Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
CAGL0L12342g8.271ON89189146550.0
NDAI0B020208.271ON90590629120.0
NCAS0B050508.271ON92390828870.0
YLR092W (SUL2)8.271ON89391028410.0
Smik_12.1518.271ON89390928360.0
Suva_10.1768.271ON89391328350.0
Skud_12.1608.271ON89391028350.0
KNAG0G020708.271ON89990928190.0
Smik_2.435na 1ON86383727350.0
TDEL0F039808.271ON86789727300.0
Skud_2.424na 1ON86389327220.0
Suva_4.554na 1ON85090027010.0
YBR294W (SUL1)na 1ON85989426990.0
Kpol_543.438.271ON86690226960.0
KAFR0B027508.271ON83489326830.0
TPHA0J008008.271ON91792326460.0
ZYRO0C01452g8.271ON90690825970.0
SAKL0H16830g8.271ON86289825900.0
TPHA0A017608.271ON89389825370.0
KLLA0F19338g8.271ON89191525110.0
KLTH0G13486g8.271ON90291724990.0
Kwal_56.237598.271ON86190724090.0
AGR077C8.271ON84889122820.0
Ecym_42998.271ON87489121790.0
TBLA0F030508.271ON89752213901e-178
NDAI0B022108.99ON7065173333e-31
NCAS0B048008.99ON7245123272e-30
KNAG0D023908.99ON7164813235e-30
TBLA0C052708.99ON7764733228e-30
KLLA0E14059g8.99ON7065823155e-29
TPHA0H007208.99ON7874913041e-27
ZYRO0F04796g8.99ON7355212978e-27
YPR003C8.99ON7545112971e-26
Ecym_7084na 2ON6894822961e-26
KLTH0G16764g8.99ON7104922942e-26
AGR213Cna 2ON6894852905e-26
Kpol_467.118.99ON7444952801e-24
Suva_16.3228.99ON7424752782e-24
Smik_16.2418.99ON7445302782e-24
Skud_16.2868.99ON7454782674e-23
SAKL0H08800gna 2ON6205042531e-21
CAGL0L09207g8.99ON7251782131e-16
Kwal_27.110398.99ON7262182022e-15
SAKL0B03124g8.99ON7441691951e-14
TDEL0C012808.99ON7271401801e-12
KLLA0E04731g3.485ON1060138820.50
NCAS0G003405.690ON887124771.8
TDEL0A029602.521ON90277771.9
KAFR0C019103.485ON1020156744.4
KLTH0F14674g3.485ON1010130726.4
SAKL0F02926g3.485ON1050130718.8
ZYRO0B08228g5.88ON129346718.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0L12342g
         (891 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0L12342g Chr12 (1333884..1336559) [2676 bp, 891 aa] {ON} sim...  1797   0.0  
NDAI0B02020 Chr2 (501062..503779) [2718 bp, 905 aa] {ON} Anc_8.271   1126   0.0  
NCAS0B05050 Chr2 (937285..940056) [2772 bp, 923 aa] {ON} Anc_8.271   1116   0.0  
YLR092W Chr12 (323544..326225) [2682 bp, 893 aa] {ON}  SUL2High ...  1098   0.0  
Smik_12.151 Chr12 (303440..306121) [2682 bp, 893 aa] {ON} YLR092...  1097   0.0  
Suva_10.176 Chr10 (328373..331054) [2682 bp, 893 aa] {ON} YLR092...  1096   0.0  
Skud_12.160 Chr12 (306715..309396) [2682 bp, 893 aa] {ON} YLR092...  1096   0.0  
KNAG0G02070 Chr7 (469623..472322) [2700 bp, 899 aa] {ON} Anc_8.2...  1090   0.0  
Smik_2.435 Chr2 (775289..777880) [2592 bp, 863 aa] {ON} YLR092W ...  1058   0.0  
TDEL0F03980 Chr6 (737605..740208) [2604 bp, 867 aa] {ON} Anc_8.2...  1056   0.0  
Skud_2.424 Chr2 (758785..761376) [2592 bp, 863 aa] {ON} YBR294W ...  1053   0.0  
Suva_4.554 Chr4 (962125..964677) [2553 bp, 850 aa] {ON} YBR294W ...  1045   0.0  
YBR294W Chr2 (789235..791814) [2580 bp, 859 aa] {ON}  SUL1High a...  1044   0.0  
Kpol_543.43 s543 (93697..96297) [2601 bp, 866 aa] {ON} (93697..9...  1043   0.0  
KAFR0B02750 Chr2 (562981..565485) [2505 bp, 834 aa] {ON} Anc_8.2...  1038   0.0  
TPHA0J00800 Chr10 (186144..188897) [2754 bp, 917 aa] {ON} Anc_8....  1023   0.0  
ZYRO0C01452g Chr3 complement(103175..105895) [2721 bp, 906 aa] {...  1004   0.0  
SAKL0H16830g Chr8 complement(1479446..1482034) [2589 bp, 862 aa]...  1002   0.0  
TPHA0A01760 Chr1 complement(356771..359452) [2682 bp, 893 aa] {O...   981   0.0  
KLLA0F19338g Chr6 (1789536..1792211) [2676 bp, 891 aa] {ON} simi...   971   0.0  
KLTH0G13486g Chr7 complement(1156678..1159386) [2709 bp, 902 aa]...   967   0.0  
Kwal_56.23759 s56 complement(693180..695765) [2586 bp, 861 aa] {...   932   0.0  
AGR077C Chr7 complement(874110..876656) [2547 bp, 848 aa] {ON} S...   883   0.0  
Ecym_4299 Chr4 complement(639078..641702) [2625 bp, 874 aa] {ON}...   843   0.0  
TBLA0F03050 Chr6 complement(738517..741210) [2694 bp, 897 aa] {O...   540   e-178
NDAI0B02210 Chr2 complement(546721..548841) [2121 bp, 706 aa] {O...   132   3e-31
NCAS0B04800 Chr2 complement(873061..875235) [2175 bp, 724 aa] {O...   130   2e-30
KNAG0D02390 Chr4 (420952..423102) [2151 bp, 716 aa] {ON} Anc_8.9...   129   5e-30
TBLA0C05270 Chr3 complement(1273901..1276231) [2331 bp, 776 aa] ...   128   8e-30
KLLA0E14059g Chr5 (1245694..1247814) [2121 bp, 706 aa] {ON} simi...   125   5e-29
TPHA0H00720 Chr8 complement(143103..145466) [2364 bp, 787 aa] {O...   121   1e-27
ZYRO0F04796g Chr6 (399222..401429) [2208 bp, 735 aa] {ON} simila...   119   8e-27
YPR003C Chr16 complement(561504..563768) [2265 bp, 754 aa] {ON} ...   119   1e-26
Ecym_7084 Chr7 complement(167032..169101) [2070 bp, 689 aa] {ON}...   118   1e-26
KLTH0G16764g Chr7 complement(1454815..1456947) [2133 bp, 710 aa]...   117   2e-26
AGR213C Chr7 complement(1156110..1158179) [2070 bp, 689 aa] {ON}...   116   5e-26
Kpol_467.11 s467 (26194..28428) [2235 bp, 744 aa] {ON} (26194..2...   112   1e-24
Suva_16.322 Chr16 complement(565605..567833) [2229 bp, 742 aa] {...   111   2e-24
Smik_16.241 Chr16 complement(438048..440282) [2235 bp, 744 aa] {...   111   2e-24
Skud_16.286 Chr16 complement(525800..528037) [2238 bp, 745 aa] {...   107   4e-23
SAKL0H08800g Chr8 (753145..755007) [1863 bp, 620 aa] {ON} simila...   102   1e-21
CAGL0L09207g Chr12 complement(999571..1001748) [2178 bp, 725 aa]...    87   1e-16
Kwal_27.11039 s27 complement(614861..617041) [2181 bp, 726 aa] {...    82   2e-15
SAKL0B03124g Chr2 complement(288006..290240) [2235 bp, 744 aa] {...    80   1e-14
TDEL0C01280 Chr3 complement(218824..221007) [2184 bp, 727 aa] {O...    74   1e-12
KLLA0E04731g Chr5 complement(418094..421276) [3183 bp, 1060 aa] ...    36   0.50 
NCAS0G00340 Chr7 (57980..60643) [2664 bp, 887 aa] {ON} Anc_5.690...    34   1.8  
TDEL0A02960 Chr1 complement(529484..532192) [2709 bp, 902 aa] {O...    34   1.9  
KAFR0C01910 Chr3 (382140..385202) [3063 bp, 1020 aa] {ON} Anc_3....    33   4.4  
KLTH0F14674g Chr6 (1201874..1204906) [3033 bp, 1010 aa] {ON} sim...    32   6.4  
SAKL0F02926g Chr6 complement(245957..249109) [3153 bp, 1050 aa] ...    32   8.8  
ZYRO0B08228g Chr2 (641988..645869) [3882 bp, 1293 aa] {ON} simil...    32   8.8  

>CAGL0L12342g Chr12 (1333884..1336559) [2676 bp, 891 aa] {ON}
           similar to uniprot|Q12325 Saccharomyces cerevisiae
           YLR092w SEL2 sulfate transporter or uniprot|P38359
           Saccharomyces cerevisiae YBR294w SUL1
          Length = 891

 Score = 1797 bits (4655), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 874/891 (98%), Positives = 874/891 (98%)

Query: 1   MEELDNLELEYNQFKNNERPSNTNAGADIEKGLDTKKYFERSITDNSTYGKKSYSIPSYE 60
           MEELDNLELEYNQFKNNERPSNTNAGADIEKGLDTKKYFERSITDNSTYGKKSYSIPSYE
Sbjct: 1   MEELDNLELEYNQFKNNERPSNTNAGADIEKGLDTKKYFERSITDNSTYGKKSYSIPSYE 60

Query: 61  EDTITLKDYYDTNLRDYFTWASVVDYIRSLFPVVNWLPFYNPKWFLSDLIAGITVGTVLV 120
           EDTITLKDYYDTNLRDYFTWASVVDYIRSLFPVVNWLPFYNPKWFLSDLIAGITVGTVLV
Sbjct: 61  EDTITLKDYYDTNLRDYFTWASVVDYIRSLFPVVNWLPFYNPKWFLSDLIAGITVGTVLV 120

Query: 121 PQSMSYAQIATLPPEYGLYSSFIGALVYSFFATSKDVCIGPVAVMSLQTAKVIARVKEKH 180
           PQSMSYAQIATLPPEYGLYSSFIGALVYSFFATSKDVCIGPVAVMSLQTAKVIARVKEKH
Sbjct: 121 PQSMSYAQIATLPPEYGLYSSFIGALVYSFFATSKDVCIGPVAVMSLQTAKVIARVKEKH 180

Query: 181 PDLDPSITGPIIATVLAFICGIIATGVGLLRLGFLVELISLNAVAGFMTGSAFNIIWGQI 240
           PDLDPSITGPIIATVLAFICGIIATGVGLLRLGFLVELISLNAVAGFMTGSAFNIIWGQI
Sbjct: 181 PDLDPSITGPIIATVLAFICGIIATGVGLLRLGFLVELISLNAVAGFMTGSAFNIIWGQI 240

Query: 241 PGLMGYSKKVNTRRSTYHVVIDSLKHLPDTKLDAAFGLIPLFTLFFWKWWCNSMGPKLTD 300
           PGLMGYSKKVNTRRSTYHVVIDSLKHLPDTKLDAAFGLIPLFTLFFWKWWCNSMGPKLTD
Sbjct: 241 PGLMGYSKKVNTRRSTYHVVIDSLKHLPDTKLDAAFGLIPLFTLFFWKWWCNSMGPKLTD 300

Query: 301 RYFPANSRPRANKYWKAFYFYLQASRNGIIIILFTAVSYGITKGVAKDKRRISVLGTVPK 360
           RYFPANSRPRANKYWKAFYFYLQASRNGIIIILFTAVSYGITKGVAKDKRRISVLGTVPK
Sbjct: 301 RYFPANSRPRANKYWKAFYFYLQASRNGIIIILFTAVSYGITKGVAKDKRRISVLGTVPK 360

Query: 361 GLRHTGVMKLPHGILNNIAAEIPSSIIVLLLEHIAISKSFGRVNDYKINPNQEIIAIGVS 420
           GLRHTGVMKLPHGILNNIAAEIPSSIIVLLLEHIAISKSFGRVNDYKINPNQEIIAIGVS
Sbjct: 361 GLRHTGVMKLPHGILNNIAAEIPSSIIVLLLEHIAISKSFGRVNDYKINPNQEIIAIGVS 420

Query: 421 NLLGTFFNAYPATGSFSRSALKAKCNVMTPLSGIFSAACVLLAIYCLTGAFFYIPKATLS 480
           NLLGTFFNAYPATGSFSRSALKAKCNVMTPLSGIFSAACVLLAIYCLTGAFFYIPKATLS
Sbjct: 421 NLLGTFFNAYPATGSFSRSALKAKCNVMTPLSGIFSAACVLLAIYCLTGAFFYIPKATLS 480

Query: 481 AVIIHAVFDLIASYHTTWSLWKMNVFDFIGFITTVFITVFSSIENGIYFAVCWSCAILLY 540
           AVIIHAVFDLIASYHTTWSLWKMNVFDFIGFITTVFITVFSSIENGIYFAVCWSCAILLY
Sbjct: 481 AVIIHAVFDLIASYHTTWSLWKMNVFDFIGFITTVFITVFSSIENGIYFAVCWSCAILLY 540

Query: 541 NNAFPAGKFLGRIEIAEVVNPKIVDDDDFSFENSNESFDDEGIYFDNSVAEDKLGTSSND 600
           NNAFPAGKFLGRIEIAEVVNPKIVDDDDFSFENSNESFDDEGIYFDNSVAEDKLGTSSND
Sbjct: 541 NNAFPAGKFLGRIEIAEVVNPKIVDDDDFSFENSNESFDDEGIYFDNSVAEDKLGTSSND 600

Query: 601 LKKFNAGVKTRSINGELVNGQTSSDIRYYTKWVPFDHAYSKELNPSVRITPPPPGVIVYR 660
           LKKFNAGVKTRSINGELVNGQTSSDIRYYTKWVPFDHAYSKELNPSVRITPPPPGVIVYR
Sbjct: 601 LKKFNAGVKTRSINGELVNGQTSSDIRYYTKWVPFDHAYSKELNPSVRITPPPPGVIVYR 660

Query: 661 LSDSYTYINCSRHYDLIFDEIKRVTRRGQLIQHRHKWDRPWNDPGEWEAPDLXXXXXXXX 720
           LSDSYTYINCSRHYDLIFDEIKRVTRRGQLIQHRHKWDRPWNDPGEWEAPDL        
Sbjct: 661 LSDSYTYINCSRHYDLIFDEIKRVTRRGQLIQHRHKWDRPWNDPGEWEAPDLKKFFNVKK 720

Query: 721 XXXXXXXXXTDVDTFENENEIEHIHDGEHYKKNDKDERPLLRVVCLDFSQVANTDATALQ 780
                    TDVDTFENENEIEHIHDGEHYKKNDKDERPLLRVVCLDFSQVANTDATALQ
Sbjct: 721 FVSVFKRKVTDVDTFENENEIEHIHDGEHYKKNDKDERPLLRVVCLDFSQVANTDATALQ 780

Query: 781 SLADLRKAVNKYADRQVEFHFVGIYSPWIKRGLRNLGFGTTNEEYSDESIIAGHSSYHLS 840
           SLADLRKAVNKYADRQVEFHFVGIYSPWIKRGLRNLGFGTTNEEYSDESIIAGHSSYHLS
Sbjct: 781 SLADLRKAVNKYADRQVEFHFVGIYSPWIKRGLRNLGFGTTNEEYSDESIIAGHSSYHLS 840

Query: 841 RFRESEQDGFNELDSLESQRNIGSKTKVLAASGTNLPFFHVDIPDFSKWDI 891
           RFRESEQDGFNELDSLESQRNIGSKTKVLAASGTNLPFFHVDIPDFSKWDI
Sbjct: 841 RFRESEQDGFNELDSLESQRNIGSKTKVLAASGTNLPFFHVDIPDFSKWDI 891

>NDAI0B02020 Chr2 (501062..503779) [2718 bp, 905 aa] {ON} Anc_8.271
          Length = 905

 Score = 1126 bits (2912), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 563/906 (62%), Positives = 677/906 (74%), Gaps = 50/906 (5%)

Query: 2   EELDNLELEYNQFKNNERPSNTNAGADIEKG------------LDTKKYFERSITDNSTY 49
           + L +LELEY+Q+K +E  + +N G D+E               D K   +      +T+
Sbjct: 34  QNLADLELEYDQYKASETNNKSNHGPDLETNNLDVQFSNTYNTGDKKNSIKNHQIQINTF 93

Query: 50  GKKSYSIPSYEEDTITLKDYYDTNLRDYFTWASVVDYIRSLFPVVNWLPFYNPKWFLSDL 109
              S  IPS+EE  I+ KDYY  +L++ F+  SV +Y  S+FP++ WLP YN  WF SDL
Sbjct: 94  NADSVIIPSFEEHAISFKDYYRHSLKENFSLKSVKEYALSIFPIIRWLPHYNLAWFSSDL 153

Query: 110 IAGITVGTVLVPQSMSYAQIATLPPEYGLYSSFIGALVYSFFATSKDVCIGPVAVMSLQT 169
           IAGITVG VLVPQSMSYAQIATLPP+YGLYSSFIGA  YS FATSKDVCIGPVAVMSL+T
Sbjct: 154 IAGITVGCVLVPQSMSYAQIATLPPQYGLYSSFIGAFTYSLFATSKDVCIGPVAVMSLET 213

Query: 170 AKVIARVKEKHPDLDPSITGPIIATVLAFICGIIATGVGLLRLGFLVELISLNAVAGFMT 229
            KVI +V  K+P+ DP+IT P+IATVLAF+CG+I  G+G LRLGFLVELISLNAV GFMT
Sbjct: 214 GKVITKVLAKYPEADPNITAPVIATVLAFLCGVITAGIGFLRLGFLVELISLNAVTGFMT 273

Query: 230 GSAFNIIWGQIPGLMGYSKKVNTRRSTYHVVIDSLKHLPDTKLDAAFGLIPLFTLFFWKW 289
           GSA NI+WGQIP LMGY  KVNTR STY V+I+SLKHLPDTKLDA FGLIPLF L+ WKW
Sbjct: 274 GSALNIMWGQIPALMGYGSKVNTRTSTYKVIIESLKHLPDTKLDAVFGLIPLFILYLWKW 333

Query: 290 WCNSMGPKLTDRYFPANSRPRANKYWKAFYFYLQASRNGIIIILFTAVSYGITKGVAKDK 349
           WC +MGP++ D++F  N +   N Y K FYFY QA++N +III+FTA+++ ITKG  KD+
Sbjct: 334 WCGNMGPRMADKWFANNEK--GNFYLKKFYFYAQAAKNAVIIIVFTAIAWSITKGKTKDE 391

Query: 350 RRISVLGTVPKGLRHTGVMKLPHGILNNIAAEIPSSIIVLLLEHIAISKSFGRVNDYKIN 409
           R IS+LG+VPKGL+  GVMKLP G+ + IA E+P+S+IVLLLEHIAI+KSFGR+NDYK+ 
Sbjct: 392 RPISILGSVPKGLKEVGVMKLPDGLASKIAPELPASVIVLLLEHIAIAKSFGRINDYKVV 451

Query: 410 PNQEIIAIGVSNLLGTFFNAYPATGSFSRSALKAKCNVMTPLSGIFSAACVLLAIYCLTG 469
           P+QE+IAIGV+NL+GTFFNAYPATGSFSRSALKAKC V TPLSG+F+ +CVLLA+YCLTG
Sbjct: 452 PDQELIAIGVTNLIGTFFNAYPATGSFSRSALKAKCEVRTPLSGLFTGSCVLLALYCLTG 511

Query: 470 AFFYIPKATLSAVIIHAVFDLIASYHTTWSLWKMNVFDFIGFITTVFITVFSSIENGIYF 529
            F YIPKATLSAVIIHAV DLIASYHTTW+ WKMN  D   FI TVFITVFSSIENGIYF
Sbjct: 512 VFLYIPKATLSAVIIHAVSDLIASYHTTWNFWKMNPLDCFSFIVTVFITVFSSIENGIYF 571

Query: 530 AVCWSCAILLYNNAFPAGKFLGRIEIAEVVNPKIVDDDDFSFENSNESFDDEGIYFDNSV 589
           A+CWSCAIL+   AFPAGKFLGR+EIAEVVN   VDD   SFE ++ S +       +++
Sbjct: 572 AMCWSCAILVLKVAFPAGKFLGRVEIAEVVN-GCVDD---SFEVTDYSSNSNLSLSADTI 627

Query: 590 AEDKLGTSSNDLKKFNAGVKTRSINGELVNG----QTSSDIRYYTKWVPFDHAYSKELNP 645
             +K       LK  +  +  +++  +L +     Q  S IRYYTKW+PFDHAY+KELNP
Sbjct: 628 NHNK------KLKILHIPL-LKTLKDQLFSDISSIQGKSKIRYYTKWLPFDHAYTKELNP 680

Query: 646 SVRITPPPPGVIVYRLSDSYTYINCSRHYDLIFDEIKRVTRRGQLIQHRHKWDRPWNDPG 705
           +V I PPPPGVIVYRL+DS+TY+NCS+HYD+IF+EIK+ T+RGQLI+HR K DRPWNDPG
Sbjct: 681 NVIILPPPPGVIVYRLTDSFTYMNCSKHYDVIFEEIKKQTKRGQLIRHRKKSDRPWNDPG 740

Query: 706 EWEAPDLXXXXXXXXXXXXXXXXXTDVDTFENENEIEHIHDGEHYKKNDKDERPLLRVVC 765
           EWEAP+                     +   N+NE  HI D    K   +D+RPLL+V+C
Sbjct: 741 EWEAPNFSKLWKKLSFRR---------NKNNNDNEETHIPDVPVSK---RDDRPLLKVLC 788

Query: 766 LDFSQVANTDATALQSLADLRKAVNKYADRQVEFHFVGIYSPWIKRGLRNLGFGTTNEEY 825
           LDFSQVA  DATALQSL DLRKA+NKYADRQVEFHF GI SPWIK+GL N+GFGT NEEY
Sbjct: 789 LDFSQVAQVDATALQSLVDLRKAINKYADRQVEFHFAGIVSPWIKKGLINIGFGTINEEY 848

Query: 826 SDESIIAGHSSYHLSRFRESEQDGFNELDSLESQRNIGSKTKVLAASGTNLPFFHVDIPD 885
           SDESIIAGH+SYHL+R            D LE     G   KV  A+GTNLPFFH+DIPD
Sbjct: 849 SDESIIAGHTSYHLARIPG---------DDLELPTMRGGNYKVYTATGTNLPFFHIDIPD 899

Query: 886 FSKWDI 891
           F +WD+
Sbjct: 900 FYQWDV 905

>NCAS0B05050 Chr2 (937285..940056) [2772 bp, 923 aa] {ON} Anc_8.271
          Length = 923

 Score = 1116 bits (2887), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 551/908 (60%), Positives = 676/908 (74%), Gaps = 42/908 (4%)

Query: 2   EELDNLELEYNQFKNNERPSNTNAGADIEKG---------LDTKKYFERSITDNSTYGKK 52
           + LD+LELEY+Q+K +E  +N +   +             L+T++  +   ++ +   + 
Sbjct: 40  QNLDDLELEYDQYKVSETNNNDDVINNNNNNNNNNNNIPELETQQNLDVQFSNTTNNKEN 99

Query: 53  SYSI---------PSYEEDTITLKDYYDTNLRDYFTWASVVDYIRSLFPVVNWLPFYNPK 103
            Y I         P+Y+E T+++KDYYD ++R+  T   V DY  S+FP+  WLP YN  
Sbjct: 100 QYRIVSTVNPVIIPNYDEKTVSIKDYYDHSIRENVTLVGVRDYFLSIFPITRWLPHYNLT 159

Query: 104 WFLSDLIAGITVGTVLVPQSMSYAQIATLPPEYGLYSSFIGALVYSFFATSKDVCIGPVA 163
           WF SDLIAGITVG VLVPQSMSYAQIATLP +YGLYSSFIGA  YS FATSKDVCIGPVA
Sbjct: 160 WFTSDLIAGITVGCVLVPQSMSYAQIATLPAQYGLYSSFIGAFCYSLFATSKDVCIGPVA 219

Query: 164 VMSLQTAKVIARVKEKHPDLDPSITGPIIATVLAFICGIIATGVGLLRLGFLVELISLNA 223
           VMSL+TAKV+ +V  K+PD DP+IT PI+AT L+ +CGI+  GVG+LRLGFLVELISLNA
Sbjct: 220 VMSLETAKVVTKVLAKYPDNDPTITAPIVATALSLLCGIVTAGVGVLRLGFLVELISLNA 279

Query: 224 VAGFMTGSAFNIIWGQIPGLMGYSKKVNTRRSTYHVVIDSLKHLPDTKLDAAFGLIPLFT 283
           V GFMTGSA NI+WGQ+PGLMGY+ KVNTR + Y V+I++LKHLPDTKLDA FGLIPLF 
Sbjct: 280 VTGFMTGSALNILWGQVPGLMGYNSKVNTRTANYKVIIETLKHLPDTKLDAVFGLIPLFL 339

Query: 284 LFFWKWWCNSMGPKLTDRYFPANSRPRANKYWKAFYFYLQASRNGIIIILFTAVSYGITK 343
           L+ WKWWC++MGPKL D++FP N   RAN Y+K FYFY QA++N IIII+FTA+S+ IT+
Sbjct: 340 LYLWKWWCDNMGPKLVDKWFPKNKNERANFYFKKFYFYAQAAKNAIIIIVFTAISWSITR 399

Query: 344 GVAKDKRRISVLGTVPKGLRHTGVMKLPHGILNNIAAEIPSSIIVLLLEHIAISKSFGRV 403
           G AK  R IS+LGTVPKGL+  GVMKLP G+L+ +A E+P+S+IVLLLEHIAI+KSFGR+
Sbjct: 400 GKAKADRPISILGTVPKGLKEVGVMKLPDGLLSKLAPELPASVIVLLLEHIAIAKSFGRI 459

Query: 404 NDYKINPNQEIIAIGVSNLLGTFFNAYPATGSFSRSALKAKCNVMTPLSGIFSAACVLLA 463
           NDYK+ P+QE+IAIGV+NL+GTFFNAYPATGSFSRSALKAKC V TPLSGIF+ ACVLLA
Sbjct: 460 NDYKVVPDQELIAIGVTNLIGTFFNAYPATGSFSRSALKAKCKVRTPLSGIFTGACVLLA 519

Query: 464 IYCLTGAFFYIPKATLSAVIIHAVFDLIASYHTTWSLWKMNVFDFIGFITTVFITVFSSI 523
           +YCLTGAFFYIPKATLSAVII AV DLIASY  TW+ WKMN  D + F+ TVFITVFSSI
Sbjct: 520 LYCLTGAFFYIPKATLSAVIIQAVSDLIASYKITWNFWKMNPLDCLCFLVTVFITVFSSI 579

Query: 524 ENGIYFAVCWSCAILLYNNAFPAGKFLGRIEIAEVVNPKIVDDDDFSFENSNESFDDEGI 583
           ENGIYFAVCWSCAILL    FPAGKFLGRIE+AEV++  +  D+      + E       
Sbjct: 580 ENGIYFAVCWSCAILLLKVCFPAGKFLGRIEVAEVIDGYV--DNSIESATTAEYSSASSP 637

Query: 584 YFDNSVAEDKLGTSSNDLKKFNAGVKTRSINGELVNGQTSSDIRYYTKWVPFDHAYSKEL 643
             DN     K+  +S+    F    K  +++   V+   +  +RYYTKWVPFDHAY++EL
Sbjct: 638 SSDNETDTKKIQKTSS--ISFGKDAKAVAVSTSPVD--CNPKVRYYTKWVPFDHAYTREL 693

Query: 644 NPSVRITPPPPGVIVYRLSDSYTYINCSRHYDLIFDEIKRVTRRGQLIQHRHKWDRPWND 703
           NPSV I PPPPGVIVYRL+DS+TYINCSRHYD+IFDE+KR TRRGQL++HR K DRPWND
Sbjct: 694 NPSVNILPPPPGVIVYRLTDSFTYINCSRHYDVIFDEVKRQTRRGQLLRHRKKADRPWND 753

Query: 704 PGEWEAPDLXXXXXXXXXXXXXXXXXTDVDTFENENEIEHIHDGEHYKKNDKDERPLLRV 763
           PGEWEAP                      ++ + E+ ++ + D        +D RPLL++
Sbjct: 754 PGEWEAPQFLKNLFHRKKK----------NSTDEESAVD-VSDNSSI----RDNRPLLKI 798

Query: 764 VCLDFSQVANTDATALQSLADLRKAVNKYADRQVEFHFVGIYSPWIKRGLRNLGFGTTNE 823
           VCLDFSQVA  DA+A+QSL DLRK++N+YADRQVEFHF GI SPW+KRGL N GFGT N+
Sbjct: 799 VCLDFSQVAQIDASAIQSLVDLRKSINRYADRQVEFHFAGIVSPWVKRGLINRGFGTIND 858

Query: 824 EYSDESIIAGHSSYHLSRFRESEQDGFNELDSLESQRNIGSKTKVLAASGTNLPFFHVDI 883
           E+SD SIIAGHSSYHL+R   +  D   +L+S        S+  V AA+GTNLPFFH+DI
Sbjct: 859 EFSDASIIAGHSSYHLTR---TLPDSDFDLESNFRDTYSRSQYHVFAATGTNLPFFHIDI 915

Query: 884 PDFSKWDI 891
           PDFSKWD+
Sbjct: 916 PDFSKWDL 923

>YLR092W Chr12 (323544..326225) [2682 bp, 893 aa] {ON}  SUL2High
           affinity sulfate permease; sulfate uptake is mediated by
           specific sulfate transporters Sul1p and Sul2p, which
           control the concentration of endogenous activated
           sulfate intermediates
          Length = 893

 Score = 1098 bits (2841), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 549/910 (60%), Positives = 678/910 (74%), Gaps = 59/910 (6%)

Query: 1   MEELDNLELEYNQFKNNERPSNTNAGADIE-------------KGLDTKKYFERSITDNS 47
           + +LD+LELEY+Q+KNNE  ++T    D+E             KG+   K    + +D S
Sbjct: 24  VPDLDDLELEYDQYKNNEN-NDTFNDKDLESNSVAKHNAVNSSKGVKGSKIDYFNPSDVS 82

Query: 48  TYGKKSYSIPSYEEDTITLKDYYDTNLRDYFTWASVVDYIRSLFPVVNWLPFYNPKWFLS 107
            Y     S+  +EE T++LK+YYD ++R + T      Y++S+FP++NWLP YN  WF +
Sbjct: 83  LYDN---SVSQFEETTVSLKEYYDHSIRSHLTVKGACSYLKSVFPIINWLPHYNFSWFTA 139

Query: 108 DLIAGITVGTVLVPQSMSYAQIATLPPEYGLYSSFIGALVYSFFATSKDVCIGPVAVMSL 167
           DLIAGIT+G VLVPQSMSYAQ+ATLP +YGLYSSFIGA  YSFFATSKDVCIGPVAVMSL
Sbjct: 140 DLIAGITIGCVLVPQSMSYAQVATLPAQYGLYSSFIGAYSYSFFATSKDVCIGPVAVMSL 199

Query: 168 QTAKVIARVKEKHPDLDPSITGPIIATVLAFICGIIATGVGLLRLGFLVELISLNAVAGF 227
           QTAKVIA V  K+PD D +ITGP+IAT LA +CGII+  VG LRLGFLVELISLNAVAGF
Sbjct: 200 QTAKVIADVTAKYPDGDSAITGPVIATTLALLCGIISAAVGFLRLGFLVELISLNAVAGF 259

Query: 228 MTGSAFNIIWGQIPGLMGYSKKVNTRRSTYHVVIDSLKHLPDTKLDAAFGLIPLFTLFFW 287
           MTGSAFNI+WGQ+P LMGY+  VNTR +TY VVI++LKHLPDTKLDA FGLIPLF L+ W
Sbjct: 260 MTGSAFNILWGQVPALMGYNSLVNTRAATYKVVIETLKHLPDTKLDAVFGLIPLFLLYVW 319

