Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
CAGL0L12320g8.266ON27827811741e-163
Kpol_392.48.266ON281174960.001
TDEL0F039308.266ON280181910.005
YLR091W (GEP5)8.266ON29338790.16
Smik_12.1508.266ON29248740.56
Kwal_56.237778.266ON26743740.63
AGR082C8.266ON266108702.0
Suva_10.1758.266ON29943683.1
KLTH0G13596g8.266ON26780658.5
NOTE: 10 genes in the same pillar as CAGL0L12320g were not hit in these BLAST results
LIST: ZYRO0C01562g Skud_12.159 NCAS0B05040 KAFR0B02740 Ecym_4304 KLLA0F19228g KNAG0G02060 TPHA0J00760 NDAI0B02010 SAKL0H16940g

BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0L12320g
         (278 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0L12320g Chr12 (1332269..1333105) [837 bp, 278 aa] {ON} weak...   456   e-163
Kpol_392.4 s392 complement(4596..5441) [846 bp, 281 aa] {ON} com...    42   0.001
TDEL0F03930 Chr6 (731115..731957) [843 bp, 280 aa] {ON} Anc_8.26...    40   0.005
YLR091W Chr12 (322297..323178) [882 bp, 293 aa] {ON}  GEP5Protei...    35   0.16 
Smik_12.150 Chr12 (302200..303078) [879 bp, 292 aa] {ON} YLR091W...    33   0.56 
Kwal_56.23777 s56 complement(701822..702625) [804 bp, 267 aa] {O...    33   0.63 
AGR082C Chr7 complement(882744..883544) [801 bp, 266 aa] {ON} Sy...    32   2.0  
Suva_10.175 Chr10 (327133..328032) [900 bp, 299 aa] {ON} YLR091W...    31   3.1  
KLTH0G13596g Chr7 complement(1165293..1166096) [804 bp, 267 aa] ...    30   8.5  

>CAGL0L12320g Chr12 (1332269..1333105) [837 bp, 278 aa] {ON} weakly
           similar to uniprot|Q12393 Saccharomyces cerevisiae
           YLR091w
          Length = 278

 Score =  456 bits (1174), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 230/278 (82%), Positives = 230/278 (82%)

Query: 1   MSGRVLEVFRGLPLLPLSHEIVARCWDRMVRQRDVYYQFAVHVSHCHERLSTRNXXXXXX 60
           MSGRVLEVFRGLPLLPLSHEIVARCWDRMVRQRDVYYQFAVHVSHCHERLSTRN      
Sbjct: 1   MSGRVLEVFRGLPLLPLSHEIVARCWDRMVRQRDVYYQFAVHVSHCHERLSTRNLLRLVT 60

Query: 61  XXXXXXAPMNELPAHLRQYQSEYHALVASWPTVTERQILDAMELGKGMAVRIPHNKTLRQ 120
                 APMNELPAHLRQYQSEYHALVASWPTVTERQILDAMELGKGMAVRIPHNKTLRQ
Sbjct: 61  HVHHVLAPMNELPAHLRQYQSEYHALVASWPTVTERQILDAMELGKGMAVRIPHNKTLRQ 120

Query: 121 MFEQHEWLVQQXXXXXXXXXXXXXXXCEVQMATPXXXXXXXXXXXXXEISFRQCPLTIRE 180
           MFEQHEWLVQQ               CEVQMATP             EISFRQCPLTIRE
Sbjct: 121 MFEQHEWLVQQRLLDDKRLKRRRLLRCEVQMATPTTNGSTNGNTNGSEISFRQCPLTIRE 180

Query: 181 LTPLGALESEAKFKNRVRSDVHSLWRLLAVQHPPLSRPHADELVRTLKRTLGTSRTDRSI 240
           LTPLGALESEAKFKNRVRSDVHSLWRLLAVQHPPLSRPHADELVRTLKRTLGTSRTDRSI
Sbjct: 181 LTPLGALESEAKFKNRVRSDVHSLWRLLAVQHPPLSRPHADELVRTLKRTLGTSRTDRSI 240

