SN +   + L +    +   
Sbjct: 9   ATSYKDEGNKFLKQQDFQRANELYTKAIE--TDPTQSIFYSNRALANLKLDNFMNALNDC 66

Query: 150 TRALELKPDYSKALLRRASAYENMGRYQDAMFDISVL 186
           T A+EL     KA  RR  A   +  ++ A  D +++
Sbjct: 67  TNAIELNSSNLKAYHRRGLANIGLLNFKSARNDFNIV 103

>Skud_7.432 Chr7 complement(715852..717393) [1542 bp, 513 aa] {ON}
           YGR123C (REAL)
          Length = 513

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 31/106 (29%), Positives = 53/106 (50%), Gaps = 1/106 (0%)

Query: 82  LASSEDQKKVYATALKDKGNALFKEKRFEDAIEFYNHAIKLHE-DPVFHSNISACYVSLG 140
           +++  +  +V A   K++GN L KEK F  AIE Y  AI L     ++ SN +  +  + 
Sbjct: 1   MSNPTEADRVKAHERKNEGNVLVKEKHFLKAIEKYTEAIDLDSTQTIYFSNRALSHFKVD 60

Query: 141 DLDKVVESSTRALELKPDYSKALLRRASAYENMGRYQDAMFDISVL 186
           +    +     A++L P   KA  RRA +   +  ++ A  D++VL
Sbjct: 61  NFQSALNDCDEAIKLDPKNIKAYHRRALSCMALLEFKKAKRDLNVL 106

 Score = 32.7 bits (73), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 21/66 (31%), Positives = 35/66 (53%), Gaps = 2/66 (3%)

Query: 369 FEKAIALDPNNAAVYYHRGQMYFITQNYEKAGEDFKKSKESDPKNIFPYIQ--LACLAYR 426
           + +AI LD      + +R   +F   N++ A  D  ++ + DPKNI  Y +  L+C+A  
Sbjct: 35  YTEAIDLDSTQTIYFSNRALSHFKVDNFQSALNDCDEAIKLDPKNIKAYHRRALSCMALL 94

Query: 427 ENKMAE 432
           E K A+
Sbjct: 95  EFKKAK 100

>YOR007C Chr15 complement(338938..339978) [1041 bp, 346 aa] {ON}
           SGT2Glutamine-rich cytoplasmic protein that serves as a
           scaffold for binding Get4/5p and other proteins required
           to mediate posttranslational insertion of tail-anchored
           proteins into the ER membrane; has similarity to human
           cochaperone SGT
          Length = 346

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 41/146 (28%), Positives = 77/146 (52%), Gaps = 9/146 (6%)

Query: 88  QKKVYATALKDKGNALFKEKRFEDAIEFYNHAIK-LHEDPVFHSNISACYVSLGDLDKVV 146
           + K  A  LK +GN     K +E AI  Y  AIK L  + ++++N +A + SL + D+ V
Sbjct: 97  ETKAKAEDLKMQGNKAMANKDYELAINKYTEAIKVLPTNAIYYANRAAAHSSLKEYDQAV 156

Query: 147 ESSTRALELKPDYSKALLRRASAYENMGRYQDAMFDI-SVLSLNGDFNGSSIEPMLERNL 205
           + +  A+ + P Y +   R   A    G+ ++A+     VL + GD   ++ E M +R+ 
Sbjct: 157 KDAESAISIDPSYFRGYSRLGFAKYAQGKPEEALEAYKKVLDIEGD---NATEAM-KRDY 212

Query: 206 NKQALRVLKEDMGIDASVPQAEQPRE 231
            + A + +++ + ++ +VP  EQ R+
Sbjct: 213 -ESAKKKVEQSLNLEKTVP--EQSRD 235

>KNAG0H00610 Chr8 (99931..102852) [2922 bp, 973 aa] {ON} Anc_3.367
           YBR112C
          Length = 973

 Score = 43.5 bits (101), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 28/129 (21%), Positives = 61/129 (47%), Gaps = 17/129 (13%)

Query: 366 FSYFEKAIALDPNNAAVYYHRGQMYFITQNYEKAGEDFKKSKESDPKNIFPYIQLACLAY 425
            +Y  K++ +DP++A  +YH G+++ +  +Y  A + F+++   D +N   +  +  L Y
Sbjct: 301 LNYLLKSLEVDPSDATTWYHLGRVHMVRSDYTAAYDAFQQAVNRDSRNPIFWCSIGVLYY 360

Query: 426 RENKMAECEKLFEEARKTFPTAPEVPNFYAEILADKGDIDE--------AVKQYNIAYRL 477
           + ++  +    +  A +  P       + +E+  D G + E        A+  Y  A RL
Sbjct: 361 QISQYRDALDAYTRAIRLNP-------YISEVWYDLGTLYETCNNQLTDALDAYKQAARL 413

Query: 478 ESLQKQIHV 486
           +   + IH+
Sbjct: 414 DP--ENIHI 420

>ZYRO0C16522g Chr3 complement(1281166..1284090) [2925 bp, 974 aa]
           {ON} highly similar to uniprot|P14922 Saccharomyces
           cerevisiae YBR112C CYC8 General transcriptional co-
           repressor acts together with Tup1p also acts as part of
           a transcriptional co-activator complex that recruits the
           SWI/SNF and SAGA complexes to promoters
          Length = 974

 Score = 43.5 bits (101), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 22/101 (21%), Positives = 50/101 (49%), Gaps = 7/101 (6%)

Query: 366 FSYFEKAIALDPNNAAVYYHRGQMYFITQNYEKAGEDFKKSKESDPKNIFPYIQLACLAY 425
            S+  K++ +DP++A  +YH G+++ I  +Y  A + F+++   D +N   +  +  L Y
Sbjct: 290 LSFLSKSLEVDPSDATTWYHLGRVHMIRSDYTAAYDAFQQAVNRDSRNPIFWCSIGVLYY 349

Query: 426 RENKMAECEKLFEEARKTFPTAPEVPNFYAEILADKGDIDE 466
           + ++  +    +  A +  P       + +E+  D G + E
Sbjct: 350 QISQYRDALDAYTRAIRLNP-------YISEVWYDLGTLYE 383

>CAGL0D01364g Chr4 (152033..155479) [3447 bp, 1148 aa] {ON} similar
           to uniprot|P14922 Saccharomyces cerevisiae YBR112c CYC8
           general repressor of transcription
          Length = 1148

 Score = 43.1 bits (100), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 29/129 (22%), Positives = 61/129 (47%), Gaps = 17/129 (13%)

Query: 366 FSYFEKAIALDPNNAAVYYHRGQMYFITQNYEKAGEDFKKSKESDPKNIFPYIQLACLAY 425
            SY  K++ +DP++A  +YH G+++ I  +Y  A + F+++   D +N   +  +  L Y
Sbjct: 284 LSYLLKSLEVDPSDATTWYHLGRVHMIRSDYTAAYDAFQQAVNRDSRNPIFWCSIGVLYY 343

Query: 426 RENKMAECEKLFEEARKTFPTAPEVPNFYAEILADKG--------DIDEAVKQYNIAYRL 477
           + ++  +    +  A +  P       + +E+  D G         + +A+  Y  A RL
Sbjct: 344 QISQYRDALDAYTRAIRLNP-------YISEVWYDLGTLYETCNNQLSDALDAYKQAARL 396

Query: 478 ESLQKQIHV 486
           +   + IH+
Sbjct: 397 DP--ENIHI 403

>NCAS0A00490 Chr1 complement(76652..78514) [1863 bp, 620 aa] {ON} 
          Length = 620

 Score = 43.1 bits (100), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 34/118 (28%), Positives = 58/118 (49%), Gaps = 8/118 (6%)

Query: 82  LASSEDQKKVYATALKDKGNALFKEKRFEDAIEFYNHAIKLHEDPVFHSNISACYVSLGD 141
           L+  E +KK  A   K  GN L+K++ F++AI  Y  A    +D  + +NI A     GD
Sbjct: 284 LSPEETEKKRRADEEKRIGNDLYKKRNFKEAIIHYTKAWNTFQDITYLNNIGAAQFERGD 343

Query: 142 LDKVVESSTRAL----ELKPD---YSKALLRRASAYENMGRYQDAMFDISV-LSLNGD 191
              V++S  +A+       P+    +K+ +R  +AY  +  ++ A+      L LNG+
Sbjct: 344 YGNVLKSLGQAVFFAEHTNPEPQVLAKSYIRMGNAYHRIWDHEHAITAYEYGLMLNGN 401

 Score = 42.4 bits (98), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 23/86 (26%), Positives = 43/86 (50%), Gaps = 2/86 (2%)

Query: 96  LKDKGNALFKEKRFEDAIEFYNHAIKL--HEDPVFHSNISACYVSLGDLDKVVESSTRAL 153
           LK+ GN  +KEK +E A+ ++  A+        + +SN +A ++ L    + +E     +
Sbjct: 11  LKELGNKTYKEKGYEQAVHYFTSALSQPSTNKHILYSNRAAAHIGLKHYAEALEDGKNCV 70

Query: 154 ELKPDYSKALLRRASAYENMGRYQDA 179
           EL P++ K   R   AY  + +  +A
Sbjct: 71  ELAPNWDKGYSRVGVAYLGLQKLDEA 96

 Score = 34.3 bits (77), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 30/111 (27%), Positives = 52/111 (46%), Gaps = 8/111 (7%)

Query: 67  LTINGDEE-KPDMAAMLASSEDQKKVYATALKD------KGNALFKEKRFEDAIEFYNHA 119
           L +NG+EE K  +A++    E  KK     L+       +G   F  + +  A++ Y   
Sbjct: 396 LMLNGNEEHKKKLASLRVEFEKVKKGEFIDLQKFEEARIEGKQHFLNREYFKAMKCYTEM 455

Query: 120 IKLH-EDPVFHSNISACYVSLGDLDKVVESSTRALELKPDYSKALLRRASA 169
           IK +   PV   N +A +  L    +V++   +A+ + P Y KA +R+  A
Sbjct: 456 IKTNPTSPVGWCNRAAVFEKLLTCPQVIDDCDKAISVDPSYIKAYVRKGFA 506

>TPHA0M01630 Chr13 complement(340500..343631) [3132 bp, 1043 aa]
           {ON} Anc_3.367 YBR112C
          Length = 1043

 Score = 43.1 bits (100), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 32/134 (23%), Positives = 61/134 (45%), Gaps = 26/134 (19%)

Query: 371 KAIALDPNNAAVYYHRGQMYFITQNYEKAGEDFKKSKESDPKNIFPYIQLACLAYRENKM 430
           K++ +DP++AA +YH G+++ I  +Y  A + F+++   D +N   +  +  L Y+ ++ 
Sbjct: 296 KSLEIDPSDAATWYHLGRVHMIRADYTAAYDAFQQAVNRDSRNPIFWCSIGVLYYQISQY 355

Query: 431 AECEKLFEEARKTFPTAPEVPNFYAEILADKGDIDEAV-KQYN----------------- 472
            +    +  A +  P       + +E+  D G + E   KQ N                 
Sbjct: 356 RDALDAYTRAIRLNP-------YISEVWYDLGTLYETCNKQLNDALDAYKQAARLDPDNV 408

Query: 473 -IAYRLESLQKQIH 485
            I  RLESL +Q+ 
Sbjct: 409 HIRERLESLAQQLQ 422

>TDEL0G04480 Chr7 (813648..814679) [1032 bp, 343 aa] {ON} Anc_6.21
           YOR007C
          Length = 343

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 37/140 (26%), Positives = 70/140 (50%), Gaps = 13/140 (9%)

Query: 54  ATASEPATSDKAYLTINGDEEKPDMAAMLASSEDQKKVYATALKDKGNALFKEKRFEDAI 113
            ++SE AT+    + +N           + + + + K  A  LK +GN     K F+ AI
Sbjct: 69  GSSSETATTQAESIKVN-----------IPAEDAETKAKAETLKLEGNKAMACKDFDLAI 117

Query: 114 EFYNHAIK-LHEDPVFHSNISACYVSLGDLDKVVESSTRALELKPDYSKALLRRASAYEN 172
           + Y+ AI+ L  + V+++N +A + S+   ++ ++ +  A++  P YSK   R   A   
Sbjct: 118 KKYSDAIEVLPTNAVYYANRAAAHSSMKAYEEAIKDAESAIKTDPTYSKGYSRLGYAKFA 177

Query: 173 MGRYQDAMFDI-SVLSLNGD 191
           +G+ +DA+     VL + GD
Sbjct: 178 LGQAEDALEAYKKVLDIEGD 197

>NDAI0C05290 Chr3 (1224979..1226118) [1140 bp, 379 aa] {ON}
           Anc_8.506 YBR155W
          Length = 379

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 27/95 (28%), Positives = 46/95 (48%), Gaps = 10/95 (10%)

Query: 93  ATALKDKGNALFKEKRFEDAIEFY--------NHAIKLHEDPVFHSNISACYVSLGDLDK 144
           A   K++GN L+K KRF+DA + Y        N  +K+ E     +N +AC + L +  +
Sbjct: 76  AENFKNQGNDLYKAKRFKDARDVYLKGIQIENNKDVKIKES--LFANKAACELELKNFRR 133

Query: 145 VVESSTRALELKPDYSKALLRRASAYENMGRYQDA 179
            +     AL+L P   K   R   A+  + + ++A
Sbjct: 134 CINDCKNALQLNPKNVKCYFRMTRAFFALDKLEEA 168

>Ecym_4413 Chr4 complement(856330..857862) [1533 bp, 510 aa] {ON}
           similar to Ashbya gossypii AAR083C
          Length = 510

 Score = 42.4 bits (98), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 29/91 (31%), Positives = 43/91 (47%), Gaps = 1/91 (1%)

Query: 97  KDKGNALFKEKRFEDAIEFYNHAIKLHE-DPVFHSNISACYVSLGDLDKVVESSTRALEL 155
           KD+GN     K +  AIE Y  AI+L     +F SN +   + L      +E S++A+EL
Sbjct: 13  KDQGNKFVASKDYGQAIEAYTKAIELDGCQSIFFSNRALANLKLDRFQSALEDSSKAIEL 72

Query: 156 KPDYSKALLRRASAYENMGRYQDAMFDISVL 186
                K   RR  AY  +  +  A  D+ V+
Sbjct: 73  DSSNVKGYHRRGMAYAGLQDFISAKRDLEVV 103

>Suva_4.361 Chr4
           complement(631697..632812,632933..633154,633188..634741)
           [2892 bp, 963 aa] {ON} YBR112C (REAL)
          Length = 963

 Score = 42.4 bits (98), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 30/138 (21%), Positives = 59/138 (42%), Gaps = 26/138 (18%)

Query: 366 FSYFEKAIALDPNNAAVYYHRGQMYFITQNYEKAGEDFKKSKESDPKNIFPYIQLACLAY 425
             Y  K++  DP++A  +YH G+++ I  +Y  A + F+++   D +N   +  +  L Y
Sbjct: 286 LDYLLKSLEADPSDATTWYHLGRVHMIRTDYTAAYDAFQQAVNRDSRNPIFWCSIGVLYY 345

Query: 426 RENKMAECEKLFEEARKTFPTAPEVPNFYAEILADKGDIDEA------------------ 467
           + ++  +    +  A +  P       + +E+  D G + E                   
Sbjct: 346 QISQYRDALDAYTRAIRLNP-------YISEVWYDLGTLYETCNNQLSDALDAYKQAARL 398

Query: 468 -VKQYNIAYRLESLQKQI 484
            V   +I  RLE+L KQ+
Sbjct: 399 DVNNIHIRERLEALTKQL 416

>Kpol_505.41 s505 complement(91130..92671) [1542 bp, 513 aa] {ON}
           complement(91130..92671) [1542 nt, 514 aa]
          Length = 513

 Score = 42.4 bits (98), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 33/106 (31%), Positives = 51/106 (48%), Gaps = 7/106 (6%)

Query: 84  SSEDQKKVYATALKDKGNALFKEKRFEDAIEFYNHAIKLHEDP---VFHSNISACYVSLG 140
           ++ED  K  A   K++GN   KE+ +  AIE Y  AI+L  DP   +F+SN +   + L 
Sbjct: 5   TAEDIAK--AVEFKNEGNVFIKEQNYSKAIELYTKAIEL--DPNQSIFYSNRALAQLKLD 60

Query: 141 DLDKVVESSTRALELKPDYSKALLRRASAYENMGRYQDAMFDISVL 186
           +          AL L     KA  RR  A   +  ++ A  D++V+
Sbjct: 61  NFQSAYNDCNEALTLDSKNVKAYHRRGLANVGLLEFKRARNDLNVV 106

>Smik_2.254 Chr2 complement(447517..450579) [3063 bp, 1020 aa] {ON}
           YBR112C (REAL)
          Length = 1020

 Score = 42.4 bits (98), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 30/138 (21%), Positives = 59/138 (42%), Gaps = 26/138 (18%)

Query: 366 FSYFEKAIALDPNNAAVYYHRGQMYFITQNYEKAGEDFKKSKESDPKNIFPYIQLACLAY 425
             Y  K++  DP++A  +YH G+++ I  +Y  A + F+++   D +N   +  +  L Y
Sbjct: 284 LDYLLKSLEADPSDATTWYHLGRVHMIRTDYTAAYDAFQQAVNRDSRNPIFWCSIGVLYY 343

Query: 426 RENKMAECEKLFEEARKTFPTAPEVPNFYAEILADKGDIDEA------------------ 467
           + ++  +    +  A +  P       + +E+  D G + E                   
Sbjct: 344 QISQYRDALDAYTRAIRLNP-------YISEVWYDLGTLYETCNNQLSDALDAYKQAARL 396

Query: 468 -VKQYNIAYRLESLQKQI 484
            V   +I  RLE+L KQ+
Sbjct: 397 DVNNVHIRERLEALTKQL 414

>YBR112C Chr2 complement(462870..465770) [2901 bp, 966 aa] {ON}
           CYC8General transcriptional co-repressor, acts together
           with Tup1p; also acts as part of a transcriptional
           co-activator complex that recruits the SWI/SNF and SAGA
           complexes to promoters; can form the prion [OCT+]
          Length = 966

 Score = 42.4 bits (98), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 30/138 (21%), Positives = 59/138 (42%), Gaps = 26/138 (18%)

Query: 366 FSYFEKAIALDPNNAAVYYHRGQMYFITQNYEKAGEDFKKSKESDPKNIFPYIQLACLAY 425
             Y  K++  DP++A  +YH G+++ I  +Y  A + F+++   D +N   +  +  L Y
Sbjct: 282 LDYLLKSLEADPSDATTWYHLGRVHMIRTDYTAAYDAFQQAVNRDSRNPIFWCSIGVLYY 341

Query: 426 RENKMAECEKLFEEARKTFPTAPEVPNFYAEILADKGDIDEA------------------ 467
           + ++  +    +  A +  P       + +E+  D G + E                   
Sbjct: 342 QISQYRDALDAYTRAIRLNP-------YISEVWYDLGTLYETCNNQLSDALDAYKQAARL 394

Query: 468 -VKQYNIAYRLESLQKQI 484
            V   +I  RLE+L KQ+
Sbjct: 395 DVNNVHIRERLEALTKQL 412

>TBLA0D00460 Chr4 complement(113831..116338) [2508 bp, 835 aa] {ON}
           Anc_7.412 YBL084C
          Length = 835

 Score = 42.4 bits (98), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 39/112 (34%), Positives = 55/112 (49%), Gaps = 12/112 (10%)

Query: 318 YLGIFDFLKNDLDNSEKNLKEALALHPRVNTYIYLALTMADRGQ-SEDYF----SYFEKA 372
           ++G +  L ND D + K LK+A  ++PR  TY Y   T+    Q S D F    + + KA
Sbjct: 623 FIGNYFSLINDHDKAIKYLKKATTINPRF-TYAY---TLEGHEQASIDAFDTAKNCYRKA 678

Query: 373 IALDPNNAAVYYHRGQMYFITQNYEKAGEDFKKSKESDPKNIFPYIQLACLA 424
           IA DPN+   YY  G        Y++A   F+K+K  +P N    I L C  
Sbjct: 679 IACDPNHYNAYYGLGTCCMRLGQYDQALLYFEKAKMINPSNA---ILLCCCG 727

>KNAG0F04010 Chr6 (757749..762005) [4257 bp, 1418 aa] {ON} Anc_7.546
           YPR189W
          Length = 1418

 Score = 42.4 bits (98), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 22/80 (27%), Positives = 41/80 (51%), Gaps = 2/80 (2%)