Query: 288 KWWCNSMGPKLTDRYFPANSRPRANKYWKAFYFYLQASRNGIIIILFTAVSYGITKGVAK 347
           KWWC + GP+L DRY   N  PR +K  K  YFY QASRNGIIII+FT + + IT+G +K
Sbjct: 320 KWWCGTYGPRLNDRYNSKN--PRLHKIIKWTYFYAQASRNGIIIIVFTCIGWAITRGKSK 377

Query: 348 DKRRISVLGTVPKGLRHTGVMKLPHGILNNIAAEIPSSIIVLLLEHIAISKSFGRVNDYK 407
            +R IS+LG+VP GL+  GV  +P G+++ +   +P+SIIVLLLEHIAISKSFGR+NDYK
Sbjct: 378 SERPISILGSVPSGLKEVGVFHVPPGLMSKLGPNLPASIIVLLLEHIAISKSFGRINDYK 437

Query: 408 INPNQEIIAIGVSNLLGTFFNAYPATGSFSRSALKAKCNVMTPLSGIFSAACVLLAIYCL 467
           + P+QE+IAIGVSNLLGTFFNAYPATGSFSRSALKAKCNV TPLSG+FS +CVLLA+YCL
Sbjct: 438 VVPDQELIAIGVSNLLGTFFNAYPATGSFSRSALKAKCNVRTPLSGLFSGSCVLLALYCL 497

Query: 468 TGAFFYIPKATLSAVIIHAVFDLIASYHTTWSLWKMNVFDFIGFITTVFITVFSSIENGI 527
           TGAFFYIPKATLSAVIIHAV DL+ASY TTW+ WKMN  DFI FI TV ITVF+SIE+GI
Sbjct: 498 TGAFFYIPKATLSAVIIHAVSDLLASYQTTWNFWKMNPLDFICFIVTVLITVFASIEDGI 557

Query: 528 YFAVCWSCAILLYNNAFPAGKFLGRIEIAEVVNPKIVDDDD---FSFENSN--ESFDDEG 582
           YFA+CWSCA+L+   AFPAGKFLGR+E+AEV +  +  D D   +  EN+N   + +D G
Sbjct: 558 YFAMCWSCAMLILKVAFPAGKFLGRVEVAEVTDAYVRPDSDVVSYVSENNNGISTLEDGG 617

Query: 583 IYFDNSVAEDKLGTSSNDLKKFNAGVKTRSINGELVNGQTSSDIRYYTKWVPFDHAYSKE 642
              D+  +  K  T+S+  KK    V+T+  +    +  +   I+Y+TKW+PFDH Y++E
Sbjct: 618 --EDDKESSTKYVTNSS--KKIETNVQTKGFDSP-SSSISQPRIKYHTKWIPFDHKYTRE 672

Query: 643 LNPSVRITPPPPGVIVYRLSDSYTYINCSRHYDLIFDEIKRVTRRGQLIQHRHKWDRPWN 702
           LNP V+I PPP GV+VYRLS+SYTY+NCSRHY++I +E+K+VTRRGQLI+HR K DRPWN
Sbjct: 673 LNPDVQILPPPDGVLVYRLSESYTYLNCSRHYNIITEEVKKVTRRGQLIRHRKKSDRPWN 732

Query: 703 DPGEWEAPDLXXXXXXXXXXXXXXXXXTDVDTFENENEIEHIHDGEHYKKN-DKDERPLL 761
           DPG WEAP                         + EN+ E + +      + ++D+RPLL
Sbjct: 733 DPGPWEAPAFLKNLKFWK---------------KRENDPESMENAPSTSVDVERDDRPLL 777

Query: 762 RVVCLDFSQVANTDATALQSLADLRKAVNKYADRQVEFHFVGIYSPWIKRGLRNLGFGTT 821
           +++CLDFSQVA TDATALQSL DLRKA+N+YADRQVEFHFVGI SPW+KRGL + GFGT 
Sbjct: 778 KILCLDFSQVAQTDATALQSLVDLRKAINQYADRQVEFHFVGIISPWVKRGLISRGFGTL 837

Query: 822 NEEYSDESIIAGHSSYHLSRFRESEQDGFNELDSLESQRNIGSKTKVLAASGTNLPFFHV 881
           NEEYSDESI+AGH+SYH++R  + E++                K  V  ASGTNLPFFH+
Sbjct: 838 NEEYSDESIVAGHTSYHVARVPQGEEN--------------PEKYSVYTASGTNLPFFHI 883

Query: 882 DIPDFSKWDI 891
           DIPDF+KWDI
Sbjct: 884 DIPDFAKWDI 893

>Smik_12.151 Chr12 (303440..306121) [2682 bp, 893 aa] {ON} YLR092W
           (REAL)
          Length = 893

 Score = 1097 bits (2836), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 550/909 (60%), Positives = 675/909 (74%), Gaps = 61/909 (6%)

Query: 3   ELDNLELEYNQFKNNER---------PSNTNAGADI---EKGLDTKKYFERSITDNSTYG 50
           +LD+LELEY+Q+KNNE           SN+ A  +     KG    K    + +D S Y 
Sbjct: 26  DLDDLELEYDQYKNNENNDAFKDNDLESNSVAKPNAVGNGKGAKGSKIEYFNPSDVSLYD 85

Query: 51  KKSYSIPSYEEDTITLKDYYDTNLRDYFTWASVVDYIRSLFPVVNWLPFYNPKWFLSDLI 110
               S+  +EE T++LK+YYD ++R + T     DY++S+FP++NWLP YN  WF +DLI
Sbjct: 86  N---SVSQFEESTVSLKEYYDHSIRSHLTLKGARDYLKSVFPIINWLPHYNFNWFTADLI 142

Query: 111 AGITVGTVLVPQSMSYAQIATLPPEYGLYSSFIGALVYSFFATSKDVCIGPVAVMSLQTA 170
           AGIT+G VLVPQSMSYAQ+ATLP +YGLYSSFIGA  YSFFATSKDVCIGPVAVMSLQTA
Sbjct: 143 AGITIGCVLVPQSMSYAQVATLPAQYGLYSSFIGAYSYSFFATSKDVCIGPVAVMSLQTA 202

Query: 171 KVIARVKEKHPDLDPSITGPIIATVLAFICGIIATGVGLLRLGFLVELISLNAVAGFMTG 230
           KVIA V  K+PD DP+ITGP+IAT LA +CGII+  +G LRLGFLVELISLNAVAGFMTG
Sbjct: 203 KVIADVTAKYPDGDPAITGPVIATTLALLCGIISAAIGFLRLGFLVELISLNAVAGFMTG 262

Query: 231 SAFNIIWGQIPGLMGYSKKVNTRRSTYHVVIDSLKHLPDTKLDAAFGLIPLFTLFFWKWW 290
           SAFNI+WGQ+P LMGY+  VNTR +TY VVI++LKHLPDTKLDA FGLIPLF L+ WKWW
Sbjct: 263 SAFNILWGQVPALMGYNSLVNTRAATYKVVIETLKHLPDTKLDAVFGLIPLFLLYVWKWW 322

Query: 291 CNSMGPKLTDRYFPANSRPRANKYWKAFYFYLQASRNGIIIILFTAVSYGITKGVAKDKR 350
           C + GP L DRY   N  PR +K  K  YFY QASRNG+II++FT + + IT+G +K +R
Sbjct: 323 CGTYGPILNDRYNSKN--PRLHKILKWTYFYAQASRNGVIIVVFTCIGWAITRGKSKSER 380

Query: 351 RISVLGTVPKGLRHTGVMKLPHGILNNIAAEIPSSIIVLLLEHIAISKSFGRVNDYKINP 410
            IS+LG+VP GL+  GV  +P G+++ +   +P+SIIVLLLEHIAISKSFGR+NDYK+ P
Sbjct: 381 PISILGSVPSGLKEVGVFHVPSGLMSKLGPNLPASIIVLLLEHIAISKSFGRINDYKVVP 440

Query: 411 NQEIIAIGVSNLLGTFFNAYPATGSFSRSALKAKCNVMTPLSGIFSAACVLLAIYCLTGA 470
           +QE+IAIGVSNLLGTFFNAYPATGSFSRSALKAKCNV TPLSG+FS +CVLLA+YCLTGA
Sbjct: 441 DQELIAIGVSNLLGTFFNAYPATGSFSRSALKAKCNVRTPLSGLFSGSCVLLALYCLTGA 500

Query: 471 FFYIPKATLSAVIIHAVFDLIASYHTTWSLWKMNVFDFIGFITTVFITVFSSIENGIYFA 530
           FFYIPKATLSAVIIHAV DL+ASY TTW+ WKMN  DFI FI TV ITVF+SIE+GIYFA
Sbjct: 501 FFYIPKATLSAVIIHAVSDLLASYQTTWNFWKMNPLDFICFIVTVLITVFASIEDGIYFA 560

Query: 531 VCWSCAILLYNNAFPAGKFLGRIEIAEVVNPKIVDDDD---FSFENSNE-SFDDEGIYFD 586
           +CWSCA+LL   AFPAGKFLGR+EIAEV +  I  + D   ++ EN+N     +EG  ++
Sbjct: 561 MCWSCAMLLLKMAFPAGKFLGRVEIAEVTDAYIKANSDAVSYTSENNNGIRTSEEGDEYE 620

Query: 587 NSVAEDKLGTSSNDLKKFNAGVKTRSIN--GELVNGQTSSDIRYYTKWVPFDHAYSKELN 644
              +   +  SS   KK    V+T+S +    L+   T   ++Y+TKWVPFDH Y++ELN
Sbjct: 621 KDSSTKYITNSS---KKIETNVQTKSFDSPSSLI---TQPRMKYHTKWVPFDHKYTRELN 674

Query: 645 PSVRITPPPPGVIVYRLSDSYTYINCSRHYDLIFDEIKRVTRRGQLIQHRHKWDRPWNDP 704
           P ++I PPP GV+VYRLS+SYTY+NCSRHY++I +++K VTRRGQLI+HR K DRPWNDP
Sbjct: 675 PDIQILPPPEGVLVYRLSESYTYLNCSRHYNIITEKVKEVTRRGQLIRHRKKSDRPWNDP 734

Query: 705 GEWEAPDLXXXXXXXXXXXXXXXXXTDVDTFEN--ENEIEHIHDGEHYKKNDKDERPLLR 762
           G WEAP                   +D +  EN  +N I            ++D+RPLL+
Sbjct: 735 GPWEAPAF------LKNLKFWKKRESDSEFLENAPDNSI----------GTERDDRPLLK 778

Query: 763 VVCLDFSQVANTDATALQSLADLRKAVNKYADRQVEFHFVGIYSPWIKRGLRNLGFGTTN 822
           ++CLDFSQVA TDATALQSL DLRK +N+YADRQVEFHFVGI SPW+KRGL + GFGT N
Sbjct: 779 ILCLDFSQVAQTDATALQSLVDLRKVINQYADRQVEFHFVGIISPWVKRGLVSRGFGTLN 838

Query: 823 EEYSDESIIAGHSSYHLSRFRESEQDGFNELDSLESQRNIGSKTKVLAASGTNLPFFHVD 882
           EEYSDESI+AGH+SYH++R  +S+++                K  V  ASGTNLPFFH+D
Sbjct: 839 EEYSDESIVAGHTSYHVARVPQSKEN--------------SDKYSVYTASGTNLPFFHID 884

Query: 883 IPDFSKWDI 891
           IPDF+KWDI
Sbjct: 885 IPDFAKWDI 893

>Suva_10.176 Chr10 (328373..331054) [2682 bp, 893 aa] {ON} YLR092W
           (REAL)
          Length = 893

 Score = 1096 bits (2835), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 553/913 (60%), Positives = 678/913 (74%), Gaps = 65/913 (7%)

Query: 1   MEELDNLELEYNQFKNNERP-------------SNTNAGADIEKGLDTKKYFERSITDNS 47
           + +LD+LELEY+Q+KNNE               +N N  ++  KG+   K    + +D S
Sbjct: 24  VPDLDDLELEYDQYKNNENNGAFNDNDLESNSLTNHNTASE-AKGVKGSKVEYFNTSDIS 82

Query: 48  TYGKKSYSIPSYEEDTITLKDYYDTNLRDYFTWASVVDYIRSLFPVVNWLPFYNPKWFLS 107
            Y     S+  ++E T++ K+YYD ++R + T  +  +Y++S+FP++ WLP YN  WF++
Sbjct: 83  LYDN---SVSQFDEPTVSFKEYYDHSIRSHLTLKAAGNYLKSVFPIIYWLPHYNVNWFIA 139

Query: 108 DLIAGITVGTVLVPQSMSYAQIATLPPEYGLYSSFIGALVYSFFATSKDVCIGPVAVMSL 167
           DLIAGIT+G VLVPQSMSYAQ+ATLP +YGLYSSFIGA  YSFFATSKDVCIGPVAVMSL
Sbjct: 140 DLIAGITIGCVLVPQSMSYAQVATLPAQYGLYSSFIGAYAYSFFATSKDVCIGPVAVMSL 199

Query: 168 QTAKVIARVKEKHPDLDPSITGPIIATVLAFICGIIATGVGLLRLGFLVELISLNAVAGF 227
           QTAKVIA V  ++PD D +ITGPIIAT LA +CGII+  VG LRLGFLVELISLNAVAGF
Sbjct: 200 QTAKVIADVTARYPDGDTTITGPIIATTLALLCGIISAAVGFLRLGFLVELISLNAVAGF 259

Query: 228 MTGSAFNIIWGQIPGLMGYSKKVNTRRSTYHVVIDSLKHLPDTKLDAAFGLIPLFTLFFW 287
           MTGSAFNI+WGQ+P LMGY+K VNTR +TY +VIDSLKHLPDT LDAAFGLIPLF L+ W
Sbjct: 260 MTGSAFNILWGQVPALMGYNKLVNTRVATYKIVIDSLKHLPDTTLDAAFGLIPLFILYTW 319

Query: 288 KWWCNSMGPKLTDRYFPANSRPRANKYWKAFYFYLQASRNGIIIILFTAVSYGITKGVAK 347
           KWWC + GP+L DR+   + +PR +K  K   FY QASRNGIIII+FT +++ IT+G + 
Sbjct: 320 KWWCGTYGPRLNDRF--NSKKPRLHKIVKWTCFYAQASRNGIIIIVFTCIAWAITRGKSS 377

Query: 348 DKRRISVLGTVPKGLRHTGVMKLPHGILNNIAAEIPSSIIVLLLEHIAISKSFGRVNDYK 407
             R IS+LG+VP GL+  GV  +P G+++ +   +P+SIIVLLLEHIAISKSFGRVNDYK
Sbjct: 378 ADRPISILGSVPSGLKEVGVFHVPPGLMSKLGPNLPASIIVLLLEHIAISKSFGRVNDYK 437

Query: 408 INPNQEIIAIGVSNLLGTFFNAYPATGSFSRSALKAKCNVMTPLSGIFSAACVLLAIYCL 467
           + P+QE+IAIGVSNLLGTFFNAYPATGSFSRSALKAKCNV TPLSG+FS +CVLLA+YCL
Sbjct: 438 VVPDQELIAIGVSNLLGTFFNAYPATGSFSRSALKAKCNVRTPLSGLFSGSCVLLALYCL 497

Query: 468 TGAFFYIPKATLSAVIIHAVFDLIASYHTTWSLWKMNVFDFIGFITTVFITVFSSIENGI 527
           TGAFFYIPKATLSAVIIHAV DL+ASY TTW+ WKMN  DFI FI TV ITVFSSIENGI
Sbjct: 498 TGAFFYIPKATLSAVIIHAVSDLLASYQTTWNFWKMNPLDFICFIVTVLITVFSSIENGI 557

Query: 528 YFAVCWSCAILLYNNAFPAGKFLGRIEIAEVVNPKIVDDDD---FSFENSNE--SFDDEG 582
           YFA+CWSCAI +   AFPAGKFLGR+EIAEV +  +  D D   F+ EN+N   + +++G
Sbjct: 558 YFAMCWSCAIFILKVAFPAGKFLGRVEIAEVTDAYVRADSDSVSFTSENNNRISTLEEDG 617

Query: 583 IYFDNSVAEDKLGTSS---NDLKKFNAGVKTRSINGELVN-GQTSSDIRYYTKWVPFDHA 638
           +        +K G ++   N  KK    V+T+       + GQ    I+Y+TKW+PFDH 
Sbjct: 618 V-------GEKEGPTNYIINSFKKLETKVQTKGFESPSASIGQPR--IKYHTKWLPFDHK 668

Query: 639 YSKELNPSVRITPPPPGVIVYRLSDSYTYINCSRHYDLIFDEIKRVTRRGQLIQHRHKWD 698
           Y+KELNP V I PPP GV+VYRLS+SYTYINCSRHY++I DEIK+VTRRGQLI+HR K D
Sbjct: 669 YTKELNPDVNILPPPEGVLVYRLSESYTYINCSRHYNVITDEIKKVTRRGQLIRHRKKSD 728

Query: 699 RPWNDPGEWEAPDLXXXXXXXXXXXXXXXXXTDVDTFENENEIEHIHDGEHYKKNDKDER 758
           RPWNDPG WE P                   TD+++  +EN + +  D        +D+R
Sbjct: 729 RPWNDPGPWEPPTF------FKNLKFWKKKETDIES--SENAVNNPTDAV------RDDR 774

Query: 759 PLLRVVCLDFSQVANTDATALQSLADLRKAVNKYADRQVEFHFVGIYSPWIKRGLRNLGF 818
           PLL+++CLDFSQVA TDATALQSL DLRKA+N+YADRQVEFHFVGI SPW+KRGL + GF
Sbjct: 775 PLLKILCLDFSQVAQTDATALQSLVDLRKAINQYADRQVEFHFVGIISPWVKRGLISRGF 834

Query: 819 GTTNEEYSDESIIAGHSSYHLSRFRESEQDGFNELDSLESQRNIGSKTKVLAASGTNLPF 878
           GT NEEYSDESI+AGH+SYH++R  ++E+                 K  V  ASGTNLPF
Sbjct: 835 GTLNEEYSDESIVAGHTSYHVARVPQNEE--------------TPDKYSVYTASGTNLPF 880

Query: 879 FHVDIPDFSKWDI 891
           FH+DIPDF+KWDI
Sbjct: 881 FHIDIPDFAKWDI 893

>Skud_12.160 Chr12 (306715..309396) [2682 bp, 893 aa] {ON} YLR092W
           (REAL)
          Length = 893

 Score = 1096 bits (2835), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 552/910 (60%), Positives = 673/910 (73%), Gaps = 65/910 (7%)

Query: 4   LDNLELEYNQFKNNERP-------------SNTNAGADIEKGLDTKK--YFERSITDNST 48
           LD+LELEY+Q+KNNE               +N NA  D  KG+   K  YF+ S  D S 
Sbjct: 27  LDDLELEYDQYKNNENNGVFSDNDLESNSVANRNAVND-AKGVKGSKIEYFDPS--DVSL 83

Query: 49  YGKKSYSIPSYEEDTITLKDYYDTNLRDYFTWASVVDYIRSLFPVVNWLPFYNPKWFLSD 108
           Y     S+  +EE  ++LK+YY+ ++R + T     DY++S+FP++NWLP YN  WF++D
Sbjct: 84  YDN---SVSQFEESAVSLKEYYNHSIRSHLTLKGAGDYLKSVFPIINWLPHYNFNWFIAD 140

Query: 109 LIAGITVGTVLVPQSMSYAQIATLPPEYGLYSSFIGALVYSFFATSKDVCIGPVAVMSLQ 168
           LIAGIT+G VLVPQSMSYAQ+ATLP +YGLYSSFIGA  YSFFATSKDVCIGPVAVMSLQ
Sbjct: 141 LIAGITIGCVLVPQSMSYAQVATLPAQYGLYSSFIGAYAYSFFATSKDVCIGPVAVMSLQ 200

Query: 169 TAKVIARVKEKHPDLDPSITGPIIATVLAFICGIIATGVGLLRLGFLVELISLNAVAGFM 228
           TAKVIA V+ K+PD D +ITGP+IAT LA +CGII+  VG LRLGFLVELISLNAVAGFM
Sbjct: 201 TAKVIAEVQAKYPDGDTTITGPVIATTLALLCGIISAAVGFLRLGFLVELISLNAVAGFM 260

Query: 229 TGSAFNIIWGQIPGLMGYSKKVNTRRSTYHVVIDSLKHLPDTKLDAAFGLIPLFTLFFWK 288
           TGSAFNI+WGQ+P LMGY+K VNTR +TY VVI++LKHLPDTKLDA FGLIPLF L+ WK
Sbjct: 261 TGSAFNILWGQVPALMGYNKLVNTRAATYKVVIETLKHLPDTKLDAVFGLIPLFLLYVWK 320

Query: 289 WWCNSMGPKLTDRYFPANSRPRANKYWKAFYFYLQASRNGIIIILFTAVSYGITKGVAKD 348
           WWC + GP+L DRY   N+  R +K  K  YFY QASRNGIIII+FT + + IT+G +  
Sbjct: 321 WWCGTYGPRLNDRYNSKNA--RLHKIVKWTYFYAQASRNGIIIIVFTCIGWAITRGKSSS 378

Query: 349 KRRISVLGTVPKGLRHTGVMKLPHGILNNIAAEIPSSIIVLLLEHIAISKSFGRVNDYKI 408
           +R IS+LG+VP GL+  GV  +P G+++ +   +PSSIIVLLLEHIAISKSFGR+NDYK+
Sbjct: 379 ERPISILGSVPSGLKEVGVFHVPSGLMSKLGPSLPSSIIVLLLEHIAISKSFGRINDYKV 438

Query: 409 NPNQEIIAIGVSNLLGTFFNAYPATGSFSRSALKAKCNVMTPLSGIFSAACVLLAIYCLT 468
            P+QE+IAIGVSNLLGTFFNAYPATGSFSRSALKAKCNV TPLSG+FS +CVLLA+YCLT
Sbjct: 439 VPDQELIAIGVSNLLGTFFNAYPATGSFSRSALKAKCNVRTPLSGLFSGSCVLLALYCLT 498

Query: 469 GAFFYIPKATLSAVIIHAVFDLIASYHTTWSLWKMNVFDFIGFITTVFITVFSSIENGIY 528
           GAFFYIPKATLSAVIIHAV DL+ASY TTW+ WKMN  DFI FI TV ITVF+SIE+GIY
Sbjct: 499 GAFFYIPKATLSAVIIHAVSDLLASYQTTWNFWKMNPLDFICFIVTVLITVFASIEDGIY 558

Query: 529 FAVCWSCAILLYNNAFPAGKFLGRIEIAEVVNPKIVDDDD---FSFENSNESFDDEGIYF 585
           FA+CWSCA+LL   AFPAGKFLGR+EIAEV +  +  D D   +  EN+N     E    
Sbjct: 559 FAMCWSCAMLLLKVAFPAGKFLGRVEIAEVTDAYVKADSDAVSYVSENNNRISTLE---- 614

Query: 586 DNSVAEDKLGTS--SNDLKKFNAGVKTRSINGELVN-GQTSSDIRYYTKWVPFDHAYSKE 642
           +N   E ++     +N  KK    V+T+       + GQ    I+Y+TKW+PFDH Y++E
Sbjct: 615 ENGEDEKEISAKYITNSSKKIETNVQTKGFASPSSSIGQPR--IKYHTKWLPFDHKYTRE 672

Query: 643 LNPSVRITPPPPGVIVYRLSDSYTYINCSRHYDLIFDEIKRVTRRGQLIQHRHKWDRPWN 702
           LNP V I PPP  V+VYRLS+SYTY+NCSRHY++I DE+KR TRRGQ+I+HR K DRPWN
Sbjct: 673 LNPDVHILPPPESVLVYRLSESYTYLNCSRHYNIIIDEVKRATRRGQIIRHRKKSDRPWN 732

Query: 703 DPGEWEAPDLXXXXXXXXXXXXXXXXXTDVDTFENENEIEHIHDGEHYKKN-DKDERPLL 761
           DPG WEAP                         + E+++E   +  +   + ++DERPLL
Sbjct: 733 DPGPWEAPAFLKNLKFWK---------------KKESDLEFTQNAPNNSIDAERDERPLL 777

Query: 762 RVVCLDFSQVANTDATALQSLADLRKAVNKYADRQVEFHFVGIYSPWIKRGLRNLGFGTT 821
           +++CLDFSQVA TDATALQSL DLRKA+N+YADRQVEFHFVGI SPW+KRGL + GFGT 
Sbjct: 778 KILCLDFSQVAQTDATALQSLVDLRKAINQYADRQVEFHFVGIISPWVKRGLISRGFGTI 837

Query: 822 NEEYSDESIIAGHSSYHLSRFRESEQDGFNELDSLESQRNIGSKTKVLAASGTNLPFFHV 881
           NEEYSDESI+AGH+SYH++R   ++++                K  V  ASGTNLPFFH+
Sbjct: 838 NEEYSDESIVAGHTSYHVARVPRNKEN--------------PDKYSVYTASGTNLPFFHI 883

Query: 882 DIPDFSKWDI 891
           DIPDF+KWDI
Sbjct: 884 DIPDFAKWDI 893

>KNAG0G02070 Chr7 (469623..472322) [2700 bp, 899 aa] {ON} Anc_8.271
           YLR092W
          Length = 899

 Score = 1090 bits (2819), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 547/909 (60%), Positives = 668/909 (73%), Gaps = 65/909 (7%)

Query: 3   ELDNLELEYNQFKNNE-RPSNT--NAGADIEKGLDTKKYFERSITDNSTYGKKSYS---- 55
           +LDNLELEY+Q+K +E  P  T  +  AD ++      + E     +S     S      
Sbjct: 36  DLDNLELEYDQYKADELHPQRTILSNQADTDREKIANVFVEEQSVRDSNIPSASIEELQY 95

Query: 56  ----------IPSYEEDTITLKDYYDTNLRDYFTWASVVDYIRSLFPVVNWLPFYNPKWF 105
                     IPSY E  +T  ++++ +LR  FT  +  +YI S+FP+++WLP YN  WF
Sbjct: 96  FAHESDGAKVIPSYVEGNVTELEFFNHSLRSKFTLNAAKNYILSIFPIIHWLPHYNVYWF 155

Query: 106 LSDLIAGITVGTVLVPQSMSYAQIATLPPEYGLYSSFIGALVYSFFATSKDVCIGPVAVM 165
           + DLIAGITVG VLVPQSMSYAQIATLPP+YGLYSSFIGA +YS FATSKDVCIGPVAVM
Sbjct: 156 IQDLIAGITVGCVLVPQSMSYAQIATLPPQYGLYSSFIGAFIYSLFATSKDVCIGPVAVM 215

Query: 166 SLQTAKVIARVKEKHPDLDPSITGPIIATVLAFICGIIATGVGLLRLGFLVELISLNAVA 225
           SL+TAK+IARV ++ P+ DP + GPIIAT  A +CG IA GVG LRLGFLVELISLNAVA
Sbjct: 216 SLETAKIIARVMKRFPN-DPDVQGPIIATTTALLCGGIAAGVGFLRLGFLVELISLNAVA 274

Query: 226 GFMTGSAFNIIWGQIPGLMGYSKKVNTRRSTYHVVIDSLKHLPDTKLDAAFGLIPLFTLF 285
           GFMTGSA NII GQ+P LMGY K VNTR +TY V++++LKHLPDTKLDA FGLIPLF L+
Sbjct: 275 GFMTGSALNIISGQVPALMGYGKLVNTRTATYKVIVNTLKHLPDTKLDAVFGLIPLFILY 334

Query: 286 FWKWWCNSMGPKLTDRYFPANSRPRANKYWKAFYFYLQASRNGIIIILFTAVSYGITKGV 345
           FW+WWCN  GPKLTDRY+P  SR   N  WK FYFY QASR+GIIII+FTA+S+ IT+ V
Sbjct: 335 FWRWWCNGYGPKLTDRYYPKGSR--GNFLWKKFYFYAQASRSGIIIIVFTAISWSITRHV 392

Query: 346 AKDKRRISVLGTVPKGLRHTGVMKLPHGILNNIAAEIPSSIIVLLLEHIAISKSFGRVND 405
              +RRIS+LGTVPKGL+  G +K+P  +   IA E+P+++IVLLLEHIAISKSFGR+ND
Sbjct: 393 PSKERRISILGTVPKGLKDVGAIKVPPELPAKIAPELPAAVIVLLLEHIAISKSFGRIND 452

Query: 406 YKINPNQEIIAIGVSNLLGTFFNAYPATGSFSRSALKAKCNVMTPLSGIFSAACVLLAIY 465
           YK+ P+QE+IAIGV+NL+GTFF+AYP TGSFSRSALKAKCNV TPLSG+F+ +CVLLA+Y
Sbjct: 453 YKVVPDQELIAIGVTNLIGTFFHAYPTTGSFSRSALKAKCNVKTPLSGLFTGSCVLLALY 512

Query: 466 CLTGAFFYIPKATLSAVIIHAVFDLIASYHTTWSLWKMNVFDFIGFITTVFITVFSSIEN 525
           CLTGAFFYIPKATLSAVIIH+V DL+ASYHTTW+ +KMN  DF+ F+TT+ ITVFSSIEN
Sbjct: 513 CLTGAFFYIPKATLSAVIIHSVSDLVASYHTTWNFYKMNPLDFVCFLTTIIITVFSSIEN 572

Query: 526 GIYFAVCWSCAILLYNNAFPAGKFLGRIEIAEVVNPKIVDDDDFSFENSNESFDDEGIYF 585
           GIYFA+CWSCA+LL+  AFPAGKFLGR+EIAEVV+ +I++D+       +   +  G   
Sbjct: 573 GIYFAICWSCALLLFKVAFPAGKFLGRVEIAEVVDGEIINDNSVVMTTDDCVSEFGG--- 629

Query: 586 DNSVAEDKLGTSSNDL--KKFNAGVKTRSINGELVNGQTSSDIRYYTKWVPFDHAYSKEL 643
           +   ++DKL   S+ +   K ++   + SI          + ++YYTKWVPFDHAY++EL
Sbjct: 630 NKEFSKDKLNGKSDFIVKDKLDSTASSSSI--------AENKLKYYTKWVPFDHAYTREL 681

Query: 644 NPSVRITPPPPGVIVYRLSDSYTYINCSRHYDLIFDEIKRVTRRGQLIQHRHKWDRPWND 703
           NP V I PPPPGVIVYR+SDSYTYIN S HYD+I DEIKRVTRRGQL+QHR K DRPWND
Sbjct: 682 NPDVTIQPPPPGVIVYRMSDSYTYINASNHYDIIIDEIKRVTRRGQLLQHRKKSDRPWND 741

Query: 704 PGEWEAPDLXXXXXXXXXXXXXXXXXTDVDTFENENEIEHIHDGEHYKKN-DKDERPLLR 762
           PGEW+ P                   ++V  +    +     D E  +    +DERP+L+
Sbjct: 742 PGEWKPPKF----------------LSNVLHWRKNKKKNQTADVESLETGIVRDERPVLK 785

Query: 763 VVCLDFSQVANTDATALQSLADLRKAVNKYADRQVEFHFVGIYSPWIKRGLRNLGFGTTN 822
           V+CLDFSQVA  D+T+LQSL DLRKAVN YADRQVEFHF GI SPWIKRGL  +GFGT N
Sbjct: 786 VLCLDFSQVAQVDSTSLQSLVDLRKAVNAYADRQVEFHFAGIISPWIKRGLVKIGFGTVN 845

Query: 823 EEYSDESIIAGHSSYHLSRFRESEQDGFNELDSLESQRNIGSKTKVLAASGTNLPFFHVD 882
           EE+SDESIIAGHSSYHL +         N +  +E+        +V  A+GTNLPFFH+D
Sbjct: 846 EEFSDESIIAGHSSYHLVK---------NTIGDIENGY------QVKTATGTNLPFFHID 890

Query: 883 IPDFSKWDI 891
           IPDF KWDI
Sbjct: 891 IPDFKKWDI 899

>Smik_2.435 Chr2 (775289..777880) [2592 bp, 863 aa] {ON} YLR092W
           (REAL)
          Length = 863

 Score = 1058 bits (2735), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 520/837 (62%), Positives = 634/837 (75%), Gaps = 48/837 (5%)

Query: 55  SIPSYEEDTITLKDYYDTNLRDYFTWASVVDYIRSLFPVVNWLPFYNPKWFLSDLIAGIT 114
           SIP+YEE+T+TLKDYYD  ++D  T  S   Y+ SLFP++ WLP YN  W  +DL+AGIT
Sbjct: 75  SIPAYEENTVTLKDYYDHTIKDNLTLKSAGSYLYSLFPIIKWLPHYNFTWGYADLVAGIT 134