Query: 241 ARAYLQLLQRAXXXXXXXXDTEAEAQLQYSRVSQLVSH 278
           ARAYLQLLQRA        DTEAEAQLQYSRVSQLVSH
Sbjct: 241 ARAYLQLLQRAYTYTYTYTDTEAEAQLQYSRVSQLVSH 278

>Kpol_392.4 s392 complement(4596..5441) [846 bp, 281 aa] {ON}
           complement(4596..5441) [846 nt, 282 aa]
          Length = 281

 Score = 41.6 bits (96), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 31/174 (17%), Positives = 60/174 (34%)

Query: 70  NELPAHLRQYQSEYHALVASWPTVTERQILDAMELGKGMAVRIPHNKTLRQMFEQHEWLV 129
           ++ P HL ++++ Y  L+  WP      +L+    G G  + +  N   R        + 
Sbjct: 84  DKFPNHLEKFKNHYMELLHHWPYEFHSDVLNMARPGTGSLIYLCLNNDDRFFNFYKSQIN 143

Query: 130 QQXXXXXXXXXXXXXXXCEVQMATPXXXXXXXXXXXXXEISFRQCPLTIRELTPLGALES 189
            +                 +                  E++    P+    L P+G    
Sbjct: 144 NKWFNSVDQYKLTDEQRVSIYNDIFKQIFFLKRHTTISEVNKNMVPIVEVPLKPIGCDIP 203

Query: 190 EAKFKNRVRSDVHSLWRLLAVQHPPLSRPHADELVRTLKRTLGTSRTDRSIARA 243
             + KN     V  +W+LL++  P +S  H   ++  L+ T    R +R   R+
Sbjct: 204 ACRIKNLFNKKVDYIWKLLSLSSPAISLSHEKIIMNILEDTKDNRRINRLYRRS 257

>TDEL0F03930 Chr6 (731115..731957) [843 bp, 280 aa] {ON} Anc_8.266
           YLR091W
          Length = 280

 Score = 39.7 bits (91), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 42/181 (23%), Positives = 73/181 (40%), Gaps = 10/181 (5%)

Query: 72  LPAHLRQYQSEYHALVASWPTVTERQILDAMELGKGMAVRIPHNKTLRQMFEQHEWLVQQ 131
           LP HL+ +QS Y  ++  WP    R IL+ ME  +  ++R     + + +    E+    
Sbjct: 77  LPVHLKMFQSHYTDMLMHWPYERHRSILN-MEKPRSTSLRYRWEDSSKTVLSMAEYSKNP 135

Query: 132 XXXXXXXXXXXXXXXCEVQMATPXXXXXXXXXXXXXEISFRQCPLTIRELT--PLGALES 189
                           ++   +                + R  P+ I E+   PLG   +
Sbjct: 136 WIEDNILSKKLTIIQRDLLFHSVFSHYLFLKANPRLCNNGRNLPIPIVEIPMRPLGNDIA 195

Query: 190 EAKFKNRVRSDVHSLWRLLAVQHPPLSRPHADELVRTLKRTLGTSRTDR-----SIARAY 244
            ++ KN  +S V   +R+LA+++P LSR   + L   +     +SR  R     S  RAY
Sbjct: 196 VSRIKNLFKSKVAHTYRILAIENPVLSRGSENILSEIISD--ASSRKQRRLYQASCKRAY 253

Query: 245 L 245
           +
Sbjct: 254 V 254

>YLR091W Chr12 (322297..323178) [882 bp, 293 aa] {ON}  GEP5Protein
           of unknown function, required for mitochondrial genome
           maintenance; detected in highly purified mitochondria in
           high-throughput studies; null mutant has decreased
           levels of cardiolipin and phosphatidylethanolamine
          Length = 293

 Score = 35.0 bits (79), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 13/38 (34%), Positives = 20/38 (52%)

Query: 70  NELPAHLRQYQSEYHALVASWPTVTERQILDAMELGKG 107
           N LP H   +Q  YH L+  WP    R ++D++ +  G
Sbjct: 82  NPLPRHAHLFQKHYHFLLTHWPFENHRDLVDSIAVNNG 119

>Smik_12.150 Chr12 (302200..303078) [879 bp, 292 aa] {ON} YLR091W
           (REAL)
          Length = 292

 Score = 33.1 bits (74), Expect = 0.56,   Method: Compositional matrix adjust.
 Identities = 16/48 (33%), Positives = 22/48 (45%)