Query: 338 EALALHPRVNTYIYLALTMA--DRGQSEDYFSYFEKAIALDPNNAAVYYHRGQMYFITQN 395
           EA+ +  R   + Y  + +A  +R Q  +   +F  A+ +DPN+   +   GQ YF    
Sbjct: 675 EAIKMELRSTNWPYRVIGIAYLERQQESESVEWFHSALRVDPNDVESWVALGQAYFACGR 734

Query: 396 YEKAGEDFKKSKESDPKNIF 415
            E + + F+K+ E DP +++
Sbjct: 735 VEASTKVFEKAIEIDPLHLY 754

>Suva_7.408 Chr7 complement(706942..708483) [1542 bp, 513 aa] {ON}
           YGR123C (REAL)
          Length = 513

 Score = 42.0 bits (97), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 29/91 (31%), Positives = 45/91 (49%), Gaps = 1/91 (1%)

Query: 97  KDKGNALFKEKRFEDAIEFYNHAIKLHE-DPVFHSNISACYVSLGDLDKVVESSTRALEL 155
           K++GN   KEK F  AIE Y  AI L     ++ SN +  +  + +    +     AL+L
Sbjct: 16  KNEGNVFIKEKHFLKAIEKYTQAIDLDSTQSIYFSNRAFAHFKVDNFQSALNDCDEALKL 75

Query: 156 KPDYSKALLRRASAYENMGRYQDAMFDISVL 186
            P   KA  RRA +   +  ++ A  D++VL
Sbjct: 76  DPKNIKAYHRRALSCMALLEFKKAKKDLTVL 106

 Score = 33.1 bits (74), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 21/66 (31%), Positives = 36/66 (54%), Gaps = 2/66 (3%)

Query: 369 FEKAIALDPNNAAVYYHRGQMYFITQNYEKAGEDFKKSKESDPKNIFPYIQ--LACLAYR 426
           + +AI LD   +  + +R   +F   N++ A  D  ++ + DPKNI  Y +  L+C+A  
Sbjct: 35  YTQAIDLDSTQSIYFSNRAFAHFKVDNFQSALNDCDEALKLDPKNIKAYHRRALSCMALL 94

Query: 427 ENKMAE 432
           E K A+
Sbjct: 95  EFKKAK 100

>NCAS0E02490 Chr5 complement(493779..496208) [2430 bp, 809 aa] {ON}
           Anc_7.412 YBL084C
          Length = 809

 Score = 42.0 bits (97), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 37/137 (27%), Positives = 58/137 (42%), Gaps = 1/137 (0%)

Query: 342 LHPRVNTYIYLALTMADRGQSEDYFSYFEKAIALDPNNAAVYYHRGQMYFITQNYEKAGE 401
           LH   N Y  + +     G+ E    YFEKA +++P+NA +    G       N EKA  
Sbjct: 655 LH-HYNAYYGMGMCSMKLGEYEQALVYFEKARSINPSNAILICCCGVTMEKLGNQEKALN 713

Query: 402 DFKKSKESDPKNIFPYIQLACLAYRENKMAECEKLFEEARKTFPTAPEVPNFYAEILADK 461
            ++ + +  P +     + A L Y   K  +    FEE  K  P    V     ++    
Sbjct: 714 YYELACQIQPTSSLAKFKRAHLLYSMAKYTQALDAFEELIKIAPEEATVQFILGQLYQIM 773

Query: 462 GDIDEAVKQYNIAYRLE 478
           G   +A+K+Y IA  L+
Sbjct: 774 GRKKDAIKRYTIAMNLD 790

 Score = 36.6 bits (83), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 39/187 (20%), Positives = 66/187 (35%), Gaps = 43/187 (22%)

Query: 369 FEKAIALDPNNAAVYYHRGQMYFITQNYEKAGEDFKKSKESDPKNIFPYIQLACLAYREN 428
           F+KA  LDPN    Y  +G  Y    +Y+ A   ++K+  +D  +   Y  +   + +  
Sbjct: 613 FDKATKLDPNFVYAYTLQGHEYLSMDSYDTAKTFYRKAISNDLHHYNAYYGMGMCSMKLG 672

Query: 429 KMAECEKLFEEARKTFPTAPEVPNFYAEILADKGDIDEAVKQYNIAYRLESLQKQIHVGI 488
           +  +    FE+AR   P+   +       +   G+ ++A+  Y                 
Sbjct: 673 EYEQALVYFEKARSINPSNAILICCCGVTMEKLGNQEKALNYY----------------- 715

Query: 489 APLVGKATILARQPTPENFATISQLLEDACKADPRSEQAKVGLAQLRLQQEKVDEAIELF 548
                                     E AC+  P S  AK   A L     K  +A++ F
Sbjct: 716 --------------------------ELACQIQPTSSLAKFKRAHLLYSMAKYTQALDAF 749

Query: 549 EEAAKMA 555
           EE  K+A
Sbjct: 750 EELIKIA 756

>TBLA0H03380 Chr8 (829314..830441) [1128 bp, 375 aa] {ON} Anc_8.506
           YBR155W
          Length = 375

 Score = 41.6 bits (96), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 25/92 (27%), Positives = 45/92 (48%), Gaps = 5/92 (5%)

Query: 93  ATALKDKGNALFKEKRFEDAIEFYNHAI--KLHEDPV---FHSNISACYVSLGDLDKVVE 147
           A   K++GN  +K K++ DA E Y   I  K  +D +    ++N +AC + L +  K +E
Sbjct: 74  AGNFKNRGNEFYKLKQYRDAREVYTKGIDVKCDDDKINESLYANRAACELELKNFRKCIE 133

Query: 148 SSTRALELKPDYSKALLRRASAYENMGRYQDA 179
              +AL       K   R   A+ ++ R+ ++
Sbjct: 134 DCKKALSFNVKNIKCYYRMGKAFLSVDRFDES 165

>KNAG0I02520 Chr9 complement(487699..488052) [354 bp, 117 aa] {ON}
           Anc_6.328 YCR060W
          Length = 117

 Score = 39.3 bits (90), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 24/91 (26%), Positives = 44/91 (48%), Gaps = 8/91 (8%)

Query: 95  ALKDKGNALFKEKRFEDAIEFYNHAIKLH-EDPVFHSNISACYVSLGDLDKVVESSTRAL 153
            +K++GN  F+   F  A E+Y   I L  E+P+ +SN +   + L    + +++  R L
Sbjct: 6   TVKEQGNVAFRNSNFSSAAEYYGKCICLEPENPIGYSNRAMALIKLQKFSETIDTCQRGL 65

Query: 154 -------ELKPDYSKALLRRASAYENMGRYQ 177
                  + +P   K L R   A E++ ++Q
Sbjct: 66  GKLEDNEKDEPIRKKLLYRLHLAQESLNKFQ 96

>Skud_2.240 Chr2 complement(431507..434461) [2955 bp, 984 aa] {ON}
           YBR112C (REAL)
          Length = 984

 Score = 42.0 bits (97), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 30/138 (21%), Positives = 59/138 (42%), Gaps = 26/138 (18%)

Query: 366 FSYFEKAIALDPNNAAVYYHRGQMYFITQNYEKAGEDFKKSKESDPKNIFPYIQLACLAY 425
             Y  K++  DP++A  +YH G+++ I  +Y  A + F+++   D +N   +  +  L Y
Sbjct: 276 LDYLLKSLEADPSDATTWYHLGRVHMIRTDYTAAYDAFQQAVNRDSRNPIFWCSIGVLYY 335

Query: 426 RENKMAECEKLFEEARKTFPTAPEVPNFYAEILADKGDIDEA------------------ 467
           + ++  +    +  A +  P       + +E+  D G + E                   
Sbjct: 336 QISQYRDALDAYTRAIRLNP-------YISEVWYDLGTLYETCNNQLSDALDAYKQAARL 388

Query: 468 -VKQYNIAYRLESLQKQI 484
            V   +I  RLE+L KQ+
Sbjct: 389 DVNNVHIRERLEALTKQL 406

>KAFR0H00870 Chr8 (162118..164781) [2664 bp, 887 aa] {ON} Anc_3.367
           YBR112C
          Length = 887

 Score = 42.0 bits (97), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 16/61 (26%), Positives = 35/61 (57%)

Query: 366 FSYFEKAIALDPNNAAVYYHRGQMYFITQNYEKAGEDFKKSKESDPKNIFPYIQLACLAY 425
            +Y  K++ +DP++A  +YH G+++ I  +Y  A + F+++   D +N   +  +  L Y
Sbjct: 290 LNYLLKSLEVDPSDATTWYHLGRVHMIRSDYTAAYDAFQQAVNRDSRNPIFWCSIGVLYY 349

Query: 426 R 426
           +
Sbjct: 350 Q 350

>Ecym_2559 Chr2 (1089202..1090314) [1113 bp, 370 aa] {ON} similar to
           Ashbya gossypii AGL268C
          Length = 370

 Score = 41.2 bits (95), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 26/92 (28%), Positives = 44/92 (47%), Gaps = 5/92 (5%)

Query: 93  ATALKDKGNALFKEKRFEDAIEFYNHAI--KLHEDPV---FHSNISACYVSLGDLDKVVE 147
           A   K++GN L+K KR++DA   Y+  I  K  +D +    + N +AC + L +    + 
Sbjct: 79  AANFKNQGNDLYKVKRYKDARTMYSKGIEVKCEDDSINGSLYLNRAACELELRNFRSCIN 138

Query: 148 SSTRALELKPDYSKALLRRASAYENMGRYQDA 179
              +AL       KA  R   AY  + + ++A
Sbjct: 139 DCKKALNFNAKCVKAFYRMGQAYFKLKKLEEA 170

>CAGL0C01903g Chr3 complement(199487..201796) [2310 bp, 769 aa] {ON}
           similar to uniprot|P38042 Saccharomyces cerevisiae
           YBL084c CDC27 subunit of anaphase-promoting complex
          Length = 769

 Score = 41.6 bits (96), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 38/159 (23%), Positives = 69/159 (43%), Gaps = 1/159 (0%)

Query: 327 NDLDNSEKNLKEALALHPR-VNTYIYLALTMADRGQSEDYFSYFEKAIALDPNNAAVYYH 385
           +  D ++K  ++A+A  PR  N Y  + +     G  ++   YFEKA  + P NA +   
Sbjct: 599 DSFDAAKKCFRKAIACDPRHYNAYYGMGIYSMKLGHYDEALLYFEKARQIYPINAVLICC 658

Query: 386 RGQMYFITQNYEKAGEDFKKSKESDPKNIFPYIQLACLAYRENKMAECEKLFEEARKTFP 445
            G      +  +KA E ++ +    P +     + A L Y   +     + FEE  K  P
Sbjct: 659 CGVALEKLEYQDKALEYYELACTLQPNSNLARFKRANLLYAMGRYNLALQSFEELSKLTP 718

Query: 446 TAPEVPNFYAEILADKGDIDEAVKQYNIAYRLESLQKQI 484
             P V     ++    G  +EA++++ +A  L+    Q+
Sbjct: 719 EEPTVHFVLGQLYQIMGRKNEAIREFTVAMNLDPKGNQL 757

 Score = 37.7 bits (86), Expect = 0.082,   Method: Compositional matrix adjust.
 Identities = 24/98 (24%), Positives = 45/98 (45%)

Query: 348 TYIYLALTMADRGQSEDYFSYFEKAIALDPNNAAVYYHRGQMYFITQNYEKAGEDFKKSK 407
           T+  +   ++ +   ED    FEKA  +DP  A  Y  +G       +++ A + F+K+ 
Sbjct: 553 TWCCVGNYLSLKKDHEDAIEAFEKATKIDPKFAYAYTLQGHECSSNDSFDAAKKCFRKAI 612

Query: 408 ESDPKNIFPYIQLACLAYRENKMAECEKLFEEARKTFP 445
             DP++   Y  +   + +     E    FE+AR+ +P
Sbjct: 613 ACDPRHYNAYYGMGIYSMKLGHYDEALLYFEKARQIYP 650

>Kpol_172.2 s172 (4270..5523) [1254 bp, 418 aa] {ON} (4270..5523)
           [1254 nt, 418 aa]
          Length = 418

 Score = 40.4 bits (93), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 21/94 (22%), Positives = 47/94 (50%), Gaps = 7/94 (7%)

Query: 375 LDPNNAAVYYHRGQMYFITQNYEKAGEDFKKSKESDPKNIFPYIQLACLAYRENKMAECE 434
           +DP++AA +YH G+++ I  +Y  A + F+++   D +N   +  +  L Y+ ++     
Sbjct: 308 IDPSDAATWYHLGRVHMIRTDYTAAYDAFQQAVNRDSRNPIFWCSIGVLYYQISQ----- 362

Query: 435 KLFEEARKTFPTAPEVPNFYAEILADKGDIDEAV 468
             + +A   +  A  +  + +E+  D G + E  
Sbjct: 363 --YRDALDAYTRAIRLNPYISEVWYDLGTLYETC 394

>YCR060W Chr3 (224399..224734) [336 bp, 111 aa] {ON}  TAH1Component
           of the conserved R2TP complex (Rvb1-Rvb2-Tah1-Pih1);
           contains a single TPR domain with at least two TPR
           motifs; R2TP complex interacts with Hsp90 (Hsp82p and
           Hsc82p) to mediate assembly large protein complexes such
           as box C/D snoRNPs and RNA polymerase II
          Length = 111

 Score = 38.1 bits (87), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 16/58 (27%), Positives = 34/58 (58%), Gaps = 1/58 (1%)

Query: 97  KDKGNALFKEKRFEDAIEFYNHAIKLH-EDPVFHSNISACYVSLGDLDKVVESSTRAL 153
           K++GN+LFK+  + +A+  Y+  I    ++PV +SN +   + LG+  + ++   + L
Sbjct: 8   KEQGNSLFKQGLYREAVHCYDQLITAQPQNPVGYSNKAMALIKLGEYTQAIQMCQQGL 65

>NCAS0B02400 Chr2 complement(402763..403905) [1143 bp, 380 aa] {ON}
           Anc_8.506 YBR155W
          Length = 380

 Score = 40.4 bits (93), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 27/92 (29%), Positives = 41/92 (44%), Gaps = 5/92 (5%)

Query: 93  ATALKDKGNALFKEKRFEDAIEFYNHA--IKLHEDPV---FHSNISACYVSLGDLDKVVE 147
           A   K++GN LF  KRF +A + YN    IK   D +     +N +AC + L +    + 
Sbjct: 80  AENFKNQGNDLFTVKRFREARDIYNKGIEIKCENDKINEALFANRAACQLELKNYRSCIN 139

Query: 148 SSTRALELKPDYSKALLRRASAYENMGRYQDA 179
               AL L P   K   R   A+  +   ++A
Sbjct: 140 DCKHALTLNPKNIKCYYRMGKAFYLLNNIEEA 171

>YGR123C Chr7 complement(736662..738203) [1542 bp, 513 aa] {ON}
           PPT1Protein serine/threonine phosphatase, regulates
           Hsp90 chaperone by affecting its ATPase and cochaperone
           binding activities; has similarity to human phosphatase
           PP5; present in both the nucleus and cytoplasm;
           expressed during logarithmic growth
          Length = 513

 Score = 40.4 bits (93), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 28/91 (30%), Positives = 45/91 (49%), Gaps = 1/91 (1%)

Query: 97  KDKGNALFKEKRFEDAIEFYNHAIKLHE-DPVFHSNISACYVSLGDLDKVVESSTRALEL 155
           K++GN   KEK F  AIE Y  AI L     ++ SN +  +  + +    +     A++L
Sbjct: 16  KNEGNVFVKEKHFLKAIEKYTEAIDLDSTQSIYFSNRAFAHFKVDNFQSALNDCDEAIKL 75

Query: 156 KPDYSKALLRRASAYENMGRYQDAMFDISVL 186
            P   KA  RRA +   +  ++ A  D++VL
Sbjct: 76  DPKNIKAYHRRALSCMALLEFKKARKDLNVL 106

 Score = 32.7 bits (73), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 21/65 (32%), Positives = 35/65 (53%), Gaps = 2/65 (3%)

Query: 369 FEKAIALDPNNAAVYYHRGQMYFITQNYEKAGEDFKKSKESDPKNIFPYIQ--LACLAYR 426
           + +AI LD   +  + +R   +F   N++ A  D  ++ + DPKNI  Y +  L+C+A  
Sbjct: 35  YTEAIDLDSTQSIYFSNRAFAHFKVDNFQSALNDCDEAIKLDPKNIKAYHRRALSCMALL 94

Query: 427 ENKMA 431
           E K A
Sbjct: 95  EFKKA 99

>AAR083C Chr1 complement(492375..493991) [1617 bp, 538 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YGR123C
           (PPT1)
          Length = 538

 Score = 40.4 bits (93), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 32/97 (32%), Positives = 47/97 (48%), Gaps = 3/97 (3%)

Query: 93  ATAL--KDKGNALFKEKRFEDAIEFYNHAIKL-HEDPVFHSNISACYVSLGDLDKVVESS 149
           ATAL  K++GN   K K +  A+E Y  AI+      +F SN +   + L      +E S
Sbjct: 36  ATALDYKNEGNEWVKAKDYARAVEAYTRAIEADGTQSIFFSNRALANLKLDRFQSALEDS 95

Query: 150 TRALELKPDYSKALLRRASAYENMGRYQDAMFDISVL 186
            RA+EL     KA  RR  A+  +  +  A  D+ V+
Sbjct: 96  ARAIELDAGNVKAYHRRGLAHCGLLEWGPAKRDLEVV 132

>NCAS0A08420 Chr1 complement(1667102..1668286) [1185 bp, 394 aa]
           {ON} Anc_1.456
          Length = 394

 Score = 40.0 bits (92), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 54/208 (25%), Positives = 92/208 (44%), Gaps = 33/208 (15%)

Query: 246 GIFKPETEIPAYDESNEADVTLVRGLKALYGATSDGYQLADECFAKAAKLYREQLANNND 305
           G++  E  IP Y+ SN+       G         D      E F+KA +   + + N+  
Sbjct: 196 GLWNDEMSIPLYNASNDT-----IGGDIYEEMPDDDRHFDSENFSKAYEA-ADIIKNSGS 249

Query: 306 AAFKEK--------AATALEYLGIFDFLKNDLDNSEKNLKEALALHPRVNTYIYLALTMA 357
             FK+K           +L+Y+  +   + D+D  EKN  + L L  ++  Y+ ++L M 
Sbjct: 250 LLFKQKDYKNALFKYKKSLKYVNEY-IPEPDVD--EKNNIKFLTL--KMKLYLNMSLMMY 304

Query: 358 DRGQSEDYFSYFEKAIALD--PN--NAAVYYHRGQMYFITQNYEKAGEDFKKSKESDPKN 413
              Q +D   Y    + +D  PN   A  YY RG  Y++ +  E A +D+KK KE++P +
Sbjct: 305 YLKQYDDSILYATYLLDMDNVPNLDKAKAYYRRGNSYYMKKLLEDAKKDYKKCKENNPDD 364

Query: 414 IFPYIQLACLAYRENKMAECEKLFEEAR 441
                        + K+ E +KL +E +
Sbjct: 365 ----------KVVDQKIDEVQKLLDEKK 382

>TPHA0M00270 Chr13 complement(53640..54773) [1134 bp, 377 aa] {ON}
           Anc_6.21 YOR007C
          Length = 377

 Score = 39.7 bits (91), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 31/105 (29%), Positives = 54/105 (51%), Gaps = 11/105 (10%)

Query: 83  ASSEDQKKVYATALKDKGNALFKEKRFEDAIEFYNHAIKLHEDPV---FHSNISACYVSL 139
            S++D KK  A  LK+KGN   K K++  AI  Y+ AIKL+  P    +++N +  Y+  
Sbjct: 126 VSNDDMKK--AEKLKEKGNEEMKAKQYSKAIGSYSDAIKLY--PTNFNYYNNRALAYIKA 181

Query: 140 GDLDKVVESSTRALE----LKPDYSKALLRRASAYENMGRYQDAM 180
            + D  +  + +++E    + P   KA  R   A   +G Y+ ++
Sbjct: 182 NNFDHAIIDANKSIEIDSKIHPTNFKAYYRLGLAKYEIGDYEGSL 226

>Skud_3.135 Chr3 (208664..209020) [357 bp, 118 aa] {ON} YCR060W
           (REAL)
          Length = 118