Query: 115 VGTVLVPQSMSYAQIATLPPEYGLYSSFIGALVYSFFATSKDVCIGPVAVMSLQTAKVIA 174
           VG VLVPQSMSYAQIA+L PEYGLYSSFIGA +YS FATSKDVCIGPVAVMSLQTAKVIA
Sbjct: 135 VGCVLVPQSMSYAQIASLSPEYGLYSSFIGAFIYSLFATSKDVCIGPVAVMSLQTAKVIA 194

Query: 175 RVKEKHPDLDPSITGPIIATVLAFICGIIATGVGLLRLGFLVELISLNAVAGFMTGSAFN 234
            V +K+P+    +TGPIIAT L  +CG++ATG+G+LRLGFLVELISLNAVAGFMTGSAF+
Sbjct: 195 EVLKKYPEDQVEVTGPIIATTLCLLCGLVATGLGVLRLGFLVELISLNAVAGFMTGSAFS 254

Query: 235 IIWGQIPGLMGYSKKVNTRRSTYHVVIDSLKHLPDTKLDAAFGLIPLFTLFFWKWWCNSM 294
           IIWGQIP LMGY+K VNTR +TY VVI++LKHLP+TKLDA FGLIPL  L+ WKWWC S 
Sbjct: 255 IIWGQIPALMGYNKLVNTREATYKVVINTLKHLPNTKLDAVFGLIPLVILYLWKWWCGSF 314

Query: 295 GPKLTDRYFPANSRPRANKYWKAFYFYLQASRNGIIIILFTAVSYGITKGVAKDKRRISV 354
           G KL DR++  +++P+     K+FYFY QA RN ++II+FTA+S+ IT+  +K+KR IS+
Sbjct: 315 GIKLVDRHY--SNQPKTANRIKSFYFYAQAMRNAVVIIVFTAISFRITRNKSKEKRPISI 372

Query: 355 LGTVPKGLRHTGVMKLPHGILNNIAAEIPSSIIVLLLEHIAISKSFGRVNDYKINPNQEI 414
           LGTVP GL   GVMK+P G+L+N+++E+P+SIIVL+LEHIAISKSFGR+NDYK+ P+QE+
Sbjct: 373 LGTVPSGLNEVGVMKIPDGLLSNMSSELPASIIVLVLEHIAISKSFGRINDYKVIPDQEL 432

Query: 415 IAIGVSNLLGTFFNAYPATGSFSRSALKAKCNVMTPLSGIFSAACVLLAIYCLTGAFFYI 474
           IAIGV+NL+GTFF++YPATGSFSRSALKAKCNV TP SG+F+ ACVLLA+YCLT AFFYI
Sbjct: 433 IAIGVTNLIGTFFHSYPATGSFSRSALKAKCNVRTPFSGVFTGACVLLALYCLTSAFFYI 492

Query: 475 PKATLSAVIIHAVFDLIASYHTTWSLWKMNVFDFIGFITTVFITVFSSIENGIYFAVCWS 534
           PKATLSAVIIHAV DL+ASY TTW+ WKMN  D I FI TV ITVFSSIENGIYFA+CWS
Sbjct: 493 PKATLSAVIIHAVSDLLASYETTWNFWKMNPLDCISFIVTVLITVFSSIENGIYFAMCWS 552

Query: 535 CAILLYNNAFPAGKFLGRIEIAEVVNPKIVDDDDFSFENSNESFDDEGIYFDNSVAEDKL 594
           CA+LL   AFPAGKFLGR+E+AEV+NP I    D S  + NES ++              
Sbjct: 553 CAMLLLKQAFPAGKFLGRVEVAEVLNPTIQGHID-SIVSPNESPNE-------------- 597

Query: 595 GTSSNDLKKFNAGVKTRSINGELVNGQTSSDIRYYTKWVPFDHAYSKELNPSVRITPPPP 654
                    F+  VK+       V+   SS+ ++  KWVPFDHAY++ELN   R+ PPPP
Sbjct: 598 ---------FSKQVKSS------VDALPSSEYKFSVKWVPFDHAYTRELNSYTRVRPPPP 642

Query: 655 GVIVYRLSDSYTYINCSRHYDLIFDEIKRVTRRGQLIQHRHKWDRPWNDPGEWEAPDLXX 714
           GVIVYR SDS+TY+NCSRHYD+IFD IK  TRRGQL+  R K DRPWNDPGEW+ P+   
Sbjct: 643 GVIVYRFSDSFTYVNCSRHYDVIFDRIKEETRRGQLVSLRKKSDRPWNDPGEWKLPNSFK 702

Query: 715 XXXXXXXXXXXXXXXTDVDTFENENEIEHIHDGEHYKKNDKDERPLLRVVCLDFSQVANT 774
                                   +E+  ++D  +   ++  E+PLL+VVCLDFSQVA  
Sbjct: 703 NIFRVKRGLAT-----------KNSELPAVNDNTN---SESYEKPLLKVVCLDFSQVAQV 748

Query: 775 DATALQSLADLRKAVNKYADRQVEFHFVGIYSPWIKRGLRNLGFGTTNEEYSDESIIAGH 834
           D+TA+QSL DLRKAVNKYADRQVEFHF GI SPWIKR L ++ FGT NEE+SD SII GH
Sbjct: 749 DSTAVQSLVDLRKAVNKYADRQVEFHFAGIISPWIKRSLLSVKFGTINEEFSDTSIITGH 808

Query: 835 SSYHLSRFRESEQDGFNELDSLESQRNIGSKTKVLAASGTNLPFFHVDIPDFSKWDI 891
           SS+H+++  + E D + + DS  S       T + AA+GTNLPFFH+DIPDFSKWD+
Sbjct: 809 SSFHIAKVLKDEVD-YTDEDSPISVTCSNYDT-LCAATGTNLPFFHIDIPDFSKWDV 863

>TDEL0F03980 Chr6 (737605..740208) [2604 bp, 867 aa] {ON} Anc_8.271
           YLR092W
          Length = 867

 Score = 1056 bits (2730), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 525/897 (58%), Positives = 646/897 (72%), Gaps = 53/897 (5%)

Query: 3   ELDNLELEYNQFKNNERPSN----TNAGADI---EKGLDTKKYFERSITDNSTYGKKSYS 55
           +LD+LE EY+ +K NE+  +     N   D    +KG+D  K  E     +        +
Sbjct: 16  KLDDLEAEYDLYKANEQLEDNEVTVNGSEDDYGNKKGIDLVKETEVRYYGSPGPEAIGGN 75

Query: 56  IPSYEEDTITLKDYYDTNLRDYFTWASVVDYIRSLFPVVNWLPFYNPKWFLSDLIAGITV 115
           IP +EE T+++KDYY+  +R+  T  S   Y+ SLFP+V W P YN  W  +DL+AGITV
Sbjct: 76  IPGFEESTVSVKDYYNQFIREKLTLNSAGSYVYSLFPIVKWFPHYNLTWGYADLVAGITV 135

Query: 116 GTVLVPQSMSYAQIATLPPEYGLYSSFIGALVYSFFATSKDVCIGPVAVMSLQTAKVIAR 175
           G VLVPQSMSYAQIA+LPP+YGLYSSFIGA +YS FATSKDVCIGPVAVMSLQTAKVIA+
Sbjct: 136 GCVLVPQSMSYAQIASLPPQYGLYSSFIGAFIYSLFATSKDVCIGPVAVMSLQTAKVIAQ 195

Query: 176 VKEKHPDLDPSITGPIIATVLAFICGIIATGVGLLRLGFLVELISLNAVAGFMTGSAFNI 235
           V  K+P+ DP +T P+IAT L+ +CGI+A GVGLLRLGFLVELISLNAVAGFMTGSAFNI
Sbjct: 196 VSAKYPENDPIVTAPVIATALSLLCGIVAIGVGLLRLGFLVELISLNAVAGFMTGSAFNI 255

Query: 236 IWGQIPGLMGYSKKVNTRRSTYHVVIDSLKHLPDTKLDAAFGLIPLFTLFFWKWWCNSMG 295
           +WGQ+P LMGYS KVNTR STY VVIDSLKHLPDTKLDA FGL+PL  L+ WKWWC + G
Sbjct: 256 LWGQVPALMGYSSKVNTRASTYKVVIDSLKHLPDTKLDAVFGLVPLCLLYLWKWWCGTYG 315

Query: 296 PKLTDRYFPANSRPRANKYWKAFYFYLQASRNGIIIILFTAVSYGITKGVAKDKRRISVL 355
           PKL DR    +  P+  +  K FYFY  A RN +III+FTA+S+ ITK   K+ R I VL
Sbjct: 316 PKLADRQLAHS--PKKQRILKRFYFYSNAMRNAVIIIVFTAISWRITKNKDKEHRPIKVL 373

Query: 356 GTVPKGLRHTGVMKLPHGILNNIAAEIPSSIIVLLLEHIAISKSFGRVNDYKINPNQEII 415
           GTVP GL   GV K+P G+L  +A +IP+SIIVLLLEHIAISKSFGR+NDYK+ P+QE+I
Sbjct: 374 GTVPSGLEDVGVAKIPEGLLAKMAPDIPASIIVLLLEHIAISKSFGRINDYKVVPDQELI 433

Query: 416 AIGVSNLLGTFFNAYPATGSFSRSALKAKCNVMTPLSGIFSAACVLLAIYCLTGAFFYIP 475
           AIG +NL+GTFFNAYPATGSFSRSALKAKC V TP SG+F+  CVL+AIYCLT AFF+IP
Sbjct: 434 AIGATNLIGTFFNAYPATGSFSRSALKAKCEVRTPFSGVFTGCCVLVAIYCLTDAFFFIP 493

Query: 476 KATLSAVIIHAVFDLIASYHTTWSLWKMNVFDFIGFITTVFITVFSSIENGIYFAVCWSC 535
            ATLSAVIIHAV DL+ASY TTW+ WKMN  D   FI TV ITVFSSIENGIYFA+CWSC
Sbjct: 494 SATLSAVIIHAVSDLLASYKTTWNFWKMNPLDCCAFIVTVLITVFSSIENGIYFAMCWSC 553

Query: 536 AILLYNNAFPAGKFLGRIEIAEVVNPKIVDDDDFSFENSNESFDDEGIYFDNSVAEDKLG 595
           A+LL  +AFPAG+FLGR+E+AEV+NP +V+             D E I  ++ + E  +G
Sbjct: 554 AMLLLKHAFPAGQFLGRVEVAEVINPTVVE-------------DVEAISINDQI-EGSVG 599

Query: 596 TSSNDLKKFNAGVKTRSINGELVNGQTSSDIRYYTKWVPFDHAYSKELNPSVRITPPPPG 655
            S           K+   +   ++  + S+ ++++KWV   +AY++ELNP V+I PPPPG
Sbjct: 600 KS-----------KSLKADKGAISASSGSNYKFHSKWVAEQYAYNRELNPDVKILPPPPG 648

Query: 656 VIVYRLSDSYTYINCSRHYDLIFDEIKRVTRRGQLIQHRHKWDRPWNDPGEWE-APDLXX 714
           V+VYR+SDS+TYINCSRHYD IFD IK+ TRRGQL+  R K DRPWNDPGEWE +P +  
Sbjct: 649 VVVYRMSDSFTYINCSRHYDTIFDHIKKHTRRGQLLHLRKKSDRPWNDPGEWEISPSIKK 708

Query: 715 XXXXXXXXXXXXXXXTDVDTFENENEIEHIHDGEHYKKNDKDERPLLRVVCLDFSQVANT 774
                                +N+N+IE   D +    N +DERPLL+++CLDFSQV   
Sbjct: 709 FFKLGK---------------KNQNDIES-QDEDVAIDNTRDERPLLKIICLDFSQVVQV 752

Query: 775 DATALQSLADLRKAVNKYADRQVEFHFVGIYSPWIKRGLRNLGFGTTNEEYSDESIIAGH 834
           D+TA+QSL DLRKAV+KYADRQVEFHF GI S W+KR L ++GFGT N  YSDESIIAGH
Sbjct: 753 DSTAIQSLVDLRKAVHKYADRQVEFHFTGIISSWVKRSLLSMGFGTVNASYSDESIIAGH 812

Query: 835 SSYHLSRFRESEQDGFNELDSLESQRNIGSKTKVLAASGTNLPFFHVDIPDFSKWDI 891
           SSYH+++  +   D F           +    ++ AA+GTN+PFFH+DIPDFSKWD+
Sbjct: 813 SSYHIAKTTKPLADDFTT--DSSGSSQLQQSQEIYAATGTNMPFFHLDIPDFSKWDL 867

>Skud_2.424 Chr2 (758785..761376) [2592 bp, 863 aa] {ON} YBR294W
           (REAL)
          Length = 863

 Score = 1053 bits (2722), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 527/893 (59%), Positives = 652/893 (73%), Gaps = 55/893 (6%)

Query: 3   ELDNLELEYNQFKNNERPSNTNA---GADIEKGLDTKKYFERSITDNSTYGKKSYSIPSY 59
           +++  E EY  ++ +E   N +    G D    ++ K+ +E  +T +        SIP+Y
Sbjct: 22  DIEVFESEYRTYRESEAAENRDNFQNGDDQSWKINGKQKYE--VTKSEVSDVAYDSIPAY 79

Query: 60  EEDTITLKDYYDTNLRDYFTWASVVDYIRSLFPVVNWLPFYNPKWFLSDLIAGITVGTVL 119
           EE T+TLK+YYD +++   T  S  DY+ SLFP++ WLP YN  W  +DL+AGITVG VL
Sbjct: 80  EESTVTLKEYYDHSIKSSLTVKSAGDYLYSLFPIIKWLPHYNFTWGYADLVAGITVGCVL 139

Query: 120 VPQSMSYAQIATLPPEYGLYSSFIGALVYSFFATSKDVCIGPVAVMSLQTAKVIARVKEK 179
           VPQSMSYAQIA+L PEYGLYSSFIGA +YS FATSKDVCIGPVAVMSLQTAKVIA V +K
Sbjct: 140 VPQSMSYAQIASLSPEYGLYSSFIGAFIYSLFATSKDVCIGPVAVMSLQTAKVIAEVLKK 199

Query: 180 HPDLDPSITGPIIATVLAFICGIIATGVGLLRLGFLVELISLNAVAGFMTGSAFNIIWGQ 239
           +P+    +TGPIIAT L F+CG+++T +G+LRLGFLVELISLNAVAGFMTGSAF+IIWGQ
Sbjct: 200 YPEGQTEVTGPIIATALCFLCGVVSTALGVLRLGFLVELISLNAVAGFMTGSAFSIIWGQ 259

Query: 240 IPGLMGYSKKVNTRRSTYHVVIDSLKHLPDTKLDAAFGLIPLFTLFFWKWWCNSMGPKLT 299
           IP LMGY+  VNTR +TY VVI++LKHLP+TKLDA FGLIPL  L+ WKWWC + G  L 
Sbjct: 260 IPALMGYNSLVNTREATYKVVINTLKHLPNTKLDAVFGLIPLVILYVWKWWCGTFGITLA 319

Query: 300 DRYFPANSRPRANKYWKAFYFYLQASRNGIIIILFTAVSYGITKGVAKDKRRISVLGTVP 359
           DRY+   ++P+     K+FYFY QA RN ++II+FTA+S+ IT+  +  +R IS+LGTVP
Sbjct: 320 DRYY--RNQPKIANRLKSFYFYAQAMRNAVVIIVFTAISWRITRNKSSKERPISILGTVP 377

Query: 360 KGLRHTGVMKLPHGILNNIAAEIPSSIIVLLLEHIAISKSFGRVNDYKINPNQEIIAIGV 419
            GL   GVMK+P G+L+N+++E+P+SIIVL+LEHIAISKSFGR+NDYK+ P+QE+IAIGV
Sbjct: 378 SGLNEVGVMKIPEGLLSNMSSELPASIIVLVLEHIAISKSFGRINDYKVIPDQELIAIGV 437

Query: 420 SNLLGTFFNAYPATGSFSRSALKAKCNVMTPLSGIFSAACVLLAIYCLTGAFFYIPKATL 479
           +NL+GTFF++YPATGSFSRSALKAKCNV TP SGIF+ ACVLLA+YCLT AFF+IPKATL
Sbjct: 438 TNLIGTFFHSYPATGSFSRSALKAKCNVRTPFSGIFTGACVLLALYCLTSAFFFIPKATL 497

Query: 480 SAVIIHAVFDLIASYHTTWSLWKMNVFDFIGFITTVFITVFSSIENGIYFAVCWSCAILL 539
           SAVIIHAV DL+ SY TTW  WK N  D I FI TVFITVFSSIENGIYFA+CWSCA+LL
Sbjct: 498 SAVIIHAVSDLLTSYKTTWIFWKTNPLDCISFIATVFITVFSSIENGIYFAMCWSCAMLL 557

Query: 540 YNNAFPAGKFLGRIEIAEVVNPKIVDDDDFSFENSNESFDDEGIYFDNSVAEDKLGTSSN 599
              AFPAGKFLGR+E+AEV+NP +                 EGI   N+V      TSSN
Sbjct: 558 LKQAFPAGKFLGRVEVAEVLNPTV----------------QEGI---NAV------TSSN 592

Query: 600 DL-KKFNAGVKTRSINGELVNGQTSSDIRYYTKWVPFDHAYSKELNPSVRITPPPPGVIV 658
           +L  + +  VK+       V+   + + ++  KW+PFDH YS+ELN   ++ PPPPGVIV
Sbjct: 593 ELPNELSKQVKST------VDVLPAPEYKFSVKWIPFDHDYSRELNRYTKVRPPPPGVIV 646

Query: 659 YRLSDSYTYINCSRHYDLIFDEIKRVTRRGQLIQHRHKWDRPWNDPGEWEAPDLXXXXXX 718
           YRL+DS+TY+NCSRHYD+IFD IK  TRRGQLI  R K DRPWNDPGEW+ P+       
Sbjct: 647 YRLADSFTYVNCSRHYDIIFDRIKEETRRGQLISLRKKSDRPWNDPGEWKMPNSFKALFK 706

Query: 719 XXXXXXXXXXXTDVDTFENENEIEHIHDGEHYKKNDKDERPLLRVVCLDFSQVANTDATA 778
                        V +  N  E                E+PLL+VVCLDFSQVA  D+TA
Sbjct: 707 FKRKSATTDNELPVSSGRNNQE--------------SYEKPLLKVVCLDFSQVAQVDSTA 752

Query: 779 LQSLADLRKAVNKYADRQVEFHFVGIYSPWIKRGLRNLGFGTTNEEYSDESIIAGHSSYH 838
           +QSL DLRKAVNKYADRQVEFHF GI SPWIKR L ++ FGTTNEEYSD+SIIAGHSS+H
Sbjct: 753 VQSLVDLRKAVNKYADRQVEFHFAGIISPWIKRSLLSVKFGTTNEEYSDDSIIAGHSSFH 812

Query: 839 LSRFRESEQDGFNELDSLESQRNIGSKTKVLAASGTNLPFFHVDIPDFSKWDI 891
           +++  + + D + E DS  S      +T + AA+GTNLPFFH+DIPDFSKWD+
Sbjct: 813 VAKVLKDDVD-YTEEDSRISTSYSNYET-LCAATGTNLPFFHIDIPDFSKWDV 863

>Suva_4.554 Chr4 (962125..964677) [2553 bp, 850 aa] {ON} YBR294W
           (REAL)
          Length = 850

 Score = 1045 bits (2701), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 521/900 (57%), Positives = 650/900 (72%), Gaps = 65/900 (7%)

Query: 1   MEELDNLELE-----YNQFKNNERPSNTNAGADIEK-GLDTKKYFERSITDNSTYGKKSY 54
           ++  +NL +E     Y+ ++ +E  +N +   + +   ++  + FE + T++S     SY
Sbjct: 7   LDNQENLNIEIFDSKYSSYRESEAAANRDDSHNEQSWKVNGNRKFEHTKTESSDV---SY 63

Query: 55  -SIPSYEEDTITLKDYYDTNLRDYFTWASVVDYIRSLFPVVNWLPFYNPKWFLSDLIAGI 113
            SIP YEE T+TLK+YY  ++++  T  S  +Y+ SLFP+V WLP YN  W  +DL+AGI
Sbjct: 64  DSIPRYEESTVTLKEYYGHSIKNSLTAKSAGNYVSSLFPIVKWLPHYNFTWCYADLVAGI 123

Query: 114 TVGTVLVPQSMSYAQIATLPPEYGLYSSFIGALVYSFFATSKDVCIGPVAVMSLQTAKVI 173
           TVG VLVPQSMSYAQIA+L PEYGLYSSF+GA +YS FATSKDVCIGPVAVMSLQTAKVI
Sbjct: 124 TVGCVLVPQSMSYAQIASLSPEYGLYSSFVGAFIYSLFATSKDVCIGPVAVMSLQTAKVI 183

Query: 174 ARVKEKHPDLDPSITGPIIATVLAFICGIIATGVGLLRLGFLVELISLNAVAGFMTGSAF 233
           A V +K+P     +TGPIIAT L  +CGI+ T +G+LRLGFLVELISLNAVAGFMTGSAF
Sbjct: 184 AEVLKKYPQDQTEVTGPIIATALCLLCGIVTTALGVLRLGFLVELISLNAVAGFMTGSAF 243

Query: 234 NIIWGQIPGLMGYSKKVNTRRSTYHVVIDSLKHLPDTKLDAAFGLIPLFTLFFWKWWCNS 293
           +IIWGQ+P LMGY+K VNTR STY VVI++LKHLP+TKLDA FGLIPL  L+ WKWWC +
Sbjct: 244 SIIWGQVPALMGYNKLVNTRESTYKVVINTLKHLPETKLDAVFGLIPLVILYVWKWWCGT 303

Query: 294 MGPKLTDRYFPANSRPRANKYWKAFYFYLQASRNGIIIILFTAVSYGITKGVAKDKRRIS 353
            G  L +R++   + P+     K+FYFY QA RN ++I++FTA+S+ IT+  A + R IS
Sbjct: 304 YGITLANRHY--QNHPKIANNLKSFYFYAQAMRNAVVIVVFTAISWSITRNKASEDRPIS 361

Query: 354 VLGTVPKGLRHTGVMKLPHGILNNIAAEIPSSIIVLLLEHIAISKSFGRVNDYKINPNQE 413
           +LGTVP GL   GVMK+P G+L+N+++E+P+SIIVL+LEHIAISKSFGR+NDYK+ P+QE
Sbjct: 362 ILGTVPSGLNEVGVMKIPEGLLSNMSSELPASIIVLVLEHIAISKSFGRINDYKVVPDQE 421

Query: 414 IIAIGVSNLLGTFFNAYPATGSFSRSALKAKCNVMTPLSGIFSAACVLLAIYCLTGAFFY 473
           +IAIGV+NL+GTFF++YPATGSFSRSALKAKCNV TP SG+F+  CVLLA+YCLT AFF+
Sbjct: 422 LIAIGVTNLVGTFFHSYPATGSFSRSALKAKCNVRTPFSGLFTGGCVLLALYCLTDAFFF 481

Query: 474 IPKATLSAVIIHAVFDLIASYHTTWSLWKMNVFDFIGFITTVFITVFSSIENGIYFAVCW 533
           IPKATLSAVIIHAV DL+ SY TTW+ WK N  D + FI TVFITVFSSIENGIYFA+CW
Sbjct: 482 IPKATLSAVIIHAVSDLLTSYETTWTFWKTNPLDCVSFIVTVFITVFSSIENGIYFAMCW 541

Query: 534 SCAILLYNNAFPAGKFLGRIEIAEVVNPKIVDDDDFSFENSNESFDDEGIYFDNSVAEDK 593
           SCAILL   AFPAG+FLGR+E+AE++NP +                       N+V    
Sbjct: 542 SCAILLLKQAFPAGRFLGRVEVAEILNPTL----------------------QNNV---- 575

Query: 594 LGTSSNDLKKFNAGVKTRSINGELVNGQTSSDIRYYTKWVPFDHAYSKELNPSVRITPPP 653
             ++   L + N  VKT       V+   SS+ R+ TKWVPFDH YS+ELN   +I PPP
Sbjct: 576 --SAVVSLNESNKQVKTT------VDVLRSSEYRFTTKWVPFDHEYSRELNRCAKICPPP 627

Query: 654 PGVIVYRLSDSYTYINCSRHYDLIFDEIKRVTRRGQLIQHRHKWDRPWNDPGEWEAPDLX 713
           PGVIVYRLSDS+TY+NCSRHYD+IFD +K  TRRGQL+  R K DRPWNDPGEW+ P   
Sbjct: 628 PGVIVYRLSDSFTYVNCSRHYDIIFDHVKEETRRGQLVNLRKKSDRPWNDPGEWKMPTSL 687

Query: 714 XXXXXXXXXXXXXXXXTDVDTFENENEIEHIHDGEHYKKNDKDERPLLRVVCLDFSQVAN 773
                                   ENE   + +G         E+PLL+V+CLDFSQVA 
Sbjct: 688 KTLFRFKRKSV------------TENEEPSVSNGS--TNRGSYEKPLLKVICLDFSQVAQ 733

Query: 774 TDATALQSLADLRKAVNKYADRQVEFHFVGIYSPWIKRGLRNLGFGTTNEEYSDESIIAG 833
            D+TA+QSL DLRKAVNKYADRQVEFHF GI SPWIKR L ++ FGT NEEYSDES+IAG
Sbjct: 734 VDSTAIQSLVDLRKAVNKYADRQVEFHFAGIISPWIKRSLSSVDFGTVNEEYSDESVIAG 793

Query: 834 HSSYHLSRFRESEQDGFNELDSLESQ--RNIGSKTKVLAASGTNLPFFHVDIPDFSKWDI 891
           HSS H+++F   +   + + +S  S    N G+   + AA+GTNLPFFH+DIPDFSKWDI
Sbjct: 794 HSSVHVTKFSSDDDADYTDEESHISAPYSNYGT---LCAATGTNLPFFHIDIPDFSKWDI 850

>YBR294W Chr2 (789235..791814) [2580 bp, 859 aa] {ON}  SUL1High
           affinity sulfate permease of the SulP anion transporter
           family; sulfate uptake is mediated by specific sulfate
           transporters Sul1p and Sul2p, which control the
           concentration of endogenous activated sulfate
           intermediates
          Length = 859

 Score = 1044 bits (2699), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 523/894 (58%), Positives = 643/894 (71%), Gaps = 56/894 (6%)

Query: 3   ELDNLELEYNQFKNNERPSNT----NAGADIEKGLDTKKYFERSITDNSTYGKKSYSIPS 58
           +++  E EY  ++ +E   N     N   +  K   +K+ F   +T N        SIP+
Sbjct: 17  DIEVFESEYRTYRESEAAENRDGLHNGDEENWKVNSSKQKF--GVTKNELSDVLYDSIPA 74

Query: 59  YEEDTITLKDYYDTNLRDYFTWASVVDYIRSLFPVVNWLPFYNPKWFLSDLIAGITVGTV 118
           YEE T+TLK+YYD ++++  T  S   Y+ SLFP++ W P YN  W  +DL+AGITVG V
Sbjct: 75  YEESTVTLKEYYDHSIKNNLTAKSAGSYLVSLFPIIKWFPHYNFTWGYADLVAGITVGCV 134

Query: 119 LVPQSMSYAQIATLPPEYGLYSSFIGALVYSFFATSKDVCIGPVAVMSLQTAKVIARVKE 178
           LVPQSMSYAQIA+L PEYGLYSSFIGA +YS FATSKDVCIGPVAVMSLQTAKVIA V +
Sbjct: 135 LVPQSMSYAQIASLSPEYGLYSSFIGAFIYSLFATSKDVCIGPVAVMSLQTAKVIAEVLK 194

Query: 179 KHPDLDPSITGPIIATVLAFICGIIATGVGLLRLGFLVELISLNAVAGFMTGSAFNIIWG 238
           K+P+    +T PIIAT L  +CGI+ATG+G+LRLGFLVELISLNAVAGFMTGSAFNIIWG
Sbjct: 195 KYPEDQTEVTAPIIATTLCLLCGIVATGLGILRLGFLVELISLNAVAGFMTGSAFNIIWG 254

Query: 239 QIPGLMGYSKKVNTRRSTYHVVIDSLKHLPDTKLDAAFGLIPLFTLFFWKWWCNSMGPKL 298
           QIP LMGY+  VNTR +TY VVI++LKHLP+TKLDA FGLIPL  L+ WKWWC + G  L
Sbjct: 255 QIPALMGYNSLVNTREATYKVVINTLKHLPNTKLDAVFGLIPLVILYVWKWWCGTFGITL 314

Query: 299 TDRYFPANSRPRANKYWKAFYFYLQASRNGIIIILFTAVSYGITKGVAKDKRRISVLGTV 358
            DRY+   ++P+     K+FYFY QA RN ++I++FTA+S+ IT+  +   R IS+LGTV
Sbjct: 315 ADRYY--RNQPKVANRLKSFYFYAQAMRNAVVIVVFTAISWSITRNKSSKDRPISILGTV 372

Query: 359 PKGLRHTGVMKLPHGILNNIAAEIPSSIIVLLLEHIAISKSFGRVNDYKINPNQEIIAIG 418
           P GL   GVMK+P G+L+N+++EIP+SIIVL+LEHIAISKSFGR+NDYK+ P+QE+IAIG
Sbjct: 373 PSGLNEVGVMKIPDGLLSNMSSEIPASIIVLVLEHIAISKSFGRINDYKVVPDQELIAIG 432

Query: 419 VSNLLGTFFNAYPATGSFSRSALKAKCNVMTPLSGIFSAACVLLAIYCLTGAFFYIPKAT 478
           V+NL+GTFF++YPATGSFSRSALKAKCNV TP SG+F+  CVLLA+YCLT AFF+IPKAT
Sbjct: 433 VTNLIGTFFHSYPATGSFSRSALKAKCNVRTPFSGVFTGGCVLLALYCLTDAFFFIPKAT 492

Query: 479 LSAVIIHAVFDLIASYHTTWSLWKMNVFDFIGFITTVFITVFSSIENGIYFAVCWSCAIL 538
           LSAVIIHAV DL+ SY TTW+ WK N  D I FI TVFITVFSSIENGIYFA+CWSCA+L
Sbjct: 493 LSAVIIHAVSDLLTSYKTTWTFWKTNPLDCISFIVTVFITVFSSIENGIYFAMCWSCAML 552

Query: 539 LYNNAFPAGKFLGRIEIAEVVNPKIVDDDDFSFENSNESFDDEGIYFDNSVAEDKLGTSS 598
           L   AFPAGKFLGR+E+AEV+NP + +D D                            SS
Sbjct: 553 LLKQAFPAGKFLGRVEVAEVLNPTVQEDIDAVI-------------------------SS 587

Query: 599 NDL-KKFNAGVKTRSINGELVNGQTSSDIRYYTKWVPFDHAYSKELNPSVRITPPPPGVI 657
           N+L  + N  VK+       V    + + ++  KWVPFDH YS+ELN +  + PPPPGVI
Sbjct: 588 NELPNELNKQVKST------VEVLPAPEYKFSVKWVPFDHGYSRELNINTTVRPPPPGVI 641

Query: 658 VYRLSDSYTYINCSRHYDLIFDEIKRVTRRGQLIQHRHKWDRPWNDPGEWEAPDLXXXXX 717
           VYRL DS+TY+NCSRHYD+IFD IK  TRRGQLI  R K DRPWNDPGEW+ PD      
Sbjct: 642 VYRLGDSFTYVNCSRHYDIIFDRIKEETRRGQLITLRKKSDRPWNDPGEWKMPDSLKSLF 701

Query: 718 XXXXXXXXXXXXTDVDTFENENEIEHIHDGEHYKKNDKDERPLLRVVCLDFSQVANTDAT 777
                         +    +        +GE Y      E+PLL+VVCLDFSQVA  D+T
Sbjct: 702 KFKRHSATTNSDLPISNGSS--------NGETY------EKPLLKVVCLDFSQVAQVDST 747

Query: 778 ALQSLADLRKAVNKYADRQVEFHFVGIYSPWIKRGLRNLGFGTTNEEYSDESIIAGHSSY 837
           A+QSL DLRKAVN+YADRQVEFHF GI SPWIKR L ++ FGTTNEEYSD+SIIAGHSS+
Sbjct: 748 AVQSLVDLRKAVNRYADRQVEFHFAGIISPWIKRSLLSVKFGTTNEEYSDDSIIAGHSSF 807

Query: 838 HLSRFRESEQDGFNELDSLESQRNIGSKTKVLAASGTNLPFFHVDIPDFSKWDI 891
           H+++  + + D + + DS  S      +T + AA+GTNLPFFH+DIPDFSKWD+
Sbjct: 808 HVAKVLKDDVD-YTDEDSRISTSYSNYET-LCAATGTNLPFFHIDIPDFSKWDV 859

>Kpol_543.43 s543 (93697..96297) [2601 bp, 866 aa] {ON}
           (93697..96297) [2601 nt, 867 aa]
          Length = 866

 Score = 1043 bits (2696), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 526/902 (58%), Positives = 665/902 (73%), Gaps = 71/902 (7%)

Query: 11  YNQFKNNERPSNTNAG--------ADIEKGL--DTKKYFERSI--TDNS------TYGKK 52
           YNQ+K  E   N++ G         +   GL  D+K  FE+ +  TD+S      ++   
Sbjct: 15  YNQYKTVEEQGNSDVGDSSGNDDLGNAGDGLTKDSKFVFEKDLGYTDDSNELTRESFLNS 74

Query: 53  SYSIPSYEEDTITLKDYYDTNLRDYFTWASVVDYIRSLFPVVNWLPFYNPKWFLSDLIAG 112
           S ++P Y E+T+TLK+YY+ ++R Y T+ S  +Y+ S+FP++ WLPFYN KW +SDLIAG
Sbjct: 75  SENVPRYIEETVTLKEYYNHSIRHYLTFKSFGNYLISIFPIIKWLPFYNYKWLISDLIAG 134

Query: 113 ITVGTVLVPQSMSYAQIATLPPEYGLYSSFIGALVYSFFATSKDVCIGPVAVMSLQTAKV 172
           IT+G VLVPQSMSYAQIATLPP+YGLYSSF+GA  YS FATSKDVCIGPVAVMSLQTAKV
Sbjct: 135 ITIGCVLVPQSMSYAQIATLPPQYGLYSSFVGAYTYSLFATSKDVCIGPVAVMSLQTAKV 194

Query: 173 IARVKEKHPDLDPS-ITGPIIATVLAFICGIIATGVGLLRLGFLVELISLNAVAGFMTGS 231
           I  V     +   + IT P+IAT LA +CGII+ GVGLLRLGFLVELISLNAV GFMTGS
Sbjct: 195 IQHVNSSLTEEQKTYITAPLIATTLALLCGIISAGVGLLRLGFLVELISLNAVTGFMTGS 254

Query: 232 AFNIIWGQIPGLMGYSKKVNTRRSTYHVVIDSLKHLPDTKLDAAFGLIPLFTLFFWKWWC 291
           A NII GQ+P LMGY+ +VNTR +TY V+I++LKHLPDTK+DA FGLIPL  L+FWKWW 
Sbjct: 255 ALNIISGQVPALMGYASEVNTREATYKVIINTLKHLPDTKIDAIFGLIPLVILYFWKWWF 314

Query: 292 NSMGPKLTDRYFPANSRPRANKYWKAFYFYLQASRNGIIIILFTAVSYGITKGVAKDKRR 351
           +SMGPKL DRY+P NS+ +  KY KAFYFY  A R+GIIII+ T++S+ +T+G +K +R 
Sbjct: 315 SSMGPKLVDRYYP-NSKYK--KYIKAFYFYGNAMRSGIIIIVMTSISWSVTRGKSKSERP 371

Query: 352 ISVLGTVPKGLRHTGVMKLPHGILNNIAAEIPSSIIVLLLEHIAISKSFGRVNDYKINPN 411
           IS+LGTVP GL+  GV   P+G+L  +A E+PSSIIVLLLEHIAI+KSFGRVNDYK+ P+
Sbjct: 372 ISILGTVPSGLQEVGVFTPPNGLLAKVAPELPSSIIVLLLEHIAIAKSFGRVNDYKVVPD 431

Query: 412 QEIIAIGVSNLLGTFFNAYPATGSFSRSALKAKCNVMTPLSGIFSAACVLLAIYCLTGAF 471
           QE+IAIG+SNL+GTFFN+YP TGSFSRSALKAKCNV TPLSGIF+ +CVLLA+YCLTGAF
Sbjct: 432 QELIAIGISNLIGTFFNSYPVTGSFSRSALKAKCNVKTPLSGIFTGSCVLLALYCLTGAF 491

Query: 472 FYIPKATLSAVIIHAVFDLIASYHTTWSLWKMNVFDFIGFITTVFITVFSSIENGIYFAV 531
           FYIPKATLSAVIIHAV DL+ASY TTWS WKMN  DFI FITTVFITVF+SIE+GIYF +
Sbjct: 492 FYIPKATLSAVIIHAVSDLVASYKTTWSFWKMNPLDFICFITTVFITVFASIEDGIYFTM 551

Query: 532 CWSCAILLYNNAFPAGKFLGRIEIAEVVNPKIVDDDDFSFENSNESFDDEGIYFDNSVAE 591
           CWS AILL+  AFPAGKFLG ++IAE+VNP+IVD D +  E +  S     +  +     
Sbjct: 552 CWSAAILLFKVAFPAGKFLGYVKIAEIVNPEIVDSD-YLVEKAETSVQYSTVLMN----- 605

Query: 592 DKLGTSSNDLKKFNAGVKTRSINGELVNGQTSSDIRYYTKWVPFDHAYSKELNPSVRITP 651
                              +     L +  + S ++Y+ KW+P+DHAY+KE+NP+V +TP
Sbjct: 606 -----------------PEKGELSYLSSKSSESQLKYHIKWIPYDHAYTKEMNPNVEVTP 648

Query: 652 PPPGVIVYRLSDSYTYINCSRHYDLIFDEIKRVTRRGQLIQHRHKWDRPWNDPGEWEAPD 711
           PP GVIVYRL++S+TYINCSR+Y+ ++D++K +TR GQL+ H  K DRPWNDPG+W+ P 
Sbjct: 649 PPDGVIVYRLTESFTYINCSRNYETLYDKVKELTRPGQLMTHIKKSDRPWNDPGDWKPPK 708

Query: 712 LXXXXXXXXXXXXXXXXXTDVDTFENENEIEHIHDGEHYKKNDK--DERPLLRVVCLDFS 769
                               ++  +N+N+     D E    ++K  D RP+L+++CLDFS
Sbjct: 709 FLKNI---------------INWRKNKNK-----DDEPTTFDNKVVDTRPILKIICLDFS 748

Query: 770 QVANTDATALQSLADLRKAVNKYADRQVEFHFVGIYSPWIKRGLRNLGFGTTNEEYSDES 829
           QVA TD+TALQSL DLR+A+NKYADRQVEFHF GI SPW+K+GL NLGFGT N+EYSDES
Sbjct: 749 QVAQTDSTALQSLLDLRRAINKYADRQVEFHFSGILSPWVKKGLVNLGFGTVNKEYSDES 808

Query: 830 IIAGHSSYHLSRFRESEQDGFNELDSLESQRNIGSKTKVLAASGTNLPFFHVDIPDFSKW 889
           II GH+SYH+ +  + E    N + ++E + N  S   + A +GTN PFFH++IPDFSKW
Sbjct: 809 IIIGHTSYHVVKTEDLEN---NPMTTVE-EPNQNSSYYIHAGTGTNFPFFHIEIPDFSKW 864

Query: 890 DI 891
           +I
Sbjct: 865 NI 866

>KAFR0B02750 Chr2 (562981..565485) [2505 bp, 834 aa] {ON} Anc_8.271
           YLR092W
          Length = 834

 Score = 1038 bits (2683), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 526/893 (58%), Positives = 642/893 (71%), Gaps = 78/893 (8%)

Query: 4   LDNLELEYNQFKNNE---RPSNTNAGADIEKGLDTKKYFERSITDNSTYGKKSYSIPSYE 60
           LD+LE E+NQ+K  E     +  N   D ++   + K  + S  D+     +   +P+YE
Sbjct: 15  LDDLEQEFNQYKKIELTISSTRQNEEVDSKRQGKSDKNVKSSSFDSIFSLTQQQQVPTYE 74

Query: 61  EDTITLKDYYDTNLRDYFTWASVVDYIRSLFPVVNWLPFYNPKWFLSDLIAGITVGTVLV 120
           E++IT+ DYY  +LR YFT+ ++ DYI+SLFP+ +WLP YN  WF+SDLIAGITVG VLV
Sbjct: 75  ENSITIADYYTYSLRPYFTFKTITDYIKSLFPIFHWLPHYNLTWFISDLIAGITVGCVLV 134

Query: 121 PQSMSYAQIATLPPEYGLYSSFIGALVYSFFATSKDVCIGPVAVMSLQTAKVIARVKEKH 180
           PQSMSYAQIATL P++GLYSSFIGA  YS FATSKDVCIGPVAVMSLQTAKVIARV++K 
Sbjct: 135 PQSMSYAQIATLSPQFGLYSSFIGAFSYSLFATSKDVCIGPVAVMSLQTAKVIARVQDKL 194

Query: 181 PDLDPSITGPIIATVLAFICGIIATGVGLLRLGFLVELISLNAVAGFMTGSAFNIIWGQI 240
           P  D  IT   IAT LA +CGIIATGVGLLRLGFLVELISLNAVAGFMTGSA NII GQ+
Sbjct: 195 PS-DTDITASEIATTLALLCGIIATGVGLLRLGFLVELISLNAVAGFMTGSALNIISGQV 253

Query: 241 PGLMGYSKKVNTRRSTYHVVIDSLKHLPDTKLDAAFGLIPLFTLFFWKWWCNSMGPKLTD 300
           PGLMGY+ +VNTR STY V+ID+LKHLPDTKLDA FGLIPLF LF WKW C+ +GP+L +
Sbjct: 254 PGLMGYNSEVNTRTSTYKVIIDTLKHLPDTKLDAVFGLIPLFLLFAWKWVCDVLGPRLNE 313

Query: 301 RYFPANSRPRANKYWKAFYFYLQASRNGIIIILFTAVSYGITKGVAKDKRRISVLGTVPK 360
           R+F     PRA++  K FYFY Q ++N IIII+FT +S+ IT+G   + R ISVLG+VPK
Sbjct: 314 RHFGNGKNPRAHRIMKNFYFYAQTTKNAIIIIVFTCISWAITRGKTSETRPISVLGSVPK 373

Query: 361 GLRHTGVMKLPHGILNNIAAEIPSSIIVLLLEHIAISKSFGRVNDYKINPNQEIIAIGVS 420
           GL+      +P G++  +A E+P+SIIVLLLEHIAI+KSFGR+NDYKI P+QEI+AIG++
Sbjct: 374 GLKDVETFTVPSGLMAKLAPELPASIIVLLLEHIAIAKSFGRINDYKIVPDQEIVAIGIT 433

Query: 421 NLLGTFFNAYPATGSFSRSALKAKCNVMTPLSGIFSAACVLLAIYCLTGAFFYIPKATLS 480
           NLLGTFF+AYPATGSFSRSALKAKCNV TPLSG+FS ACVLLA+YCLTGAFFYIPKATL 
Sbjct: 434 NLLGTFFHAYPATGSFSRSALKAKCNVRTPLSGLFSGACVLLALYCLTGAFFYIPKATLC 493

Query: 481 AVIIHAVFDLIASYHTTWSLWKMNVFDFIGFITTVFITVFSSIENGIYFAVCWSCAILLY 540
           AVIIHAV +LIASY  T + WKMN  D   F+ TV ITVF+SIE+GIYFA+CWS A+LL+
Sbjct: 494 AVIIHAVSNLIASYKATMNFWKMNPLDCFCFLVTVIITVFASIEDGIYFAMCWSVAVLLF 553

Query: 541 NNAFPAGKFLGRIEIAEVVNPKIVDDDDFSFENSNESFDDEGIYFDNSVAEDKLGTSSND 600
             AFP GKFLG+IEI EV++ K+V D      +S+E+                    S  
Sbjct: 554 KVAFPPGKFLGQIEITEVLDGKLVGDSSV-LTSSDEN--------------------SEI 592

Query: 601 LKKFNAGVKTRSINGELVNGQTSSDIRYYTKWVPFDHAYSKELNPSVRITPPPPGVIVYR 660
           L    AG     ++        + +  YYTKWVPFD +Y+KELNP   I PPPPGVIVYR
Sbjct: 593 LPTTKAGYSVEVVSNH------NENTNYYTKWVPFDFSYTKELNPDAHIKPPPPGVIVYR 646

Query: 661 LSDSYTYINCSRHYDLIFDEIKRVTRRGQLIQHRHKWDRPWNDPGEWEAPDLXXXXXXXX 720
           ++DS+TY+NCSRH+D++FDEIKR T+RG+L Q   K DRPWNDPG+WE P +        
Sbjct: 647 MADSFTYMNCSRHFDILFDEIKRSTKRGKLTQIMRKSDRPWNDPGKWE-PRVFIKKY--- 702

Query: 721 XXXXXXXXXTDVDTFENENEIEHIHDGEHYKKNDK--DERPLLRVVCLDFSQVANTDATA 778
                            EN     +D ++    D+  D+RP L+++CLDFSQV+  DATA
Sbjct: 703 --------------LRREN-----YDEDNVDIEDRVIDDRPFLKIICLDFSQVSQIDATA 743

Query: 779 LQSLADLRKAVNKYADRQVEFHFVGIYSPWIKRGLRNLGFGTTNEEYSDESIIAGHSSYH 838
           +Q L DLRK+VNKYADRQVEFHFVGI SPWIK+ LRN GFGT N EYSDESII GHSSYH
Sbjct: 744 IQCLYDLRKSVNKYADRQVEFHFVGIISPWIKKSLRNFGFGTINNEYSDESIIMGHSSYH 803

Query: 839 LSRFRESEQDGFNELDSLESQRNIGSKTKVLAASGTNLPFFHVDIPDFSKWDI 891
           L++    + DG                  + AA+GTNLPFFH+DIP+F+KWDI
Sbjct: 804 LTK----DVDG------------------IKAATGTNLPFFHIDIPNFNKWDI 834

>TPHA0J00800 Chr10 (186144..188897) [2754 bp, 917 aa] {ON} Anc_8.271
           YLR092W
          Length = 917

 Score = 1023 bits (2646), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 533/923 (57%), Positives = 645/923 (69%), Gaps = 70/923 (7%)

Query: 3   ELDNLELEYNQFKNNERPS-------NTNAGADIEKGLDTK-------KYFERSITDNST 48
           +L+ LE EY+Q+K  E          N++   +I    + K       K+ ++S    ST
Sbjct: 31  DLEALEEEYDQYKKEEEIEYISGNYLNSSPTQNINVTSNPKYEEYKKLKHLDQSYNYVST 90

Query: 49  -YGKKSYSIPSYEEDTITLKDYYDTNLRDYFTWASVVDYIRSLFPVVNWLPFYNPKWFLS 107
            Y    Y IP++ E+ IT K+YY+ +L++YFT+ +  +Y  S+FP+++WLPFYN  WF+S
Sbjct: 91  EYLDTDYLIPAHNENIITFKEYYNHSLKEYFTFNAAKNYALSIFPIIHWLPFYNFNWFIS 150

Query: 108 DLIAGITVGTVLVPQSMSYAQIATLPPEYGLYSSFIGALVYSFFATSKDVCIGPVAVMSL 167
           DLIAGIT+G VLVPQSMSYAQIATL P+YGLYSSFIGA VY+ FATSKDVCIGPVAVMSL
Sbjct: 151 DLIAGITIGCVLVPQSMSYAQIATLDPQYGLYSSFIGAFVYALFATSKDVCIGPVAVMSL 210

Query: 168 QTAKVIARVKEKHPDLDPSITGPIIATVLAFICGIIATGVGLLRLGFLVELISLNAVAGF 227
           +TAKVIA V   H   DP +TGPIIAT LA +CG IA  VG LRLGFLVELISLNAV GF
Sbjct: 211 ETAKVIADVSS-HFQNDPDVTGPIIATTLALLCGGIAAAVGFLRLGFLVELISLNAVTGF 269

Query: 228 MTGSAFNIIWGQIPGLMGYSKKVNTRRSTYHVVIDSLKHLPDTKLDAAFGLIPLFTLFFW 287
           MTGSAFNI+WGQ+PGLMGYSK VNTR++TY VVID+LKHLPDTKLDA FGLIPLF L+  
Sbjct: 270 MTGSAFNILWGQVPGLMGYSKLVNTRQATYKVVIDTLKHLPDTKLDAVFGLIPLFILYVV 329

Query: 288 KWWCNSMGPKLTDRYFPANSRPRANKYWKAFYFYLQASRNGIIIILFTAVSYGITKGVAK 347
           KWWC + G +L ++ F +N R R   Y K FYFY  A RN ++II+FTA+S+ IT+  + 
Sbjct: 330 KWWCTNYGLQLAEKQFSSNERYRF--YLKKFYFYTNAMRNAVVIIIFTAISWSITRNKSS 387

Query: 348 DKRRISVLGTVPKGLRHTGVMKLPHGILNNIAAEIPSSIIVLLLEHIAISKSFGRVNDYK 407
            +R I+VLGTVP GL+  GV K    I+  I  ++P+SIIVLLLEHIAI+KSFGR+NDYK
Sbjct: 388 SERPITVLGTVPSGLKDIGVFKPQTKIVQKIGPQLPASIIVLLLEHIAIAKSFGRINDYK 447

Query: 408 INPNQEIIAIGVSNLLGTFFNAYPATGSFSRSALKAKCNVMTPLSGIFSAACVLLAIYCL 467
           I P+QE+IAIG+SNL+GTFF+AYPATGSFSRSAL AKCNV TPLSGIF+  CVLLA+YCL
Sbjct: 448 IVPDQELIAIGISNLVGTFFSAYPATGSFSRSALNAKCNVKTPLSGIFTGGCVLLALYCL 507

Query: 468 TGAFFYIPKATLSAVIIHAVFDLIASYHTTWSLWKMNVFDFIGFITTVFITVFSSIENGI 527
           TGAFFYIPKATLSAVIIHAV DLIASY TT S W MN  D + F+ TV ITVFSSIENGI
Sbjct: 508 TGAFFYIPKATLSAVIIHAVSDLIASYQTTLSFWNMNPLDTLCFLVTVLITVFSSIENGI 567

Query: 528 YFAVCWSCAILLYNNAFPAGKFLGRIEIAEVVN--PKIVDDDDFSFENSNESFDDEGIYF 585
           YFA+C+SCA+ ++ +AFPAGKFLGRIEIAEV+N  PK    DDF  +N N     E   F
Sbjct: 568 YFAMCYSCALFIFRSAFPAGKFLGRIEIAEVINATPK----DDFQMDNFNGFETSEYNNF 623

Query: 586 DNSVAEDKLGTSSNDLKKFNAGVKTRSINGELVNGQTSSDIRYYTKWVPFDHAYSKELNP 645
               +  K   ++ +  K+N+   +++               +YTKWVPFDH Y+KELN 
Sbjct: 624 PADQSYGKFDIANKNTHKYNSPHCSKN---------------FYTKWVPFDHTYTKELNK 668

Query: 646 SVRITPPPPGVIVYRLSDSYTYINCSRHYDLIFDEIKRVTRRGQLIQHRHKWDRPWNDPG 705
            V I  PPPGVIVYRLSDS+ Y+NCSRH+D IFDE+KR T+RG+ I +  K  RPWNDPG
Sbjct: 669 DVEILEPPPGVIVYRLSDSFIYLNCSRHFDTIFDEVKRKTKRGKFIGNIKKSQRPWNDPG 728

Query: 706 EWEAP----------DLXXXXXXXXXXXXXXXXXTDVDTFENENEIEHIHDGEHYKKNDK 755
           EWEAP          +L                 TD+D   N             K  D 
Sbjct: 729 EWEAPTWMTKKFSIRNLFKRKQEAESNVPNEDASTDLDISNN-------------KDIDM 775

Query: 756 DERPLLRVVCLDFSQVANTDATALQSLADLRKAVNKYADRQVEFHFVGIYSPWIKRGLRN 815
           D RP+L+V+CLDFSQV+ TD TALQSL DLRK+VN YADRQVEFHF GI SPW+KRGL  
Sbjct: 776 DHRPVLQVICLDFSQVSQTDNTALQSLFDLRKSVNSYADRQVEFHFCGIISPWVKRGLIK 835

Query: 816 LGFGTTNEEYSDESIIAGHSSYHLSR---FRESEQDGFNELDSLESQRNIGSKT----KV 868
           LGFGT NE YSD S I GH SYH+ +   FR          D++ S  NI +K      +
Sbjct: 836 LGFGTVNEAYSDASTIVGHVSYHIVKNPTFRNKSFSSHTSEDTI-SDMNIEAKDYNNYSI 894

Query: 869 LAASGTNLPFFHVDIPDFSKWDI 891
            AASGTN PFFH+DIP+FSKWD+
Sbjct: 895 EAASGTNYPFFHIDIPNFSKWDV 917

>ZYRO0C01452g Chr3 complement(103175..105895) [2721 bp, 906 aa] {ON}
           similar to uniprot|P38359 Saccharomyces cerevisiae
           YBR294W SUL1 High affinity sulfate permease sulfate
           uptake is mediated by specific sulfate transporters
           Sul1p and Sul2p which control the concentration of
           endogenous activated sulfate intermediates and
           uniprot|Q12325 Saccharomyces cerevisiae YLR092W SUL2
          Length = 906

 Score = 1004 bits (2597), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 518/908 (57%), Positives = 643/908 (70%), Gaps = 51/908 (5%)

Query: 1   MEELDNLELEYNQFKNNERPSNTNAGADIEKGLDTKK----YFERSITD-NSTYGKKSY- 54
           +  LD+LE EY+Q+K  E         D E   D +K    Y E  +   NST G  +  
Sbjct: 33  VSNLDDLEQEYDQYKAAEDRERVVGRGDDEYDDDLRKGKVDYKETELEYWNSTNGTTNLL 92

Query: 55  ----SIPSYEEDTITLKDYYDTNLRDYFTWASVVDYIRSLFPVVNWLPFYNPKWFLSDLI 110
               ++PSYEE  +   D +  +L+D  T  +V  Y  S FP++ WLPFYN KW  +DL+
Sbjct: 93  APKATVPSYEEGQVGPFDIFYHDLKDRMTLGAVKHYFESAFPIIKWLPFYNWKWGYADLV 152

Query: 111 AGITVGTVLVPQSMSYAQIATLPPEYGLYSSFIGALVYSFFATSKDVCIGPVAVMSLQTA 170
           AGITVG VLVPQSMSYAQIATLPP+YGLYSSF+GA +YSFFATSKDVCIGPVAVMSL+TA
Sbjct: 153 AGITVGCVLVPQSMSYAQIATLPPQYGLYSSFVGAFIYSFFATSKDVCIGPVAVMSLETA 212

Query: 171 KVIARVKEKHPDLDPSITGPIIATVLAFICGIIATGVGLLRLGFLVELISLNAVAGFMTG 230
           KVI    EK P  D  +TGP+IAT LA +CGI+A G G+LRLGFLVELISLNAVAGFMTG
Sbjct: 213 KVIQETLEKFPKEDHEVTGPLIATALALLCGIVAMGAGVLRLGFLVELISLNAVAGFMTG 272

Query: 231 SAFNIIWGQIPGLMGYSKKVNTRRSTYHVVIDSLKHLPDTKLDAAFGLIPLFTLFFWKWW 290
           S+ NII GQ+P LMG+ K V+TR STY ++I+SLK+L  T+LDA FGLIPL  L+ WKWW
Sbjct: 273 SSLNIISGQVPALMGFKKYVHTRDSTYKIIINSLKNLKHTQLDAVFGLIPLVLLYTWKWW 332

Query: 291 CNSMGPKLTDRYFPANSRPRANKYWKAFYFYLQASRNGIIIILFTAVSYGITKGVAKDKR 350
           C+S GPKL DR+F  N  P+     K FYFY QA R+ +III+FTA+SYGITKG  +   
Sbjct: 333 CSSYGPKLADRHFKNN--PKKRDILKTFYFYAQAMRSAVIIIVFTAISYGITKG--RKTP 388

Query: 351 RISVLGTVPKGLRHTGVMKLPHGILNNIAAEIPSSIIVLLLEHIAISKSFGRVNDYKINP 410
           RISVLG VPKGL+   VM++P G+L+ + + IPS+II+LLLEHI+I+KSFGRVN+YK+ P
Sbjct: 389 RISVLGKVPKGLKDVHVMRIPEGLLSKMGSSIPSAIIILLLEHISIAKSFGRVNNYKVVP 448

Query: 411 NQEIIAIGVSNLLGTFFNAYPATGSFSRSALKAKCNVMTPLSGIFSAACVLLAIYCLTGA 470
           +QE+IAIG +NL+GTFFNAYPATGSFSRSALKAKCNV TPLSG+FS ACVLLA+YCLT  
Sbjct: 449 DQELIAIGATNLIGTFFNAYPATGSFSRSALKAKCNVRTPLSGVFSGACVLLALYCLTQT 508

Query: 471 FFYIPKATLSAVIIHAVFDLIASYHTTWSLWKMNVFDFIGFITTVFITVFSSIENGIYFA 530
           F+YIP ATLSAVIIHAV DL ASY T+W+ +KMN  DFI FI TVFITVFSSI+ GIYFA
Sbjct: 509 FYYIPSATLSAVIIHAVSDLCASYKTSWNFYKMNPGDFIAFIVTVFITVFSSIDYGIYFA 568

Query: 531 VCWSCAILLYNNAFPAGKFLGRIEIAEVVNPKIVDDDDFSFENSNESFDDEGIYFDNSVA 590
           +CWS A+ L  N F  G+FLGR+E+AEVVN ++    D + E+ +ES    G + D   A
Sbjct: 569 MCWSAAMFLLKNMFAPGRFLGRVEVAEVVNAQV----DPNVESVSES---AGSHLDGFQA 621

Query: 591 EDKLGTSSNDLKKFN-AGVKTRSING------ELVNGQTSSDIRYYTKWVPFDHAYSKEL 643
           +  + +SS  L   + + V +  +NG        +N Q    + Y+TKW+ +D +YS+E 
Sbjct: 622 QSSIESSSKKLDPLDKSAVHSNYLNGGDDGSDNNINNQIGQKLVYHTKWISYDRSYSREF 681

Query: 644 NPSVRITPPPPGVIVYRLSDSYTYINCSRHYDLIFDEIKRVTRRGQLIQHRHKWDRPWND 703
           NP V I PPPPGVIVYR  DSYTY+NCSRHYD+I+DE++R TRRGQ+I    K DRPWND
Sbjct: 682 NPEVPIQPPPPGVIVYRFGDSYTYLNCSRHYDIIYDEVRRTTRRGQMISAVKKVDRPWND 741

Query: 704 PGEWEAPDLXXXXXXXXXXXXXXXXXTDVDTFENENEIEHIHDGEHYKKNDKDERPLLRV 763
           PGEWEAP                   +   T E   E E   + +  ++  +D RPLL++
Sbjct: 742 PGEWEAPRW------------FKKLTSKKKTAEEWAETE-AQESKAAEQKLQDNRPLLKI 788

Query: 764 VCLDFSQVANTDATALQSLADLRKAVNKYADRQVEFHFVGIYSPWIKRGLRNLGFGTTNE 823
           +CLDFSQ + TDATA+Q+L DLRK VN+YADRQVEFH  G+Y+PW+KR L N GFGT NE
Sbjct: 789 ICLDFSQCSQTDATAIQNLTDLRKQVNRYADRQVEFHICGLYAPWVKRALVNFGFGTVNE 848

Query: 824 EYSDESIIAGHSSYHLSRFRESEQDGFNELDSLESQRNIGSKTKVLAASGTNLPFFHVDI 883
           EYSDES++AGH SYH++R   S +DG              ++  V  ASGTNLPFFHV+I
Sbjct: 849 EYSDESLLAGHRSYHVARAPTSLEDGLGS----------PAQYSVYPASGTNLPFFHVEI 898

Query: 884 PDFSKWDI 891
           PDFSKWD+
Sbjct: 899 PDFSKWDL 906

>SAKL0H16830g Chr8 complement(1479446..1482034) [2589 bp, 862 aa]
           {ON} similar to uniprot|Q12325 Saccharomyces cerevisiae
           YLR092W SUL2 High affinity sulfate permease sulfate
           uptake is mediated by specific sulfate transporters
           Sul1p and Sul2p which control the concentration of
           endogenous activated sulfate intermediates and
           uniprot|P38359 Saccharomyces cerevisiae YBR294W SUL1
          Length = 862

 Score = 1002 bits (2590), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 510/898 (56%), Positives = 645/898 (71%), Gaps = 72/898 (8%)

Query: 4   LDNLELEYNQFKNNERPSNTNAGADIEKGL-------DTKKYFERSITDNSTYGKKSYS- 55
           LD+LE EY+ +KN E+  N    +D+ + L       D K       T    YG  S   
Sbjct: 27  LDDLEAEYDNYKNAEQ--NPREKSDVVETLPPTTHQNDAKGLKNDGQTTVELYGTTSSGG 84

Query: 56  -IPSYEEDTITLKDYYDTNLRDYFTWASVVDYIRSLFPVVNWLPFYNPKWFLSDLIAGIT 114
            IP Y EDT+  KDYYD +L    +++S  +Y+ SLFPV+ W+P YN  W   D++AG+T
Sbjct: 85  VIPGYHEDTVNFKDYYDQSLSSNISFSSFREYLISLFPVIRWIPHYNFAWMYGDVVAGVT 144

Query: 115 VGTVLVPQSMSYAQIATLPPEYGLYSSFIGALVYSFFATSKDVCIGPVAVMSLQTAKVIA 174
           VG VLVPQSMSYAQIA+LP +YGLYSSFIGA +YSFFATSKDVCIGPVAVMSL+TAKVIA
Sbjct: 145 VGCVLVPQSMSYAQIASLPAQYGLYSSFIGAFIYSFFATSKDVCIGPVAVMSLETAKVIA 204

Query: 175 RVKEKHPDLDPSITGPIIATVLAFICGIIATGVGLLRLGFLVELISLNAVAGFMTGSAFN 234
           RV E  PD D  ITGPIIAT L+ +CG I  G+G+LRLGFLVELISLNAVAGFMTGSAF+
Sbjct: 205 RVTEHLPD-DTEITGPIIATALSLLCGAITLGIGVLRLGFLVELISLNAVAGFMTGSAFS 263

Query: 235 IIWGQIPGLMGYSKKVNTRRSTYHVVIDSLKHLPDTKLDAAFGLIPLFTLFFWKWWCNSM 294
           II GQ+P LMGY++KVNTR +TY VVI++LKHLPDTKLDA FGLIPL  L+ WK+ CN++
Sbjct: 264 IITGQLPALMGYNEKVNTRDTTYKVVINTLKHLPDTKLDAVFGLIPLLILYLWKYGCNTI 323

Query: 295 GPKLTDRYFPANSRPRANKYWKAFYFYLQASRNGIIIILFTAVSYGITKGVAKDKRRISV 354
           GP   DR    +S PRA K+WK+F+FY QA RN  +I+LFT +++GIT+   K K  IS+
Sbjct: 324 GPNWVDRRMNPHS-PRA-KFWKSFFFYAQALRNAFVIVLFTLIAWGITR--HKKKHPISL 379

Query: 355 LGTVPKGLRHTGVMKLPHGILNNIAAEIPSSIIVLLLEHIAISKSFGRVNDYKINPNQEI 414
           L TVP GL++ GVMK P  +  N+A E+P++ I+LLLEHIAI+K+FGR+NDYK+ P+QE+
Sbjct: 380 LNTVPSGLKNVGVMKFPDHLATNLAPELPAAAIILLLEHIAIAKAFGRINDYKVVPDQEL 439

Query: 415 IAIGVSNLLGTFFNAYPATGSFSRSALKAKCNVMTPLSGIFSAACVLLAIYCLTGAFFYI 474
           IAIGV+NL+GTFFNAYPATGSFSRSALKAKCNV TPLSG+F+ ACVLLA+YCLT AF+YI
Sbjct: 440 IAIGVTNLVGTFFNAYPATGSFSRSALKAKCNVRTPLSGVFTGACVLLALYCLTEAFYYI 499