 Score = 37.4 bits (85), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 17/59 (28%), Positives = 36/59 (61%), Gaps = 1/59 (1%)

Query: 97  KDKGNALFKEKRFEDAIEFYNHAIKLH-EDPVFHSNISACYVSLGDLDKVVESSTRALE 154
           K +GNALFK+  + +A++ Y+  I    ++PV +SN +   + LG+  + +++  + L+
Sbjct: 12  KQQGNALFKQGLYLEAVDSYDRLIAAQPQNPVGYSNKAMALIKLGEHAQAIQACQQGLQ 70

>YBL084C Chr2 complement(67169..69445) [2277 bp, 758 aa] {ON}
           CDC27Subunit of the Anaphase-Promoting Complex/Cyclosome
           (APC/C), which is a ubiquitin-protein ligase required
           for degradation of anaphase inhibitors, including
           mitotic cyclins, during the metaphase/anaphase
           transition
          Length = 758

 Score = 40.0 bits (92), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 42/187 (22%), Positives = 69/187 (36%), Gaps = 43/187 (22%)

Query: 369 FEKAIALDPNNAAVYYHRGQMYFITQNYEKAGEDFKKSKESDPKNIFPYIQLACLAYREN 428
           FEKA  LDPN A  Y  +G  +    + + A   ++K+   DP++   Y  L   A +  
Sbjct: 563 FEKATQLDPNFAYAYTLQGHEHSSNDSSDSAKTCYRKALACDPQHYNAYYGLGTSAMKLG 622

Query: 429 KMAECEKLFEEARKTFPTAPEVPNFYAEILADKGDIDEAVKQYNIAYRLESLQKQIHVGI 488
           +  E    FE+AR   P    +      I    G +++      + Y+ ++L        
Sbjct: 623 QYEEALLYFEKARSINPVNVVL------ICCCGGSLEK------LGYKEKAL-------- 662

Query: 489 APLVGKATILARQPTPENFATISQLLEDACKADPRSEQAKVGLAQLRLQQEKVDEAIELF 548
                                  Q  E AC   P S  +K  + QL     + + A++ F
Sbjct: 663 -----------------------QYYELACHLQPTSSLSKYKMGQLLYSMTRYNVALQTF 699

Query: 549 EEAAKMA 555
           EE  K+ 
Sbjct: 700 EELVKLV 706

 Score = 35.8 bits (81), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 39/160 (24%), Positives = 65/160 (40%), Gaps = 2/160 (1%)

Query: 327 NDLDNSEKNL-KEALALHPR-VNTYIYLALTMADRGQSEDYFSYFEKAIALDPNNAAVYY 384
           ND  +S K   ++ALA  P+  N Y  L  +    GQ E+   YFEKA +++P N  +  
Sbjct: 587 NDSSDSAKTCYRKALACDPQHYNAYYGLGTSAMKLGQYEEALLYFEKARSINPVNVVLIC 646

Query: 385 HRGQMYFITQNYEKAGEDFKKSKESDPKNIFPYIQLACLAYRENKMAECEKLFEEARKTF 444
             G         EKA + ++ +    P +     ++  L Y   +     + FEE  K  
Sbjct: 647 CCGGSLEKLGYKEKALQYYELACHLQPTSSLSKYKMGQLLYSMTRYNVALQTFEELVKLV 706

Query: 445 PTAPEVPNFYAEILADKGDIDEAVKQYNIAYRLESLQKQI 484
           P          +     G   +A+K+  +A  L+    Q+
Sbjct: 707 PDDATAHYLLGQTYRIVGRKKDAIKELTVAMNLDPKGNQV 746

 Score = 32.3 bits (72), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 36/167 (21%), Positives = 65/167 (38%), Gaps = 13/167 (7%)

Query: 387 GQMYFITQNYEKAGEDFKKSKESDPKNIFPYIQLACLAYRENKMAECEKLFEEARKTFPT 446
           G+++F   NY+ + + F + K+  P  +      + L +  +   +   L      T P 
Sbjct: 479 GKLHFEIINYDMSLKYFNRLKDLQPARVKDMEIFSTLLWHLHDKVKSSNLANGLMDTMPN 538

Query: 447 APEVPNFYAEILADKGDIDEAVKQYNIAYRLESLQKQIHVGIAPLVGKATILARQPTPEN 506
            PE       +L+ + D D A+K +  A +L+           P    A  L       N
Sbjct: 539 KPETWCCIGNLLSLQKDHDAAIKAFEKATQLD-----------PNFAYAYTLQGHEHSSN 587

Query: 507 FATIS--QLLEDACKADPRSEQAKVGLAQLRLQQEKVDEAIELFEEA 551
            ++ S       A   DP+   A  GL    ++  + +EA+  FE+A
Sbjct: 588 DSSDSAKTCYRKALACDPQHYNAYYGLGTSAMKLGQYEEALLYFEKA 634

>ZYRO0B03828g Chr2 (318153..320336) [2184 bp, 727 aa] {ON} similar
           to uniprot|P38042 Saccharomyces cerevisiae YBL084C CDC27
           Subunit of the Anaphase-Promoting Complex/Cyclosome
           (APC/C) which is a ubiquitin-protein ligase required for
           degradation of anaphase inhibitors including mitotic
           cyclins during the metaphase/anaphase transition
          Length = 727

 Score = 40.0 bits (92), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 39/159 (24%), Positives = 70/159 (44%), Gaps = 1/159 (0%)

Query: 327 NDLDNSEKNLKEALALHPR-VNTYIYLALTMADRGQSEDYFSYFEKAIALDPNNAAVYYH 385
           + +D ++   ++A+A  P+  N Y  L +     GQ E+   YFEKA +++P N  +   
Sbjct: 557 DSIDMAKTCYRKAIASDPQHYNAYYGLGMCCMKLGQYEEALLYFEKARSINPVNVILICC 616

Query: 386 RGQMYFITQNYEKAGEDFKKSKESDPKNIFPYIQLACLAYRENKMAECEKLFEEARKTFP 445
            G         EKA + ++ + E  P +     + A L Y   + +   + FEE  +  P
Sbjct: 617 CGVALEKMSYQEKALQYYELASELQPSSSLAKFKKAHLLYVMARYSVALENFEELAELAP 676

Query: 446 TAPEVPNFYAEILADKGDIDEAVKQYNIAYRLESLQKQI 484
               V     ++    G   +AVK++ IA  L+    Q+
Sbjct: 677 DEATVHFLLGQLYQIMGRKKDAVKEFTIAMNLDPKGNQL 715

 Score = 35.8 bits (81), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 23/79 (29%), Positives = 37/79 (46%)

Query: 368 YFEKAIALDPNNAAVYYHRGQMYFITQNYEKAGEDFKKSKESDPKNIFPYIQLACLAYRE 427
           YFEKA  +DP+ A  Y  +G  +    + + A   ++K+  SDP++   Y  L     + 
Sbjct: 531 YFEKATEVDPHFAYGYTLQGHEHSSNDSIDMAKTCYRKAIASDPQHYNAYYGLGMCCMKL 590

Query: 428 NKMAECEKLFEEARKTFPT 446
            +  E    FE+AR   P 
Sbjct: 591 GQYEEALLYFEKARSINPV 609

>Smik_6.215 Chr6 complement(354154..355695) [1542 bp, 513 aa] {ON}
           YGR123C (REAL)
          Length = 513

 Score = 39.7 bits (91), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 28/91 (30%), Positives = 45/91 (49%), Gaps = 1/91 (1%)

Query: 97  KDKGNALFKEKRFEDAIEFYNHAIKLH-EDPVFHSNISACYVSLGDLDKVVESSTRALEL 155
           K++GN   KEK F  AIE Y  AI L     ++ SN +  +  + +    +     A++L
Sbjct: 16  KNEGNVFVKEKHFLKAIEKYTEAIDLDATQSIYFSNRAFAHFKVDNFQSALNDCDEAIKL 75

Query: 156 KPDYSKALLRRASAYENMGRYQDAMFDISVL 186
            P   KA  RRA +   +  ++ A  D++VL
Sbjct: 76  DPKNIKAYHRRALSCMALLEFKKAKKDLNVL 106

 Score = 32.7 bits (73), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 21/66 (31%), Positives = 36/66 (54%), Gaps = 2/66 (3%)

Query: 369 FEKAIALDPNNAAVYYHRGQMYFITQNYEKAGEDFKKSKESDPKNIFPYIQ--LACLAYR 426
           + +AI LD   +  + +R   +F   N++ A  D  ++ + DPKNI  Y +  L+C+A  
Sbjct: 35  YTEAIDLDATQSIYFSNRAFAHFKVDNFQSALNDCDEAIKLDPKNIKAYHRRALSCMALL 94

Query: 427 ENKMAE 432
           E K A+
Sbjct: 95  EFKKAK 100

>KNAG0B02240 Chr2 complement(434466..436685) [2220 bp, 739 aa] {ON}
           Anc_7.412 YBL084C
          Length = 739

 Score = 39.7 bits (91), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 37/156 (23%), Positives = 68/156 (43%), Gaps = 1/156 (0%)

Query: 330 DNSEKNLKEALALHPR-VNTYIYLALTMADRGQSEDYFSYFEKAIALDPNNAAVYYHRGQ 388
           D ++   ++A+A  P+  N Y  L    +  G+ +    YFEKA  ++P NA +    G 
Sbjct: 572 DTAKIMYRKAIACDPQHYNAYYGLGDCASRLGKYDKALLYFEKARVINPVNAILICCCGH 631

Query: 389 MYFITQNYEKAGEDFKKSKESDPKNIFPYIQLACLAYRENKMAECEKLFEEARKTFPTAP 448
                   ++A   ++ +++  P+   P  + A L +   K +    +FE   K  P   
Sbjct: 632 SLEKLNLPDQALTYYELAEKLQPEMTIPKYKKAQLLFSLGKFSSAMYIFESLTKLSPEEV 691

Query: 449 EVPNFYAEILADKGDIDEAVKQYNIAYRLESLQKQI 484
            V     +I    G   +A+K+Y IA  L+ +  Q+
Sbjct: 692 TVHFMLGQIYQTMGRKKDAIKEYTIALNLDPMGNQV 727

 Score = 36.6 bits (83), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 44/178 (24%), Positives = 72/178 (40%), Gaps = 9/178 (5%)

Query: 369 FEKAIALDPNNAAVYYHRGQMYFITQNYEKAGEDFKKSKESDPKNIFPYIQLACLAYREN 428
           FEKA +LD   A  Y  +G  +   + Y+ A   ++K+   DP++   Y  L   A R  
Sbjct: 544 FEKATSLDRKFAYAYTLQGHEHAANETYDTAKIMYRKAIACDPQHYNAYYGLGDCASRLG 603

Query: 429 KMAECEKLFEEARKTFPTAPEVPNFYAEILADKGDIDEAVKQYNIAYRLESLQKQIHVGI 488
           K  +    FE+AR   P    +       L      D+A+  Y +A   E LQ ++ +  
Sbjct: 604 KYDKALLYFEKARVINPVNAILICCCGHSLEKLNLPDQALTYYELA---EKLQPEMTI-- 658

Query: 489 APLVGKATILARQPTPENFATISQLLEDACKADPRSEQAKVGLAQLRLQQEKVDEAIE 546
            P   KA +L    +   F++   + E   K  P        L Q+     +  +AI+
Sbjct: 659 -PKYKKAQLLF---SLGKFSSAMYIFESLTKLSPEEVTVHFMLGQIYQTMGRKKDAIK 712

>NCAS0D02670 Chr4 complement(512529..513584) [1056 bp, 351 aa] {ON}
           Anc_6.21 YOR007C
          Length = 351

 Score = 39.3 bits (90), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 43/162 (26%), Positives = 74/162 (45%), Gaps = 15/162 (9%)

Query: 93  ATALKDKGNALFKEKRFEDAIEFYNHAIKLHE------DPVFHSNISACYVSLGDLDKVV 146
           A  LK +GN   + + ++DAI+ Y  AI L +      D  + SN S      G  ++  
Sbjct: 84  AIKLKLEGNKAVERENYKDAIDKYTRAIDLLKKNGLPVDRGYLSNKSLALTKSGRYEEAC 143

Query: 147 ESSTRALELKPDYSKALLRRASAYENMGRYQDAMFDI-SVLSLNGDFNGSSIEPMLERNL 205
           + +   +++ P +SK   R A A     +Y+DAM     VL L G+    +++   E  +
Sbjct: 144 DDALACIKIDPTFSKGYSRLAEAKIGQNKYEDAMNAYKQVLDLEGNKATDTMKRDFE--I 201

Query: 206 NKQALRVLKEDMGID--ASVPQAEQ----PRERQELPSNTSL 241
            KQ    L     ID  ++ P +E     P + +E+ + +SL
Sbjct: 202 TKQKFETLNFSTHIDSGSATPISEAANKYPPKDEEIRTRSSL 243

>TDEL0C02720 Chr3 (477529..479631) [2103 bp, 700 aa] {ON} Anc_7.412
           YBL084C
          Length = 700

 Score = 39.3 bits (90), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 37/153 (24%), Positives = 66/153 (43%), Gaps = 1/153 (0%)

Query: 327 NDLDNSEKNLKEALALHPR-VNTYIYLALTMADRGQSEDYFSYFEKAIALDPNNAAVYYH 385
           + +D ++   + ALA  P+  N Y  L +     GQ +    +FEKA  ++P N  +   
Sbjct: 530 DSIDTAKNCYRRALACDPQHYNAYYGLGMCYMKLGQYDKALLFFEKARNINPVNVILICC 589

Query: 386 RGQMYFITQNYEKAGEDFKKSKESDPKNIFPYIQLACLAYRENKMAECEKLFEEARKTFP 445
            G         EKA + ++++ E  P +     + A L Y   + +   + FEE  K  P
Sbjct: 590 CGVALEKLSYQEKALQYYEQACELQPSSSLAKFKKAHLLYSMARYSAALENFEELAKLAP 649

Query: 446 TAPEVPNFYAEILADKGDIDEAVKQYNIAYRLE 478
               V     ++    G   +AVK++ +A  L+
Sbjct: 650 DEATVHFLLGQLYQIMGRKKDAVKEFTVAMNLD 682

 Score = 37.7 bits (86), Expect = 0.081,   Method: Compositional matrix adjust.
 Identities = 63/278 (22%), Positives = 102/278 (36%), Gaps = 55/278 (19%)

Query: 288 CFAKAAKLYREQL----ANNNDAAFKEKAATALEYLGIFDFLKNDLDNSEK------NLK 337
           C A+  KL+ E L    + N+    +    T  + + IF  L   L +S +       L 
Sbjct: 416 CQAQLGKLHYEILNYEESLNHFNQLRRMQPTRTQDIEIFSTLLWHLHDSTRLSHLSNELV 475

Query: 338 EALALHPRVNTYIYLALTMADRGQSEDYFSYFEKAIALDPNNAAVYYHRGQMYFITQNYE 397
           E L   P+  T+  L    + +   ED   YFEKA  +D N A  Y  +G  +    + +
Sbjct: 476 ETLPNKPQ--TWCCLGNLYSLQRDHEDAIKYFEKATKIDYNFAYAYTLQGHEHSSNDSID 533

Query: 398 KAGEDFKKSKESDPKNIFPYIQLACLAYRENKMAECEKLFEEARKTFPTAPEVPNFYAEI 457
            A   ++++   DP++   Y  L     +  +  +    FE+AR   P           +
Sbjct: 534 TAKNCYRRALACDPQHYNAYYGLGMCYMKLGQYDKALLFFEKARNINPVN-------VIL 586

Query: 458 LADKGDIDEAVKQYNIAYRLESLQKQIHVGIAPLVGKATILARQPTPENFATISQLLEDA 517
           +   G     V    ++Y+ ++L                               Q  E A
Sbjct: 587 ICCCG-----VALEKLSYQEKAL-------------------------------QYYEQA 610

Query: 518 CKADPRSEQAKVGLAQLRLQQEKVDEAIELFEEAAKMA 555
           C+  P S  AK   A L     +   A+E FEE AK+A
Sbjct: 611 CELQPSSSLAKFKKAHLLYSMARYSAALENFEELAKLA 648

>YDR320C Chr4 complement(1106095..1108101) [2007 bp, 668 aa] {ON}
           SWA2Auxilin-like protein involved in vesicular
           transport; clathrin-binding protein required for
           uncoating of clathrin-coated vesicles
          Length = 668

 Score = 39.3 bits (90), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 28/115 (24%), Positives = 54/115 (46%), Gaps = 34/115 (29%)

Query: 96  LKDKGNALFKEKRFEDAIEFY---------NHAIKLHEDPVFHSNISACYVSLGDLDKVV 146
            K KG +LFK   + ++++ Y         NH +++    +  SNI A  + +G+  K +
Sbjct: 377 FKAKGTSLFKNGDYINSLQEYEKSLNTLPLNHPLRI----IALSNIIASQLKIGEYSKSI 432

Query: 147 ESSTRALELKPD---------------------YSKALLRRASAYENMGRYQDAM 180
           E+S+ ALEL P                      + K ++RRA ++E++  ++ A+
Sbjct: 433 ENSSMALELFPSSKAKWKNKISNSDPERSFNDIWPKIMIRRAESFEHLESFKKAL 487

>TPHA0E01110 Chr5 (228116..230197) [2082 bp, 693 aa] {ON} Anc_5.352
           YDR320C
          Length = 693

 Score = 38.9 bits (89), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 37/124 (29%), Positives = 51/124 (41%), Gaps = 26/124 (20%)

Query: 96  LKDKGNALFKEKRFEDAIEFY----NHAIKLHEDPVF-HSNISACYVSLGDLDKVVESST 150
            KD+G   FK+  +  A E Y    N   KLH   +   SN+ A  +  GD   ++  ST
Sbjct: 400 FKDRGTEYFKKGDYVSATEQYEKSLNSLSKLHPLRIIASSNLLASLLKTGDYTSMITIST 459

Query: 151 RALELKPD---------------------YSKALLRRASAYENMGRYQDAMFDISVLSLN 189
            AL+L P                      +SK + RRA A+E +  YQ A     +L  N
Sbjct: 460 SALDLFPKESKLWDNVIQNSEPSKTYKEIWSKLVARRAEAFEFIENYQQAYDSYQLLIEN 519

Query: 190 GDFN 193
             FN
Sbjct: 520 NIFN 523

>Kpol_1050.112 s1050 (249717..252797,252855..252863,252906..253898)
           [4083 bp, 1360 aa] {ON}
           (249717..252797,252855..252863,252906..253898) [4083 nt,
           1361 aa]
          Length = 1360

 Score = 38.9 bits (89), Expect = 0.045,   Method: Compositional matrix adjust.
 Identities = 17/58 (29%), Positives = 30/58 (51%)

Query: 358 DRGQSEDYFSYFEKAIALDPNNAAVYYHRGQMYFITQNYEKAGEDFKKSKESDPKNIF 415
           +R Q  D   +F+ A+ ++PNN   +   GQ Y      E +   F+K+ E DP +++
Sbjct: 680 ERQQESDAIEWFQSALRIEPNNVESWVGLGQSYLSCGRIEASIRVFEKATELDPDHLY 737

 Score = 32.0 bits (71), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 21/78 (26%), Positives = 38/78 (48%), Gaps = 1/78 (1%)

Query: 100 GNALFKEKRFEDAIEFYNHAIKLHEDPV-FHSNISACYVSLGDLDKVVESSTRALELKPD 158
           G A  + ++  DAIE++  A+++  + V     +   Y+S G ++  +    +A EL PD
Sbjct: 675 GIANLERQQESDAIEWFQSALRIEPNNVESWVGLGQSYLSCGRIEASIRVFEKATELDPD 734

Query: 159 YSKALLRRASAYENMGRY 176
           +  A    A +   MG Y
Sbjct: 735 HLYAKYFTAQSLSEMGEY 752

>KAFR0B00250 Chr2 complement(58608..62870) [4263 bp, 1420 aa] {ON}
           Anc_7.546 YPR189W
          Length = 1420

 Score = 38.9 bits (89), Expect = 0.048,   Method: Compositional matrix adjust.
 Identities = 32/133 (24%), Positives = 56/133 (42%), Gaps = 7/133 (5%)

Query: 349 YIYLALTMADRGQSEDYFSYFEKAIALDPNNAAVYYHRGQMYFITQNYEKAGEDFKKSKE 408
           Y  + ++  +     D   +F+ A+ +DPN+   +   GQ YF     E + + F+K+ E
Sbjct: 687 YRVMGISFLEDQNETDSIEWFQSALRVDPNDIESWVGLGQAYFACGRVEASIKVFEKAVE 746

Query: 409 SDP-KNIFPYIQLACLAYRENKMAECEKLFEEARKTFPTAPEVPNFYAEILADKGDIDEA 467
             P  N   Y     LA    +M E E+  +  R      PE   F  E+      +D +
Sbjct: 747 LSPDHNYAKYFNSVALA----QMDEFERAIDILRHVLKDEPEKEVFKMELATQI--VDYS 800

Query: 468 VKQYNIAYRLESL 480
              YN  Y ++++
Sbjct: 801 FDLYNQGYLMKAI 813

 Score = 35.0 bits (79), Expect = 0.61,   Method: Compositional matrix adjust.
 Identities = 17/69 (24%), Positives = 34/69 (49%)

Query: 369  FEKAIALDPNNAAVYYHRGQMYFITQNYEKAGEDFKKSKESDPKNIFPYIQLACLAYREN 428
            F KA+ L P +  ++++   +     +   AGE   +++   P+N  P++ +A L  +E 
Sbjct: 993  FIKAMVLSPKDVEIWFNLALLALQNNDTVLAGEIMSRAQSMAPQNSSPWLGMALLYEKEG 1052

Query: 429  KMAECEKLF 437
            K  E   +F
Sbjct: 1053 KSTESANMF 1061

>Suva_2.34 Chr2 complement(63832..65304,65365..66183) [2292 bp, 763
           aa] {ON} YBL084C (REAL)
          Length = 763

 Score = 38.5 bits (88), Expect = 0.050,   Method: Compositional matrix adjust.
 Identities = 41/187 (21%), Positives = 69/187 (36%), Gaps = 43/187 (22%)

Query: 369 FEKAIALDPNNAAVYYHRGQMYFITQNYEKAGEDFKKSKESDPKNIFPYIQLACLAYREN 428
           FEKA  LDPN A  Y  +G  +    + + A   ++K+   DP++   Y  L   + +  
Sbjct: 568 FEKATQLDPNFAYAYTLQGHEHSSNDSSDSAKTCYRKALACDPQHYNAYYGLGTSSMKLG 627

Query: 429 KMAECEKLFEEARKTFPTAPEVPNFYAEILADKGDIDEAVKQYNIAYRLESLQKQIHVGI 488
           +  E    FE+AR   P    +      I    G +++      + Y+ + L        
Sbjct: 628 QYEEALLYFEKARSINPVNVVL------ICCCGGSLEK------LGYKEKVL-------- 667

Query: 489 APLVGKATILARQPTPENFATISQLLEDACKADPRSEQAKVGLAQLRLQQEKVDEAIELF 548
                                  Q  E AC+  P S  +K  + QL     + + A++ F
Sbjct: 668 -----------------------QYYELACQLQPTSSLSKYKMGQLLYSMTRYNVALQTF 704

Query: 549 EEAAKMA 555
           EE  K+ 
Sbjct: 705 EELVKLV 711

 Score = 34.7 bits (78), Expect = 0.82,   Method: Compositional matrix adjust.
 Identities = 39/162 (24%), Positives = 66/162 (40%), Gaps = 2/162 (1%)

Query: 327 NDLDNSEKNL-KEALALHPR-VNTYIYLALTMADRGQSEDYFSYFEKAIALDPNNAAVYY 384
           ND  +S K   ++ALA  P+  N Y  L  +    GQ E+   YFEKA +++P N  +  
Sbjct: 592 NDSSDSAKTCYRKALACDPQHYNAYYGLGTSSMKLGQYEEALLYFEKARSINPVNVVLIC 651

Query: 385 HRGQMYFITQNYEKAGEDFKKSKESDPKNIFPYIQLACLAYRENKMAECEKLFEEARKTF 444
             G         EK  + ++ + +  P +     ++  L Y   +     + FEE  K  
Sbjct: 652 CCGGSLEKLGYKEKVLQYYELACQLQPTSSLSKYKMGQLLYSMTRYNVALQTFEELVKLV 711

Query: 445 PTAPEVPNFYAEILADKGDIDEAVKQYNIAYRLESLQKQIHV 486
           P          +     G   +AVK+  +A  L+    Q+ +
Sbjct: 712 PDDATAHYLLGQTYRIVGRKKDAVKELTVAMNLDPKGNQVVI 753

 Score = 31.6 bits (70), Expect = 7.4,   Method: Compositional matrix adjust.
 Identities = 36/167 (21%), Positives = 65/167 (38%), Gaps = 13/167 (7%)

Query: 387 GQMYFITQNYEKAGEDFKKSKESDPKNIFPYIQLACLAYRENKMAECEKLFEEARKTFPT 446
           G+++F   NY+ + + F + K+  P  +      + L +  +   +   L      T P 
Sbjct: 484 GKLHFEIINYDMSLKYFNRLKDLQPARVKDMEIYSTLLWHLHDKVKSSNLANGLMDTMPN 543

Query: 447 APEVPNFYAEILADKGDIDEAVKQYNIAYRLESLQKQIHVGIAPLVGKATILARQPTPEN 506
            PE       +L+ + D D A+K +  A +L+           P    A  L       N
Sbjct: 544 KPETWCCIGNLLSLQKDHDAAIKAFEKATQLD-----------PNFAYAYTLQGHEHSSN 592

Query: 507 FATIS--QLLEDACKADPRSEQAKVGLAQLRLQQEKVDEAIELFEEA 551
            ++ S       A   DP+   A  GL    ++  + +EA+  FE+A
Sbjct: 593 DSSDSAKTCYRKALACDPQHYNAYYGLGTSSMKLGQYEEALLYFEKA 639

>TBLA0I02310 Chr9 (528067..528417) [351 bp, 116 aa] {ON} Anc_6.328
           YCR060W
          Length = 116

 Score = 35.8 bits (81), Expect = 0.061,   Method: Compositional matrix adjust.
 Identities = 18/61 (29%), Positives = 32/61 (52%), Gaps = 1/61 (1%)

Query: 96  LKDKGNALFKEKRFEDAIEFYNHAIKLH-EDPVFHSNISACYVSLGDLDKVVESSTRALE 154
           LK KGN  FK   + +AI +YN  I +   +P+ +SN +   +     D+ + +  + L+
Sbjct: 6   LKAKGNISFKNGSYSEAISWYNRCISIDPSNPIGYSNKAMALLKADRFDEAITTCEKGLQ 65

Query: 155 L 155
           L
Sbjct: 66  L 66

>Smik_2.36 Chr2 complement(61159..63414) [2256 bp, 751 aa] {ON}
           YBL084C (REAL)
          Length = 751

 Score = 38.1 bits (87), Expect = 0.061,   Method: Compositional matrix adjust.
 Identities = 41/187 (21%), Positives = 68/187 (36%), Gaps = 43/187 (22%)

Query: 369 FEKAIALDPNNAAVYYHRGQMYFITQNYEKAGEDFKKSKESDPKNIFPYIQLACLAYREN 428
           FEKA  LDPN A  Y  +G  +    + + A   ++K+   DP++   Y  L   + +  
Sbjct: 556 FEKATQLDPNFAYAYTLQGHEHSSNDSSDSAKTCYRKALACDPQHYNAYYGLGTSSMKLG 615

Query: 429 KMAECEKLFEEARKTFPTAPEVPNFYAEILADKGDIDEAVKQYNIAYRLESLQKQIHVGI 488
           +  E    FE+AR   P    +      I    G +++      + Y+ ++L        
Sbjct: 616 QYEEALLYFEKARSINPVNVVL------ICCCGGSLEK------LGYKEKAL-------- 655

Query: 489 APLVGKATILARQPTPENFATISQLLEDACKADPRSEQAKVGLAQLRLQQEKVDEAIELF 548
                                  Q  E AC   P S  +K  + QL     +   A++ F
Sbjct: 656 -----------------------QYYELACHLQPTSSLSKYKMGQLLYSMTRYSVALQTF 692

Query: 549 EEAAKMA 555
           EE  K+ 
Sbjct: 693 EELVKLV 699

 Score = 36.2 bits (82), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 39/160 (24%), Positives = 66/160 (41%), Gaps = 2/160 (1%)

Query: 327 NDLDNSEKNL-KEALALHPR-VNTYIYLALTMADRGQSEDYFSYFEKAIALDPNNAAVYY 384
           ND  +S K   ++ALA  P+  N Y  L  +    GQ E+   YFEKA +++P N  +  
Sbjct: 580 NDSSDSAKTCYRKALACDPQHYNAYYGLGTSSMKLGQYEEALLYFEKARSINPVNVVLIC 639

Query: 385 HRGQMYFITQNYEKAGEDFKKSKESDPKNIFPYIQLACLAYRENKMAECEKLFEEARKTF 444
             G         EKA + ++ +    P +     ++  L Y   + +   + FEE  K  
Sbjct: 640 CCGGSLEKLGYKEKALQYYELACHLQPTSSLSKYKMGQLLYSMTRYSVALQTFEELVKLV 699

Query: 445 PTAPEVPNFYAEILADKGDIDEAVKQYNIAYRLESLQKQI 484
           P          +     G   +A+K+  +A  L+    Q+
Sbjct: 700 PDDATAHYLLGQTYRIVGRKKDAIKELTVAMNLDPKGNQV 739

 Score = 32.7 bits (73), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 36/167 (21%), Positives = 65/167 (38%), Gaps = 13/167 (7%)

Query: 387 GQMYFITQNYEKAGEDFKKSKESDPKNIFPYIQLACLAYRENKMAECEKLFEEARKTFPT 446
           G+++F   NY+ + + F + K+  P  +      + L +  +   +   L      T P 
Sbjct: 472 GKLHFEIINYDMSLKYFNRLKDLQPARVKDMEIFSTLLWHLHDKVKSSNLANGLMDTMPN 531

Query: 447 APEVPNFYAEILADKGDIDEAVKQYNIAYRLESLQKQIHVGIAPLVGKATILARQPTPEN 506
            PE       +L+ + D D A+K +  A +L+           P    A  L       N
Sbjct: 532 KPETWCCVGNLLSLQKDHDAAIKAFEKATQLD-----------PNFAYAYTLQGHEHSSN 580

Query: 507 FATIS--QLLEDACKADPRSEQAKVGLAQLRLQQEKVDEAIELFEEA 551
            ++ S       A   DP+   A  GL    ++  + +EA+  FE+A
Sbjct: 581 DSSDSAKTCYRKALACDPQHYNAYYGLGTSSMKLGQYEEALLYFEKA 627

>TDEL0E02750 Chr5 (529920..531614) [1695 bp, 564 aa] {ON} Anc_5.352
           YDR320C
          Length = 564

 Score = 38.1 bits (87), Expect = 0.071,   Method: Compositional matrix adjust.
 Identities = 31/127 (24%), Positives = 53/127 (41%), Gaps = 34/127 (26%)

Query: 97  KDKGNALFKEKRFEDAIEFY---------NHAIKLHEDPVFHSNISACYVSLGDLDKVVE 147
           KD+G   FK   +  A + Y         NHA+++    V +SN++A    +G+  + + 
Sbjct: 277 KDRGTEFFKAGDYVSASQEYEKSLNSLPQNHALRI----VAYSNLTAALFKVGEYKRCLS 332

Query: 148 SSTRALELKPD---------------------YSKALLRRASAYENMGRYQDAMFDISVL 186
               ALE+ P                      + K + RRA A+E++  Y+ A+ D   L
Sbjct: 333 DIESALEMFPKDPNLWDEPIQDSQPIRTFKEMWPKIVTRRAEAFEHIENYERALQDYQSL 392

Query: 187 SLNGDFN 193
               +FN
Sbjct: 393 IEKNNFN 399

>Smik_3.159 Chr3 (222475..222822) [348 bp, 115 aa] {ON} YCR060W
           (REAL)
          Length = 115

 Score = 35.4 bits (80), Expect = 0.094,   Method: Compositional matrix adjust.
 Identities = 18/67 (26%), Positives = 37/67 (55%), Gaps = 3/67 (4%)

Query: 97  KDKGNALFKEKRFEDAIEFYNHAIKLH-EDPVFHSNISACYVSLGDLDKVVESSTRALE- 154
           K+ GNALFK+  + +A++ Y+  I    ++PV +SN +   + L +    +++    L  
Sbjct: 12  KELGNALFKQGLYREAVDSYDQLITAQPQNPVGYSNKAMALIKLAEYTHAIQTCQEGLRY 71

Query: 155 -LKPDYS 160
            L P+++
Sbjct: 72  ALGPEHA 78

>KLLA0E20857g Chr5 (1860517..1862649) [2133 bp, 710 aa] {ON} similar
           to uniprot|Q751K0 Ashbya gossypii AGL294W AGL294Wp and
           some similarites with YBL084C uniprot|P38042
           Saccharomyces cerevisiae YBL084C CDC27 Subunit of the
           Anaphase-Promoting Complex/Cyclosome (APC/C) which is a
           ubiquitin-protein ligase required for degradation of
           anaphase inhibitors including mitotic cyclins during the
           metaphase/anaphase transition
          Length = 710

 Score = 37.7 bits (86), Expect = 0.097,   Method: Compositional matrix adjust.
 Identities = 29/98 (29%), Positives = 48/98 (48%), Gaps = 5/98 (5%)

Query: 89  KKVYATALKDKGNALFKEKRFEDAIEFYNHAIKLHEDPVFHSNISACYVSLGDL---DKV 145
           +K +  AL   G    K  +FE+A+ F+  A  L  +PV       C V+L  L   ++ 
Sbjct: 556 EKTHYNALYGLGMCCVKLGKFEEALLFFEKARAL--NPVNVILNCCCGVALERLQQPERA 613

Query: 146 VESSTRALELKPDYSKALLRRASAYENMGRYQDAMFDI 183
           +     A EL+P+ S AL +++    NMG+Y  A+ + 
Sbjct: 614 LNFYELATELQPNSSLALFKKSQLLLNMGQYSSALHNF 651

 Score = 33.1 bits (74), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 37/164 (22%), Positives = 65/164 (39%), Gaps = 2/164 (1%)

Query: 323 DFLKND-LDNSEKNLKEALALHPRVNTYIY-LALTMADRGQSEDYFSYFEKAIALDPNNA 380
           ++  ND  DN++   ++AL +       +Y L +     G+ E+   +FEKA AL+P N 
Sbjct: 535 EYSNNDAFDNAKSCFRKALTIEKTHYNALYGLGMCCVKLGKFEEALLFFEKARALNPVNV 594

Query: 381 AVYYHRGQMYFITQNYEKAGEDFKKSKESDPKNIFPYIQLACLAYRENKMAECEKLFEEA 440
            +    G      Q  E+A   ++ + E  P +     + + L     + +     FE  
Sbjct: 595 ILNCCCGVALERLQQPERALNFYELATELQPNSSLALFKKSQLLLNMGQYSSALHNFERL 654

Query: 441 RKTFPTAPEVPNFYAEILADKGDIDEAVKQYNIAYRLESLQKQI 484
               P    V      +    G   +A+ QY IA  L+    Q+
Sbjct: 655 ESLTPDEAHVHFLLGNLYQIVGKKQDAMNQYTIAMNLDPKGSQL 698

>ZYRO0B04224g Chr2 (350069..351610) [1542 bp, 513 aa] {ON} highly
           similar to uniprot|P53043 Saccharomyces cerevisiae
           YGR123C
          Length = 513

 Score = 37.4 bits (85), Expect = 0.098,   Method: Compositional matrix adjust.
 Identities = 27/95 (28%), Positives = 45/95 (47%), Gaps = 1/95 (1%)

Query: 93  ATALKDKGNALFKEKRFEDAIEFYNHAIKLHE-DPVFHSNISACYVSLGDLDKVVESSTR 151
           A   KD+GN   K++ F  A E Y  AI+L +   +F SN +  ++   +    +    +
Sbjct: 12  ALEYKDQGNDFVKKQDFIKAAELYTKAIELDDTKSIFFSNRALAHLKQDNFQLSLNDCDK 71

Query: 152 ALELKPDYSKALLRRASAYENMGRYQDAMFDISVL 186
           ALEL     KA  RR  +Y  +  ++ A  D+  +
Sbjct: 72  ALELDSKNIKAYHRRGLSYVGLLEFKKARTDLKTV 106

>Ecym_7142 Chr7 complement(287110..289137) [2028 bp, 675 aa] {ON}
           similar to Ashbya gossypii AGL294W
          Length = 675

 Score = 37.7 bits (86), Expect = 0.098,   Method: Compositional matrix adjust.
 Identities = 30/110 (27%), Positives = 49/110 (44%), Gaps = 7/110 (6%)

Query: 310 EKAATALEYLGIFDFLKNDLDNSEKNLKEALALHPRVNTYIYLALTMADRGQSEDYFS-- 367
           +K+A     LG    L  D D + K LK+A  L PR   + Y          + D F   
Sbjct: 454 DKSAITWCCLGNLFSLNRDHDEAIKALKKATNLDPR---FAYAYTLQGHEYSNNDAFDNA 510

Query: 368 --YFEKAIALDPNNAAVYYHRGQMYFITQNYEKAGEDFKKSKESDPKNIF 415
              + KA+A++PN+   +Y  G        Y++A   F+K++  +P N+ 
Sbjct: 511 KMCYRKALAINPNHYNAHYGLGMSCIKLGQYDEALLHFEKARSINPVNVI 560

 Score = 34.7 bits (78), Expect = 0.76,   Method: Compositional matrix adjust.
 Identities = 19/55 (34%), Positives = 26/55 (47%)

Query: 360 GQSEDYFSYFEKAIALDPNNAAVYYHRGQMYFITQNYEKAGEDFKKSKESDPKNI 414
           GQ  +    FEK   L PN A +++  GQ+Y I    + A   F  +   DPK I
Sbjct: 607 GQYSNALQNFEKLEQLTPNEAPIHFLLGQLYQIVGRKKDAITQFTIAMNLDPKGI 661

 Score = 32.0 bits (71), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 32/143 (22%), Positives = 65/143 (45%), Gaps = 16/143 (11%)

Query: 275 YGATSDGYQLAD-ECFAKAAKLYREQLA---NNNDAAFKEKAATALEYLGIFDFLKNDLD 330
           Y  T  G++ ++ + F  A   YR+ LA   N+ +A +          LG+        D
Sbjct: 492 YAYTLQGHEYSNNDAFDNAKMCYRKALAINPNHYNAHYG---------LGMSCIKLGQYD 542

Query: 331 NSEKNLKEALALHPRVNTYIYLALTMA--DRGQSEDYFSYFEKAIALDPNNAAVYYHRGQ 388
            +  + ++A +++P VN  +     +A    G+ E    +++ A  L PN++   + + Q
Sbjct: 543 EALLHFEKARSINP-VNVILNCCCGVALERLGRREKALDFYQLACELQPNSSLALFKKSQ 601

Query: 389 MYFITQNYEKAGEDFKKSKESDP 411
           + F    Y  A ++F+K ++  P
Sbjct: 602 LLFNLGQYSNALQNFEKLEQLTP 624

>KLLA0C08910g Chr3 complement(781726..782073) [348 bp, 115 aa] {ON}
           similar to uniprot|P25638 Saccharomyces cerevisiae
           YCR060W TAH1 HSP90 cofactor interacts with Hsp82p Pih1p
           Rvb1 and Rvb2 contains a single TPR domain with at least
           two TPR motifs
          Length = 115

 Score = 35.0 bits (79), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 19/59 (32%), Positives = 28/59 (47%), Gaps = 1/59 (1%)

Query: 96  LKDKGNALFKEKRFEDAIEFYNHAIKLH-EDPVFHSNISACYVSLGDLDKVVESSTRAL 153
            K KGN  +K+  F DA+ FY  AI     +PV +SN +   + L +     +   R L
Sbjct: 7   FKIKGNTAYKQNNFTDAVNFYKKAITYDPTNPVGYSNCAMALIKLNNYADASQMCQRGL 65

>NDAI0E04040 Chr5 (900685..903036) [2352 bp, 783 aa] {ON} Anc_7.412
           YBL084C
          Length = 783

 Score = 37.0 bits (84), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 34/138 (24%), Positives = 56/138 (40%)

Query: 347 NTYIYLALTMADRGQSEDYFSYFEKAIALDPNNAAVYYHRGQMYFITQNYEKAGEDFKKS 406
           N Y  + +     G+ E    YFEKA +++P+N  +    G  +      EKA   ++ +
Sbjct: 634 NAYYGIGMCSMKLGEFEHALLYFEKARSINPSNVILICCCGVAFEKLSYPEKALSYYELA 693