Query: 475 PKATLSAVIIHAVFDLIASYHTTWSLWKMNVFDFIGFITTVFITVFSSIENGIYFAVCWS 534
           PKATLSAVIIHAV DLIASY TTW+ WKMN  D + F+ TVFIT+FSSIENGIYFA+CWS
Sbjct: 500 PKATLSAVIIHAVSDLIASYETTWNFWKMNPLDCLCFLVTVFITIFSSIENGIYFAICWS 559

Query: 535 CAILLYNNAFPAGKFLGRIEIAEVVNPKIVDDDDFSFENSNESFDDEGIYFDNSVAEDKL 594
           CAILL+  AFP+GKFLGR+E++EV+NP + +D         E FD E I   +S  + KL
Sbjct: 560 CAILLFKIAFPSGKFLGRVEVSEVINPTVREDLGVV-----EDFDSENINVASS-TKPKL 613

Query: 595 GTSSNDLKKFNAGVKTRSINGELVNGQTSSDIRYYTKWVPFDHAYSKELNPSVRITPPPP 654
           G S++     N+ + T             S +R++TKW+P ++ Y +E N  + + PPPP
Sbjct: 614 GLSAD-----NSSIST-----------GPSRVRFHTKWIPLENNYGREYNSGIVVQPPPP 657

Query: 655 GVIVYRLSDSYTYINCSRHYDLIFDEIKRVTRRGQLIQHRHKWDRPWNDPGEWEAPDLXX 714
           GVIVYR S+S+TYINCSR YD+IFDE+KR+TRRG ++ H  K DRPWNDPG+WE P    
Sbjct: 658 GVIVYRPSESWTYINCSRQYDIIFDEVKRLTRRGIVLAHTKKSDRPWNDPGQWEPPLFLK 717

Query: 715 XXXXXXXXXXXXXXXTDVDTFENENEIEHIHDGEHYKKNDKDERPLLRVVCLDFSQVANT 774
                               F+    +E     E   +  +DERP+L+++ +D+SQV   
Sbjct: 718 ------------------KLFKRGKRLEQ----ELSPELGRDERPVLKILAMDWSQVTQI 755

Query: 775 DATALQSLADLRKAVNKYADRQVEFHFVGIYSPWIKRGLRNLGFGTTNEEYSDESIIAGH 834
           DAT +Q+L DLRKA+NKYADRQVEFHF GI SPWIKR L  +GFGT N+E++DES+I GH
Sbjct: 756 DATGVQNLVDLRKAINKYADRQVEFHFSGIISPWIKRALVAVGFGTVNDEFADESLILGH 815

Query: 835 SSYHLSRFRESEQDGFNELDSLESQRNIGS-KTKVLAASGTNLPFFHVDIPDFSKWDI 891
           SSYH+ + R  ++           + +IG  +  + AASGTN+PFFHV++PDFSKW +
Sbjct: 816 SSYHIVKTRPQDE-----------ENHIGQGRYNISAASGTNMPFFHVEMPDFSKWSL 862

>TPHA0A01760 Chr1 complement(356771..359452) [2682 bp, 893 aa] {ON}
           Anc_8.271 YLR092W
          Length = 893

 Score =  981 bits (2537), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 494/898 (55%), Positives = 636/898 (70%), Gaps = 23/898 (2%)

Query: 3   ELDNLELEYNQFKNNERPSNTNAGADIEKGLDTKKYFERSITDNSTYGK----KSYSIPS 58
           +L+  ELEY+  K  +   +     D+   +D +   E +   ++  G+     S SIP 
Sbjct: 10  DLERFELEYDHGKRGDDTHDRVEARDLYSKVDIE---EVTFQCDNYSGRLDVNSSLSIPM 66

Query: 59  YEEDTITLKDYYDTNLRDYFTWASVVDYIRSLFPVVNWLPFYNPKWFLSDLIAGITVGTV 118
           Y E  +T+KD+Y   + DYF+   +V Y+ SLFP++ WLP YN  W + DLIAGITVG V
Sbjct: 67  YNEKPVTIKDFYYEKINDYFSIGEIVQYLTSLFPLLKWLPHYNLDWLIQDLIAGITVGCV 126

Query: 119 LVPQSMSYAQIATLPPEYGLYSSFIGALVYSFFATSKDVCIGPVAVMSLQTAKVIARVKE 178
           LVPQSMSYAQIATL P+YGLYSSFIGA +YSFFATSKDVCIGPVAVMSLQTAKVI RV  
Sbjct: 127 LVPQSMSYAQIATLAPQYGLYSSFIGAFIYSFFATSKDVCIGPVAVMSLQTAKVIERVTS 186

Query: 179 KHPDLDPSI-TGPIIATVLAFICGIIATGVGLLRLGFLVELISLNAVAGFMTGSAFNIIW 237
                + +I T PIIAT LA +CGII+TG+G LRLGFL+E ISLNAVAGFMTGSAFNII 
Sbjct: 187 GLTADEQTIYTAPIIATALALLCGIISTGIGFLRLGFLIEFISLNAVAGFMTGSAFNIIC 246

Query: 238 GQIPGLMGYSKKVNTRRSTYHVVIDSLKHLPDTKLDAAFGLIPLFTLFFWKWWCNSMGP- 296
           GQ+P LMGY+KKVNTR STY VVI++LKHLPDTKLDA FGLIPL  L+  KW+ +S+GP 
Sbjct: 247 GQVPALMGYNKKVNTRASTYEVVINTLKHLPDTKLDAVFGLIPLSILYLCKWFFSSLGPQ 306

Query: 297 ---KLTDRYFPANSRPRANKYWKAFYFYLQASRNGIIIILFTAVSYGITKGVAKDKRRIS 353
              KL++R      + +  KY   ++FY  A RNG++II+FTA+S+ IT+G +     IS
Sbjct: 307 YLNKLSNRRNLTERQRKIIKYLGNYFFYSNAMRNGVVIIVFTAISWAITRGKSSTSVPIS 366

Query: 354 VLGTVPKGLRHTGVMKLPHGILNNIAAEIPSSIIVLLLEHIAISKSFGRVNDYKINPNQE 413
           +LGTVPKGL+   V K+P G+   +A ++PSSII+LLLEHIAISKSFGRVNDYKI P+QE
Sbjct: 367 ILGTVPKGLKEVAVFKVPGGLFEKLAPDLPSSIIILLLEHIAISKSFGRVNDYKIVPDQE 426

Query: 414 IIAIGVSNLLGTFFNAYPATGSFSRSALKAKCNVMTPLSGIFSAACVLLAIYCLTGAFFY 473
           +IAIGV+NL+GTFF AYPATGSFSRSALKAKC+V TPLSG+FS ACVLLA+YCLTGAF+Y
Sbjct: 427 LIAIGVTNLIGTFFMAYPATGSFSRSALKAKCDVKTPLSGLFSGACVLLALYCLTGAFYY 486

Query: 474 IPKATLSAVIIHAVFDLIASYHTTWSLWKMNVFDFIGFITTVFITVFSSIENGIYFAVCW 533
           IPKATLSAVIIHAV DL+ASY TT + +KMN  DF+ FITTVFITVFSSIE GIYFA+C+
Sbjct: 487 IPKATLSAVIIHAVSDLLASYKTTLNFYKMNPLDFVCFITTVFITVFSSIEYGIYFAICF 546

Query: 534 SCAILLYNNAFPAGKFLGRIEIAEVVNPKIVDDDDFSFENSNESFDDEGIYFDNSVAEDK 593
           SCA L++ N FP G FLG I+IAEV+NP +  +D     + + S   E    D+SV +++
Sbjct: 547 SCAQLIFKNMFPVGSFLGYIKIAEVLNPTLSTNDYTILLDDSSSVLGEENTKDDSV-KNR 605

Query: 594 LGTSSNDLKKFNAGVKTRSINGELVNGQTSSDIRYYTKWVPFDHAYSKELNPSVRITPPP 653
           L  + N         + +S   E+ +   ++++ YY +WVP  + Y +E+NP ++ITPPP
Sbjct: 606 LDQNENPKSSEKEYSEFKSY--EMSSNSKTTNLSYYVRWVPMKNDYHREVNPLIKITPPP 663

Query: 654 PGVIVYRLSDSYTYINCSRHYDLIFDEIKRVTRRGQLIQHRHKWDRPWNDPGEWEAPDLX 713
           PG+IVYR  DS+TY+NCSRHYD+I+DE+K+ TR+G    ++ K DRPWND GEWE P   
Sbjct: 664 PGIIVYRFGDSFTYLNCSRHYDIIYDEVKKNTRKGISNVYKRKQDRPWNDVGEWECPK-- 721

Query: 714 XXXXXXXXXXXXXXXXTDVDTFENENEIEHIHDGEHYKKNDKDERPLLRVVCLDFSQVAN 773
                           TD+   E+++  E I      K N+ D +P L+++C DFSQV  
Sbjct: 722 ----SLKNLFNKFKKKTDIGGDEDKDGNEAIESNS--KANNTDNKPELKIICFDFSQVVQ 775

Query: 774 TDATALQSLADLRKAVNKYADRQVEFHFVGIYSPWIKRGLRNLGFGTTNEEYSDESIIAG 833
           TDATA+QSL DLRKAVN+Y+++Q+E+HF GI S W+K+ L  +GFGT N+ YSD+SII G
Sbjct: 776 TDATAIQSLNDLRKAVNRYSNKQIEYHFSGIISAWVKKSLIEMGFGTVNDNYSDKSIIIG 835

Query: 834 HSSYHLSRFRESEQDGFNELDSLESQRNIGSKTKVLAASGTNLPFFHVDIPDFSKWDI 891
           H SYH+S+    E    N+++    Q +      +   +GTN PFFH+DIPDFS W++
Sbjct: 836 HQSYHVSKINNQEDGLENQINEKYLQPDGSYIYHIQTVTGTNYPFFHIDIPDFSNWEL 893

>KLLA0F19338g Chr6 (1789536..1792211) [2676 bp, 891 aa] {ON} similar
           to uniprot|P38359 Saccharomyces cerevisiae YBR294W SUL1
           High affinity sulfate permease sulfate uptake is
           mediated by specific sulfate transporters Sul1p and
           Sul2p which control the concentration of endogenous
           activated sulfate intermediates and uniprot|Q12325
           Saccharomyces cerevisiae YLR092W SUL2
          Length = 891

 Score =  971 bits (2511), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 499/915 (54%), Positives = 630/915 (68%), Gaps = 79/915 (8%)

Query: 3   ELDNLELEYNQFKNNE--RPSNTNAGADIEKGLDTKKYFER---SITDNSTYGKK----- 52
           + D LE EY+  K +E   P  +N  +          Y +R   SI D +T+G K     
Sbjct: 30  DFDQLEQEYDDLKTSEIIAPHISNGHSISSSPRHHHLYEDRHLDSIIDTNTHGFKKHDNG 89

Query: 53  ----------------SYSIPSYEEDTITLKDYYDTNLRDYFTWASVVDYIRSLFPVVNW 96
                           S  +P+YEE  +  K  YD  LR Y T++++V+Y+ SLFP++ W
Sbjct: 90  NGKFADVNIEQIYNYDSLRVPNYEETVVDAKQLYDEKLRPYLTFSAIVEYLTSLFPLLKW 149

Query: 97  LPFYNPKWFLSDLIAGITVGTVLVPQSMSYAQIATLPPEYGLYSSFIGALVYSFFATSKD 156
           +  YN  W  +DL+AGITVG VLVPQSMSYAQIATLP +YGLYSSF+GA +YSFFATSKD
Sbjct: 150 VHHYNFNWLYNDLVAGITVGCVLVPQSMSYAQIATLPAQYGLYSSFVGAFIYSFFATSKD 209

Query: 157 VCIGPVAVMSLQTAKVIARVKEKHPDLDPSITGPIIATVLAFICGIIATGVGLLRLGFLV 216
           VCIGPVAVMSL+TAKVIARV EK  + +P IT PIIAT L+ ICG +A GVGLLRLGFLV
Sbjct: 210 VCIGPVAVMSLETAKVIARVLEKVGEDNPEITAPIIATTLSLICGGVALGVGLLRLGFLV 269

Query: 217 ELISLNAVAGFMTGSAFNIIWGQIPGLMGYSKKVNTRRSTYHVVIDSLKHLPDTKLDAAF 276
           E ISLNAVAGFMTGSA NI+ GQ+PGLMGYSK VNTR STY V+I++LKHLPDTKLDA F
Sbjct: 270 EFISLNAVAGFMTGSAINIMSGQVPGLMGYSKNVNTRDSTYKVIINTLKHLPDTKLDAVF 329

Query: 277 GLIPLFTLFFWKWWCNSMGPKLTDRYFPANSRPRANKYWKAFYFYLQASRNGIIIILFTA 336
           GLIPLF L+ WK++C ++GPKL DRY   +   RA  Y K   FYLQA RN  +II+FT 
Sbjct: 330 GLIPLFILYSWKYFCGTLGPKLVDRYVARSDVKRAAAY-KYILFYLQALRNAFVIIIFTL 388

Query: 337 VSYGITKGVAKDKRRISVLGTVPKGLRHTGVMKLPHGILNNIAAEIPSSIIVLLLEHIAI 396
           +S+GIT+  AK+   IS+LGTVP GL++ GVMKLP G+++N+A+E+PS+II+L+LEHIAI
Sbjct: 389 ISWGITRHKAKEDLPISLLGTVPSGLKNVGVMKLPDGLVSNLASELPSAIIILVLEHIAI 448

Query: 397 SKSFGRVNDYKINPNQEIIAIGVSNLLGTFFNAYPATGSFSRSALKAKCNVMTPLSGIFS 456
           SK+FGRVN YK+ P+QE+IAIGV+NL+ TFFNAYPATGSFSRSALKAKCNV TPLSGIF+
Sbjct: 449 SKAFGRVNGYKVVPDQELIAIGVTNLISTFFNAYPATGSFSRSALKAKCNVKTPLSGIFT 508

Query: 457 AACVLLAIYCLTGAFFYIPKATLSAVIIHAVFDLIASYHTTWSLWKMNVFDFIGFITTVF 516
            ACVLL++YCLT AF++IPKA LSA+IIHAV DL+ASY TTW+ W MN  DF+ FI TV 
Sbjct: 509 GACVLLSLYCLTDAFYFIPKAALSAIIIHAVSDLVASYKTTWNFWLMNPLDFVCFIVTVI 568

Query: 517 ITVFSSIENGIYFAVCWSCAILLYNNAFPAGKFLGRIEIAEVVNPKIVDDDDFSFENSNE 576
           IT+FSSIENGIYFAVCWSCA+LL    FP G+FLG +EI +V N ++             
Sbjct: 569 ITIFSSIENGIYFAVCWSCALLLLKVVFPTGQFLGYVEICQVSNAEV------------- 615

Query: 577 SFDDEGIYFDNSVAEDKLGTSSNDLKKFNAGVKTRSINGELVNGQTSSDIRYYTKWVPFD 636
              DE I       + +  T  +++ K N  VK   +  E       S ++Y+TKW+P +
Sbjct: 616 ---DENIDRIVLSEDSQPKTIEDNVTKNNTAVKVGVVANESFG---HSQLQYHTKWLPLN 669

Query: 637 HAYSKELNPSVRITPPPPGVIVYRLSDSYTYINCSRHYDLIFDEIKRVTRRGQLIQHRHK 696
           + Y +ELNP V +  PPPGVIVYR S+S+TY+NCSR YD IFD +K +TR G+L++H  K
Sbjct: 670 NHYQRELNPDVVVQAPPPGVIVYRPSESWTYVNCSRQYDTIFDRVKELTRPGKLLKHVSK 729

Query: 697 WDRPWNDPGEWEAPDLXXXXXXXXXXXXXXXXXTDVDTFENENEIEHIHDGEHYKKNDKD 756
            D+ WNDPGEWE P L                   +    N++++E    GE       D
Sbjct: 730 HDKMWNDPGEWEPPFL----------------VKKLFKLGNKHDLE---GGEVI-----D 765

Query: 757 ERPLLRVVCLDFSQVANTDATALQSLADLRKAVNKYADRQVEFHFVGIYSPWIKRGLRNL 816
           ERP+L+++ +D+SQV   D+T +Q+L DLRKA+NKYA+RQVEFHF GI SPWIKR L N 
Sbjct: 766 ERPVLKILAMDWSQVTQIDSTGVQNLVDLRKAINKYANRQVEFHFSGIISPWIKRSLINA 825

Query: 817 GFGTTNEEYSDESIIAGHSSYHLSRFRESEQDGFNELDSLESQRNIGSKTKVLAASGTNL 876
           GFGT NEE+SDESII GH+SY L + R   QD          +  +     +  A G NL
Sbjct: 826 GFGTVNEEFSDESIIVGHTSYSLVKNRPDLQD---------PEAALPEPIALHTALGVNL 876

Query: 877 PFFHVDIPDFSKWDI 891
           PFFH+++P+F KW +
Sbjct: 877 PFFHLEMPEFHKWHL 891

>KLTH0G13486g Chr7 complement(1156678..1159386) [2709 bp, 902 aa]
           {ON} similar to uniprot|Q12325 Saccharomyces cerevisiae
           YLR092W SUL2 High affinity sulfate permease sulfate
           uptake is mediated by specific sulfate transporters
           Sul1p and Sul2p which control the concentration of
           endogenous activated sulfate intermediates and
           uniprot|P38359 Saccharomyces cerevisiae YBR294W SUL1
          Length = 902

 Score =  967 bits (2499), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 496/917 (54%), Positives = 626/917 (68%), Gaps = 75/917 (8%)

Query: 3   ELDNLELEYNQFKNNERPSNTNAGADIEKGLDTKKYFERSITDN---------------- 46
           +LD+L+ EY QFKN E  S+  AG D+      +   E                      
Sbjct: 29  DLDDLDAEYGQFKNAEH-SDATAGRDLTSEYGAQFAAEFGGEPGSGSGSGSGFPEAKPVA 87

Query: 47  -STYGKKSYSIPSYEEDTITLKDYYDTNLRDYFTWASVVDYIRSLFPVVNWLPFYNPKWF 105
            +  G    ++  + E  +T+ ++Y  NLR  FT A+  +Y+RSL P++ WLP YN +W 
Sbjct: 88  PAAPGNVPSALYEFHERPVTVGEFYSQNLRSTFTLATFTNYLRSLLPIMRWLPHYNARWL 147

Query: 106 LSDLIAGITVGTVLVPQSMSYAQIATLPPEYGLYSSFIGALVYSFFATSKDVCIGPVAVM 165
             DL+AGITVG VLVPQSMSYAQIATL P+YGLYSSF+GA +YSFFATSKDVCIGPVAVM
Sbjct: 148 YQDLVAGITVGCVLVPQSMSYAQIATLSPQYGLYSSFVGAFIYSFFATSKDVCIGPVAVM 207

Query: 166 SLQTAKVIARVKEKHPDLDPSITGPIIATVLAFICGIIATGVGLLRLGFLVELISLNAVA 225
           SLQTAK I+ V    P+ D  IT P+IAT LA +CGII+ G+G+LRLGFLVELIS  AVA
Sbjct: 208 SLQTAKAISHVVSSLPE-DTEITSPMIATALALLCGIISLGLGVLRLGFLVELISSTAVA 266

Query: 226 GFMTGSAFNIIWGQIPGLMGYSKKVNTRRSTYHVVIDSLKHLPDTKLDAAFGLIPLFTLF 285
           GFMTGSA NII GQ+P LMGY+K VNTR STY V+I+SL+HLPDTKLDA FGL+PL  L+
Sbjct: 267 GFMTGSALNIIAGQVPALMGYNKLVNTRTSTYKVIINSLRHLPDTKLDAVFGLVPLVILY 326

Query: 286 FWKWWCNSMGPKLTDRYFPANSRPRANKYWKAFYFYLQASRNGIIIILFTAVSYGITKGV 345
            WKW C++ GP+L  RY       R ++ W   + Y QA RN ++I++FTA+++G++   
Sbjct: 327 VWKWGCSTGGPRLVQRY-----GSRRSRMWDNVFLYTQALRNAVVIVVFTAIAWGMSHRA 381

Query: 346 AKD--KRRISVLGTVPKGLRHTGVMKLPHGILNNIAAEIPSSIIVLLLEHIAISKSFGRV 403
            K+    RIS+LGTVP GL+  GVMK+P G+L+ IA E+P+S+IVL+LEHIAISK+FGRV
Sbjct: 382 LKEGGSARISLLGTVPSGLKDVGVMKVPSGLLSKIAPELPASVIVLVLEHIAISKAFGRV 441

Query: 404 NDYKINPNQEIIAIGVSNLLGTFFNAYPATGSFSRSALKAKCNVMTPLSGIFSAACVLLA 463
           NDY++ P+QE+IAIG +NL+GTFFNAYPATGSFSRSALKAKCNV TPLSG+FS ACVLLA
Sbjct: 442 NDYRVVPDQELIAIGATNLIGTFFNAYPATGSFSRSALKAKCNVSTPLSGLFSGACVLLA 501

Query: 464 IYCLTGAFFYIPKATLSAVIIHAVFDLIASYHTTWSLWKMNVFDFIGFITTVFITVFSSI 523
           IYCLT AF +IPKATLSAVIIHAV DLIASY TTWS W+++  D + F+ TV ITVFSSI
Sbjct: 502 IYCLTSAFKFIPKATLSAVIIHAVSDLIASYKTTWSFWRLSPPDLVCFLVTVVITVFSSI 561

Query: 524 ENGIYFAVCWSCAILLYNNAFPAGKFLGRIEIAE--VVNPKIVDDDDFSFENS-----NE 576
           ENGIYFA+CWS A+LL+  AFPAGKFLGR++IAE  V N         S  NS     N 
Sbjct: 562 ENGIYFAMCWSVAVLLFRTAFPAGKFLGRVQIAEARVTNSGAGAGVGMSSGNSAGTAVNR 621

Query: 577 SFDDEGIYFDNSVAEDKLG-TSSNDLKKFN-AGV-KTRSINGELVNGQTSSDIRYYTKWV 633
             + E  +   SV+ + L  T+    K  N AG  K   + G + +G +    R++TKWV
Sbjct: 622 EKERETTFTAVSVSSESLSHTAPGKAKAANSAGTDKLGKVEGHVTDGGSPRAPRFHTKWV 681

Query: 634 PFDHAYSKELNPSVRITPPPPGVIVYRLSDSYTYINCSRHYDLIFDEIKRVTRRGQLIQH 693
           PFD  Y++ELNP V + PPPPGVIV+R S+S+TY+NCSR YD IFDE+ R+TRRG+    
Sbjct: 682 PFDR-YTRELNPEVFVAPPPPGVIVFRPSESWTYVNCSRQYDAIFDEVVRLTRRGRPQIV 740

Query: 694 RHKWDRPWNDPGEWEAPDLXXXXXXXXXXXXXXXXXTDVDTFENENEIEHIHDGEHYKKN 753
                RPWNDPGEW  P                        F++ +E     D E+ +  
Sbjct: 741 AKSSSRPWNDPGEWHPPKFLR------------------KLFKSSSE-----DLEN-RAV 776

Query: 754 DKDERPLLRVVCLDFSQVANTDATALQSLADLRKAVNKYADRQVEFHFVGIYSPWIKRGL 813
            +DERP+LRV+ +D+SQVA  D+T LQ+L DLRKAVNKYADRQVEFHF GI  PW+KRGL
Sbjct: 777 ARDERPVLRVIAMDWSQVAQVDSTGLQTLQDLRKAVNKYADRQVEFHFAGIIEPWVKRGL 836

Query: 814 RNLGFGTTNEEYSDESIIAGHSSYHLSRFRESEQDGFNELDSLESQRNIGSKTKVLAASG 873
            N GFGT N+E++DES++ GH S H++R  E  +D  + L                 A+G
Sbjct: 837 INSGFGTVNDEFADESLLVGHKSCHIARSAEPTEDEESRLAH--------------PATG 882

Query: 874 TNLPFFHVDIPDFSKWD 890
           TNLPFFH+++PDFS+WD
Sbjct: 883 TNLPFFHLELPDFSEWD 899

>Kwal_56.23759 s56 complement(693180..695765) [2586 bp, 861 aa] {ON}
           YBR294W (SUL1) - Probable sulfate transport protein
           [contig 173] FULL
          Length = 861

 Score =  932 bits (2409), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 494/907 (54%), Positives = 624/907 (68%), Gaps = 78/907 (8%)

Query: 3   ELDNLELEYNQFKNNERPS-----NTNAGADIEKGLDTKKYFERSITDNSTYGKKS---- 53
           +LD+L+ EY  FKN E        ++N GA +  G  TK   +++  D S          
Sbjct: 11  DLDDLDAEYGHFKNTEHSEIGGGPSSNPGAAVGVGASTKLGQDQN-GDKSGATGGGNGAN 69

Query: 54  -----YSIP-SYEEDTITLKDYYDTNLRDYFTWASVVDYIRSLFPVVNWLPFYNPKWFLS 107
                Y  P +Y ED +T ++YYDT +R   T ++V  Y+R L PV+NWLP YN +WF  
Sbjct: 70  EPLALYDSPEAYYEDKVTFREYYDTTIRPSLTASNVRQYLRDLLPVINWLPHYNGRWFYQ 129

Query: 108 DLIAGITVGTVLVPQSMSYAQIATLPPEYGLYSSFIGALVYSFFATSKDVCIGPVAVMSL 167
           D++AGITVG VLVPQSMSYA IATLPP++GLYSSF+GA++YSFFATSKDVCIGPVAVMSL
Sbjct: 130 DMVAGITVGCVLVPQSMSYAVIATLPPQFGLYSSFVGAMIYSFFATSKDVCIGPVAVMSL 189

Query: 168 QTAKVIARVKEKHPDLDPSITGPIIATVLAFICGIIATGVGLLRLGFLVELISLNAVAGF 227
           QTAK +++V  + P  D  IT P++AT LAF+CG+I+ G+G+LRLGFLVELIS  AVAGF
Sbjct: 190 QTAKAVSKVMAELPA-DTDITAPVVATALAFLCGLISLGLGVLRLGFLVELISSTAVAGF 248

Query: 228 MTGSAFNIIWGQIPGLMGYSKKVNTRRSTYHVVIDSLKHLPDTKLDAAFGLIPLFTLFFW 287
           MTGSA NII GQ+P LMGY+K VNTR STY V+I++LKHLPDTKLDA FGLIPL  L+ W
Sbjct: 249 MTGSALNIISGQLPALMGYNKLVNTRTSTYKVIIETLKHLPDTKLDAVFGLIPLVMLYTW 308

Query: 288 KWWCNSMGPKLTDRYFPANSRPRANKYWKAFYFYLQASRNGIIIILFTAVSYGITKGVAK 347
           KW CNS GP+L +RY    SR +  + W A  FY QA RN +III+FTA+++ I+    K
Sbjct: 309 KWLCNSGGPRLVERYTVRGSRKQ--RIWSATLFYTQALRNAVIIIVFTAIAWSISH--HK 364

Query: 348 DKRRISVLGTVPKGLRHTGVMKLPHGILNNIAAEIPSSIIVLLLEHIAISKSFGRVNDYK 407
            K  IS+LG VP GL+  GVMKLP G+   IA E+P+S+IVLLLEHIAI+K+FGRVNDY+
Sbjct: 365 KKAPISLLGPVPSGLKDVGVMKLPDGLAAKIAPELPASVIVLLLEHIAIAKAFGRVNDYR 424

Query: 408 INPNQEIIAIGVSNLLGTFFNAYPATGSFSRSALKAKCNVMTPLSGIFSAACVLLAIYCL 467
           + P+QE+IAIG +NLLGTFFNAYPATGSFSRSALKAKCNV TPLSG+FS ACVLLAIYCL
Sbjct: 425 VVPDQELIAIGATNLLGTFFNAYPATGSFSRSALKAKCNVSTPLSGVFSGACVLLAIYCL 484

Query: 468 TGAFFYIPKATLSAVIIHAVFDLIASYHTTWSLWKMNVFDFIGFITTVFITVFSSIENGI 527
           T AF YIPKATLSAVIIHAV DLIASY TTWS+W++N  D + F+ TVFI VFSSIENGI
Sbjct: 485 TSAFQYIPKATLSAVIIHAVSDLIASYKTTWSIWRLNPLDLVCFLATVFIAVFSSIENGI 544

Query: 528 YFAVCWSCAILLYNNAFPAGKFLGRIEIAEVVNPKIVDDDDFSFENSNESFDDEGI-YFD 586
           YFA+CWS A+LL+  AFP  +FLGR+EIAE+   + V         S +    +G+ Y  
Sbjct: 545 YFAMCWSVAVLLFKVAFPRAQFLGRVEIAELATNEGVSAGSEFAPLSKDFEKGKGVSYAS 604

Query: 587 NSVAEDKLGTSSNDLKKFNAGVKTRSINGE---LVNGQTSSDIRYYTKWVPFDHAYSKEL 643
            SV+ +           FNA  K + I G    +     ++   ++TKWVPF+  Y++EL
Sbjct: 605 GSVSSE----------SFNA--KKQGIEGGSQFVGGASNAAGAGFHTKWVPFE-PYTREL 651

Query: 644 NPSVRITPPPPGVIVYRLSDSYTYINCSRHYDLIFDEIKRVTRRGQLIQHRHKWDRPWND 703
           NP V +  PPPGVIV+R S+S+TY+NC+R Y+ IFDE+ R TRRG+ +Q   K  RPWND
Sbjct: 652 NPQVPVAQPPPGVIVFRPSESWTYVNCARQYNAIFDEVVRTTRRGK-VQVTSKSGRPWND 710

Query: 704 PGEWEAPDLXXXXXXXXXXXXXXXXXTDVDTFENENEIEHIHDGEHYKKNDKDERPLLRV 763
           PGEW  P                     +  +  +   E +  G        D+RP+LRV
Sbjct: 711 PGEWHPPKF-------------------LRKWFGKKYSESLEQGVV-----SDDRPVLRV 746

Query: 764 VCLDFSQVANTDATALQSLADLRKAVNKYADRQVEFHFVGIYSPWIKRGLRNLGFGTTNE 823
           + +D+SQVA  D+T LQ+L DLRKAV+KYADRQVEFHF GI SPWIKRGL N GFGT NE
Sbjct: 747 IAMDWSQVAQVDSTGLQTLHDLRKAVSKYADRQVEFHFSGIISPWIKRGLLNTGFGTVNE 806

Query: 824 EYSDESIIAGHSSYHLSRFRESEQDGFNELDSLESQRNIGSKTKVLAASGTNLPFFHVDI 883
           E++DES++ GH +Y ++R   +  +     ++L  Q           A+G N+PFFH ++
Sbjct: 807 EHADESLLVGHKTYQVARGGATGDE-----EALLPQ----------PATGVNMPFFHAEM 851

Query: 884 PDFSKWD 890
           PDFSKWD
Sbjct: 852 PDFSKWD 858

>AGR077C Chr7 complement(874110..876656) [2547 bp, 848 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR092W
           (SUL2)
          Length = 848

 Score =  883 bits (2282), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 454/891 (50%), Positives = 583/891 (65%), Gaps = 78/891 (8%)

Query: 2   EELDNLELEYNQFKNNERPSNTNAGADIEKGLDTKKYFERSITDNSTYG---KKSYSIPS 58
           ++++ L+ EY+Q K  E  S   A       + +++Y           G       ++P 
Sbjct: 29  DDIEALQAEYDQLKAGEVHSAQGA---THGDIGSRQYSGSGKPAAQYLGLNVNSREAVPE 85

Query: 59  YEEDTITLKDYYDTNLRDYFTWASVVDYIRSLFPVVNWLPFYNPKWFLSDLIAGITVGTV 118
           YEE  +++KDYY+  LR + +  +  DY  S+FP+  W+  YN  W  +D++AGITVG V
Sbjct: 86  YEETVVSVKDYYNYKLRGFISLNTARDYALSVFPLHRWIHHYNVAWMYADMVAGITVGCV 145

Query: 119 LVPQSMSYAQIATLPPEYGLYSSFIGALVYSFFATSKDVCIGPVAVMSLQTAKVIARVKE 178
           LVPQSMSYAQ+A+L P+YGLYSSF+GA +YSFFATSKDVCIGPVAVMSL+TAKVIARV E
Sbjct: 146 LVPQSMSYAQLASLSPQYGLYSSFVGAFIYSFFATSKDVCIGPVAVMSLETAKVIARVTE 205

Query: 179 KHPDLDPSITGPIIATVLAFICGIIATGVGLLRLGFLVELISLNAVAGFMTGSAFNIIWG 238
             P+ D +ITGPIIAT L  +CG IA  +G+LRLGFLVE IS+ AV GFMTGSA +II G
Sbjct: 206 NLPE-DTNITGPIIATALTLLCGAIAMVIGILRLGFLVEFISITAVTGFMTGSALSIISG 264

Query: 239 QIPGLMGYSKKVNTRRSTYHVVIDSLKHLPDTKLDAAFGLIPLFTLFFWKWWCNSMGPKL 298
           Q+P LMGYSKKVNTR +TY V+I+SLKHL DT ++AAFGL+PL  LF WKW C S+GP+L
Sbjct: 265 QVPSLMGYSKKVNTRATTYKVIIESLKHLKDTNMNAAFGLVPLVLLFLWKWICGSLGPRL 324

Query: 299 TDRYFPANSRPRANKYWKAFYFYLQASRNGIIIILFTAVSYGITKGVAKDKRRISVLGTV 358
            DRY     +P     W A +FYLQA RN +II++FTA+S+GI++    +K  IS+LG V
Sbjct: 325 VDRYL--QFKPSRASRWNAAFFYLQALRNAVIIVVFTAISWGISRH-KLEKPPISLLGKV 381

Query: 359 PKGLRHTGVMKLPHGILNNIAAEIPSSIIVLLLEHIAISKSFGRVNDYKINPNQEIIAIG 418
           P GL++ G ++LP G++  +  E+P++ I+LLLEHIAI+KSFGR+N+YK+ P+QE+IAIG
Sbjct: 382 PSGLKNVGPLELPEGLVEKLLPELPAATIILLLEHIAIAKSFGRINNYKVVPDQELIAIG 441

Query: 419 VSNLLGTFFNAYPATGSFSRSALKAKCNVMTPLSGIFSAACVLLAIYCLTGAFFYIPKAT 478
           V+NL  TFFNAYPATGSFSRSALKAKCNV TPLSG+F+ ACVLLA+YCLT AF++IPKAT
Sbjct: 442 VTNLFATFFNAYPATGSFSRSALKAKCNVKTPLSGLFTGACVLLALYCLTEAFYFIPKAT 501

Query: 479 LSAVIIHAVFDLIASYHTTWSLWKMNVFDFIGFITTVFITVFSSIENGIYFAVCWSCAIL 538
           LSAVIIHAV DLIASY  TW  W+ N  DF  FI TV ITVFSSIE+GIYF++ WSCA+L
Sbjct: 502 LSAVIIHAVADLIASYKVTWMFWRTNPLDFFAFIVTVIITVFSSIEHGIYFSISWSCAVL 561

Query: 539 LYNNAFPAGKFLGRIEIAEVVNPKIVDDDDFSFENSNESFDDEGIYFDNSVAEDKLGTSS 598
           L   AFP GKFLG I++AEV+ P        + E    S D+   +    + +D      
Sbjct: 562 LCKVAFPDGKFLGYIDVAEVIEP--AGPPSINSEADLASIDNSATF--QQIDKD------ 611

Query: 599 NDLKKFNAGVKTRSINGELVNGQTSSDIRYYTKWVPFDHAYSKELNPSVRITPPPPGVIV 658
                   G K  ++   L +  T    R++ +W+P DHAYS+ELNP   + PPPPGVIV
Sbjct: 612 --------GGKLNTVESVLPDPHT----RFHRRWIPLDHAYSRELNPEAVVNPPPPGVIV 659

Query: 659 YRLSDSYTYINCSRHYDLIFDEIKRVTRRGQLIQHRHKWDRPWNDPGEWEAPDLXXXXXX 718
           YR +DS+TY+NCSRH+D+I D +K  TR GQL+ H    +R W DPG W  P +      
Sbjct: 660 YRPTDSWTYLNCSRHFDIILDHVKEHTRPGQLVNHLSNKERLWCDPGPWRPPRIFR---- 715

Query: 719 XXXXXXXXXXXTDVDTFENENEIEHIHDGEHYKKNDKDERPLLRVVCLDFSQVANTDATA 778
                                    I D +       D RP+LRV+ +D+SQV+  D+T 
Sbjct: 716 -----------------------RFIAD-KRTGSAVADARPVLRVLAMDWSQVSQVDSTG 751

Query: 779 LQSLADLRKAVNKYADRQVEFHFVGIYSPWIKRGLRNLGFGTTNEEYSDESIIAGHSSYH 838
           +Q+L DLR A+NKYADR VEFHF GI SPWIKR L N GFG      +D  +I+   SYH
Sbjct: 752 IQNLVDLRNALNKYADRPVEFHFAGIVSPWIKRALVNTGFGI-----ADPPLISSRVSYH 806

Query: 839 LSRFRESEQDGFNELDSLESQRNIGSKTKVLAASGTNLPFFHVDIPDFSKW 889
           L R                   +I     V+ A GTN PFFH+D+PDF  W
Sbjct: 807 LVRLPADPP-------------HIVHGHSVVFALGTNTPFFHLDMPDFETW 844

>Ecym_4299 Chr4 complement(639078..641702) [2625 bp, 874 aa] {ON}
           similar to Ashbya gossypii AGR077C
          Length = 874

 Score =  843 bits (2179), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 437/891 (49%), Positives = 588/891 (65%), Gaps = 59/891 (6%)

Query: 4   LDNLELEYNQFKNNERPSNTNAGADIEKGLDTKKYFERSITDNSTYGKK--SYSIPSYEE 61
           LD LE +Y +FK NE  +  +   +    +D       S+      G     +  P Y E
Sbjct: 40  LDELETDYTRFKTNEDSAGYSGAENERSRIDKFDSVGSSLQFAKYDGNALPDFKAPPYYE 99

Query: 62  DTITLKDYYDTNLRDYFTWASVVDYIRSLFPVVNWLPFYNPKWFLSDLIAGITVGTVLVP 121
            T+T  +YYD  +R     +    Y  SLFP++ W+  YN  W  SD IAGITVG VLVP
Sbjct: 100 TTVTFMEYYDRTIRSRVGRSFFRSYFLSLFPIIKWIHHYNFAWMYSDFIAGITVGCVLVP 159

Query: 122 QSMSYAQIATLPPEYGLYSSFIGALVYSFFATSKDVCIGPVAVMSLQTAKVIARVKEKHP 181
           QSMSYAQ+A L PEYGLYSSFIGA +YSFFATSKDVCIGPVAVMS+Q +KVI+ V ++ P
Sbjct: 160 QSMSYAQLAGLKPEYGLYSSFIGAFIYSFFATSKDVCIGPVAVMSVQVSKVISHVIDQLP 219

Query: 182 DLDPSITGPIIATVLAFICGIIATGVGLLRLGFLVELISLNAVAGFMTGSAFNIIWGQIP 241
           +  P IT P++A+ LA    I+   +GLLRLGF++ELIS+ AVAGFMTGSA +I+  Q+P
Sbjct: 220 EGTP-ITAPMVASALALFSSILVIPIGLLRLGFILELISVTAVAGFMTGSALSILASQLP 278

Query: 242 GLMGYSKKVNTRRSTYHVVIDSLKHLPDTKLDAAFGLIPLFTLFFWKWWCNSMGPKLTDR 301
            L+G  +K+NTR  TY V+I +LKHL  + ++AAFGLI L  LFFWKW C  +GPKL  +
Sbjct: 279 SLLGI-QKINTRVETYRVLISTLKHLNGSDINAAFGLICLALLFFWKWTCGYLGPKLISK 337

Query: 302 YFPANSRPRANKYWKAFYFYLQASRNGIIIILFTAVSYGITKGVAKDKRRISVLGTVPKG 361
           Y   NS+    + W++F+FY QA RN  ++ L T VS+ +  G  K K  ISVLGTVP G
Sbjct: 338 YLRPNSK--KARIWQSFFFYAQALRNAFVLFLATFVSW-LVIGRHKKKTSISVLGTVPSG 394

Query: 362 LRHTGVMKLPHGILNNIAAEIPSSIIVLLLEHIAISKSFGRVNDYKINPNQEIIAIGVSN 421
           L+H GV  +P G+++ +  ++P ++I+LLLEHI I+KSFGR+N+YKI P+QE+IAIGV+N
Sbjct: 395 LKHVGVPTIPSGLVHKLMPQLPPAVIILLLEHITIAKSFGRINNYKIVPDQELIAIGVTN 454

Query: 422 LLGTFFNAYPATGSFSRSALKAKCNVMTPLSGIFSAACVLLAIYCLTGAFFYIPKATLSA 481
           L+G+FFNAYPATGSFSRSALKAKCNV TPLSG+FS ACVLLA+Y LT AF+YIPKA LSA
Sbjct: 455 LIGSFFNAYPATGSFSRSALKAKCNVKTPLSGLFSGACVLLALYYLTSAFYYIPKAALSA 514

Query: 482 VIIHAVFDLIASYHTTWSLWKMNVFDFIGFITTVFITVFSSIENGIYFAVCWSCAILLYN 541
           VIIHAV DLIASY  ++ LW  N FD I F+ T+ +T+FSSIENGIYFAV +S A LL  
Sbjct: 515 VIIHAVVDLIASYKLSFYLWNTNPFDLISFLATILLTIFSSIENGIYFAVAFSMATLLMK 574

Query: 542 NAFPAGKFLGRIEIAEVVNPKIVDDDDFSFENSNESFDDEGIYFDNSVAEDKLGTSSNDL 601
           NAFP+GKFLG ++I EV N  + +D D S  N++     E I  D+ +A+D    +S +L
Sbjct: 575 NAFPSGKFLGYVKITEVSNLNVFEDLD-SIGNNDPELPQE-ISKDSKLAKDPDVHASANL 632

Query: 602 KKFNAGVKTRSINGELVNGQTSSDIRYYTKWVPFDHAYSKELNPSVRITPPPPGVIVYRL 661
                               +  D+R++TKWVP D+ YS+ELNP + +  PPPGVIVYR 
Sbjct: 633 M------------------ASKLDVRFHTKWVPLDNGYSRELNPEIAVHMPPPGVIVYRP 674

Query: 662 SDSYTYINCSRHYDLIFDEIKRVTRRGQLIQHRHKWDRPWNDPGEWEAPDLXXXXXXXXX 721
           ++S+ Y+NCSR +D+I D +K +TR G+L+ H  K ++ W +PG+W  P           
Sbjct: 675 TESWHYLNCSRQFDIIVDRVKTLTRPGKLVNHLRKSEQLWCEPGDWVPP----------- 723

Query: 722 XXXXXXXXTDVDTFENENEIEHIHDGEHYKKNDK-DERPLLRVVCLDFSQVANTDATALQ 780
                        F  +   ++ H     +  ++ D RP+L+++ +D++QV + D+T++Q
Sbjct: 724 ------------LFLRKFFKKYRHKAAKPEVVEQVDNRPVLKILAMDWTQVTHVDSTSIQ 771

Query: 781 SLADLRKAVNKYADRQVEFHFVGIYSPWIKRGLRNLGFGTTNEEYSDESIIAGHSSYHLS 840
           SL DLRK +N+YADRQV FHF GI SPWIKR L + GFGT NE YS++ ++  +S+YH+ 
Sbjct: 772 SLIDLRKTINRYADRQVGFHFSGIVSPWIKRALVHAGFGTINENYSNDPLLLKYSTYHVV 831

Query: 841 RFRESEQDGFNELDSLESQRNIGSKTKVLAASGTNLPFFHVDIPDFSKWDI 891
           +   S  +        E+Q+N      +  ASGTN PFFH+D+PDF+KWDI
Sbjct: 832 QNVLSADE--------ENQQNSEISASLDVASGTNFPFFHIDMPDFTKWDI 874

>TBLA0F03050 Chr6 complement(738517..741210) [2694 bp, 897 aa] {ON}
           Anc_8.271 YLR092W
          Length = 897

 Score =  540 bits (1390), Expect = e-178,   Method: Compositional matrix adjust.
 Identities = 274/522 (52%), Positives = 360/522 (68%), Gaps = 25/522 (4%)

Query: 59  YEEDTITLKDYYDTNLRDYFTWASVVDYIRSLFPVVNWLPFYNPKWFLSDLIAGITVGTV 118
           Y E  +TL + ++  +   FTW S+  Y+ SL P+  W+  YN +WF+SD+IAGITVG V
Sbjct: 3   YREKQVTLIETFNHRVPRAFTWQSIKTYLLSLLPITKWIAHYNLQWFISDVIAGITVGCV 62

Query: 119 LVPQSMSYAQIATLPPEYGLYSSFIGALVYSFFATSKDVCIGPVAVMSLQTAKVIARVKE 178
           LVPQSMSYAQIATL P+YGLYSS +G  +Y+ FATSKD+CIGPVA+MSLQTAK IA V +
Sbjct: 63  LVPQSMSYAQIATLDPQYGLYSSIMGCFIYTVFATSKDICIGPVAIMSLQTAKAIAHVHQ 122

Query: 179 KHPDLDPSITGPIIATVLAFICGIIATGVGLLRLGFLVELISLNAVAGFMTGSAFNIIWG 238
           KHPD    I   IIA+ +A ICG I  G+G+LRLGF ++LI + AV GF +GSAFNI+WG
Sbjct: 123 KHPD----IPAHIIASTIAVICGAITMGIGVLRLGFFIDLIPVTAVFGFTSGSAFNILWG 178

Query: 239 QIPGLMGYSKKVNTRRSTYHVVIDSLKHLPDTKLDAAFGLIPLFTLFFWKWWCNSMGPKL 298
           QIPGLMGYSK VNTR+ TY VV+D+LK LP T ++A  GLIPLF LF WK+ C+      
Sbjct: 179 QIPGLMGYSKDVNTRQDTYKVVVDTLKKLPKTNINAVMGLIPLFCLFVWKYGCDY----- 233

Query: 299 TDRYFPANSRPRANKYWKAFYFYLQASRNGIIIILFTAVSYGITKGVAKDKRRISVLGTV 358
                 A  R     + K   FYL + R  I+II+ +A +YG     AK+   + VLG +
Sbjct: 234 ------ALRRGNLKPWPKRIVFYLLSLRVTIVIIICSAAAYG-----AKNP-SLKVLGKI 281

Query: 359 PKGLRHTG---VMKLPHGILNNIAAEIPSSIIVLLLEHIAISKSFGRVNDYKINPNQEII 415
           PKG        +  +P  ++++I +EIP+S+IVL+LEH++I+KSF RVN+Y+++ +QE+ 
Sbjct: 282 PKGFAAASDNRLKSIPSDLVSDIWSEIPASVIVLVLEHVSIAKSFARVNNYRVSADQELT 341

Query: 416 AIGVSNLLG-TFFNAYPATGSFSRSALKAKCNVMTPLSGIFSAACVLLAIYCLTGAFFYI 474
           AIGVSN++G     AYP TGSFSR+ALKA+C V TPL  IFS  CV++AI  LT A  +I
Sbjct: 342 AIGVSNVMGACCLGAYPVTGSFSRTALKARCEVRTPLGSIFSGLCVVVAITSLTSALAWI 401

Query: 475 PKATLSAVIIHAVFDLIASYHTTWSLWKMNVFDFIGFITTVFITVFSSIENGIYFAVCWS 534
           PKATLSAVIIHAV  LI+SY  T  L+KM   D +GF+ T+FITVFS IE G+YFAVCW+
Sbjct: 402 PKATLSAVIIHAVSGLISSYKVTIRLYKMGPLDCLGFLVTIFITVFSEIEIGVYFAVCWA 461

Query: 535 CAILLYNNAFPAGKFLGRIEIAEVVNPKIVDDDDFSFENSNE 576
           C +L+   AFP G FLG + + E+    I   +   +E+ N+
Sbjct: 462 CFLLMIRIAFPYGAFLGYVRVREISRSSITMIEPMDYESGND 503

 Score =  187 bits (475), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 107/260 (41%), Positives = 142/260 (54%), Gaps = 31/260 (11%)

Query: 569 FSFENSNESFDDEGI-YFDNSVAEDKLGTSSNDLKKFNAGVKTRSINGELV-NGQTSSDI 626
           F  E S  S   EG    DNS   ++L  SS D  + N  +  + +  +LV + +   D 
Sbjct: 625 FRQETSENSTIVEGTGNLDNSQDLEQLDQSSVDENQDN--IINKRLTRQLVYDHELEHDT 682

Query: 627 RYYTKWVPFDHAYSKELNPSVRITPPPPGVIVYRLSDSYTYINCSRHYDLIFDEIKRVTR 686
                W+P+ H +++ELNP V+I PPPPGV+VYR SDS TYINCSR+YD I D IK  T+
Sbjct: 683 PTEIIWIPYSHRFTRELNPHVKIHPPPPGVVVYRFSDSLTYINCSRNYDNIIDYIKDNTK 742

Query: 687 RGQL-IQHRHKWDRPWNDPGEWEAPDLXXXXXXXXXXXXXXXXXTDVDTFENENEIEHIH 745
            G++ +     + +PWN+PG WE P L                             EH  
Sbjct: 743 PGEIDVLSDALYVKPWNNPGPWEKPKLKFW--------------------------EHAD 776

Query: 746 DGEHYKKNDKDERPLLRVVCLDFSQVANTDATALQSLADLRKAVNKYADRQVEFHFVGIY 805
                KK   D+RP LR++CLDFSQVA  D+TALQ+L DLR  VN Y    VE+HF GI 
Sbjct: 777 PEIARKKRMADKRPTLRILCLDFSQVAQIDSTALQALIDLRHEVNAYTCSLVEWHFCGII 836

Query: 806 SPWIKRGLRNLGFGTTNEEY 825
           SPW++R L  +GFG  N+E+
Sbjct: 837 SPWVRRNLIEIGFGKINKEF 856

>NDAI0B02210 Chr2 complement(546721..548841) [2121 bp, 706 aa] {ON}
           Anc_8.99
          Length = 706

 Score =  132 bits (333), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 125/517 (24%), Positives = 215/517 (41%), Gaps = 38/517 (7%)

Query: 41  RSITDNSTYGKKSYSIPSYEEDTIT-----LKDYYDTNLRDYFTWASVVDYIRSLFPVVN 95
           R   D +     + +I  + ED +      ++D    N R   T +++ DY+   FP  +
Sbjct: 5   RRFCDTNGSSDSAEAISQHNEDGLVYNQEDVQDRIAINNRSILTTSNIWDYLAYYFPCFS 64

Query: 96  WLPFYNPKWFLSDLIAGITVGTVLVPQSMSYA-QIATLPPEYGLYSSFIGALVYSFFATS 154
           W+P Y    FL DL AG++V +  +P ++SYA  +A + P  GLYS  I   +Y+ F + 
Sbjct: 65  WMPNYTLTKFLGDLTAGLSVASFQIPLALSYATSLAHVEPLSGLYSLAITPFIYAIFGSV 124

Query: 155 KDVCIGPVAVMSLQTAKVIARVKEKHPDLDPSITGPIIATVLAFICGIIATGVGLLRLGF 214
             + +GP + +SL    V+ +  E   + D  I+   I+ V+ FI G     +G+ RLGF
Sbjct: 125 PQMIVGPESAISL----VVGQAVEPMVNHDERISTISISIVVTFISGSFLLFLGIFRLGF 180

Query: 215 LVELISLNAVAGFMTGSAFNIIWGQIPGLMGYSKKVNTRRSTYHVVIDSLKHL---PDTK 271
           L  ++S   + GF+    F +I   +   +   K + T    YH   + +  L       
Sbjct: 181 LGNILSRALLRGFICSVGFVMIINSLISELKLDKVLATSPEHYHTPFEKILFLIKYGQHN 240

Query: 272 LDAAFGLIPLFTLFFWKWWCNSMGPKLTDRYFPANSRPRANKYWKAFYFYLQASRNGIII 331
             A   ++ L++ F        M  +L  R+            W  F          I+I
Sbjct: 241 YHAPTAILSLYS-FIILMLMKVMKKRLMKRF-----------KWVIFV-------PEILI 281

Query: 332 ILFTAVSYGITKGVAKDKRRISVLGTVP-KGL--RHTGVMKLPHGILNNIAAEIPSSIIV 388
           ++   + +     + K K  IS++G     G    H  + K    +L  +        ++
Sbjct: 282 VIVGTIMFSFHFDI-KHKFDISIIGDFKVNGFDSLHNPLDKTNRLLLKPLLDAGIVCAVL 340

Query: 389 LLLEHIAISKSFGRVNDYKINPNQEIIAIGVSNLLGTFFNAYPATGSFSRSALKAKCNVM 448
              E    SK+ G   D  ++ N+E++A+G  N++G+ F A PA G + RS + A     
Sbjct: 341 GFFESTTASKALGTTYDLTVSSNRELVALGSMNIVGSLFGALPAFGGYGRSKINALSGGQ 400

Query: 449 TPLSGIFSAACVLLAIYCLTGAFFYIPKATLSAVIIHAVFDLIASYHTTWSLW--KMNVF 506
           T +SG+   +  L  I          P   LS V       L+    T    +       
Sbjct: 401 TVMSGVCLGSVTLFTIKFFLPVVHNTPTCVLSVVTSVVGLTLLEEAPTDLKFYFQSHGYN 460

Query: 507 DFIGFITTVFITVFSSIENGIYFAVCWSCAILLYNNA 543
           + I    T   T+F S+E GI    C+S   ++ ++A
Sbjct: 461 ELIVLGLTFITTIFYSVEVGICVGCCYSIISIIKHSA 497

>NCAS0B04800 Chr2 complement(873061..875235) [2175 bp, 724 aa] {ON}
           Anc_8.99
          Length = 724

 Score =  130 bits (327), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 134/512 (26%), Positives = 223/512 (43%), Gaps = 58/512 (11%)

Query: 66  LKDYYDTNLRDYFTWASVV-----DYIRSLFPVVNWLPFYNPKWFLSDLIAGITVGTVLV 120
           L+D   + +R + T   +V     D ++   P  +WLP Y  K F  D+IAGIT+ +  +
Sbjct: 51  LQDVNSSPMRSFLTSEQLVKMSFYDRLKYYLPCFSWLPDYTLKKFGGDMIAGITLASFQI 110

Query: 121 PQSMSYA-QIATLPPEYGLYSSFIGALVYSFFATSKDVCIGPVAVMSLQTAKVIARVKEK 179
           P ++SYA  +A + P  GLYS  I   VY  F +   + +GP + +SL    V+ +  EK
Sbjct: 111 PLALSYATSLAHVEPLCGLYSLAITPFVYCVFGSVPQMIVGPESAISL----VVGQAVEK 166

Query: 180 HPDLDPSITGPIIATVLAFICGIIATGVGLLRLGFLVELISLNAVAGFMTGSAFNIIWGQ 239
               +  +    I+ V+ F+ G I    G+ RLGFL  ++S   + GF++     ++   
Sbjct: 167 LVTHNEKVGTINISVVVTFLSGAILLIFGITRLGFLGNILSRALLRGFISSVGLVMVINS 226

Query: 240 IPGLMGYSKKVNTRRSTYHVVIDSLKHL----PD-----TKLDAAFGLIPLFTLFFWKWW 290
           +   +  +K + T    YH   + ++ L    P+     T + +    I L TL F K  
Sbjct: 227 LITELKLTKLLATVPEHYHTPFEKVQFLFKYGPENLHKPTAILSLCSFIILMTLRFLK-- 284

Query: 291 CNSMGPKLTDRYFPANSRPRANKYWKAFYFYLQASRNGIIIILFTAVSYGITKGVAKDKR 350
                 KL  RY             K+  F+ +     I++I+ +++   +   + KD  
Sbjct: 285 -----KKLMKRY-------------KSVIFFPE-----ILLIVISSLIISVNFNLKKD-F 320

Query: 351 RISVLGTVPKGLRHTGVMKL--PHGILN-NIAAEIPS----SIIVLLLEHIAISKSFGRV 403
            IS+LG        +G  KL  P G  N ++  E+ S      I+   E    SKS G +
Sbjct: 321 DISMLG----DFSTSGFDKLNNPLGKDNRSLCHELLSVGLMCAILGFFESTTASKSLGTI 376

Query: 404 NDYKINPNQEIIAIGVSNLLGTFFNAYPATGSFSRSALKAKCNVMTPLSGIFSAACVLLA 463
            D  I+ N+E++A+G  NL+G+ F A P+ G + RS + A     T +SG       L  
Sbjct: 377 YDLTISSNRELVALGSMNLVGSLFGALPSFGGYGRSKINALSGAQTVMSGACMGLITLFT 436

Query: 464 IYCLTGAFFYIPKATLSAVIIHAVFDLI--ASYHTTWSLWKMNVFDFIGFITTVFITVFS 521
           I  L     Y P   LS +       L+  A     + +      + I F      T+  
Sbjct: 437 IKFLLPVIHYTPLCILSVITTVVGLSLLEEAPSDIRFHIRCHGYNELIIFTLIFVTTIIH 496

Query: 522 SIENGIYFAVCWSCAILLYNNAFPAGKFLGRI 553
           S+E GI     +S   ++ ++A    + L R+
Sbjct: 497 SVEAGISVGCIYSIGSIIKHSAQSRIQILTRV 528

>KNAG0D02390 Chr4 (420952..423102) [2151 bp, 716 aa] {ON} Anc_8.99
           YPR003C
          Length = 716

 Score =  129 bits (323), Expect = 5e-30,   Method: Compositional matrix adjust.
 Identities = 123/481 (25%), Positives = 210/481 (43%), Gaps = 37/481 (7%)

Query: 85  DYIRSLFPVVNWLPFYNPKWFLSDLIAGITVGTVLVPQSMSYA-QIATLPPEYGLYSSFI 143
           D +    P + W+P YN K F  D IAG+++ +  +P  +S+A  +A + P  GLYS  +
Sbjct: 66  DVLPYYLPCLIWIPNYNWKKFGCDFIAGLSLASFQIPLGLSFATSLAHVEPLCGLYSLAV 125

Query: 144 GALVYSFFATSKDVCIGPVAVMSLQTAKVIARVKEKHPDLDPSITGPIIATVLAFICGII 203
              +Y+ F +   + +GP + +SL    V+ +  E     D S+    IAT+++F+ G+ 
Sbjct: 126 TPFIYALFGSVPHMIVGPESAISL----VVGQAVETLTSHDLSLETVDIATMISFMSGLT 181

Query: 204 ATGVGLLRLGFLVELISLNAVAGFMTGSAFNIIWGQIPGLMGYSKKVNTRRSTYHVVIDS 263
               G+ RLGFL  ++S   + GF++   F +I   +   +  +K + T    YH   + 
Sbjct: 182 LLFGGIFRLGFLGNILSKALLRGFISSIGFVMIVNSLITELKLNKLMLTIPEHYHTPFEK 241

Query: 264 LKHL-----PDTKLDAAFGLIPLFTLFFWKWWCNSMGPKLTDRYFPANSRPRANKYWKAF 318
           +  L      +  L  +F  + +FT              +T R F      R    W  F
Sbjct: 242 ILFLVRYGPSNYHLPTSFLSLAVFTTL------------MTIRIFKKKMMRRIK--WIVF 287

Query: 319 YFYLQASRNGIIIILFTAVSYGITKGVAKDKRRISVLGTV-PKGLR--HTGVMKLPHGIL 375
              + +     ++I    +SY       K K  ISV+G     G       + K   G++
Sbjct: 288 IPEILS-----VVIFSIVLSYMCD---LKKKYDISVIGDFNTDGFDDFRNPLSKCNRGLI 339

Query: 376 NNIAAEIPSSIIVLLLEHIAISKSFGRVNDYKINPNQEIIAIGVSNLLGTFFNAYPATGS 435
             +      S ++  LE I  SKS G   +   + N+E++A+G+ N +G+ F   PA G 
Sbjct: 340 PALRDVSLVSALLGFLESITASKSLGGYGNTVASSNRELVALGLMNTIGSAFGIIPAFGG 399

Query: 436 FSRSALKAKCNVMTPLSGIFSAACVLLAIYCLTGAFFYIPKATLSAVIIHAVFDLI--AS 493
           + RS + A     T ++G+F  +  L  I  L     YIP   LS +       L+  A 
Sbjct: 400 YGRSKINAFSGAQTVMAGVFMGSVTLFTIKFLLPVIHYIPTCVLSVITTFVGVSLLEEAP 459

Query: 494 YHTTWSLWKMNVFDFIGFITTVFITVFSSIENGIYFAVCWSCAILLYNNAFPAGKFLGRI 553
           +   + +      + I F+ T   T F SIE GI     +S   ++ ++A    + L R+
Sbjct: 460 HDIKFHIRCKGYDELIMFVLTFLCTCFYSIEFGILAGCTYSLISIVKHSAQSRIQILARV 519

Query: 554 E 554
           E
Sbjct: 520 E 520

>TBLA0C05270 Chr3 complement(1273901..1276231) [2331 bp, 776 aa]
           {ON} Anc_8.99 YPR003C
          Length = 776

 Score =  128 bits (322), Expect = 8e-30,   Method: Compositional matrix adjust.
 Identities = 119/473 (25%), Positives = 210/473 (44%), Gaps = 34/473 (7%)

Query: 79  TWASVVDYIRSLFPVVNWLPFYNPKWFLSDLIAGITVGTVLVPQSMSYA-QIATLPPEYG 137
           TW   ++ IR   P + WLP Y     + DL+AGIT+ +  +P ++SYA  IA + P  G
Sbjct: 101 TW---IELIRYYLPCLYWLPNYTRTILVGDLMAGITIASFQIPLALSYATSIAHVDPLSG 157

Query: 138 LYSSFIGALVYSFFATSKDVCIGPVAVMSLQTAKVIARVKEKHPDLDPSITGPIIATVLA 197
           LY+  +    Y+ F ++  + +GP   +SL   + +   K+ +PDLDP     +I   + 
Sbjct: 158 LYALAVSPFFYAIFGSTPQMIVGPEGAISLVIGQCVQSCKKHNPDLDPI----LIVIAVT 213

Query: 198 FICGIIATGVGLLRLGFLVELISLNAVAGFMTGSAFNIIWGQIPGLMGYSKKVNTRRSTY 257
            I G I    G+ RLG+L  +++   + GF+    F +I   I  L+   K  +      
Sbjct: 214 LISGTILLISGIFRLGYLGNILNKALLHGFIGSVGFVMI---IDSLINELKLGD------ 264

Query: 258 HVVIDSLKHLPDTKLDAAFGLIPLFTLFFWKWWCNSMGPKLTDRYFPANSRPRANKYWKA 317
            ++ D+ +H      +  F    L  +F WK+   +     T   F +       + +K 
Sbjct: 265 -ILADTPEH-----YNTPF----LKIVFLWKYAFQNFHVPTTLISFISIIILLIVRAFKK 314

Query: 318 FYFYLQASRNGI--IIILFTAVSYGITKGVAKDKRRISVLG---TVPKGLRHTGVMKLPH 372
              +       I  I+I+ T V     K    D   I +LG   +    + H  +     
Sbjct: 315 VLMHRHRWLIFIPEILIVLTTVLILSYKLDFADTYDIDILGDFKSNENSIFHNPLSNKNR 374

Query: 373 GILNNIAAEIPSSIIVLLLEHIAISKSFGRVNDYKINPNQEIIAIGVSNLLGTFFNAYPA 432
           G+++ +      + I    E    SK+ G  ++  ++ N+E++A+G+SN++ +   A P+
Sbjct: 375 GLIHVVFNIGIITAIFGFFESTTASKALGASSERSVSSNRELVALGLSNIVISTLGALPS 434

Query: 433 TGSFSRSALKAKCNVMTPLSGIFSAACVLLAIYCLTGAFFYIPKATLSAVIIHAVFDLIA 492
            G + RS + A     T LSG+F     +LAI  L     YIP   LS +     F L+ 
Sbjct: 435 FGGYGRSKINALSGGKTLLSGVFMGLTTILAILFLMPVIHYIPVCILSVITTVIGFTLLE 494

Query: 493 SYHTTWSL-WKMNVFDFIGFITTVFIT-VFSSIENGIYFAVCWSCAILLYNNA 543
                 S  W+   ++ +  I   F+T +F S+E  +Y    +S   ++ ++A
Sbjct: 495 EIPKEVSFHWRCRGYNELFLIVLTFMTSIFYSVETSMYIGCVYSILNIIKHSA 547

>KLLA0E14059g Chr5 (1245694..1247814) [2121 bp, 706 aa] {ON} similar
           to uniprot|P53394 Saccharomyces cerevisiae YPR003C
           Hypothetical ORF
          Length = 706

 Score =  125 bits (315), Expect = 5e-29,   Method: Compositional matrix adjust.
 Identities = 150/582 (25%), Positives = 251/582 (43%), Gaps = 78/582 (13%)