Query: 407 KESDPKNIFPYIQLACLAYRENKMAECEKLFEEARKTFPTAPEVPNFYAEILADKGDIDE 466
            +  P +     + A L Y         + FEE  K  P    V     ++    G   +
Sbjct: 694 CQVQPSSSLAKFKRAHLLYSMANYPLALECFEELTKLAPEEATVHFILGQLYNIMGRKKD 753

Query: 467 AVKQYNIAYRLESLQKQI 484
           AVK+Y IA  L+    Q+
Sbjct: 754 AVKEYTIAMNLDPKGNQV 771

>Ecym_2090 Chr2 complement(163340..163858) [519 bp, 172 aa] {ON}
           similar to Ashbya gossypii AAR054C
          Length = 172

 Score = 35.4 bits (80), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 19/59 (32%), Positives = 30/59 (50%), Gaps = 1/59 (1%)

Query: 96  LKDKGNALFKEKRFEDAIEFYNHAIKL-HEDPVFHSNISACYVSLGDLDKVVESSTRAL 153
           LK KGN  FK   +E AI +Y  A  L   +P++ SN++   + L    + V +  + L
Sbjct: 44  LKVKGNTFFKNGDYETAILYYEKACALDSSNPIYFSNMATALIKLERWQEAVNACDKGL 102

>TBLA0F01230 Chr6 complement(304299..307868) [3570 bp, 1189 aa] {ON}
           Anc_3.367 YBR112C
          Length = 1189

 Score = 37.0 bits (84), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 26/120 (21%), Positives = 55/120 (45%), Gaps = 17/120 (14%)

Query: 375 LDPNNAAVYYHRGQMYFITQNYEKAGEDFKKSKESDPKNIFPYIQLACLAYRENKMAECE 434
            DP++A  +YH G+++ I  +Y  A + F+++   D +N   +  +  L Y+ ++  +  
Sbjct: 280 FDPSDATTWYHLGRIHMIRTDYTAAYDAFQQAVNRDSRNPIFWCSIGVLYYQISQYRDAL 339

Query: 435 KLFEEARKTFPTAPEVPNFYAEILADKGDIDE--------AVKQYNIAYRLESLQKQIHV 486
             +  A +  P       + +E+  D G + E        A+  Y  A RL+   + +H+
Sbjct: 340 DAYTRAIRLNP-------YISEVWYDLGTLYETCNNQLTDALDAYKQAARLDP--ENVHI 390

>Kpol_1043.60 s1043 (123502..125622) [2121 bp, 706 aa] {ON}
           (123502..125622) [2121 nt, 707 aa]
          Length = 706

 Score = 36.6 bits (83), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 41/181 (22%), Positives = 70/181 (38%), Gaps = 61/181 (33%)

Query: 100 GNALFKEKRFEDAIEFYNHAIKL------------------------HEDPVFH------ 129
           G   FK   +E A + +  AIKL                        + D ++H      
Sbjct: 14  GTTYFKSGSYEKAKDLFKKAIKLGYSYNKDDLVELRESMGLSGGSLHNSDKIYHPKLVKL 73

Query: 130 -SNISACYVSLGDLDKVVESSTRALELKPDYSKALLRRASAYENMGR-------YQDAM- 180
             N+SA Y  L +LDK  ESS+R + ++P   K  +R     +  G+       Y+  + 
Sbjct: 74  YDNLSATYEKLQELDKAYESSSRMIHIEPYNMKGYIRMGKVLQRQGKDPEAYKCYKKGLL 133

Query: 181 --------FDISVLSLNGDFNGSSIEPMLERNLNKQALRVLKEDMGIDASVPQAEQPRER 232
                   FDI V             P   R++ KQ   ++K+ +  + S+P ++  ++R
Sbjct: 134 MSREMLQKFDIVV-------------PEKFRDIIKQQRDIVKKRIN-NQSLPNSDTSQKR 179

Query: 233 Q 233
           Q
Sbjct: 180 Q 180

>NCAS0B02560 Chr2 complement(427447..429183) [1737 bp, 578 aa] {ON}
           Anc_8.470
          Length = 578

 Score = 36.2 bits (82), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 22/82 (26%), Positives = 42/82 (51%), Gaps = 1/82 (1%)

Query: 99  KGNALFKEKRFEDAIEFYNHAIKLH-EDPVFHSNISACYVSLGDLDKVVESSTRALELKP 157
           +G   + E  F+  IE +  ++K++  D V  + + A   +    +  +++  RAL LKP
Sbjct: 437 RGLLYYAEDDFDKTIECFKESLKINPNDEVMWNRLGASLANSNKPEDAIQAYHRALNLKP 496

Query: 158 DYSKALLRRASAYENMGRYQDA 179
            + +A    A A  N+G Y++A
Sbjct: 497 SFVRARYNLAVASMNIGCYKEA 518

>NDAI0J00130 Chr10 complement(10432..14643) [4212 bp, 1403 aa] {ON}
            Anc_7.546 YPR189W
          Length = 1403

 Score = 36.6 bits (83), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 18/72 (25%), Positives = 36/72 (50%)

Query: 369  FEKAIALDPNNAAVYYHRGQMYFITQNYEKAGEDFKKSKESDPKNIFPYIQLACLAYREN 428
            F KA+ALDP N  ++++   +     +   A E   +S+   P++  P++ +A ++  + 
Sbjct: 975  FIKAVALDPKNTEIWFNLAMLGLRHDDITFAKEVLNRSQSVAPQDSVPWLGMALVSELKG 1034

Query: 429  KMAECEKLFEEA 440
               E  +LF  A
Sbjct: 1035 DKQESSRLFAHA 1046

 Score = 31.6 bits (70), Expect = 7.3,   Method: Compositional matrix adjust.
 Identities = 17/66 (25%), Positives = 29/66 (43%)

Query: 349 YIYLALTMADRGQSEDYFSYFEKAIALDPNNAAVYYHRGQMYFITQNYEKAGEDFKKSKE 408
           Y  L +      Q      +F+ AI +DPN+   +   GQ Y      E + + F+K+ E
Sbjct: 672 YRVLGIAYLQNQQESSSIEWFQSAIRVDPNDIESWVGLGQAYLACGRIEASMKVFEKAME 731

Query: 409 SDPKNI 414
            D  ++
Sbjct: 732 LDGSHL 737

>NDAI0C04320 Chr3 complement(983914..986034) [2121 bp, 706 aa] {ON}
           Anc_5.352 YDR320C
          Length = 706

 Score = 36.2 bits (82), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 35/132 (26%), Positives = 56/132 (42%), Gaps = 33/132 (25%)

Query: 96  LKDKGNALFKEKRFEDAIEFYNHAIKLHEDPVFH-------SNISACYVSLGDLDKVVES 148
            K +G+ LFK   +  A++ Y  +  L+  P +H       SNI A  + +G+  K +E 
Sbjct: 417 FKTRGSELFKNGDYVSALQEYEKS--LNTLPQYHPLRIISYSNIIATQLKIGEYSKSIED 474

Query: 149 STRALELKPD-----------------------YSKALLRRASAYENMGRYQDAMFDISV 185
              AL L P                        +SK ++R+A +YE++  Y+ A+     
Sbjct: 475 CKIALSLFPKGKVTSAWNQIIPDSTPQRSFKDIWSKLIMRQAESYEHLENYKLALDSYQK 534

Query: 186 LSLNGDFNGSSI 197
           L  NG F  S I
Sbjct: 535 LIENG-FTNSKI 545

>ACR168W Chr3 (650615..652738) [2124 bp, 707 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YKL022C (CDC16)
          Length = 707

 Score = 36.2 bits (82), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 28/115 (24%), Positives = 45/115 (39%)

Query: 368 YFEKAIALDPNNAAVYYHRGQMYFITQNYEKAGEDFKKSKESDPKNIFPYIQLACLAYRE 427
           YF KA  LDPN    +      Y +   +E+A   +  +    P    P++ L     R 
Sbjct: 444 YFSKASVLDPNFGYAWLGFAHTYAVEGEHEQALSAYSTAARFFPGTHLPHLYLGMQYSRM 503

Query: 428 NKMAECEKLFEEARKTFPTAPEVPNFYAEILADKGDIDEAVKQYNIAYRLESLQK 482
           + +   E+ F  A    PT P + N    +   K D   A K +  A    ++Q+
Sbjct: 504 DTLTLAEEYFMMAYDICPTDPLLLNELGVVYFKKMDYPRAKKFFKRACEAINMQQ 558

>TBLA0H01520 Chr8 (344716..346785) [2070 bp, 689 aa] {ON} Anc_3.367
           YBR112C
          Length = 689

 Score = 35.8 bits (81), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 68/339 (20%), Positives = 125/339 (36%), Gaps = 62/339 (18%)

Query: 91  VYATALKDKGNALFKEKRFEDAIEFYNHAIKLHEDP----VFHSNISACYVSLGDLDKVV 146
           ++AT     G+        + A   Y  A+    DP    ++H  I   Y   G LD   
Sbjct: 234 IWATL----GHCYLMLDDLQKAYNAYQQALNNLSDPNVPKLWHG-IGILYDRYGSLDFAE 288

Query: 147 ESSTRALELKPDYSKA---LLRRASAYENMGRYQDAMFDISVLSLNGDFNGSSIEPMLER 203
           E+  + L+L P++ KA     R    Y++ GR+ +A     + SLN         P+ E 
Sbjct: 289 EAFKKVLDLDPNFEKANEIYFRLGIIYKHKGRWNEA-----IESLNCILKRPP-PPLTES 342

Query: 204 NLNKQALRVLKEDMGIDASVPQAEQPRERQELPSNTSLSSFFGIFKPETEIPAYDESNEA 263
           ++  Q   +L+     + +    E                               ++N +
Sbjct: 343 DIWFQIGNILENKFDWNGAKDAYEH----------------------------VSKNNNS 374

Query: 264 DVTLVRGLKALYGATSDGYQLADECFAKAAKLYREQLANNNDAAFKEKAATALEYLGIFD 323
           +  L++ L  LY   +  +   D       K                  +T   YLG   
Sbjct: 375 NPKLLKQLGCLYSMENVEFYNLDIAMGHLVK----------SLELDPTDSTTWYYLGRIH 424

Query: 324 FLKNDLDNSEKNLKEALALHPRVNTYIYLALTMA--DRGQSEDYFSYFEKAIALDPNNAA 381
             K D   + ++L++A+    R N   + ++ +     GQ+ D    + +AI L+P  + 
Sbjct: 425 MAKKDFTAAYESLQQAVNRDSR-NPIFWCSIGVLYYQIGQNHDALDAYTRAIRLNPYISE 483

Query: 382 VYYHRGQMY-FITQNYEKAGEDFKKSKESDPKNIFPYIQ 419
           V+Y+ G +Y         A + ++++   DP+N  P IQ
Sbjct: 484 VWYNLGTLYETCNDQITDALDSYERALSLDPEN--PVIQ 520

 Score = 33.9 bits (76), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 16/85 (18%), Positives = 40/85 (47%)

Query: 366 FSYFEKAIALDPNNAAVYYHRGQMYFITQNYEKAGEDFKKSKESDPKNIFPYIQLACLAY 425
             +  K++ LDP ++  +Y+ G+++   +++  A E  +++   D +N   +  +  L Y
Sbjct: 400 MGHLVKSLELDPTDSTTWYYLGRIHMAKKDFTAAYESLQQAVNRDSRNPIFWCSIGVLYY 459

Query: 426 RENKMAECEKLFEEARKTFPTAPEV 450
           +  +  +    +  A +  P   EV
Sbjct: 460 QIGQNHDALDAYTRAIRLNPYISEV 484

>TDEL0B07600 Chr2 (1331773..1334031) [2259 bp, 752 aa] {ON}
           Anc_2.665 YKL022C
          Length = 752

 Score = 35.8 bits (81), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 27/106 (25%), Positives = 48/106 (45%), Gaps = 8/106 (7%)

Query: 316 LEYLGIFDFLKNDLDNSEKNLKEAL----ALHPRVNTYIYLALTMADR----GQSEDYFS 367
           L  +G+  F +NDL  ++K LK AL     L P   T + + + +A      G++E    
Sbjct: 569 LNEMGVMYFKRNDLQKAKKFLKRALEAVEELDPTSKTSVSIQMNLAHAYRRLGENERAIK 628

Query: 368 YFEKAIALDPNNAAVYYHRGQMYFITQNYEKAGEDFKKSKESDPKN 413
            F+  + +   ++  Y   G +Y  T+  +KA + F  +    P N
Sbjct: 629 CFKSVLKVSNKSSDTYCSLGFLYLKTKQLQKAIDHFHTALALRPSN 674

>Ecym_5637 Chr5 (1288532..1290685) [2154 bp, 717 aa] {ON} similar to
           Ashbya gossypii ACR168W
          Length = 717

 Score = 35.8 bits (81), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 26/102 (25%), Positives = 39/102 (38%)

Query: 368 YFEKAIALDPNNAAVYYHRGQMYFITQNYEKAGEDFKKSKESDPKNIFPYIQLACLAYRE 427
           YF KA  LDPN    +      Y +   +E+A   +  +    P    P++ L     R 
Sbjct: 454 YFSKASVLDPNFGYAWLGFAHTYAVEGEHEQALSAYSTAARFFPGTHLPHLYLGMQYSRM 513

Query: 428 NKMAECEKLFEEARKTFPTAPEVPNFYAEILADKGDIDEAVK 469
           + +   E+ F  A    PT P + N    +   K D   A K
Sbjct: 514 DTLTLAEEYFMMAYDICPTDPLLLNELGVVYFKKMDYPRAKK 555

>Kpol_339.13 s339 complement(21257..23317) [2061 bp, 686 aa] {ON}
           complement(21257..23317) [2061 nt, 687 aa]
          Length = 686

 Score = 35.4 bits (80), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 31/113 (27%), Positives = 49/113 (43%), Gaps = 30/113 (26%)

Query: 96  LKDKGNALFKEKRFEDAIEFYNHAIKLHEDPVFH-------SNISACYVSLGDLDKVVES 148
            K++G   FK   +  A+E Y  +  L+  P+ H       SNI A     G+  K +E 
Sbjct: 397 FKERGTENFKTGDYVTALEAYQKS--LNTLPIKHPLRIIASSNILASMSKTGEYRKSIEI 454

Query: 149 STRALELKPD---------------------YSKALLRRASAYENMGRYQDAM 180
           ST ALE  P                      + K +L+RA A+E++  Y++A+
Sbjct: 455 STSALEQFPGDQKQWNEFIQDSEPQRTYKDIWPKIVLKRAEAFEHIESYENAL 507

>KLLA0B09262g Chr2 (814303..817128) [2826 bp, 941 aa] {ON} highly
           similar to uniprot|P14922 Saccharomyces cerevisiae
           YBR112C CYC8 General transcriptional co- repressor acts
           together with Tup1p also acts as part of a
           transcriptional co-activator complex that recruits the
           SWI/SNF and SAGA complexes to promoters
          Length = 941

 Score = 35.4 bits (80), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 25/105 (23%), Positives = 48/105 (45%), Gaps = 2/105 (1%)

Query: 313 ATALEYLGIFDFLKNDLDNSEKNLKEALALHPRVNT-YIYLALTMADRGQSEDYFSYFEK 371
           AT+  +LG    ++ND  ++    ++A+    R  T +  + +      Q  D    + +
Sbjct: 358 ATSWYHLGRIHMIRNDYTSAYDAFQQAVNRDSRNPTFWCSIGVLYYQIAQYRDALDAYTR 417

Query: 372 AIALDPNNAAVYYHRGQMYFITQN-YEKAGEDFKKSKESDPKNIF 415
           AI L+P  + V+Y  G +Y    N    A + +K++   DP N+ 
Sbjct: 418 AIRLNPYISEVWYDLGTLYETCNNQVNDALDAYKQAARLDPNNVH 462

>AGL294W Chr7 (154711..156681) [1971 bp, 656 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YBL084C (CDC27)
          Length = 656

 Score = 35.4 bits (80), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 28/110 (25%), Positives = 49/110 (44%), Gaps = 7/110 (6%)

Query: 310 EKAATALEYLGIFDFLKNDLDNSEKNLKEALALHPRVNTYIYLALTMADRGQSEDYFS-- 367
           +K       LG    L  D D + K LK+A +L+P+   + Y          + D F   
Sbjct: 435 DKNCITWCCLGNLFSLNRDHDEAIKALKKATSLNPQ---FAYAYTLQGHEYSNNDAFDNA 491

Query: 368 --YFEKAIALDPNNAAVYYHRGQMYFITQNYEKAGEDFKKSKESDPKNIF 415
              + KA+A++PN+   +Y  G        Y++A   F+K++  +P N+ 
Sbjct: 492 KMCYRKALAINPNHYNAHYGLGMSCIKLGQYDEALLHFEKARSINPVNVI 541

 Score = 33.1 bits (74), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 19/55 (34%), Positives = 25/55 (45%)

Query: 360 GQSEDYFSYFEKAIALDPNNAAVYYHRGQMYFITQNYEKAGEDFKKSKESDPKNI 414
           GQ  +    FEK   L PN A V++  GQ+Y I    + A   F  +   DP  I
Sbjct: 588 GQYSNALQNFEKLEQLTPNEAPVHFLLGQLYQIVGRKKDAITQFTIAMNLDPNGI 642

 Score = 32.0 bits (71), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 32/140 (22%), Positives = 63/140 (45%), Gaps = 10/140 (7%)

Query: 275 YGATSDGYQLAD-ECFAKAAKLYREQLANNNDAAFKEKAATALEYLGIFDFLKNDLDNSE 333
           Y  T  G++ ++ + F  A   YR+ LA N +         A   LG+        D + 
Sbjct: 473 YAYTLQGHEYSNNDAFDNAKMCYRKALAINPNHY------NAHYGLGMSCIKLGQYDEAL 526

Query: 334 KNLKEALALHPRVNTYIYLALTMA--DRGQSEDYFSYFEKAIALDPNNAAVYYHRGQMYF 391
            + ++A +++P VN  +     +A    G+ E    +++ A  L PN++   + + Q+ F
Sbjct: 527 LHFEKARSINP-VNVILNCCCGVALERLGRREKALDFYQLACELQPNSSLALFKKSQLLF 585

Query: 392 ITQNYEKAGEDFKKSKESDP 411
               Y  A ++F+K ++  P
Sbjct: 586 NLGQYSNALQNFEKLEQLTP 605

>Skud_2.24 Chr2 complement(50790..53099) [2310 bp, 769 aa] {ON}
           YBL084C (REAL)
          Length = 769

 Score = 35.0 bits (79), Expect = 0.58,   Method: Compositional matrix adjust.
 Identities = 40/187 (21%), Positives = 68/187 (36%), Gaps = 43/187 (22%)

Query: 369 FEKAIALDPNNAAVYYHRGQMYFITQNYEKAGEDFKKSKESDPKNIFPYIQLACLAYREN 428
           FEKA  LDPN A  Y  +G  +    + + A   ++K+   D ++   Y  L   + +  
Sbjct: 574 FEKATQLDPNFAYAYTLQGHEHSSNDSSDSAKTCYRKALACDSQHYNAYYGLGTSSMKLG 633

Query: 429 KMAECEKLFEEARKTFPTAPEVPNFYAEILADKGDIDEAVKQYNIAYRLESLQKQIHVGI 488
           +  E    FE+AR   P    +      I    G +++      + Y+ ++L        
Sbjct: 634 QYEEALLYFEKARSINPVNVVL------ICCCGGSLEK------LGYKEKAL-------- 673

Query: 489 APLVGKATILARQPTPENFATISQLLEDACKADPRSEQAKVGLAQLRLQQEKVDEAIELF 548
                                  Q  E AC   P S  +K  + QL     + + A++ F
Sbjct: 674 -----------------------QYYELACHLQPTSSLSKYKMGQLLYSMTRYNVALQTF 710

Query: 549 EEAAKMA 555
           EE  K+ 
Sbjct: 711 EELVKLV 717

 Score = 32.0 bits (71), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 38/160 (23%), Positives = 64/160 (40%), Gaps = 2/160 (1%)

Query: 327 NDLDNSEKNL-KEALALHPR-VNTYIYLALTMADRGQSEDYFSYFEKAIALDPNNAAVYY 384
           ND  +S K   ++ALA   +  N Y  L  +    GQ E+   YFEKA +++P N  +  
Sbjct: 598 NDSSDSAKTCYRKALACDSQHYNAYYGLGTSSMKLGQYEEALLYFEKARSINPVNVVLIC 657