Query: 44  TDNSTYGKKSYSIPSYEEDTITLKD---YYDTNLRDYFTWASVVDYIRSLFPVVNWLPFY 100
           T  ST G K  ++   E + +TLKD   YY                     P  +W+P Y
Sbjct: 44  TSTSTVGLKFSTVSFPENERVTLKDTIPYY--------------------LPCFSWIPTY 83

Query: 101 NPKWFLSDLIAGITVGTVLVPQSMSYA-QIATLPPEYGLYSSFIGALVYSFFATSKDVCI 159
           + K  + D IAG+++ +  +P +MSYA  +A +PP  GLYS      VY+   +   + +
Sbjct: 84  SVKKCMGDFIAGLSLASFQIPLAMSYATSVAHVPPLCGLYSLVFSPAVYTVLGSVPQMIV 143

Query: 160 GPVAVMSLQTAKVI-ARVKEKHPDLDPSITGPIIATVLAFICGIIATGVGLLRLGFLVEL 218
           GP + +SL   + I AR+ E     DP +    I  V+ FI G++    GLLRLGFL  +
Sbjct: 144 GPESAISLILGQAIEARLSE-----DPKLKAINICLVITFISGLVLLTGGLLRLGFLENV 198

Query: 219 ISLNAVAGFMTGSAFNIIWGQIPGLMGYSKKVNTRRSTYHV----VIDSLKHLPDT--KL 272
           +S   + GF++G    ++   +   +  +    TR+  YH     V+  +K+ P+   K 
Sbjct: 199 LSRALLRGFISGVGVIMVITSLVVELKLNHVTPTRQEHYHSPFEKVLFIMKYGPENYHKP 258

Query: 273 DAAFGLIPLFTLFFWKWWCNSMGPKLTDRYFPANSRPRANKYWKAFYFYLQASRNGIIII 332
            A   L+    L   + +                      +Y K F + +      +++ 
Sbjct: 259 TAILSLVAFVILMSLRIF--------------------KKRYGKKFKWLVLLPDILVVVA 298

Query: 333 LFTAVSYGITKGVAKDKRRISVLGTVPK-GLRHTGVMKLPHGILNNIAAE--IPSSIIVL 389
           L   VSY   K   K +  I ++  +PK  ++H   +K P   +N    +    +  +V 
Sbjct: 299 LSIFVSY---KMHLKSRYGIEIINDIPKDSMKH---LKNPFSNVNVATFKDLFSTGFMVA 352

Query: 390 LL---EHIAISKSFGRVNDYKINPNQEIIAIGVSNLLGTFFNAYPATGSFSRSALKAKCN 446
           +L   E    SKS G   +  I+ N+E+IA+G  N++G+ F   PA G + RS + A   
Sbjct: 353 MLGFFESATASKSLGTSYNLAISSNRELIALGSMNVVGSMFAILPAFGGYGRSKINAYSG 412

Query: 447 VMTPLSGIFSAACVLLAIYCLTGAFFYIPKATLSAVIIHAVFDLI-ASYHTTWSLWKMNV 505
             T +SG F     L  I  L     YIP   LS +       L+  + H     W+   
Sbjct: 413 AQTTMSGFFMGLVTLFTIQFLLPIIRYIPVCILSVITTVVGLTLLEEAPHDLKFHWRCKG 472

Query: 506 F-DFIGFITTVFITVFSSIENGIYFAVCWSCAILLYNNAFPAGKFLGRIEIAEVVNPKIV 564
           + +   F  T+  T+F S+E GIY     S   ++ ++A    + LGR+   E      +
Sbjct: 473 YSELTVFTVTLLATLFYSLEAGIYIGCACSIINVIKHSAKSRIQILGRVPGTET----FI 528

Query: 565 DDDDFSFENS----NESFDDEGIYFDNSVAEDKLGTSSNDLK 602
           + DD+    +    N   ++   +    +AE    T+++DLK
Sbjct: 529 NADDYQANAAGYFINPQIEEIEGFLIVKIAEPLTFTNADDLK 570

>TPHA0H00720 Chr8 complement(143103..145466) [2364 bp, 787 aa] {ON}
           Anc_8.99 YPR003C
          Length = 787

 Score =  121 bits (304), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 127/491 (25%), Positives = 204/491 (41%), Gaps = 52/491 (10%)

Query: 87  IRSLFPVVNWLPFYNPKWFLSDLIAGITVGTVLVPQSMSYA-QIATLPPEYGLYSSFIGA 145
           I+   P + WLP YN   F SD I+GI++ +  +P ++SYA  IA + P  GLYS  I  
Sbjct: 110 IQYYLPCLRWLPIYNCSDFFSDCISGISLASFQIPLALSYATSIAHVKPLCGLYSLAITP 169

Query: 146 LVYSFFATSKDVCIGPVAVMSLQTAKVIARVKEKH---PDLDPSITGPIIATVLAFICGI 202
           ++Y    +   + +GP   +SL   + + ++   +      D  I+   I+  + F+ G+
Sbjct: 170 VIYGILGSVPPMIVGPEGAISLVVGQAVDKLHGSYNLSSQEDDHISRMNISVTITFLSGL 229

Query: 203 IATGVGLLRLGFLVELISLNAVAGFMTGSAFNIIWGQIPGLMGYSKKVNTRRSTYHVVID 262
           +    GLLRLGFL  ++S   +  F++          + G+M     + T      ++ID
Sbjct: 230 VLFICGLLRLGFLGSVLSKPLLRSFIS---------SVGGVMVIDALI-TEMKLNCILID 279

Query: 263 SLKHLPDTKLDAAFGLIPLFTLFFWKWWCNSMGPKLTDRYFPANSRPRANKYWKAFYFYL 322
           + +H        AF  I    +F  K+  N+     T       S     +Y K  Y   
Sbjct: 280 NDRHY-----HTAFEKI----MFIIKYAPNNFHKPTTVLSVVCFSILYFVRYCKKKYIIK 330

Query: 323 QASRNGIIIILFTAVSYGITKGVA--KDKRRISVLGTVPKGLRHTGVMKLPHGILNNIAA 380
             S   +  IL   +S GI       KD   IS++G V     ++    L  G L N  +
Sbjct: 331 HKSLIFLPEILIVVISTGILSASYNFKDNYGISIIGDV-----NSNNSNLIAGNLQNPLS 385

Query: 381 EIPSSIIVLLL------------EHIAISKSFGRVNDYKINPNQEIIAIGVSNLLGTFFN 428
                +  +L+            E    SKS G   +  I+ N+E++A+GV NL  +   
Sbjct: 386 SSNKELFPILMNTGFAIAALGFFESTTASKSLGTKFELSISSNRELVALGVMNLTASLLG 445

Query: 429 AYPATGSFSRSALKAKCNVMTPLSGIFSAACVLLAIYCLTGAFFYIPKATLSAVIIHAVF 488
             P+ G + RS + A     T +SG+      +L I  L     +IP   LS +      
Sbjct: 446 GLPSFGGYGRSKINAFSGAKTVMSGVVMGGITVLTIKFLLNYIHFIPTCVLSVITTIVGL 505

Query: 489 DLI------ASYHTTWSLWKMNVFDFIGFITTVFITVFSSIENGIYFAVCWSCAILLYNN 542
            LI        +H  W     N  + I F  T   T+F S+E GI     +S   ++  +
Sbjct: 506 SLIEEAPGEVKFH--WRCKGYN--ELIIFFMTACGTIFFSVEVGIIIGCSYSIISIIKFS 561

Query: 543 AFPAGKFLGRI 553
           A    + LGRI
Sbjct: 562 AKSRIQILGRI 572

>ZYRO0F04796g Chr6 (399222..401429) [2208 bp, 735 aa] {ON} similar
           to uniprot|P53394 Saccharomyces cerevisiae YPR003C
           Hypothetical ORF
          Length = 735

 Score =  119 bits (297), Expect = 8e-27,   Method: Compositional matrix adjust.
 Identities = 129/521 (24%), Positives = 210/521 (40%), Gaps = 71/521 (13%)

Query: 82  SVVDYIRSLFPVVNWLPFYNPKWFLSDLIAGITVGTVLVPQSMSYA-QIATLPPEYGLYS 140
           S+ D +    P  +WLP YN    + DLIAG+++ +  +P ++S+A  +A + P  GLYS
Sbjct: 81  SIWDVLPYYLPFFSWLPNYNISKCIGDLIAGVSLASFQIPLALSFATSVAHVEPLCGLYS 140

Query: 141 SFIGALVYSFFATSKDVCIGPVAVMSLQTAKVIARVKEKHPDLDPSITGPIIATVLAFIC 200
                 +Y+   +   + +GP + +SL   + + ++   +PDL        ++ V+ FI 
Sbjct: 141 LAFTPFIYAILGSVPQMIVGPESAISLVVGQAVEKMISHNPDLHTL----QLSAVITFIS 196

Query: 201 GIIATGVGLLRLGFLVELISLNAVAGFMTGSAFNIIWGQIPGLMGYSKKVNTRRSTYHVV 260
           G      GL RLGFL  ++S   + GF++     +I   +       K +      YH  
Sbjct: 197 GGFLFFFGLCRLGFLGNVLSRALLRGFISSVGLVMIINSMISEFKLDKILKDLPVHYHTP 256

Query: 261 IDSLK----------HLPDTKLDAAFGLIPLFTLFFWKWWCNSMGPKLTDRYFPANSRPR 310
            + +           H P T L          + FF       +  KL          PR
Sbjct: 257 FEKILFLVTYAPNNYHGPTTALS--------LSCFFILIMTKIIKKKLM---------PR 299

Query: 311 ANKYWKAFYFYLQASRNGIIIILFTAVSYGITKGVAKDKRRISVLGTV-PKGLRHTGVMK 369
               W  F           I++L     +   K   K    IS +G    KGL       
Sbjct: 300 CR--WIVFV--------PDILLLIIGTIFLSIKYRFKHNYSISTVGDFNTKGLDK----- 344

Query: 370 LPHGILNNIAAE----IPS-------SIIVLLLEHIAISKSFGRVNDYKINPNQEIIAIG 418
               +LN ++AE    IP        + ++   E    SKS G   D  I+ N+E++A+G
Sbjct: 345 ----LLNPLSAENRGLIPQLLSAGFITAMLGFFESTTASKSLGSSYDLAISSNRELVALG 400

Query: 419 VSNLLGTFFNAYPATGSFSRSALKAKCNVMTPLSGIFSAACVLLAIYCLTGAFFYIPKAT 478
             NL  +   + PA G + RS + A     T +SG F    VLL I  L     YIP   
Sbjct: 401 SMNLFSSILGSLPAFGGYGRSKINAFSGAQTVMSGAFMGLLVLLTIKFLLPMIHYIPICV 460

Query: 479 LSAVIIHAVFDLIASYHTTWSLWKMNVF---DFIGFITTVFITVFSSIENGIYFAVCWSC 535
           LS V       L+        ++    F   + + F  TV  T+F S+E GI     +S 
Sbjct: 461 LSVVTTMVGISLLEEAPADL-MFHFRCFGYDELLVFTLTVLTTMFYSVEVGICIGCGYSV 519

Query: 536 AILLYNNAFPAGKFLGRIEIAEVVNPKIVDDDDFSFENSNE 576
             ++ ++A    + L R++       + V+ DD+  + + E
Sbjct: 520 ISIIKHSAKSRIQILARVQGTS----RFVNSDDYLKQTNRE 556

>YPR003C Chr16 complement(561504..563768) [2265 bp, 754 aa] {ON}
           Putative sulfate permease; physically interacts with
           Hsp82p; green fluorescent protein (GFP)-fusion protein
           localizes to the ER; YPR003C is not an essential gene
          Length = 754

 Score =  119 bits (297), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 127/511 (24%), Positives = 205/511 (40%), Gaps = 57/511 (11%)

Query: 91  FPVVNWLPFYNPKWFLSDLIAGITVGTVLVPQSMSY-AQIATLPPEYGLYSSFIGALVYS 149
            P  +WLP Y       D+IAGI+V +  +P ++SY   IA +PP  GLYS  I   VY 
Sbjct: 105 LPCFSWLPEYTFNKLWGDVIAGISVASFQIPLALSYTTSIAHVPPLCGLYSLAISPFVYG 164

Query: 150 FFATSKDVCIGPVAVMSL---QTAKVIARVKEKHPDLDPSITGPIIATVLAFICGIIATG 206
              +   + +GP + +SL   Q  + I   KE    +D       I+TV+ F+ G I   
Sbjct: 165 ILGSVPQMIVGPESAISLVVGQAVESITLHKENVSLID-------ISTVITFVSGTILLF 217

Query: 207 VGLLRLGFLVELISLNAVAGFMTGSAFNIIWGQIPGLMGYSKKVNTRRSTYHVVIDSLKH 266
            G+ R GFL  ++S   + GF++     +I   +   +   K + +    YH   + +  
Sbjct: 218 SGISRFGFLGNVLSKALLRGFISSVGLVMIINSLISELKLDKFLVSLPQHYHTPFEKILF 277

Query: 267 LPDTK------LDAAFGLIPLFTLFFWKWWCNSMGPKLTDRYFPANSRPRANKYWKAFYF 320
           L D          A F    L  LF  +                   + +  KY K+  F
Sbjct: 278 LIDYAPAQYHIPTAIFSGCCLIVLFLTRLL-----------------KRKLMKYHKSAIF 320

Query: 321 YLQASRNGIIIILFTAVSYGITKGVAKDKRRISVLGTVPKGLRHTGVMKLPHGILNNIAA 380
           +       I+ IL +       K   K +  IS++G            +L + +      
Sbjct: 321 FPDILLVVIVTILIS------MKFNLKHRYGISIIG----DFSMDNFDELKNPLTRPRRK 370

Query: 381 EIP----SSIIVLLL---EHIAISKSFGRVNDYKINPNQEIIAIGVSNLLGTFFNAYPAT 433
            IP    +S+IV +L   E    SKS G   +  ++ N+E++A+G  N++ + F A PA 
Sbjct: 371 LIPDLFSASLIVAMLGFFESTTASKSLGTTYNLTVSSNRELVALGFMNIVISLFGALPAF 430

Query: 434 GSFSRSALKAKCNVMTPLSGIFSAACVLLAIYCLTGAFFYIPKATLSAVIIHAVFDLIAS 493
           G + RS + A     + +SG+F     L+ +  L     YIP   LS +       L+  
Sbjct: 431 GGYGRSKINALSGAQSVMSGVFMGVITLITMNLLLQFVHYIPNCVLSVITTIIGISLLEE 490

Query: 494 Y--HTTWSLWKMNVFDFIGFITTVFITVFSSIENGIYFAVCWSCAILLYNNAFPAGKFLG 551
                 + L      +   F  T   T+F SIE GI     +S   ++ ++A    + L 
Sbjct: 491 VPGDIKFHLRCGGFSELFVFAVTFCTTIFYSIEAGICIGCVYSIINIIKHSAKSRIQILA 550

Query: 552 RIEIAEVVNPKIVDDDDFSFENSNESFDDEG 582
           R+           + DD+       S D EG
Sbjct: 551 RVAGTS----NFTNLDDYMMNMKRNSLDVEG 577

>Ecym_7084 Chr7 complement(167032..169101) [2070 bp, 689 aa] {ON}
           similar to Ashbya gossypii AGR213C
          Length = 689

 Score =  118 bits (296), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 120/482 (24%), Positives = 215/482 (44%), Gaps = 44/482 (9%)

Query: 85  DYIRSLFPVVNWLPFYNPKWFLSDLIAGITVGTVLVPQSMSYAQIATLPPEYGLYSSFIG 144
            YI    P++ W P Y+ K    DL+AGI++    +P ++S + +A + P  GL+S  I 
Sbjct: 42  SYISYYLPILKWFPEYDRKKLGKDLLAGISLTAFQIPFAISLSTMAHVSPYAGLFSLVIP 101

Query: 145 ALVYSFFATSKDVCIGPVAVMSLQTAKVIARVKE--KHPDLDPSITGPIIATVLAFICGI 202
            L+Y+ F +   + +GP  V+SL    V+ +  E   H  +D  +T  +IA       G 
Sbjct: 102 PLIYAVFGSVPTMVVGPQTVVSL----VVGQSCEAWSHKSVDSLVTVAVIACT----SGF 153

Query: 203 IATGVGLLRLGFLVELISLNAVAGFMTGSAFNIIWGQI-PGLMG---YSKKV---NTRRS 255
           I   +GL R+GF+   IS   + GF+   A  ++  ++ P L     Y  +V   N   +
Sbjct: 154 ILLSMGLFRMGFIDNAISKAFLRGFIFALAIMMLITELLPELQLEDLYRDEVAQGNAGTT 213

Query: 256 TYHVVIDSLKHLPDTKLDAAFGLIPLFTLFFWKWWCNSMGPKLTDRYFPANSRPRANKYW 315
           T+      LK+ P+     +F +   F  F     C     K   +YF   +  R +K  
Sbjct: 214 TWDKFNFILKYGPEHA--DSFSMKLSFIAFSILMVC-----KYVKKYF---TEKRGSKLC 263

Query: 316 KAFYFYLQASRNGIIIILFTAVSYGITKGVAKDKRRISVLGTVPKGLRHTGVMKLPHGIL 375
           + F   L      +++  F  +SY          R   ++G +P    H    K+P    
Sbjct: 264 RFFPDLL------LVVAGFIYLSYYNDWSSTMGTR---IIGNLPPNKNH---FKVPITSF 311

Query: 376 NNIAAEIPSSIIVLLL---EHIAISKSFGRVNDYKINPNQEIIAIGVSNLLGTFFNAYPA 432
                    S +V +L   +     K+ G   D  I+ N+E++++G+ N++ + F+A PA
Sbjct: 312 KEFKELFDISFLVAILGLFDSATAFKAIGEKFDIDISSNRELVSLGLINVVSSVFSALPA 371

Query: 433 TGSFSRSALKAKCNVMTPLSGIFSAACVLLAIYCLTGAFFYIPKATLSAVIIHAVFDLIA 492
            G + RS L   C+  TP++GI  +   +  +  + GAF Y+P   L+ +I +  ++L+ 
Sbjct: 372 FGGYGRSKLNILCSAQTPMAGIVVSVAAIFCMNYMMGAFHYLPLCVLAVIISYIAYNLLE 431

Query: 493 SYHT-TWSLWKMNVF-DFIGFITTVFITVFSSIENGIYFAVCWSCAILLYNNAFPAGKFL 550
              +  +  W +  + + + F+  V  T+  S + G+   V  +   LL +      + L
Sbjct: 432 EIPSDLFFYWSVGGYQELLTFVAVVVTTLVWSPQFGVSIGVGLTMIRLLKHTTQSRVQIL 491

Query: 551 GR 552
           GR
Sbjct: 492 GR 493

>KLTH0G16764g Chr7 complement(1454815..1456947) [2133 bp, 710 aa]
           {ON} similar to uniprot|P53394 Saccharomyces cerevisiae
           YPR003C Hypothetical ORF
          Length = 710

 Score =  117 bits (294), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 119/492 (24%), Positives = 202/492 (41%), Gaps = 45/492 (9%)

Query: 91  FPVVNWLPFYNPKWFLSDLIAGITVGTVLVPQSMSYA-QIATLPPEYGLYSSFIGALVYS 149
            P  +WLP Y+    L D IAG ++ +  +P +MSY+  +A +PP  GL +      VY+
Sbjct: 70  LPCFSWLPTYDTSKLLRDFIAGASLASFQIPLAMSYSTSVAHVPPICGLNALAFTPFVYA 129

Query: 150 FFATSKDVCIGPVAVMSLQTAKVIARVKEKHPDLDPSITGPIIATVLAFICGIIATGVGL 209
            F +   + +GP + +SL    V+ +  EK    D S+    +  +L FI G I    G+
Sbjct: 130 VFGSVPHMIVGPESAISL----VVGQAIEKQMKHDKSLDVVNLCLILTFISGAILFCFGI 185

Query: 210 LRLGFLVELISLNAVAGFMTGSAFNIIWGQIPGLMGYSKKVNTRRSTYHVVIDSLKHLPD 269
           +R G+L  ++S   + GF++     ++   +   +   K  N     YH         P 
Sbjct: 186 MRFGYLDSVLSRALLRGFISAVGLVMVLNSLITELKLKKVFNDAPGHYHA--------PF 237

Query: 270 TKLDAAFGLIPLFTLFFWKWWCNSMGPKLTDRYFPANSR---PRANKYWKAFYFYLQASR 326
            KL   F   P        +   +    L+      + R    R ++ +K   F  +   
Sbjct: 238 QKLIFLFHYAP------GNYHVPTALLSLSSFSILMSLRLVKKRLSRVYKKVIFVPE--- 288

Query: 327 NGIIIILFTAVSYGITKGVAKDKRRISVLGTVPKGLRHTGVMKLPHGILNNIAAEIPSSI 386
              I+I+   V+ G      K +  I ++G +  G        L    L+  +    +  
Sbjct: 289 ---ILIVVALVTLGSYHFSFKLRYNIDIVGDIEVGDTSKFRNPLSKKNLSLFSELFHAGF 345

Query: 387 IVLLL---EHIAISKSFGRVNDYKINPNQEIIAIGVSNLLGTFFNAYPATGSFSRSALKA 443
           +V LL   E    SKS G   +  ++ N+E++A+G  NL+G+ F A P+ G + RS + A
Sbjct: 346 MVALLGFFESTTASKSLGSSYELSVSSNRELVALGSLNLVGSIFGALPSFGGYGRSKINA 405

Query: 444 KCNVMTPLSGIFSAACVLLAIYCLTGAFFYIPKATLSAVIIHAVFDLIAS------YHTT 497
                T +SG+F      +    L  A  +IP   LS +       L         YH  
Sbjct: 406 YSGAATVMSGVFMGLITCVTSMFLLNAIHHIPVCVLSVITTMVGITLFEEAPADLRYHFR 465

Query: 498 WSLWKMNVFDFIGFITTVFITVFSSIENGIYFAVCWSCAILLYNNAFPAGKFLGRIEIAE 557
              +     + + F  TV  T F S+E GI     +S   ++ N+     + L R+   +
Sbjct: 466 CRGYN----ELLIFALTVLTTFFYSVEAGITLGCGYSVIRVIKNSTKSKIQILRRVSGTD 521

Query: 558 VVNPKIVDDDDF 569
               + V+ DDF
Sbjct: 522 ----QFVNADDF 529

>AGR213C Chr7 complement(1156110..1158179) [2070 bp, 689 aa] {ON}
           Non-syntenic homolog of Saccharomyces cerevisiae YPR003C
          Length = 689

 Score =  116 bits (290), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 114/485 (23%), Positives = 214/485 (44%), Gaps = 42/485 (8%)

Query: 86  YIRSLFPVVNWLPFYNPKWFLSDLIAGITVGTVLVPQSMSYAQIATLPPEYGLYSSFIGA 145
           Y+    P++ WLP Y+      D++AG+T+ +  +P ++S   +A + P  GLY+  I  
Sbjct: 43  YVSYYLPILRWLPEYSWGKMAKDMLAGLTLTSFQIPLAISLTTMAHVSPYAGLYALVIPP 102

Query: 146 LVYSFFATSKDVCIGPVAVMSLQTAKVIARVKEKHPDLDPSITGPIIATVLAFICGIIAT 205
           L+Y+ F +   + +GP  V SL   +        H  L+P +T      V+  I G++  
Sbjct: 103 LIYAVFGSVPTMVVGPQTVASLVVGQSCD--AWAHKSLEPLMT----VAVIGCISGVLVF 156

Query: 206 GVGLLRLGFLVELISLNAVAGFMTGSAFNIIWGQI-PGLMGYSKKVNTRRSTYHVVIDSL 264
            +G+ RLGF+   IS   + GF +  A  ++  ++ P L     +++ R           
Sbjct: 157 AMGIFRLGFIDNAISKAFLKGFTSALAVVMLITELLPQL-----QIDDRYK--------- 202

Query: 265 KHLPDTKLDAAFGLIPLFTLFFWKWWCNSMGPKLTDRYFPANSRPRANKYWKAFYFYLQA 324
           + L + K+ +A     +F L   + + N    KL+   F   S    +KY K    YL A
Sbjct: 203 QALKEGKVGSAAWDKLVFALENAREYSNPFSVKLSVAAF---SILLLSKYLKK---YLTA 256

Query: 325 SRNGIIIILFTAVSYGITKGVA-------KDKRRISVLGTVPKGLRHTGVMKLPHGILNN 377
                 +  F  +   +   +         +K  + ++G +P    H   +K+P      
Sbjct: 257 KYGWTKLTFFPDLLLVVLGSILLSFYYDWDNKYNLPIVGDLPPNKDH---IKVPIQSFQE 313

Query: 378 IAAEIPSSIIVLLL---EHIAISKSFGRVNDYKINPNQEIIAIGVSNLLGTFFNAYPATG 434
                 +S +V +L   E     KS     D  ++ N+E++++G+ N++G+ F++ PA G
Sbjct: 314 FKDLFDASFLVAILGLFESATAFKSISATFDIDVSSNRELVSLGLINIVGSVFSSLPAFG 373

Query: 435 SFSRSALKAKCNVMTPLSGIFSAACVLLAIYCLTGAFFYIPKATLSAVIIHAVFDLIASY 494
            + RS L   C   TP++GIF +   +  +  L G F Y+P   L+ +I    ++L+   
Sbjct: 374 GYGRSKLNIFCGAQTPMAGIFVSLSAIFCMRFLMGVFHYLPLCILAVIISFIAYNLLEEV 433

Query: 495 -HTTWSLWKMNVF-DFIGFITTVFITVFSSIENGIYFAVCWSCAILLYNNAFPAGKFLGR 552
               +  W ++ + + I F   V  T+  S + G+   +  +   LL +      + LG+
Sbjct: 434 PGDMFFYWSVSGYQELITFSAVVLSTLIWSPQFGLVMGLGLTMIRLLKHTTQSRIQILGK 493

Query: 553 IEIAE 557
             I +
Sbjct: 494 DPITK 498

>Kpol_467.11 s467 (26194..28428) [2235 bp, 744 aa] {ON}
           (26194..28428) [2235 nt, 745 aa]
          Length = 744

 Score =  112 bits (280), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 124/495 (25%), Positives = 215/495 (43%), Gaps = 77/495 (15%)

Query: 91  FPVVNWLPFYNPKWF--LSDLIAGITVGTVLVPQSMSYA-QIATLPPEYGLYSSFIGALV 147
            P  +W+P Y   WF  +SD +AGI++ +  +P ++SYA  IA + P  GLYS  I   +
Sbjct: 89  LPCFSWIPQYT--WFKLISDFLAGISLASFQIPLALSYATSIAHVEPLCGLYSLAITPFI 146

Query: 148 YSFFATSKDVCIGPVAVMSLQTAKVIARVKEKHPDLDPSITGPIIATVLAFICGIIATGV 207
           Y+ F +   + +GP + +SL   + +  +K      D ++    I+ VL FI G     +
Sbjct: 147 YAVFGSVPQMIVGPESAISLVVGQSVELLKSH----DSALEIINISVVLTFISGAALLIL 202

Query: 208 GLLRLGFLVELISLNAVAGFMTGSAFNIIWGQIPGLMGYSKKVNTRRSTYHVVIDSLKHL 267
           G+LRLGFL  ++S + + GF++     +I   +   +  +K +   +   H   + ++ L
Sbjct: 203 GILRLGFLGNVLSRSLLRGFISSIGLVMIIDSLITELKLNKLLAGLKVHCHTSFEKVQFL 262

Query: 268 ---------PDTKLDAAFGLIPLFTLFFWKWWCNSMGPKLTDRYFPANSRPRANKYWKAF 318
                      T L +A   + LF++   K                   R  A   W AF
Sbjct: 263 IKYAPTNYHKPTALLSAIAFVTLFSIRLLK------------------KRWMAKHRWLAF 304

Query: 319 Y----------FYLQAS-----RNGIIII--LFTAVSYGITKGVAKDKRRISVLGTVPKG 361
                       YL A+     + GI+I+    T     +   ++K+ R+I     +P+ 
Sbjct: 305 IPEILMVVIISIYLSATWEFKKQYGILIVGDFNTHAIDKLKNPISKENRKI-----MPQ- 358

Query: 362 LRHTGVMKLPHGILNNIAAEIPSSIIVLLLEHIAISKSFGRVNDYKINPNQEIIAIGVSN 421
           L +TGV+    G   ++ A                SKS G   D  I+ N+E++A+G  N
Sbjct: 359 LLNTGVLISLLGFFESMTA----------------SKSLGTTYDLAISSNRELVALGSMN 402

Query: 422 LLGTFFNAYPATGSFSRSALKAKCNVMTPLSGIFSAACVLLAIYCLTGAFFYIPKATLSA 481
           ++ + F A P+ G + RS + A     T +SG+F  +  L+ I  L     YIP   LS 
Sbjct: 403 VIASLFGALPSFGGYGRSKINAFSGSKTVMSGVFMGSVTLITIRYLLPLIHYIPLCILSV 462

Query: 482 VIIHAVFDLIASYHTTWSL-WKMNVFD-FIGFITTVFITVFSSIENGIYFAVCWSCAILL 539
           +       L+    +     ++   +D    F  TV  T+  S+E GI     +S   ++
Sbjct: 463 ITSIVGISLLEEAPSELKFHFRCKGYDELFVFAITVLATLLYSVEMGICIGCGYSIISIV 522

Query: 540 YNNAFPAGKFLGRIE 554
            ++A    + LGR++
Sbjct: 523 KHSAKSRIQILGRVQ 537

>Suva_16.322 Chr16 complement(565605..567833) [2229 bp, 742 aa] {ON}
           YPR003C (REAL)
          Length = 742

 Score =  111 bits (278), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 115/475 (24%), Positives = 195/475 (41%), Gaps = 39/475 (8%)

Query: 91  FPVVNWLPFYNPKWFLSDLIAGITVGTVLVPQSMSYA-QIATLPPEYGLYSSFIGALVYS 149
            P  +WLP Y       D+IAGI++ +  +P ++SY   IA +PP  GLYS  I   VY 
Sbjct: 95  LPCFSWLPEYTFNKLWGDIIAGISLASFQIPLALSYTTSIAHVPPLCGLYSLAISPFVYG 154

Query: 150 FFATSKDVCIGPVAVMSLQTAKVIARVKEKHPDLDPSITGPIIATVLAFICGIIATGVGL 209
              +   + +GP + +SL   + +  +   H D   +++   I+ V+ F+ G I    G+
Sbjct: 155 ILGSVPQMIVGPESAISLVVGQAVESI-TLHKD---NVSLIDISIVITFVSGAILLFSGI 210

Query: 210 LRLGFLVELISLNAVAGFMTGSAFNIIWGQIPGLMGYSKKVNTRRSTYHVVIDSLKHLPD 269
            R GFL  ++S   + GF++     +I   +   +   K + +    YH   + +  L D
Sbjct: 211 SRFGFLGNVLSKALLRGFISSVGLVMIINSLVSELKLDKFLVSLPQHYHTPFEKVLFLID 270

Query: 270 ------TKLDAAFGLIPLFTLFFWKWWCNSMGPKLTDRYFPANSRPRANKYWKAFYFYLQ 323
                  K  A F       L   +     +  KL  R+             K+  F+  
Sbjct: 271 YAPAQYHKPTAIFSGCCFIILIVMRL----LKKKLMKRH-------------KSAVFFPD 313

Query: 324 ASRNGIIIILFTAVSYGITKGVAKDKRRISVLGTVPKGLRHTGVMKLPHGILNNIAAEIP 383
                I+ IL +       K   K +  IS++G             L H     +     
Sbjct: 314 ILLVVIVTILIS------MKLSLKQRYGISIVGDFSMDNFDKLKNPLTHSRRKLMPDLFS 367

Query: 384 SSIIVLLL---EHIAISKSFGRVNDYKINPNQEIIAIGVSNLLGTFFNAYPATGSFSRSA 440
           +S+IV +L   E    SKS G   +  ++ N+E++A+G  N+  + F A P+ G + RS 
Sbjct: 368 ASLIVAMLGFFESTTASKSLGTTYNLTVSSNRELVALGCINMFISLFGALPSFGGYGRSK 427

Query: 441 LKAKCNVMTPLSGIFSAACVLLAIYCLTGAFFYIPKATLSAVIIHAVFDLIASY--HTTW 498
           + A     + +SG+F     L+ +  L     YIP   LS +       L+        +
Sbjct: 428 INALSGAQSVMSGVFVGIITLITMKLLLQFVHYIPNCVLSVITTVIGISLLEEVPGDIKF 487