Query: 385 HRGQMYFITQNYEKAGEDFKKSKESDPKNIFPYIQLACLAYRENKMAECEKLFEEARKTF 444
             G         EKA + ++ +    P +     ++  L Y   +     + FEE  K  
Sbjct: 658 CCGGSLEKLGYKEKALQYYELACHLQPTSSLSKYKMGQLLYSMTRYNVALQTFEELVKLV 717

Query: 445 PTAPEVPNFYAEILADKGDIDEAVKQYNIAYRLESLQKQI 484
           P          +     G   +A+K+  +A  L+    Q+
Sbjct: 718 PDDATAHYLLGQTYRIVGRKKDAIKELTVAMNLDPKGNQV 757

>KLTH0C06204g Chr3 complement(538533..540416) [1884 bp, 627 aa] {ON}
           some similarities with uniprot|P38042 Saccharomyces
           cerevisiae YBL084C CDC27 Subunit of the
           Anaphase-Promoting Complex/Cyclosome (APC/C) which is a
           ubiquitin-protein ligase required for degradation of
           anaphase inhibitors including mitotic cyclins during the
           metaphase/anaphase transition
          Length = 627

 Score = 35.0 bits (79), Expect = 0.59,   Method: Compositional matrix adjust.
 Identities = 26/131 (19%), Positives = 56/131 (42%)

Query: 348 TYIYLALTMADRGQSEDYFSYFEKAIALDPNNAAVYYHRGQMYFITQNYEKAGEDFKKSK 407
           T+  +    + +   E+    F+++  LDP+    Y  +G  Y     ++ A   ++K+ 
Sbjct: 411 TWCCIGNLFSLKKDHEESIKAFQRSTQLDPSFTYAYTLQGHEYSSNDAFDTAMTCYRKAL 470

Query: 408 ESDPKNIFPYIQLACLAYRENKMAECEKLFEEARKTFPTAPEVPNFYAEILADKGDIDEA 467
            S+P++   +  L     +  +  EC   FE+AR   P    +       L      ++A
Sbjct: 471 GSNPQHYNAHYGLGMCCLKLGQYEECLLHFEKARSINPVNVILICCCGVALEKLSHQEKA 530

Query: 468 VKQYNIAYRLE 478
           ++ Y++A  L+
Sbjct: 531 LQYYDLACELQ 541

 Score = 31.2 bits (69), Expect = 8.6,   Method: Compositional matrix adjust.
 Identities = 37/164 (22%), Positives = 67/164 (40%), Gaps = 2/164 (1%)

Query: 323 DFLKND-LDNSEKNLKEALALHPR-VNTYIYLALTMADRGQSEDYFSYFEKAIALDPNNA 380
           ++  ND  D +    ++AL  +P+  N +  L +     GQ E+   +FEKA +++P N 
Sbjct: 452 EYSSNDAFDTAMTCYRKALGSNPQHYNAHYGLGMCCLKLGQYEECLLHFEKARSINPVNV 511

Query: 381 AVYYHRGQMYFITQNYEKAGEDFKKSKESDPKNIFPYIQLACLAYRENKMAECEKLFEEA 440
            +    G       + EKA + +  + E  P +     + A L     K     + FE+ 
Sbjct: 512 ILICCCGVALEKLSHQEKALQYYDLACELQPVSSLALFKRAQLLLAMGKYNFALENFEKL 571

Query: 441 RKTFPTAPEVPNFYAEILADKGDIDEAVKQYNIAYRLESLQKQI 484
               P    +     ++    G   +AVK+  IA  L+    Q+
Sbjct: 572 VTIAPDEATIHFLLGQLYQIVGRKQDAVKELTIAMNLDPKGSQL 615

>NCAS0A15300 Chr1 (3006855..3011051) [4197 bp, 1398 aa] {ON} 
          Length = 1398

 Score = 35.0 bits (79), Expect = 0.61,   Method: Compositional matrix adjust.
 Identities = 18/67 (26%), Positives = 32/67 (47%)

Query: 349 YIYLALTMADRGQSEDYFSYFEKAIALDPNNAAVYYHRGQMYFITQNYEKAGEDFKKSKE 408
           Y  + +   +R Q  D   +F+ AI +DPN+   +   GQ Y      E + + F+K+ E
Sbjct: 668 YRVIGIGNLERQQESDSIEWFQSAIRVDPNDVESWIGLGQAYLGCGRIEASIKVFEKAIE 727

Query: 409 SDPKNIF 415
            D  + +
Sbjct: 728 LDSSHTY 734

>TPHA0J02730 Chr10 (603215..604906) [1692 bp, 563 aa] {ON} Anc_5.466
           YOR132W
          Length = 563

 Score = 35.0 bits (79), Expect = 0.64,   Method: Compositional matrix adjust.
 Identities = 27/115 (23%), Positives = 53/115 (46%), Gaps = 9/115 (7%)

Query: 452 NFYAEILADKGDIDEAVKQYNIAYRLESLQKQIHVGIAPLVGKATILARQPTPENFATIS 511
           N + +I+   GDID  +   +IA   + L+          +   T + ++        + 
Sbjct: 312 NHFGKIITTVGDIDSIIATLDIATLYDGLE---------WIVNDTYVVKEALTNRHLLMR 362

Query: 512 QLLEDACKADPRSEQAKVGLAQLRLQQEKVDEAIELFEEAAKMARTVDEKLQAIT 566
           +LL+       + EQA+   A+      KV+E+I+  +EA+K+ + +  KL+ IT
Sbjct: 363 ELLKAQQSTKSKQEQARKLRAKRDTNPVKVEESIQQLKEASKLEQQLTLKLERIT 417

>Kpol_1028.51 s1028 complement(123535..123888) [354 bp, 117 aa] {ON}
           complement(123535..123888) [354 nt, 118 aa]
          Length = 117

 Score = 32.7 bits (73), Expect = 0.65,   Method: Compositional matrix adjust.
 Identities = 18/63 (28%), Positives = 32/63 (50%), Gaps = 1/63 (1%)

Query: 97  KDKGNALFKEKRFEDAIEFYNHAIKLH-EDPVFHSNISACYVSLGDLDKVVESSTRALEL 155
           K  GN  FK+  +  A+E+Y   I++  E+P+ +SN +   + L    + +ES    L+ 
Sbjct: 7   KTTGNTYFKDGNYLKAVEYYKKCIEVEPENPIGYSNSAMSLIKLTKYTEALESCGTGLKY 66

Query: 156 KPD 158
             D
Sbjct: 67  VND 69

>SAKL0A01672g Chr1 complement(154932..155318) [387 bp, 128 aa] {ON}
           similar to uniprot|P25638 Saccharomyces cerevisiae
           YCR060W TAH1 HSP90
          Length = 128

 Score = 33.1 bits (74), Expect = 0.69,   Method: Compositional matrix adjust.
 Identities = 18/62 (29%), Positives = 33/62 (53%), Gaps = 1/62 (1%)

Query: 95  ALKDKGNALFKEKRFEDAIEFYNHAIKLH-EDPVFHSNISACYVSLGDLDKVVESSTRAL 153
            LK KGN  FK+  +E A+ +Y  AI     +P+ +SN +   + L    + V++  + L
Sbjct: 6   TLKAKGNVFFKKCDYETAVLYYQKAITADPSNPIGYSNNAMGLIKLEKWSEAVDACNKGL 65

Query: 154 EL 155
           ++
Sbjct: 66  KM 67

>Kwal_34.16092 s34 complement(198730..199917) [1188 bp, 395 aa] {ON}
           YJR032W (CPR7) - peptidyl-prolyl cis/trans isomerase
           [contig 270] FULL
          Length = 395

 Score = 34.7 bits (78), Expect = 0.76,   Method: Compositional matrix adjust.
 Identities = 22/67 (32%), Positives = 34/67 (50%), Gaps = 4/67 (5%)

Query: 349 YIYLALTMADRGQSEDYFSY----FEKAIALDPNNAAVYYHRGQMYFITQNYEKAGEDFK 404
           Y+ L+L M +  + E+  +Y     E   A   + A  YY  G  +F  + Y+KA  DFK
Sbjct: 297 YLNLSLVMFNLKRYEEAITYTTYLLEIPEASSIDKAKAYYRSGNCHFAKKRYDKALSDFK 356

Query: 405 KSKESDP 411
             KE++P
Sbjct: 357 CCKENNP 363

>Skud_15.245 Chr15 (431002..433254) [2253 bp, 750 aa] {ON} YOR080W
           (REAL)
          Length = 750

 Score = 34.7 bits (78), Expect = 0.83,   Method: Compositional matrix adjust.
 Identities = 16/35 (45%), Positives = 21/35 (60%)

Query: 131 NISACYVSLGDLDKVVESSTRALELKPDYSKALLR 165
           NI ACY  L DL   ++ S R+L+L PD  K  +R
Sbjct: 92  NICACYEKLDDLKSCLKISRRSLKLDPDNVKCYIR 126

>Kwal_14.874 s14 complement(90148..92316) [2169 bp, 722 aa] {ON}
           YKL022C (CDC16) - putative metal-binding nucleic
           acid-binding protein, interacts with Cdc23p and Cdc27p
           to catalyze the conjugation of ubiquitin to cyclin B
           [contig 245] FULL
          Length = 722

 Score = 34.7 bits (78), Expect = 0.83,   Method: Compositional matrix adjust.
 Identities = 33/137 (24%), Positives = 57/137 (41%), Gaps = 11/137 (8%)

Query: 391 FITQNYEKAGED-----FKKSKESDPKNIFPYIQLACLAYRENKMAECEKLFEEARKTFP 445
           FI+  YE  G++       K  E+ PK+   +  +       NK+AE  K F +A    P
Sbjct: 409 FISCLYELGGKNKLFLISHKMAENFPKHPITWFGVGAYYMCSNKVAEARKYFSKASILDP 468

Query: 446 TAPEVPNFYAEILADKGDIDEAVKQYNIAYRLESLQKQIHVGIAPLVGKATILARQPTPE 505
           +  +    +A   A +G+ ++A+  Y+ A R        H+    L  +  I+   P  E
Sbjct: 469 SFSQAWIGFAHTYAVEGEHEQAISAYSTASRFF---PGTHLPNLFLGMQYLIMGTLPLAE 525

Query: 506 NFATISQLLEDACKADP 522
            +  ++    D C  DP
Sbjct: 526 EYFVLAY---DVCPYDP 539

>TPHA0G00240 Chr7 complement(37417..41709) [4293 bp, 1430 aa] {ON}
           Anc_7.546 YPR189W
          Length = 1430

 Score = 34.7 bits (78), Expect = 0.88,   Method: Compositional matrix adjust.
 Identities = 20/81 (24%), Positives = 44/81 (54%), Gaps = 1/81 (1%)

Query: 111 DAIEFYNHAIKL-HEDPVFHSNISACYVSLGDLDKVVESSTRALELKPDYSKALLRRASA 169
           ++IE++  A+++  ED      +   YV  G ++  ++   +A+EL  ++  A L  A +
Sbjct: 716 ESIEWFQSALRIDKEDIESWVGLGQAYVGCGRIEASIKVFEKAIELDSNHLYAKLFLAES 775

Query: 170 YENMGRYQDAMFDISVLSLNG 190
             N+G Y+D++  +  L+L+ 
Sbjct: 776 LSNIGEYEDSILLLKELTLSS 796

>Suva_2.410 Chr2 (729992..731827) [1836 bp, 611 aa] {ON} YDR244W
           (REAL)
          Length = 611

 Score = 34.3 bits (77), Expect = 0.90,   Method: Compositional matrix adjust.
 Identities = 22/92 (23%), Positives = 51/92 (55%), Gaps = 2/92 (2%)

Query: 100 GNALFKEKRFEDAIEFYNHAIKLH-EDPVFHSNISACYVSLGDLDKVVESSTRALELKPD 158
           G   + +  F+  I+ +  A+K++  D +  + + A   +    ++ +++  RAL+LKP 
Sbjct: 464 GLLFYTKDDFDKTIDCFESALKVNPNDELMWNRLGASLANSNRSEEAIQAYHRALQLKPS 523

Query: 159 YSKALLRRASAYENMGRYQDAM-FDISVLSLN 189
           + +A    A +  N+G Y++A  + ++VLS++
Sbjct: 524 FVRARYNLAVSSMNIGCYKEAAGYLLTVLSMH 555

>Smik_15.313 Chr15 (534587..536239) [1653 bp, 550 aa] {ON} YOR132W
           (REAL)
          Length = 550

 Score = 34.3 bits (77), Expect = 0.91,   Method: Compositional matrix adjust.
 Identities = 29/113 (25%), Positives = 52/113 (46%), Gaps = 9/113 (7%)

Query: 454 YAEILADKGDIDEAVKQYNIAYRLESLQKQIHVGIAPLVGKATILARQPTPENFATISQL 513
           Y  IL   GDID  +   ++A         ++ G+  +V  A ++    T  +F   S L
Sbjct: 312 YGRILTAVGDIDSIIATMDMA--------TLYDGLEWVVRDAYVVKEALTNRHFVMRS-L 362

Query: 514 LEDACKADPRSEQAKVGLAQLRLQQEKVDEAIELFEEAAKMARTVDEKLQAIT 566
           ++    +  + EQA+   ++  +   K+DEA+   + A K  + +  KLQ IT
Sbjct: 363 IQAQQNSKTKQEQARRFRSRRDINPMKIDEALRQLKMATKKEQVLTLKLQRIT 415

>NDAI0I00440 Chr9 complement(89650..90036) [387 bp, 128 aa] {ON}
           Anc_6.328 YCR060W
          Length = 128

 Score = 32.7 bits (73), Expect = 0.91,   Method: Compositional matrix adjust.
 Identities = 18/67 (26%), Positives = 33/67 (49%), Gaps = 1/67 (1%)

Query: 96  LKDKGNALFKEKRFEDAIEFYNHAIKLH-EDPVFHSNISACYVSLGDLDKVVESSTRALE 154
           LK +GN  F++  +  A  +Y+  IKL   +P+ +SN +   +  G+    VE+    L+
Sbjct: 6   LKQEGNTFFQKGDYAQANGYYDQCIKLEPTNPIGYSNKAMSLIKQGNHGLAVETCQEGLK 65

Query: 155 LKPDYSK 161
                +K
Sbjct: 66  YTSSSTK 72

>Kwal_27.10740 s27 complement(476617..478503) [1887 bp, 628 aa] {ON}
           YBL084C (CDC27) - component of the anaphase-promoting
           complex [contig 33] FULL
          Length = 628

 Score = 34.3 bits (77), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 26/133 (19%), Positives = 56/133 (42%)

Query: 348 TYIYLALTMADRGQSEDYFSYFEKAIALDPNNAAVYYHRGQMYFITQNYEKAGEDFKKSK 407
           T+  +    + +   E+    F+++  LDP+    Y  +G  Y     ++ A   ++K+ 
Sbjct: 412 TWCCIGNLFSLKKDHEESIKAFQRSTQLDPSFTYAYTLQGHEYSSNDAFDTAMTCYRKAL 471

Query: 408 ESDPKNIFPYIQLACLAYRENKMAECEKLFEEARKTFPTAPEVPNFYAEILADKGDIDEA 467
            S+ ++   Y  L   + +  +  EC   FE+AR   P    +       L      + A
Sbjct: 472 ASNSQHYNAYYGLGMCSLKLGQYEECLLHFEKARSINPVNVILICCCGVALEKLSHQERA 531

Query: 468 VKQYNIAYRLESL 480
           ++ Y++A  L+ +
Sbjct: 532 LQNYDLACELQPM 544

 Score = 34.3 bits (77), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 38/164 (23%), Positives = 69/164 (42%), Gaps = 2/164 (1%)

Query: 323 DFLKND-LDNSEKNLKEALALHPR-VNTYIYLALTMADRGQSEDYFSYFEKAIALDPNNA 380
           ++  ND  D +    ++ALA + +  N Y  L +     GQ E+   +FEKA +++P N 
Sbjct: 453 EYSSNDAFDTAMTCYRKALASNSQHYNAYYGLGMCSLKLGQYEECLLHFEKARSINPVNV 512

Query: 381 AVYYHRGQMYFITQNYEKAGEDFKKSKESDPKNIFPYIQLACLAYRENKMAECEKLFEEA 440
            +    G       + E+A +++  + E  P +     + A L     K     + FE+ 
Sbjct: 513 ILICCCGVALEKLSHQERALQNYDLACELQPMSSLALFKRAQLLLAMGKYNYALESFEKL 572

Query: 441 RKTFPTAPEVPNFYAEILADKGDIDEAVKQYNIAYRLESLQKQI 484
            K  P    +     ++    G   +AVK+  IA  L+    Q+
Sbjct: 573 VKIAPDEATIHFLLGQLYQIVGRKQDAVKELTIAMNLDPKGSQL 616

>SAKL0F16236g Chr6 (1313573..1317799) [4227 bp, 1408 aa] {ON} similar
            to uniprot|P17883 Saccharomyces cerevisiae YPR189W SKI3
            dsRNA virus protection family member contains 8 copies of
            the tetratricopeptide (TPR) domain
          Length = 1408

 Score = 34.3 bits (77), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 20/69 (28%), Positives = 32/69 (46%)

Query: 369  FEKAIALDPNNAAVYYHRGQMYFITQNYEKAGEDFKKSKESDPKNIFPYIQLACLAYREN 428
            F KAIAL P    ++Y    +     + E A +   KS+   P++  P+  +A     EN
Sbjct: 984  FIKAIALAPKEIGIWYDLAILALKNGDIEFARDVLMKSQSIAPQDSSPWFGMALAHEHEN 1043

Query: 429  KMAECEKLF 437
             + E  K+F
Sbjct: 1044 NLEESSKMF 1052

 Score = 31.6 bits (70), Expect = 7.2,   Method: Compositional matrix adjust.
 Identities = 15/67 (22%), Positives = 34/67 (50%)

Query: 349 YIYLALTMADRGQSEDYFSYFEKAIALDPNNAAVYYHRGQMYFITQNYEKAGEDFKKSKE 408
           Y  L ++  ++ +  +   +F+ A+ +D N+   +   GQ Y+     E + + F+K+ E
Sbjct: 681 YRVLGVSYLEKQKEPESIEWFQSALRVDANDVESWVGLGQAYYACGRLEASIKVFEKATE 740

Query: 409 SDPKNIF 415
             P ++F
Sbjct: 741 LAPDHLF 747

>KAFR0D02340 Chr4 complement(473431..475524) [2094 bp, 697 aa] {ON}
           Anc_5.689 YOR080W
          Length = 697

 Score = 34.3 bits (77), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 14/49 (28%), Positives = 29/49 (59%)

Query: 131 NISACYVSLGDLDKVVESSTRALELKPDYSKALLRRASAYENMGRYQDA 179
           N++AC+  L DL + +  S + ++L+P   K  +RR    + +G+ ++A
Sbjct: 72  NLAACWEKLNDLKRALNYSDKMVQLEPYNLKCYIRRGKVLQKLGKDKEA 120

>ZYRO0D00572g Chr4 complement(42511..44830,45510..45547) [2358 bp,
           785 aa] {ON} similar to uniprot|P09798 Saccharomyces
           cerevisiae YKL022C CDC16 Subunit of the
           anaphase-promoting complex/cyclosome (APC/C) which is a
           ubiquitin-protein ligase required for degradation of
           anaphase inhibitors including mitotic cyclins during the
           metaphase/anaphase transition required for sporulation
          Length = 785

 Score = 34.3 bits (77), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 24/107 (22%), Positives = 49/107 (45%), Gaps = 8/107 (7%)

Query: 316 LEYLGIFDFLKNDLDNSEKNLKEAL----ALHPRVNTYIYLALTMADR----GQSEDYFS 367
           L  +G+  F +NDL  +++ LK AL     L+P   T + + + +A      G++E    
Sbjct: 602 LNEMGVMYFKRNDLHKAKRYLKRALEAVKELNPTSRTSVSIQMNLAHAYRRLGENERAIK 661

Query: 368 YFEKAIALDPNNAAVYYHRGQMYFITQNYEKAGEDFKKSKESDPKNI 414
            F+  + +   ++  Y   G +Y  T+  ++A +    +    P N+
Sbjct: 662 CFKTVLEVSSKDSDTYCSLGFLYLKTKELQRAIDHLHTALSLKPSNL 708

>KAFR0B06400 Chr2 complement(1324711..1326300) [1590 bp, 529 aa]
           {ON} Anc_5.466 YOR132W
          Length = 529

 Score = 33.9 bits (76), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 27/117 (23%), Positives = 55/117 (47%), Gaps = 17/117 (14%)

Query: 454 YAEILADKGDIDEAVKQYNIAYRLESLQKQIHVGIAPLVGKATILARQPTPENFATISQL 513
           Y ++L   GDI+  +   ++A         ++ G   ++  A  +    T  +F     L
Sbjct: 290 YGKVLITVGDIESIISTMDLA--------TLYDGFEWIINDAYSVKETLTNRHF-----L 336

Query: 514 LEDACKADPRSEQAKVGLAQLRLQQE----KVDEAIELFEEAAKMARTVDEKLQAIT 566
           + D  +A   S+Q +  + +LR +++    K+DE+++ F+E  K   ++  KLQ  T
Sbjct: 337 MRDLIQAQQNSKQKQENVKKLRSRRDLNPLKIDESLKEFKEIIKYEESLTLKLQRTT 393

>Smik_4.491 Chr4 (895429..897267) [1839 bp, 612 aa] {ON} YDR244W
           (REAL)
          Length = 612

 Score = 33.9 bits (76), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 22/92 (23%), Positives = 51/92 (55%), Gaps = 2/92 (2%)

Query: 100 GNALFKEKRFEDAIEFYNHAIKLH-EDPVFHSNISACYVSLGDLDKVVESSTRALELKPD 158
           G   + +  F+  I+ +  A+K++  D +  + + A   +    ++ +++  RAL+LKP 
Sbjct: 465 GLLFYTKDDFDKTIDCFESALKVNPNDELMWNRLGASLANSNRSEEAIQAYHRALQLKPS 524

Query: 159 YSKALLRRASAYENMGRYQDAM-FDISVLSLN 189
           + +A    A +  N+G +++A  + +SVLS++
Sbjct: 525 FVRARYNLAVSSMNIGCFKEAAGYLLSVLSMH 556

>SAKL0F12936g Chr6 (1016829..1018727) [1899 bp, 632 aa] {ON} similar
           to uniprot|Q751K0 Ashbya gossypii AGL294W AGL294Wp and
           some similarites with YBL084C uniprot|P38042
           Saccharomyces cerevisiae YBL084C CDC27 Subunit of the
           Anaphase-Promoting Complex/Cyclosome (APC/C) which is a
           ubiquitin-protein ligase required for degradation of
           anaphase inhibitors including mitotic cyclins during the
           metaphase/anaphase transition
          Length = 632

 Score = 33.5 bits (75), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 15/44 (34%), Positives = 25/44 (56%)

Query: 369 FEKAIALDPNNAAVYYHRGQMYFITQNYEKAGEDFKKSKESDPK 412
           FEK + + P+ A V++  GQ+Y I    + A ++F  +   DPK
Sbjct: 573 FEKLVIMAPDEATVHFLLGQLYHIVGRKKDAIKEFTVAMNLDPK 616

 Score = 32.0 bits (71), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 30/134 (22%), Positives = 58/134 (43%), Gaps = 10/134 (7%)

Query: 275 YGATSDGYQLA-DECFAKAAKLYREQLANNNDAAFKEKAATALEYLGIFDFLKNDLDNSE 333
           Y  T  G++ + ++ F  A   YR+ LA N+      +   A   LG+        + S 
Sbjct: 449 YAYTLQGHEYSSNDAFDTAKTCYRKALATNS------QHYNASYGLGMCCLKLGQYEESL 502

Query: 334 KNLKEALALHPRVNTYIYLALTMA--DRGQSEDYFSYFEKAIALDPNNAAVYYHRGQMYF 391
            + ++A +++P VN  +     +     G  +D   Y+E A  L P ++   + + Q+  
Sbjct: 503 LHFQKAHSINP-VNVILICCCGVVFEKLGHQQDALKYYELACELQPTSSLALFKKSQLLL 561

Query: 392 ITQNYEKAGEDFKK 405
              +Y  A  +F+K
Sbjct: 562 SMGSYNSALVNFEK 575

>YOR132W Chr15 (573175..574830) [1656 bp, 551 aa] {ON}  VPS17Subunit
           of the membrane-associated retromer complex essential
           for endosome-to-Golgi retrograde protein transport;
           peripheral membrane protein that assembles onto the
           membrane with Vps5p to promote vesicle formation
          Length = 551

 Score = 33.5 bits (75), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 29/113 (25%), Positives = 53/113 (46%), Gaps = 9/113 (7%)

Query: 454 YAEILADKGDIDEAVKQYNIAYRLESLQKQIHVGIAPLVGKATILARQPTPENFATISQL 513
           Y +IL   GDID  +   ++A         ++ G+  +V  A  +    T  +F  +  L
Sbjct: 313 YGKILTAVGDIDSIIATMDMA--------TLYDGLEWIVRDAYAVKEALTNRHF-IMRNL 363

Query: 514 LEDACKADPRSEQAKVGLAQLRLQQEKVDEAIELFEEAAKMARTVDEKLQAIT 566
           ++    +  + EQA+   ++  +   K+DEA+   + AAK  + +  KLQ IT
Sbjct: 364 VQAQQNSKAKQEQARRFRSRRDINPMKIDEALRQLKAAAKNEQVLTLKLQRIT 416

>NDAI0G03710 Chr7 complement(894337..897702) [3366 bp, 1121 aa] {ON}
           Anc_3.5 YOL145C
          Length = 1121

 Score = 33.9 bits (76), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 25/102 (24%), Positives = 44/102 (43%), Gaps = 18/102 (17%)

Query: 99  KGNALFKEKRFEDAIEFYNHAIKLHEDPVFHSN----ISACYVSLGDLDKVVESSTRALE 154
           +   LF++K F  +++ +     L  +PV   +    I AC+  L D    + +  R+LE
Sbjct: 203 RAKLLFRKKNFMASLKLFQEL--LVNNPVLKPDPRIGIGACFWQLKDYKMAINAWERSLE 260

Query: 155 LKP------------DYSKALLRRASAYENMGRYQDAMFDIS 184
           L P             + K L+   +  E    ++DAM D+S
Sbjct: 261 LDPTNKNSKVLCLLGKFHKTLIDSGNDDEFKDNFKDAMIDLS 302

>Suva_8.129 Chr8 (231888..234113) [2226 bp, 741 aa] {ON} YOR080W
           (REAL)
          Length = 741

 Score = 33.5 bits (75), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 15/35 (42%), Positives = 21/35 (60%)

Query: 131 NISACYVSLGDLDKVVESSTRALELKPDYSKALLR 165
           NI ACY  L DL   +  S ++L+L PD +K  +R
Sbjct: 83  NICACYEKLDDLKSCLSISQKSLKLDPDNAKCYIR 117

>SAKL0B07986g Chr2 complement(675999..678641) [2643 bp, 880 aa] {ON}
           highly similar to uniprot|P14922 Saccharomyces
           cerevisiae YBR112C CYC8 General transcriptional co-
           repressor acts together with Tup1p also acts as part of
           a transcriptional co-activator complex that recruits the
           SWI/SNF and SAGA complexes to promoters
          Length = 880

 Score = 33.5 bits (75), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 25/105 (23%), Positives = 46/105 (43%), Gaps = 2/105 (1%)

Query: 313 ATALEYLGIFDFLKNDLDNSEKNLKEALALHPRVNT-YIYLALTMADRGQSEDYFSYFEK 371
           AT   +LG    ++ND   +    ++A+    R  T +  + +      Q  D    + +
Sbjct: 308 ATTWYHLGRIHMVRNDYTAAYDAFQQAVNRDSRNPTFWCSIGVLYYQISQYRDALDAYTR 367

Query: 372 AIALDPNNAAVYYHRGQMYFITQN-YEKAGEDFKKSKESDPKNIF 415
           AI L+P  + V+Y  G +Y    N    A + +K++   DP N+ 
Sbjct: 368 AIRLNPYISEVWYDLGTLYETCNNQLTDALDAYKQAARLDPNNVH 412

>SAKL0D11110g Chr4 (920630..921928) [1299 bp, 432 aa] {ON} similar
           to uniprot|P47103 Saccharomyces cerevisiae YJR032W CPR7
           Peptidyl-prolyl cis-trans isomerase (cyclophilin)
           catalyzes the cis-trans isomerization of peptide bonds
           N-terminal to proline residues binds to Hsp82p and
           contributes to chaperone activity
          Length = 432

 Score = 33.1 bits (74), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 29/113 (25%), Positives = 48/113 (42%), Gaps = 23/113 (20%)

Query: 93  ATALKDKGNALFKEKRFEDAIEFYNHAIKLHEDPV-------------------FHSNIS 133
           A  +K+ G  LFK+K F+DA   Y  A++   + +                    + NIS
Sbjct: 279 ANKIKESGTQLFKKKDFQDAFFKYRKALRYVNEYIPDMDVDEELSVKFAELKMKLYLNIS 338

Query: 134 ACYVSLGDLDKVVESSTRALELKP----DYSKALLRRASAYENMGRYQDAMFD 182
               +L   D  +  +T  LE++     D +KA  RR + Y    R ++A+ D
Sbjct: 339 LVLFNLKKYDSAITHATYLLEMEKVPTLDKAKAYYRRGNCYLAKNRLEEALKD 391

>YDR244W Chr4 (950563..952401) [1839 bp, 612 aa] {ON}
           PEX5Peroxisomal membrane signal receptor for the
           C-terminal tripeptide signal sequence (PTS1) of
           peroxisomal matrix proteins, required for peroxisomal
           matrix protein import; also proposed to have
           PTS1-receptor independent functions
          Length = 612

 Score = 33.1 bits (74), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 21/92 (22%), Positives = 51/92 (55%), Gaps = 2/92 (2%)

Query: 100 GNALFKEKRFEDAIEFYNHAIKLH-EDPVFHSNISACYVSLGDLDKVVESSTRALELKPD 158
           G   + +  F+  I+ +  A++++  D +  + + A   +    ++ +++  RAL+LKP 
Sbjct: 464 GLLFYTKDDFDKTIDCFESALRVNPNDELMWNRLGASLANSNRSEEAIQAYHRALQLKPS 523

Query: 159 YSKALLRRASAYENMGRYQDAM-FDISVLSLN 189
           + +A    A +  N+G +++A  + +SVLS++
Sbjct: 524 FVRARYNLAVSSMNIGCFKEAAGYLLSVLSMH 555

>Ecym_3459 Chr3 (864878..868225) [3348 bp, 1115 aa] {ON} similar to
           Ashbya gossypii ADL344W
          Length = 1115

 Score = 33.1 bits (74), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 25/105 (23%), Positives = 46/105 (43%), Gaps = 2/105 (1%)

Query: 313 ATALEYLGIFDFLKNDLDNSEKNLKEALALHPRVNT-YIYLALTMADRGQSEDYFSYFEK 371
           AT   +LG    ++ND   +    ++A+    R  T +  + +      Q  D    + +
Sbjct: 378 ATTWYHLGRIHMVRNDYTAAYDAFQQAVNRDSRNPTFWCSIGVLYYQISQYRDALDAYTR 437

Query: 372 AIALDPNNAAVYYHRGQMYFITQN-YEKAGEDFKKSKESDPKNIF 415
           AI L+P  + V+Y  G +Y    N    A + +K++   DP N+ 
Sbjct: 438 AIRLNPYISEVWYDLGTLYETCNNQLNDALDAYKQAARLDPNNVH 482

>KAFR0L01870 Chr12 (345757..347895) [2139 bp, 712 aa] {ON} Anc_7.412
           YBL084C
          Length = 712

 Score = 33.1 bits (74), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 31/132 (23%), Positives = 55/132 (41%)

Query: 347 NTYIYLALTMADRGQSEDYFSYFEKAIALDPNNAAVYYHRGQMYFITQNYEKAGEDFKKS 406
           N Y  L    +  G  +    +FEKA  ++P N  +    G      +NYE A + +  +
Sbjct: 563 NAYYGLGTCDSQNGNHDRSLLFFEKARMINPVNIVLICCCGVELEKVRNYELALKYYDFA 622

Query: 407 KESDPKNIFPYIQLACLAYRENKMAECEKLFEEARKTFPTAPEVPNFYAEILADKGDIDE 466
            +  P +     + A L +   + +   +LFE+  K     P +     +I    G   +
Sbjct: 623 SKLQPNSALAKYRKAELLFSLGRYSLAVELFEDLIKLDSENPNLHYMLGKIYQTMGRKKD 682

Query: 467 AVKQYNIAYRLE 478
           AVK+Y +A  L+
Sbjct: 683 AVKEYTVAMNLD 694

>Skud_15.296 Chr15 (529599..531236) [1638 bp, 545 aa] {ON} YOR132W
           (REAL)
          Length = 545

 Score = 32.7 bits (73), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 26/114 (22%), Positives = 50/114 (43%), Gaps = 9/114 (7%)

Query: 454 YAEILADKGDIDEAVKQYNIAYRLESLQKQIHVGIAPLVGKATILARQPTPENFATISQL 513
           Y +IL   GDID  +   ++A   + L+          V + T + ++        +  L
Sbjct: 307 YGKILTAVGDIDSIIATMDMATLYDGLE---------WVIRDTYVVKEALTNRHFIMRNL 357

Query: 514 LEDACKADPRSEQAKVGLAQLRLQQEKVDEAIELFEEAAKMARTVDEKLQAITF 567
           ++    +  + EQA+   ++  +   K+DEA+   + A K  + +  KLQ IT 
Sbjct: 358 IQAQQNSKAKQEQARRFRSRRDINPMKIDEALRQLKTATKSEQVLTLKLQRITL 411

>ADL344W Chr4 (103565..106297) [2733 bp, 910 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YBR112C (CYC8)
          Length = 910

 Score = 33.1 bits (74), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 25/105 (23%), Positives = 46/105 (43%), Gaps = 2/105 (1%)

Query: 313 ATALEYLGIFDFLKNDLDNSEKNLKEALALHPRVNT-YIYLALTMADRGQSEDYFSYFEK 371
           AT   +LG    ++ND   +    ++A+    R  T +  + +      Q  D    + +
Sbjct: 312 ATTWYHLGRIHMVRNDYTAAYDAFQQAVNRDSRNPTFWCSIGVLYYQISQYRDALDAYTR 371

Query: 372 AIALDPNNAAVYYHRGQMYFITQN-YEKAGEDFKKSKESDPKNIF 415
           AI L+P  + V+Y  G +Y    N    A + +K++   DP N+ 
Sbjct: 372 AIRLNPYISEVWYDLGTLYETCNNQLSDALDAYKQAVRLDPNNVH 416

>Ecym_1366 Chr1 (753035..754213) [1179 bp, 392 aa] {ON} similar to
           Ashbya gossypii AEL062C
          Length = 392

 Score = 32.7 bits (73), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 24/84 (28%), Positives = 39/84 (46%), Gaps = 10/84 (11%)

Query: 338 EALALHPRVNTYIYLALT-----MADRGQSEDYFSYF---EKAIALDPNNAAVYYHRGQM 389
           E   L  ++   +YL L+     ++   +S  Y +Y    E   +LD   A  YY RG  
Sbjct: 281 ERFLLFNKLKMKLYLNLSFVLFILSRHDESITYANYLIEMEGVTSLDK--AKAYYRRGNC 338

Query: 390 YFITQNYEKAGEDFKKSKESDPKN 413
           Y + +  E A +D+K  KE +P +
Sbjct: 339 YLVKKRLEDALQDYKNCKEYNPND 362

>TPHA0L01210 Chr12 (252106..253872) [1767 bp, 588 aa] {ON} Anc_8.470
           YDR244W
          Length = 588

 Score = 32.7 bits (73), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 19/81 (23%), Positives = 42/81 (51%), Gaps = 1/81 (1%)

Query: 100 GNALFKEKRFEDAIEFYNHAIKLH-EDPVFHSNISACYVSLGDLDKVVESSTRALELKPD 158
           G   +    F+  I+ +  A+ +H ED +  + + A   +    ++ +++  +AL+LKP 
Sbjct: 438 GLLFYSNNEFDKTIDCFKTALVIHPEDELMWNRLGASLANSSRPEEAIQAYHKALQLKPS 497

Query: 159 YSKALLRRASAYENMGRYQDA 179
           + +A    A +  N+G Y++A
Sbjct: 498 FVRARYNLAVSSINIGCYKEA 518

>KAFR0A00300 Chr1 complement(56363..59044) [2682 bp, 893 aa] {ON}
           Anc_2.637 YMR066W
          Length = 893

 Score = 32.7 bits (73), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 23/89 (25%), Positives = 36/89 (40%), Gaps = 6/89 (6%)

Query: 506 NFATISQLLEDACKADPRSEQAKVGLAQLRLQQEKVDEAIELFEEAAKMARTVDEKLQAI 565
           N   I ++L+D CK  PR+  A+            +   +ELFE    +      KL  +
Sbjct: 199 NINLILKILQDLCKNIPRNTMARYK------SVVPISLLVELFEMFKLVPLRKKRKLGIL 252

Query: 566 TFAEATKVQKRIRADPVVSKKVEETLAAY 594
              +     K++R DPV       +L AY
Sbjct: 253 LAGKLIYASKKVRMDPVNESFYINSLVAY 281

>YOR080W Chr15 (474594..476792) [2199 bp, 732 aa] {ON}
           DIA2Origin-binding F-box protein; forms an SCF ubiquitin
           ligase complex with Skp1p and Cdc53p; plays a role in
           DNA replication; plays a role in transcription; required
           for correct assembly of RSC complex, correct
           RSC-mediated transcription regulation, and correct
           nucleosome positioning; involved in invasive and
           pseudohyphal growth
          Length = 732

 Score = 32.7 bits (73), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 15/35 (42%), Positives = 20/35 (57%)

Query: 131 NISACYVSLGDLDKVVESSTRALELKPDYSKALLR 165
           NI ACY  L DL   ++ S R L+L+P   K  +R
Sbjct: 83  NICACYEKLNDLKSCLDVSQRLLKLEPGNIKCYIR 117

>Skud_4.506 Chr4 (905143..906978) [1836 bp, 611 aa] {ON} YDR244W
           (REAL)
          Length = 611

 Score = 32.3 bits (72), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 22/92 (23%), Positives = 50/92 (54%), Gaps = 2/92 (2%)

Query: 100 GNALFKEKRFEDAIEFYNHAIKLH-EDPVFHSNISACYVSLGDLDKVVESSTRALELKPD 158
           G   + +  F+  I+ +  A+K++  D +  + + A   +    ++ +++  RAL+LKP 
Sbjct: 464 GLLFYTKDDFDKTIDCFESALKVNPNDELMWNRLGASLANSNRSEEAIQAYHRALQLKPS 523

Query: 159 YSKALLRRASAYENMGRYQDAM-FDISVLSLN 189
           + +A    A +  N+G  ++A  + +SVLS++
Sbjct: 524 FVRARYNLAVSSMNIGCLKEAAGYLLSVLSMH 555

>NDAI0C05130 Chr3 (1193350..1195122) [1773 bp, 590 aa] {ON}
           Anc_8.470
          Length = 590

 Score = 32.3 bits (72), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 18/77 (23%), Positives = 41/77 (53%), Gaps = 1/77 (1%)

Query: 104 FKEKRFEDAIEFYNHAIKLH-EDPVFHSNISACYVSLGDLDKVVESSTRALELKPDYSKA 162
           +    F+  +E + +A+K++  D +  + + A   +    ++ +++  +A+ LKP + +A
Sbjct: 452 YSNDDFDKTLECFQNALKINPNDELMWNRLGASLANSNRSEEAIKAYHKAINLKPSFVRA 511

Query: 163 LLRRASAYENMGRYQDA 179
               A A  N+G YQ+A
Sbjct: 512 RYNLAVASMNIGCYQEA 528

>Suva_16.521 Chr16 (895057..899331) [4275 bp, 1424 aa] {ON} YPR189W
           (REAL)
          Length = 1424

 Score = 32.3 bits (72), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 19/82 (23%), Positives = 45/82 (54%), Gaps = 1/82 (1%)

Query: 100 GNALFKEKRFEDAIEFYNHAIKLHEDPV-FHSNISACYVSLGDLDKVVESSTRALELKPD 158
           G A  +++   D+IE++  A+++  + V     +   Y + G ++  ++   +A+EL+P 
Sbjct: 702 GIAHLEKQEESDSIEWFQSALRVDPNDVESWVGLGQAYHACGRIEASIKVFDKAIELQPS 761