Query: 499 SLWKMNVFDFIGFITTVFITVFSSIENGIYFAVCWSCAILLYNNAFPAGKFLGRI 553
            L      +   F  T  +T+F SIE+GI     +S   ++ ++A    + L RI
Sbjct: 488 HLQCGGYSELFVFAVTFGVTIFYSIESGICIGCVYSILNIIKHSAKSRIQILARI 542

>Smik_16.241 Chr16 complement(438048..440282) [2235 bp, 744 aa] {ON}
           YPR003C (REAL)
          Length = 744

 Score =  111 bits (278), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 132/530 (24%), Positives = 223/530 (42%), Gaps = 48/530 (9%)

Query: 91  FPVVNWLPFYNPKWFLSDLIAGITVGTVLVPQSMSYA-QIATLPPEYGLYSSFIGALVYS 149
            P   WLP Y       D+IAGI++ +  +P ++SY   IA +PP  GLYS  I   VY 
Sbjct: 95  LPCFAWLPEYTFSKLWGDIIAGISLASFQIPLALSYTTSIAHVPPLCGLYSLAISPFVYG 154

Query: 150 FFATSKDVCIGPVAVMSLQTAKVIARVKEKHPDLDPSITGPIIATVLAFICGIIATGVGL 209
            F +   + +GP + +SL   + +  +   H D   +++   I+ V+ F+ G I    G+
Sbjct: 155 VFGSVPQMIVGPESAISLVVGQAVESIT-LHKD---NVSLIDISIVITFVSGAILLFSGI 210

Query: 210 LRLGFLVELISLNAVAGFMTGSAFNIIWGQIPGLMGYSKKVNTRRSTYHVVIDSLKHLPD 269
            R GFL  ++S   + GF++     +I   +   +   K + +    YH   + +  L  
Sbjct: 211 SRFGFLGNVLSKALLRGFISSVGLVMIINSLISELKLDKFLVSLPQHYHTPFEKILFL-- 268

Query: 270 TKLDAAFGLIPLFTLFFWKWWCNSMGPKLTDRYFPANSRPRANKYWKAFYFYLQASRNGI 329
             +D A     + T  F        G  L   +     + +  KY K   F+       I
Sbjct: 269 --IDYAPAQYHMPTAIFS-------GCCLIILFLMRLLKRKLLKYHKGAIFFPDILLVVI 319

Query: 330 IIILFTAVSYGITKGVAKDKRRISVLGTVPKGLRHTGVMKLPHGILNNIAAEIP----SS 385
           + IL +       K   K +  I+++G            KL + +  +    IP    +S
Sbjct: 320 VTILIS------MKFDLKHRYGITIVGD----FSMDNFDKLKNPLTRSRRKLIPDLFSAS 369

Query: 386 IIVLLL---EHIAISKSFGRVNDYKINPNQEIIAIGVSNLLGTFFNAYPATGSFSRSALK 442
           +IV +L   E    SKS G   +  ++ N+E++A+G  N++ + F A P+ G + RS + 
Sbjct: 370 LIVAMLGFFESTTASKSLGTTYNLTVSSNRELVALGFMNIVISLFGALPSFGGYGRSKIN 429

Query: 443 AKCNVMTPLSGIFSAACVLLAIYCLTGAFFYIPKATLSAVIIHAVFDLIASYHT--TWSL 500
           A     + +SG+F     L+ +  L     YIP   LS +       L+    +   + L
Sbjct: 430 ALSGAQSVISGVFVGVITLITMNLLLQFVHYIPNCVLSVITTVIGISLLEEVPSDIKFHL 489

Query: 501 WKMNVFDFIGFITTVFITVFSSIENGIYFAVCWSCAILLYNNAFPAGKFLGRIEIAEVVN 560
                 +   F  T  +T+F SIE GI     +S   ++ ++A    + L R  +A   N
Sbjct: 490 RCGGYSELFVFAVTFGVTIFYSIEAGICIGCVYSILNIIKHSAKSRIQILAR--VAGTSN 547

Query: 561 PKIVDD-------DDFSFENSNESFDDEGIYFDNSVAEDKLGTSSNDLKK 603
              +DD       +  S EN+ E    EG      + E    T+S DLK+
Sbjct: 548 FTNLDDYLMNMKRNPLSIENTEEI---EGCMIVR-IPEPLTFTNSEDLKQ 593

>Skud_16.286 Chr16 complement(525800..528037) [2238 bp, 745 aa] {ON}
           YPR003C (REAL)
          Length = 745

 Score =  107 bits (267), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 112/478 (23%), Positives = 198/478 (41%), Gaps = 45/478 (9%)

Query: 91  FPVVNWLPFYNPKWFLSDLIAGITVGTVLVPQSMSY-AQIATLPPEYGLYSSFIGALVYS 149
            P  +WLP Y       D+IAGI++ +  +P ++SY   IA +PP  GLYS  I   VY 
Sbjct: 95  LPCFSWLPEYTFNKLWGDIIAGISLASFQIPLALSYTTSIAHVPPLCGLYSLAISPFVYG 154

Query: 150 FFATSKDVCIGPVAVMSLQTAKVIARVKEKHPDLDPSITGPIIATVLAFICGIIATGVGL 209
              +   + +GP + +SL   + +  +   H D   +++   I+ V+ F+ G I    G+
Sbjct: 155 ILGSVPQMIVGPESAISLVVGQAVESIT-LHKD---NVSLIDISVVITFVSGAILLFSGI 210

Query: 210 LRLGFLVELISLNAVAGFMTGSAFNIIWGQIPGLMGYSKKVNTRRSTYHVVIDSLKHLPD 269
            R GFL  ++S   + GF++     +I   +   +   K + +    YH   + +  L D
Sbjct: 211 SRFGFLGNVLSKALLRGFISSVGLVMIINALISELKLDKFLLSLPQHYHTPFEKVLFLID 270

Query: 270 ------TKLDAAFGLIPLFTLFFWKWWCNSMGPKLTDR-YFPANSRPRANKYWKAFYFYL 322
                  K  A F    L  LF  +     +        +FP                  
Sbjct: 271 YAPAQYHKPTAIFSGCCLIVLFSMRLLKKKLVKHHKSAIFFP------------------ 312

Query: 323 QASRNGIIIILFTAVSYGITKGVAKDKRRISVLGTVPKGLRHTGVMKLP--HGILNNIAA 380
                 I++++  A+   + K   K +  I+++G     + +   +K P  H     I  
Sbjct: 313 -----DILLVVIVAIFISM-KFSLKHRYGITIIGDF--SMDNFDKLKNPFTHSRRKLIPD 364

Query: 381 EIPSSIIVLLL---EHIAISKSFGRVNDYKINPNQEIIAIGVSNLLGTFFNAYPATGSFS 437
              +S+IV +L   E    SKS G   +  ++ N+E++A+G  N++ + F A P+ G + 
Sbjct: 365 LFSASLIVAMLGFFESTTASKSLGTTYNLTVSSNRELVALGFMNIVISLFGALPSFGGYG 424

Query: 438 RSALKAKCNVMTPLSGIFSAACVLLAIYCLTGAFFYIPKATLSAVIIHAVFDLIASY--H 495
           RS + A     + +SG+F     L+ +  L     YIP   LS +       L+      
Sbjct: 425 RSKINALSGAQSVMSGVFVGIITLITMNLLLQFVHYIPNCVLSVITTVIGISLLEEVPGD 484

Query: 496 TTWSLWKMNVFDFIGFITTVFITVFSSIENGIYFAVCWSCAILLYNNAFPAGKFLGRI 553
             + L      +   F  T  +T+  SIE GI     +S   ++ ++A    + L R+
Sbjct: 485 IKFHLRCGGYSELFVFAVTFGVTILCSIEAGICIGCVYSILNIIKHSAKSRIQILARV 542

>SAKL0H08800g Chr8 (753145..755007) [1863 bp, 620 aa] {ON} similar
           to uniprot|Q74ZI9 Ashbya gossypii AGR213C AGR213Cp and
           weakly similar to YPR003C uniprot|P53394 Saccharomyces
           cerevisiae YPR003C Hypothetical ORF
          Length = 620

 Score =  102 bits (253), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 125/504 (24%), Positives = 216/504 (42%), Gaps = 68/504 (13%)

Query: 122 QSMSYAQIATLPPEYGLYSSFIGALVYSFFATSKDVCIGPVAVMSLQTAKVIARVKE--K 179
            S+S + +A LPP  GLYS  I  L+Y    T     +GP  V+SL    V+ +  E   
Sbjct: 1   MSISLSTLAHLPPSTGLYSLVIPPLIYCILGTVPTTVVGPQTVVSL----VVGQSCEWWS 56

Query: 180 HPDLDPSITGPIIATVLAFICGIIATGVGLLRLGFLVELISLNAVAGFMTGSAFNII--- 236
           H  L+P  T  +I  V     G I   +G+ R+GF+   +S   + GF++  A  ++   
Sbjct: 57  HRSLEPLSTVAVIGCV----SGGILFAMGVFRMGFIDNALSKAFLRGFVSSLALVMLITE 112

Query: 237 -WGQIPGLMGYSKKV------NTRRSTYHVVIDSLKHLPDTKLDAAFGLIPLFTLFFWKW 289
              ++     Y+  V       T    +  +++      DT              F W  
Sbjct: 113 LLPELKLEELYAHYVAQGYIGTTTWEKFRFILEKAPENSDT--------------FTWNL 158

Query: 290 WCNSMGPKLTDRYFPANSRPRANKY-WKAFYFYLQASRNGIIIILFTAVSYGITKGVAKD 348
              +    +T RY     R  A K  WK   F+ +     I+I++  +++   T+  ++ 
Sbjct: 159 SLFTFILLMTIRYL---KRHLAEKCGWKKCIFFPE-----ILIVVVGSITLSNTQKWSEL 210

Query: 349 KRRISVLGTVPKGLRHTGVMKLPHGILNNIAAEIPSSIIVLLL---EHIAISKSFGRVND 405
           K  I ++G +P    H   +K+P    +       +S ++ +L   E   + KS    ++
Sbjct: 211 KG-IKIIGDIPPNSDH---IKVPVQTFSEFKELFGTSALIAMLGLFESTIVFKSVCSNSN 266

Query: 406 YKINPNQEIIAIGVSNLLGTFFNAYPATGSFSRSALKAKCNVMTPLSGIFSAACVLLAIY 465
              + N+E++++GV NL+ + F+A PA G + RS +   C   T  SG+F +   LLAI 
Sbjct: 267 VDASSNRELVSLGVVNLVSSIFSALPAFGGYGRSKMNISCGAQTQFSGVFVS---LLAII 323

Query: 466 C---LTGAFFYIPKATLSAVIIHAVFDLI----ASYHTTWSLWKMNVFDFIGFITTVFIT 518
           C   L  AF ++P   L+ +I    F L+    A     WS+      +   FI  V  T
Sbjct: 324 CMNFLMNAFHHLPICILAVIISTVAFSLLEEAPADLMFYWSVGGYQ--ELFIFIIIVVTT 381

Query: 519 VFSSIENGIYFAVCWSCAILLYNNAFPAGKFLGRIEIAEVVNPKIVDDDDFSFENSNESF 578
           +  S + G+   +C +   LL ++     + LGR  I      K +DDD    ENS+   
Sbjct: 382 LVWSPQFGVTMGMCLTMIRLLKHSTRSRVQILGRDPITYTF--KNIDDD----ENSDIPL 435

Query: 579 DDEGIYFDNSVAEDKLGTSSNDLK 602
           ++        + E  + ++ +DL+
Sbjct: 436 EEIEKVMVVKIPEPLIFSNVSDLR 459

>CAGL0L09207g Chr12 complement(999571..1001748) [2178 bp, 725 aa]
           {ON} some similarities with uniprot|P53394 Saccharomyces
           cerevisiae YPR003c
          Length = 725

 Score = 86.7 bits (213), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 52/178 (29%), Positives = 93/178 (52%), Gaps = 5/178 (2%)

Query: 91  FPVVNWLPFYNPKWFLSDLIAGITVGTVLVPQSMSYA-QIATLPPEYGLYSSFIGALVYS 149
            P ++W+P Y+ + F  DL+AGI++ +  +P ++SYA  IA + P  GLYS  I  L+Y+
Sbjct: 74  LPCMSWIPHYSWEIFFGDLVAGISLASFQIPLALSYATSIAHVEPLCGLYSLAITPLIYA 133

Query: 150 FFATSKDVCIGPVAVMSLQTAKVIARVKEKHPDLDPSITGPIIATVLAFICGIIATGVGL 209
            F +   + +GP + +SL    V+ +  EK    D  I+   I  ++ FI G++   +G 
Sbjct: 134 IFGSVPQMIVGPESAISL----VVGQATEKFSAHDSEISTVTITMMITFISGVVLFFLGS 189

Query: 210 LRLGFLVELISLNAVAGFMTGSAFNIIWGQIPGLMGYSKKVNTRRSTYHVVIDSLKHL 267
           +RLGFL  ++S   + GF++     +I   +   +  + K+      YH  +  +  L
Sbjct: 190 VRLGFLGNILSKALLRGFISSVGLVMIINSLIIELKLNHKLADVAGHYHTPVGKIMFL 247

 Score = 55.8 bits (133), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 44/184 (23%), Positives = 78/184 (42%), Gaps = 14/184 (7%)

Query: 392 EHIAISKSFGRVNDYKINPNQEIIAIGVSNLLGTFFNAYPATGSFSRSALKAKCNVMTPL 451
           E    SKS G   +   + N+E+IA+G  N++G+ F A P+ G + RS +       T +
Sbjct: 358 ESTTASKSLGSDYNLTYSSNRELIALGFMNIVGSLFGALPSFGGYGRSKVNVFSGGKTVM 417

Query: 452 SGIFSAACVLLAIYCLTGAFFYIPKATLSAVIIHAVFDLIAS------YHTTWSLWKMNV 505
           SG       LL    L     Y P   LS +       L+        +H   S +    
Sbjct: 418 SGAMVGLITLLTAKLLLPMIHYTPTCVLSVITTVIGISLLEEVPSDIKFHIHCSGYS--- 474

Query: 506 FDFIGFITTVFITVFSSIENGIYFAVCWSCAILLYNNAFPAGKFLGRIEIAEVVNPKIVD 565
            +   F  T   T+  S+E G+     +S  +++ ++A    + L ++E ++    + V+
Sbjct: 475 -ELTVFTLTFIATLSQSVELGVTVGCIYSLILIVKHSALSRIQILAKLEGSD----EFVN 529

Query: 566 DDDF 569
            DD+
Sbjct: 530 VDDY 533

>Kwal_27.11039 s27 complement(614861..617041) [2181 bp, 726 aa] {ON}
           YPR003C - Hypothetical ORF [contig 31] FULL
          Length = 726

 Score = 82.4 bits (202), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 65/218 (29%), Positives = 104/218 (47%), Gaps = 22/218 (10%)

Query: 16  NNERP-SNTNAGADIEKGLDTKKYFERSITDNSTYGKK-SYSIPSYEEDTITLKDYYDTN 73
           +N RP S+ +   D     + +    R  TD S   K+ S ++P+   D I L       
Sbjct: 23  SNLRPESSISVDGDSSLSPENQARQSRVSTDISEQPKEVSPAMPAPSRDEIQLT------ 76

Query: 74  LRDYFTWASVVDYIRSLFPVVNWLPFYNPKWFLSDLIAGITVGTVLVPQSMSYA-QIATL 132
                 W  +  Y+    P  +WLP Y+   F+ DLIAG ++ +  +P +MSY+  +A +
Sbjct: 77  -----MWHRLTYYL----PCFSWLPTYDATKFIGDLIAGASLASFQIPLAMSYSTSVAHV 127

Query: 133 PPEYGLYSSFIGALVYSFFATSKDVCIGPVAVMSLQTAKVIARVKEKHPDLDPSITGPII 192
           PP  GL +     LVY+ F +   + +GP + +SL    V+ +  EK    D S+    +
Sbjct: 128 PPICGLNALAFTPLVYAVFGSVPHMIVGPESAISL----VVGQAIEKLTKHDASLNVTNL 183

Query: 193 ATVLAFICGIIATGVGLLRLGFLVELISLNAVAGFMTG 230
             VL FI G I    GL+R GFL  ++S   + GF++ 
Sbjct: 184 CVVLTFISGSILFSFGLMRFGFLDSVLSRALLRGFISA 221

 Score = 72.4 bits (176), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 64/221 (28%), Positives = 94/221 (42%), Gaps = 17/221 (7%)

Query: 392 EHIAISKSFGRVNDYKINPNQEIIAIGVSNLLGTFFNAYPATGSFSRSALKAKCNVMTPL 451
           E    SKS G   D  I+ N+E++A+G  NL+G+ F A P+ G + RS + A     T +
Sbjct: 369 ESTTASKSLGTNYDLAISSNRELVALGSLNLVGSLFGALPSFGGYGRSKINAYSGAATVM 428

Query: 452 SGIFSAACVLLAIYCLTGAFFYIPKATLSAVIIHAVFDLI--ASYHTTWSLWKMNVFDFI 509
           SG+F     L+    L  A  +IP   LS +       L   A     +        + +
Sbjct: 429 SGVFMGLITLITSKFLLNAIRHIPICVLSVITTMVGISLFEEAPADLKFHFRCRGYNELL 488

Query: 510 GFITTVFITVFSSIENGIYFAVCWSCAILLYNNAFPAGKFLGRIEIAEVVNPKIVDDDDF 569
            F  TV  T F S+E GI     +S    + N+     + LGRI        + V+ D+F
Sbjct: 489 TFAITVLTTFFYSVEAGITLGCGYSIIRAIKNSTQSGIQILGRISGTN----RFVNADEF 544

Query: 570 SFENSNESFDDE-GIYFDN-------SVAEDKLGTSSNDLK 602
               S  S D E G   D+        +AE    T++ DLK
Sbjct: 545 ---YSASSLDSEFGPRLDHMEGCLVARIAEPLTFTNTEDLK 582

>SAKL0B03124g Chr2 complement(288006..290240) [2235 bp, 744 aa] {ON}
           similar to uniprot|P53394 Saccharomyces cerevisiae
           YPR003C Hypothetical ORF
          Length = 744

 Score = 79.7 bits (195), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 47/169 (27%), Positives = 84/169 (49%), Gaps = 5/169 (2%)

Query: 91  FPVVNWLPFYNPKWFLSDLIAGITVGTVLVPQSMSYA-QIATLPPEYGLYSSFIGALVYS 149
            P  +WLP Y+ + F  D IAG+++ +  +P +MSYA  IA + P  GLY+       Y+
Sbjct: 97  LPCFSWLPSYDLRKFFGDFIAGVSLASFQIPLAMSYATSIAHVEPLCGLYALAFTPFFYA 156

Query: 150 FFATSKDVCIGPVAVMSLQTAKVIARVKEKHPDLDPSITGPIIATVLAFICGIIATGVGL 209
            F +   + +GP + +SL    V+ +  E     DPS++   +  ++ FI G++    G+
Sbjct: 157 IFGSVPQMIVGPESAISL----VVGQAIEPMIRHDPSLSSLDLCVIITFISGVVLFTFGV 212

Query: 210 LRLGFLVELISLNAVAGFMTGSAFNIIWGQIPGLMGYSKKVNTRRSTYH 258
            R GFL  ++S   + GF++     ++   +   +   K  +   S YH
Sbjct: 213 FRFGFLDNVLSRAFLRGFISAVGVIMVINSLIVELKLKKVFDDAPSHYH 261

 Score = 68.2 bits (165), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 51/186 (27%), Positives = 82/186 (44%), Gaps = 6/186 (3%)

Query: 392 EHIAISKSFGRVNDYKINPNQEIIAIGVSNLLGTFFNAYPATGSFSRSALKAKCNVMTPL 451
           E    SKS G   D  ++ N+E++A+G  NL+G+ F A P+ G + RS + A     T +
Sbjct: 381 ESTTASKSLGTAYDLAVSSNRELVALGSLNLIGSLFGALPSFGGYGRSKINAYSGAQTVV 440

Query: 452 SGIFSAACVLLAIYCLTGAFFYIPKATLSAVIIHAVFDLI--ASYHTTWSLWKMNVFDFI 509
           SG       +  I  L     YIP   LS +       L+  A     + +      + I
Sbjct: 441 SGACMGTITMFTIKFLLKFIRYIPVCVLSVITTVVGLSLLEEAPADLRFHIRCRGYNELI 500

Query: 510 GFITTVFITVFSSIENGIYFAVCWSCAILLYNNAFPAGKFLGRIEIAEVVNPKIVDDDDF 569
            FI TV  T F S+E GI     +S   ++ ++     + LG++        K V+ D++
Sbjct: 501 SFIITVLTTFFYSVEAGITVGCGYSIIRVIKHSTKSRIQILGKLAGTN----KFVNADEY 556

Query: 570 SFENSN 575
             +NS 
Sbjct: 557 EGKNST 562

>TDEL0C01280 Chr3 complement(218824..221007) [2184 bp, 727 aa] {ON}
           Anc_8.99 YPR003C
          Length = 727

 Score = 73.9 bits (180), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 40/140 (28%), Positives = 76/140 (54%), Gaps = 5/140 (3%)

Query: 91  FPVVNWLPFYNPKWFLSDLIAGITVGTVLVPQSMSYA-QIATLPPEYGLYSSFIGALVYS 149
            P  +W+P Y    F+ DL+AGIT+ +  +P ++SYA  +A + P  GLYS      +Y+
Sbjct: 82  LPCFSWIPEYTWSKFMGDLVAGITLASFQIPLALSYATSLAHVEPLCGLYSLAFTPFIYA 141

Query: 150 FFATSKDVCIGPVAVMSLQTAKVIARVKEKHPDLDPSITGPIIATVLAFICGIIATGVGL 209
            F +   + +GP + +SL   + + +++  + +    I+   I+ ++ FI G+     G+
Sbjct: 142 IFGSVPQMIVGPESAISLVVGQAVEKLRAHNHE----ISTMSISVLVTFISGMFLFVFGI 197

Query: 210 LRLGFLVELISLNAVAGFMT 229
            R GFL  ++S   + GF++
Sbjct: 198 CRFGFLGNVLSRALLRGFIS 217

 Score = 64.7 bits (156), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 44/170 (25%), Positives = 74/170 (43%), Gaps = 2/170 (1%)

Query: 387 IVLLLEHIAISKSFGRVNDYKINPNQEIIAIGVSNLLGTFFNAYPATGSFSRSALKAKCN 446
           I+   E    +KS G   ++ I+ N+E++A+G  NL  +   A PA G + RS + +   
Sbjct: 361 ILGFFESTTAAKSLGSAYEFAISSNRELVALGSMNLCASVLGALPAFGGYGRSKINSFSG 420

Query: 447 VMTPLSGIFSAACVLLAIYCLTGAFFYIPKATLSAVIIHAVFDLI--ASYHTTWSLWKMN 504
             T +SG+     VLL +        YIP   LS +       L+  A     +      
Sbjct: 421 AQTVMSGVCMGVIVLLTVKFFLSQIRYIPVCILSVITTIVGISLLEEAPADLRFHFNSRG 480

Query: 505 VFDFIGFITTVFITVFSSIENGIYFAVCWSCAILLYNNAFPAGKFLGRIE 554
             + + F  TV  T F S+E G+     +S   ++ ++A    + L R+E
Sbjct: 481 YDELLVFAVTVLTTFFYSLEMGVCIGCGYSVISIIKHSAKSRIQILARVE 530

>KLLA0E04731g Chr5 complement(418094..421276) [3183 bp, 1060 aa]
           {ON} similar to uniprot|P53273 Saccharomyces cerevisiae
           YGR125W Hypothetical ORF
          Length = 1060

 Score = 36.2 bits (82), Expect = 0.50,   Method: Compositional matrix adjust.
 Identities = 33/138 (23%), Positives = 58/138 (42%), Gaps = 15/138 (10%)

Query: 403 VNDYKINPNQEIIAIGVSNLLGTFFNAYPATGSFSRSALKAKCNVMTPLSGIFSAACVLL 462
           +N  K + ++E+IA G SNL+  F  +      ++ S L  +    +P++GI       +
Sbjct: 553 LNVDKYDVDKELIAHGYSNLISGFLGSIQNYLVYTNSVLFIRAGADSPIAGIMLTIGTFI 612

Query: 463 AIYCLTGAFFYIPKATLSAVIIHAVFDLIA-------------SYHTTWSL-WKMNVFDF 508
            +        +IP   + ++I    ++LI               Y T W +   M V DF
Sbjct: 613 VMVIGPVIISFIPICIVGSLIFLLGYELIQEAVIDTWGKLQPFEYLTIWIIVITMGVVDF 672

Query: 509 -IGFITTVFITVFSSIEN 525
            IG I  + +  FS + N
Sbjct: 673 VIGIIVGILLACFSFLVN 690

>NCAS0G00340 Chr7 (57980..60643) [2664 bp, 887 aa] {ON} Anc_5.690
           YKR089C
          Length = 887

 Score = 34.3 bits (77), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 34/124 (27%), Positives = 56/124 (45%), Gaps = 21/124 (16%)

Query: 775 DATALQSLADLRKAVNKYADRQVEFHFVG----IYSPWIKRGLRNLG---------FGTT 821
            A+ L     +    NK  DR++E  F G    I + W+ R L N+G          GT 
Sbjct: 182 QASQLYDYVTIENLTNKLRDRRLEQDFSGLLYLIRTNWV-RNLGNMGNVNLYRHSYVGTK 240

Query: 822 N--EEYSDESIIAGHSSYHLSRFRESEQDGFNELDSLESQRNIGSKTKVLAASGTNLPFF 879
           +  +EY  ES +A  +  + S   +S   G  +    +++RNIG KT ++ + G     F
Sbjct: 241 HIIDEYMKESHLAIEALLNQSEVDDSYLLGMLQ----QTRRNIG-KTALVLSGGATFGLF 295

Query: 880 HVDI 883
           H+ +
Sbjct: 296 HIGV 299

>TDEL0A02960 Chr1 complement(529484..532192) [2709 bp, 902 aa] {ON}
           Anc_2.521 YKR009C
          Length = 902

 Score = 34.3 bits (77), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 23/77 (29%), Positives = 41/77 (53%), Gaps = 3/77 (3%)

Query: 813 LRNLGFGTTNEEYSDESIIAGHSSYHLSRFRESEQDGFN--ELDSLESQRNIGSKTKVLA 870
           + N   GT N   ++ES +A   +  +++  +S +D FN  E D +     +G+ +K L+
Sbjct: 588 ITNFKSGTVNPSTTEESSMAILQAVQMAQSSKSSKDIFNYTERDCILYNLGLGATSKELS 647

Query: 871 ASGTNLPFFHVDIPDFS 887
            +  N P FHV +P F+
Sbjct: 648 LTYENDPNFHV-LPSFA 663

>KAFR0C01910 Chr3 (382140..385202) [3063 bp, 1020 aa] {ON} Anc_3.485
           YGR125W
          Length = 1020

 Score = 33.1 bits (74), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 30/156 (19%), Positives = 67/156 (42%), Gaps = 6/156 (3%)

Query: 407 KINPNQEIIAIGVSNLLGTFFNAYPATGSFSRSALKAKCNVMTPLSGIFSAACVLLAIYC 466
           K + ++E+IA G+SNL+   F +      ++ S L  +    +P +G       ++ +  
Sbjct: 503 KYDVDKELIAHGLSNLVSGMFGSIQNYLVYTNSVLFIRAGADSPFAGYLLIFLTIVVMLI 562

Query: 467 LTGAFFYIPKATLSAVIIHAVFD-LIASYHTTWSLWKMNVFDFIGFITTVFITVFSSIEN 525
                 +IP   + ++I    ++ L+ +   TW   K+  F+++  +  V          
Sbjct: 563 GPVIISFIPICIVGSLIFLLGYELLVEALLDTWD--KLTTFEYVTVVVIVLTMGIVDFVL 620

Query: 526 GIYFAVCWSCAILLYNNAFPA---GKFLGRIEIAEV 558
           GI   +  +C   L +++      G+F G++  + V
Sbjct: 621 GIIVGILIACFKFLIDSSKLQTINGEFSGKVAKSTV 656

>KLTH0F14674g Chr6 (1201874..1204906) [3033 bp, 1010 aa] {ON}
           similar to uniprot|P53273 Saccharomyces cerevisiae
           YGR125W Hypothetical ORF
          Length = 1010

 Score = 32.3 bits (72), Expect = 6.4,   Method: Compositional matrix adjust.
 Identities = 30/130 (23%), Positives = 54/130 (41%), Gaps = 3/130 (2%)

Query: 407 KINPNQEIIAIGVSNLLGTFFNAYPATGSFSRSALKAKCNVMTPLSGIFSAACVLLAIYC 466
           K++ ++E+IA G SN L     +      ++ S L  K      L+G+  AA     +  
Sbjct: 505 KLDVDKELIAHGYSNFLSGMIGSVQNYLVYTNSLLFIKAGADDSLAGLMLAAATFGIMVI 564

Query: 467 LTGAFFYIPKATLSAVIIHAVFDLIA-SYHTTWSLWKMNVFDFIGFITTVFITVFSSIEN 525
                 YIP   + ++I    ++L+  +   TW   K+N F++   +  VF         
Sbjct: 565 GPVIVAYIPVCIVGSLIFLLGYELLKEALVDTWG--KLNNFEYATVVAIVFTMGAFDFVL 622

Query: 526 GIYFAVCWSC 535
           GI   +  +C
Sbjct: 623 GIIVGILIAC 632

>SAKL0F02926g Chr6 complement(245957..249109) [3153 bp, 1050 aa]
           {ON} similar to uniprot|P53273 Saccharomyces cerevisiae
           YGR125W Hypothetical ORF
          Length = 1050

 Score = 32.0 bits (71), Expect = 8.8,   Method: Compositional matrix adjust.
 Identities = 30/130 (23%), Positives = 55/130 (42%), Gaps = 3/130 (2%)

Query: 407 KINPNQEIIAIGVSNLLGTFFNAYPATGSFSRSALKAKCNVMTPLSGIFSAACVLLAIYC 466
           K + ++E+IA G SNLL  F  +      ++ S L  +    +  +G   A    + +  
Sbjct: 544 KFDVDKELIAHGYSNLLSGFSGSIQNYLVYTNSFLFIRAGSDSSWAGFLLALGTFVVMII 603

Query: 467 LTGAFFYIPKATLSAVIIHAVFDLIA-SYHTTWSLWKMNVFDFIGFITTVFITVFSSIEN 525
                 +IP   + ++I    ++LI  +   TW   K+N F++I  +  VF         
Sbjct: 604 GPVIISFIPICIVGSLIFLLGYELIKEALFDTWG--KLNRFEYITIVIIVFTMGVFDFVL 661

Query: 526 GIYFAVCWSC 535
           GI   +  +C
Sbjct: 662 GIIVGILIAC 671

>ZYRO0B08228g Chr2 (641988..645869) [3882 bp, 1293 aa] {ON} similar
           to uniprot|Q75AR9 Ashbya gossypii ADL149W ADL149Wp and
           some similarites with YHR158C uniprot|P38853
           Saccharomyces cerevisiae YHR158C KEL1 Protein required
           for proper cell fusion and cell morphology functions in
           a complex with Kel2p to negatively regulate mitotic exit
           interacts with Tem1p and Lte1p localizes to regions of
           polarized growth potential Cdc28p substrate
          Length = 1293

 Score = 32.0 bits (71), Expect = 8.8,   Method: Compositional matrix adjust.
 Identities = 19/46 (41%), Positives = 24/46 (52%), Gaps = 8/46 (17%)

Query: 16  NNERPSNTNAGADIEKGLDTKKY--------FERSITDNSTYGKKS 53
           N E+P+NT   ADIE+  DT++          ERSI  N T   KS
Sbjct: 765 NTEKPANTEKPADIERPADTERSADIERSADIERSIDTNGTQENKS 810

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.321    0.138    0.421 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 99,630,703
Number of extensions: 4613768
Number of successful extensions: 15378
Number of sequences better than 10.0: 59
Number of HSP's gapped: 15635
Number of HSP's successfully gapped: 88
Length of query: 891
Length of database: 53,481,399
Length adjustment: 119
Effective length of query: 772
Effective length of database: 39,836,145
Effective search space: 30753503940
Effective search space used: 30753503940
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 70 (31.6 bits)