Query: 159 YSKALLRRASAYENMGRYQDAM 180
           ++ A   RA +  +MG Y +++
Sbjct: 762 HTYARYFRALSLCDMGEYLESL 783

>KLTH0F15202g Chr6 complement(1247894..1249558) [1665 bp, 554 aa]
           {ON} similar to uniprot|P32913 Saccharomyces cerevisiae
           YOR132W VPS17 Peripheral membrane protein required for
           vacuolar protein sorting
          Length = 554

 Score = 32.3 bits (72), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 31/115 (26%), Positives = 52/115 (45%), Gaps = 9/115 (7%)

Query: 452 NFYAEILADKGDIDEAVKQYNIAYRLESLQKQIHVGIAPLVGKATILARQPTPENFATIS 511
           N + + L+  GDID  +   +IA         ++ G+  LV +   +    T  +F  + 
Sbjct: 314 NKFGKTLSAVGDIDSVMATLDIA--------TLYDGLEWLVQETYSVKEALTNRHFL-MR 364

Query: 512 QLLEDACKADPRSEQAKVGLAQLRLQQEKVDEAIELFEEAAKMARTVDEKLQAIT 566
            LL+    +  R EQA+   A+  +   KVDEAI   + A     T+  KL+ +T
Sbjct: 365 DLLQAQQTSSSRQEQARKLRARRDVSPLKVDEAIRALKAATTAEHTLTLKLRRVT 419

>Skud_16.493 Chr16 (854949..859226) [4278 bp, 1425 aa] {ON} YPR189W
            (REAL)
          Length = 1425

 Score = 32.3 bits (72), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 16/69 (23%), Positives = 35/69 (50%)

Query: 369  FEKAIALDPNNAAVYYHRGQMYFITQNYEKAGEDFKKSKESDPKNIFPYIQLACLAYREN 428
            F KA AL+P    ++++   +     + + A +   KS+   P++  P++ +A +  ++ 
Sbjct: 1001 FIKATALEPKATDIWFNLAMLGLKKNDTDFAQQVLNKSQSLAPQDSSPWLGMALILEKQG 1060

Query: 429  KMAECEKLF 437
             + E  KLF
Sbjct: 1061 NIVESSKLF 1069

>KLLA0E23453g Chr5 (2088516..2090996) [2481 bp, 826 aa] {ON} similar
           to uniprot|P38129 Saccharomyces cerevisiae YBR198C TAF5
           Subunit (90 kDa) of TFIID and SAGA complexes involved in
           RNA polymerase II transcription initiation and in
           chromatin modification
          Length = 826

 Score = 32.3 bits (72), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 20/67 (29%), Positives = 35/67 (52%), Gaps = 3/67 (4%)

Query: 302 NNNDAAFKEKAATALEYLGIFDFLKNDLDNSEKNLKEALA--LHPRVNTYIYLALTMADR 359
           +NN    K +  T L Y   +  LKN +D+S +  K  L+  ++P +  Y++L L + D 
Sbjct: 141 DNNGQLIKPQQVTPLHYFRAYSMLKNWIDSSLELYKPELSRIIYP-IFIYVFLQLVIKDP 199

Query: 360 GQSEDYF 366
            Q+  +F
Sbjct: 200 LQARRFF 206

>NDAI0A05100 Chr1 (1157935..1160958) [3024 bp, 1007 aa] {ON}
           Anc_3.367
          Length = 1007

 Score = 32.0 bits (71), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 61/299 (20%), Positives = 107/299 (35%), Gaps = 57/299 (19%)

Query: 126 PVFHSNISACYVSLGDLDKVVESSTRALELKPDYSKA---LLRRASAYENMGRYQDAMFD 182
           P     I   Y   G LD   E+  + LEL P + KA     R    Y++ G++  A+  
Sbjct: 165 PKLWHGIGILYDRYGSLDYAEEAFAKVLELDPHFEKANEIYFRLGIIYKHQGKWNQALEC 224

Query: 183 ISVLSLNGDFNGSSIEPMLERNLNKQALRVLKEDMGIDASVPQAEQPRERQELPSNTSLS 242
              + LN         P+ E ++  Q   VL+                         S+ 
Sbjct: 225 FRYI-LN-----QPPAPLQEWDIWFQLGSVLE-------------------------SMG 253

Query: 243 SFFGIFKPETEIPAYDE---SNEADVTLVRGLKALYGATSDGYQLADECFAKAAKLYREQ 299
            + G  +      AY+     NE    +++ L  LYG  +  +    +      K     
Sbjct: 254 EWTGAKE------AYEHVLLQNEHHAKVLQQLGCLYGMNNVSFYDPQKALGYLLK----- 302

Query: 300 LANNNDAAFKEKAATALEYLGIFDFLKNDLDNSEKNLKEALALHPRVNTYIYLALTMA-- 357
                      + AT   +LG    ++ND   +    ++A+    R N   + ++ +   
Sbjct: 303 -----SLEVDSQDATTWYHLGRVHMIRNDYTAAYDAFQQAVNRDSR-NPIFWCSIGVLYY 356

Query: 358 DRGQSEDYFSYFEKAIALDPNNAAVYYHRGQMYFITQN-YEKAGEDFKKSKESDPKNIF 415
              Q  D    + +AI L+P  + V+Y  G +Y    N    A + +K++   DP+NI 
Sbjct: 357 QISQYRDALDAYTRAIRLNPYISEVWYDLGTLYETCNNQLNDALDAYKQAARLDPENIH 415

>Kwal_23.5408 s23 (1146253..1150485) [4233 bp, 1410 aa] {ON} YPR189W
            (SKI3) - Contains 8 copies of the TPR domain [contig 8]
            FULL
          Length = 1410

 Score = 32.3 bits (72), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 19/69 (27%), Positives = 33/69 (47%)

Query: 369  FEKAIALDPNNAAVYYHRGQMYFITQNYEKAGEDFKKSKESDPKNIFPYIQLACLAYREN 428
            F KA AL P   +V+Y    +     + + A     KS+   P++  P++ LA  + +E 
Sbjct: 986  FIKATALSPRETSVWYDMAVLALKYNDIDFARSVLMKSQTIAPQDSSPWLGLALASEKEG 1045

Query: 429  KMAECEKLF 437
             + E  +LF
Sbjct: 1046 LVEESSRLF 1054

>CAGL0K11209g Chr11 (1089300..1091072) [1773 bp, 590 aa] {ON}
           similar to uniprot|P35056 Saccharomyces cerevisiae
           YDR244w PAS10 peroxisomal targeting signal receptor
          Length = 590

 Score = 32.0 bits (71), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 22/98 (22%), Positives = 50/98 (51%), Gaps = 5/98 (5%)

Query: 100 GNALFKEKRFEDAIEFYNHAIKLH-EDPVFHSNISACYVSLGDLDKVVESSTRALELKPD 158
           G   +    F+  I+ +  A+K++  D +  + + A   +    ++ +++  RAL+LKP 
Sbjct: 431 GLLFYANDEFDRTIDCFQAALKVNPNDELMWNRLGASLANSNRSEEAIQAYHRALQLKPS 490

Query: 159 YSKALLRRASAYENMGRYQDA----MFDISVLSLNGDF 192
           + +A    A +  N+G Y++A    +  +S+  + G+F
Sbjct: 491 FVRARYNLAVSSMNIGCYKEAAEHLLTALSMHDVEGEF 528

>TBLA0A09170 Chr1 complement(2276263..2278443) [2181 bp, 726 aa]
           {ON} Anc_5.689 YOR080W
          Length = 726

 Score = 32.0 bits (71), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 23/105 (21%), Positives = 44/105 (41%), Gaps = 31/105 (29%)

Query: 100 GNALFKEKRFEDAIEFYNHAIKL---HEDP---------------------VFH------ 129
           G   FK + ++DA + +  A+KL   +E P                     ++H      
Sbjct: 19  GTNFFKNENYQDARKLFEKAVKLVRSYEQPRIIQLRIAANLPITPLNSDGKLYHPRYIKL 78

Query: 130 -SNISACYVSLGDLDKVVESSTRALELKPDYSKALLRRASAYENM 173
             N++AC+  +G++ K +  S + +E +P   K  +R A  +  M
Sbjct: 79  LDNLAACWEKVGEVSKAIRVSKKMIESEPYNMKGYIRSARLWLKM 123

>KLTH0H02068g Chr8 complement(188834..189946) [1113 bp, 370 aa] {ON}
           similar to uniprot|P53691 Saccharomyces cerevisiae
           YLR216C CPR6 Peptidyl-prolyl cis-trans isomerase
           (cyclophilin) catalyzes the cis-trans isomerization of
           peptide bonds N-terminal to proline residues binds to
           Hsp82p and contributes to chaperone activity
          Length = 370

 Score = 31.6 bits (70), Expect = 6.4,   Method: Compositional matrix adjust.
 Identities = 32/114 (28%), Positives = 52/114 (45%), Gaps = 24/114 (21%)

Query: 93  ATALKDKGNALFKEKRFEDAIEFYNHAIKL----------HED---------PVFHSNIS 133
            +A+KD G +LFK ++F+ A+  Y  +  +           ED          +F  NI+
Sbjct: 218 VSAVKDIGTSLFKAQKFQPALTKYEKSSSMLKQYFPQDLPAEDISRVDQLRISIFL-NIA 276

Query: 134 ACYVSLGDLDKVVESSTRALE--LKPDYS--KALLRRASAYENMGRYQDAMFDI 183
            C +  GD  K + S+T  +      D S  KAL RR  AY ++   + A+ D+
Sbjct: 277 LCAIKTGDYQKALTSTTEVVHDAAADDKSKAKALYRRGLAYYHLKDPEMAITDL 330

>TBLA0B07970 Chr2 (1887119..1889182) [2064 bp, 687 aa] {ON} Anc_5.72
           YHR166C
          Length = 687

 Score = 31.6 bits (70), Expect = 6.6,   Method: Compositional matrix adjust.
 Identities = 23/73 (31%), Positives = 41/73 (56%), Gaps = 5/73 (6%)

Query: 368 YFEKAIALDPNNAAVYYHRGQMYFITQNYEKAGEDFKKSKE-SD---PKNIFPYIQLACL 423
           YF+KA AL P +  ++   G+ YFI  N + A + +K++ + SD     +I  Y +LA L
Sbjct: 543 YFQKACALKPLDKRMWQALGECYFIVDNTDSALKCYKRALQLSDLALQDSIILY-KLAIL 601

Query: 424 AYRENKMAECEKL 436
             + + +  C+K+
Sbjct: 602 YEKMDDIENCKKM 614

>ACL164C Chr3 complement(67792..71961) [4170 bp, 1389 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOR124C
           (UBP2)
          Length = 1389

 Score = 32.0 bits (71), Expect = 6.7,   Method: Compositional matrix adjust.
 Identities = 15/43 (34%), Positives = 22/43 (51%)

Query: 342 LHPRVNTYIYLALTMADRGQSEDYFSYFEKAIALDPNNAAVYY 384
           +HP    Y ++ L+        D    +E  IALDP NA++YY
Sbjct: 383 MHPYDTNYHFVHLSSNYYYSDRDIIKNYEAQIALDPANASIYY 425

>NDAI0F00400 Chr6 complement(96274..98568) [2295 bp, 764 aa] {ON}
           Anc_5.689 YOR080W
          Length = 764

 Score = 31.6 bits (70), Expect = 7.3,   Method: Compositional matrix adjust.
 Identities = 12/49 (24%), Positives = 28/49 (57%)

Query: 131 NISACYVSLGDLDKVVESSTRALELKPDYSKALLRRASAYENMGRYQDA 179
           N +AC+  +G+L+K +  +T+   ++P   K  +R+    + + + +DA
Sbjct: 99  NRAACWEKMGELEKALRDATKMCFIEPYNLKCFIRKGKILQKLHKLKDA 147

>SAKL0G19712g Chr7 (1697758..1699923) [2166 bp, 721 aa] {ON} similar
           to uniprot|P09798 Saccharomyces cerevisiae YKL022C CDC16
           Subunit of the anaphase-promoting complex/cyclosome
           (APC/C) which is a ubiquitin-protein ligase required for
           degradation of anaphase inhibitors including mitotic
           cyclins during the metaphase/anaphase transition
           required for sporulation
          Length = 721

 Score = 31.6 bits (70), Expect = 7.7,   Method: Compositional matrix adjust.
 Identities = 56/238 (23%), Positives = 88/238 (36%), Gaps = 22/238 (9%)

Query: 368 YFEKAIALDPNNAAVYYHRGQMYFITQNYEKAGEDFKKSKESDPKNIFPYIQLACLAYRE 427
           YF KA  LDPN    +      Y     +E+A   +  +    P    P + L       
Sbjct: 455 YFSKASILDPNFGQAWIGFAHTYAAEGEHEQAVSAYSTASRFFPGTHLPNLFLGMQYIVM 514

Query: 428 NKMAECEKLFEEARKTFPTAPEVPNFYAEILADKGDIDEAVKQYNIAY----RLESLQK- 482
           N ++  E+    A    P  P + N    I   K D  +A K +  A+    RL S  K 
Sbjct: 515 NTLSLAEEYLTLAYDICPHDPLLLNEMGVIYFKKSDYPKAKKYFKKAWEASKRLNSDSKA 574

Query: 483 --QIHVGIAPLVGKATILARQPTPENFATISQLLEDACKADPRSEQAKVGLAQLRLQQEK 540
              IH  +     K     R       A    +LE + +    S    +GL  L+L+  K
Sbjct: 575 WLSIHTNLGHTYRKMGDYERA-----VACFKIVLETSNQ--DTSVYCAIGLIYLKLR--K 625

Query: 541 VDEAIELFEEAAKMARTVDEKLQAITFAEATKVQKRIRADP----VVSKKVEETLAAY 594
           +++AI+    A  +A     ++      +A +V      D     VVS K+ E+ + Y
Sbjct: 626 IEKAIDSLHNA--LALQPSNQIAQDLLKQALEVNMCTVLDETHPLVVSSKINESASNY 681

>KAFR0C01850 Chr3 (369596..371536) [1941 bp, 646 aa] {ON} Anc_5.352
           YDR320C
          Length = 646

 Score = 31.2 bits (69), Expect = 8.1,   Method: Compositional matrix adjust.
 Identities = 24/109 (22%), Positives = 51/109 (46%), Gaps = 34/109 (31%)

Query: 99  KGNALFKEKRFEDAIEFY---------NHAIKLHEDPVFHSNISACYVSLGDLDKVVESS 149
           +G++ FK   +  A+E Y         +H +++    + +SNI+A  + +G+   +V+ +
Sbjct: 363 RGSSFFKNGDYISALEEYEKSLNTLPQSHPLRI----IAYSNITAAELKIGEYSNLVKKA 418

Query: 150 TRALELKPD---------------------YSKALLRRASAYENMGRYQ 177
            +AL+L P                      +SK +LR+A A E++  ++
Sbjct: 419 DKALKLFPKENLKWNLIIQDSEPHKSYKDIWSKLVLRKAEALEHLENFE 467

>TBLA0B04990 Chr2 (1171599..1175831) [4233 bp, 1410 aa] {ON}
           Anc_7.546 YPR189W
          Length = 1410

 Score = 31.6 bits (70), Expect = 8.5,   Method: Compositional matrix adjust.
 Identities = 16/49 (32%), Positives = 24/49 (48%)

Query: 366 FSYFEKAIALDPNNAAVYYHRGQMYFITQNYEKAGEDFKKSKESDPKNI 414
            S FEK I+ DP NA     +G ++   +N+  A    K+  E  P N+
Sbjct: 465 LSLFEKIISEDPGNARAKMGKGIIFMERENWNDANNLLKEVTEEFPDNL 513

>NCAS0F02870 Chr6 complement(573068..575170) [2103 bp, 700 aa] {ON}
           Anc_5.352 YDR320C
          Length = 700

 Score = 31.2 bits (69), Expect = 8.7,   Method: Compositional matrix adjust.
 Identities = 25/115 (21%), Positives = 51/115 (44%), Gaps = 34/115 (29%)

Query: 96  LKDKGNALFKEKRFEDAIEFY---------NHAIKLHEDPVFHSNISACYVSLGDLDKVV 146
            +++G   FK   +  + + Y         NH +++    + +SNI A  + +G+  K +
Sbjct: 406 FRNRGTQYFKNGDYVSSFQEYEKSLNTLPVNHPLRI----IAYSNIIASELKIGEYSKSL 461

Query: 147 ESSTRALELKPD---------------------YSKALLRRASAYENMGRYQDAM 180
           ++S+ ALE+ PD                     + K  LR+A A E++  ++ A+
Sbjct: 462 KNSSSALEMFPDDTAQWTAVIQDSDPQRTYKDIWPKVKLRQAEALEHIESFKAAL 516

>ZYRO0D05434g Chr4 complement(469258..470544) [1287 bp, 428 aa] {ON}
           conserved hypothetical protein
          Length = 428

 Score = 31.2 bits (69), Expect = 9.0,   Method: Compositional matrix adjust.
 Identities = 25/91 (27%), Positives = 44/91 (48%), Gaps = 7/91 (7%)

Query: 427 ENKMAECEKLFEEARKTFPTAPEVPNFYAEILAD-KGDIDEAVKQYNIAYRLESLQKQIH 485
           E K+ +  KL+   R   P +PE  +FY EIL   +G+++ AV+  N +     +Q+   
Sbjct: 8   EKKLEQLSKLY---RDIVPASPETESFYLEILVSCEGNLEAAVELINDSL---GVQRTSE 61

Query: 486 VGIAPLVGKATILARQPTPENFATISQLLED 516
             I    GK    A  P P+   +++  ++D
Sbjct: 62  TDILCAKGKHEDEAVSPAPKVQKSLNSFIKD 92

>KLTH0H14234g Chr8 (1236691..1237878) [1188 bp, 395 aa] {ON} similar
           to uniprot|P47103 Saccharomyces cerevisiae YJR032W CPR7
           Peptidyl-prolyl cis-trans isomerase (cyclophilin)
           catalyzes the cis-trans isomerization of peptide bonds
           N-terminal to proline residues binds to Hsp82p and
           contributes to chaperone activity
          Length = 395

 Score = 30.8 bits (68), Expect = 9.8,   Method: Compositional matrix adjust.
 Identities = 21/71 (29%), Positives = 33/71 (46%), Gaps = 8/71 (11%)

Query: 349 YIYLALTMADRGQSEDYFSY------FEKAIALDPNNAAVYYHRGQMYFITQNYEKAGED 402
           Y+ L L M ++ + ED   Y        +A  LD   A  YY  G  + + + ++KA  D
Sbjct: 297 YLNLILVMFNQKKYEDAIKYSVYLLEIPEASGLD--RAKAYYRSGNCHLMKKRFDKALAD 354

Query: 403 FKKSKESDPKN 413
           F   KE +P +
Sbjct: 355 FNACKEHNPND 365

>SAKL0E06490g Chr5 complement(530588..531718) [1131 bp, 376 aa] {ON}
           similar to uniprot|P40990 Saccharomyces cerevisiae
           YDL107W MSS2 Peripherally bound inner membrane protein
           of the mitochondrial matrix required for export of
           C-terminal tail of Cox2p through the inner membrane
          Length = 376

 Score = 30.8 bits (68), Expect = 10.0,   Method: Compositional matrix adjust.
 Identities = 28/86 (32%), Positives = 43/86 (50%), Gaps = 16/86 (18%)

Query: 320 GIFDFLKNDLDNSEKNLKEALALHPRVNTYI---------YLALTMADRGQSEDYFSYFE 370
           G   F  NDL N+EK  K+ LAL    +T++          ++    +  ++EDYF    
Sbjct: 161 GDLTFKNNDLINAEKYYKDFLALED--DTFLAGEVYGQLGQISFRKPNLFKAEDYFL--- 215

Query: 371 KAIALDPNNAAV--YYHRGQMYFITQ 394
           K+I L P   +V  Y++ GQMY  +Q
Sbjct: 216 KSIKLCPLEYSVHSYFYLGQMYMNSQ 241

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.314    0.130    0.355 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 56,647,457
Number of extensions: 2459278
Number of successful extensions: 8017
Number of sequences better than 10.0: 301
Number of HSP's gapped: 7950
Number of HSP's successfully gapped: 456
Length of query: 600
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 485
Effective length of database: 40,294,809
Effective search space: 19542982365
Effective search space used: 19542982365
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 69 (31.2 bits)