Query: 70  NELPAHLRQYQSEYHALVASWPTVTERQILDAMELGKGMAVRIPHNKT 117
           N  P H   +Q  YH L+  WP    R ++D++   KG    IP   T
Sbjct: 82  NPRPRHALLFQKHYHFLLTHWPFENHRLLVDSIAAHKGKLNSIPSKTT 129

>Kwal_56.23777 s56 complement(701822..702625) [804 bp, 267 aa] {ON}
           YLR091W - Hypothetical ORF [contig 173] FULL
          Length = 267

 Score = 33.1 bits (74), Expect = 0.63,   Method: Compositional matrix adjust.
 Identities = 15/43 (34%), Positives = 24/43 (55%)

Query: 174 CPLTIRELTPLGALESEAKFKNRVRSDVHSLWRLLAVQHPPLS 216
            P+    + PLG   ++ + KN  +  V  +WR+LAV +P LS
Sbjct: 166 VPIVEIPMKPLGQNIADVRIKNLFKRKVAYVWRILAVDNPALS 208

 Score = 30.0 bits (66), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 14/43 (32%), Positives = 23/43 (53%), Gaps = 1/43 (2%)

Query: 70  NELPAHLRQYQSEYHALVASWPTVTERQILDAMELGKGMAVRI 112
           NE+P H++ ++  Y+ L   WP    R IL  M+  K  ++R 
Sbjct: 62  NEIPQHIKAFREHYNELRDFWPYECHRTIL-GMQSPKSQSIRF 103

>AGR082C Chr7 complement(882744..883544) [801 bp, 266 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR091W
          Length = 266

 Score = 31.6 bits (70), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 34/108 (31%), Positives = 54/108 (50%), Gaps = 16/108 (14%)

Query: 170 SFRQCPLTIRE--LTPLGALESEAKFKNRVRSDVHSLWRLLAVQHPPLSRPHADELVRTL 227
           S R+ P+ + E  +TPLG    + +     +    S+ RLL  +HP L+ P A+E    +
Sbjct: 169 SVRRLPIPVVEIGMTPLGFDIPDVRVDGLFKDKTKSVLRLLYREHPALT-PAAEE---DM 224

Query: 228 KRTLGTSRTDRSIARAYLQLLQRAXXXXXXXXDTEAEAQLQYSRVSQL 275
            R +    T R++ R YL+  +RA          +A+AQL   RVS+L
Sbjct: 225 LRIIAECPT-RAMRRIYLRACRRAYV-------LDADAQL--FRVSRL 262

>Suva_10.175 Chr10 (327133..328032) [900 bp, 299 aa] {ON} YLR091W
           (REAL)
          Length = 299

 Score = 30.8 bits (68), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 12/43 (27%), Positives = 21/43 (48%)

Query: 70  NELPAHLRQYQSEYHALVASWPTVTERQILDAMELGKGMAVRI 112
           N  P H   +Q  YH L++ WP    R ++D++    G  + +
Sbjct: 82  NPRPRHAHLFQKHYHFLLSHWPFENHRSLVDSIPAQNGKLISL 124

>KLTH0G13596g Chr7 complement(1165293..1166096) [804 bp, 267 aa]
           {ON} weakly similar to uniprot|Q12393 Saccharomyces
           cerevisiae YLR091W Hypothetical ORF
          Length = 267

 Score = 29.6 bits (65), Expect = 8.5,   Method: Compositional matrix adjust.
 Identities = 23/80 (28%), Positives = 40/80 (50%), Gaps = 6/80 (7%)

Query: 174 CPLTIRELTPLGALESEAKFKNRVRSDVHSLWRLLAVQHPPLSRPHADELVRTLKRTLGT 233
            P+    + PLG    E + +N  +  +  +W++LA+  P LSR   +EL  +L + + +
Sbjct: 166 VPIVEIPMKPLGQNIPEVRVRNLFKRKIAYVWKVLALDSPALSR--QNEL--SLAKIIDS 221

Query: 234 SR--TDRSIARAYLQLLQRA 251
            +   D S  R   +L QRA
Sbjct: 222 PQLPEDVSSKRELKRLYQRA 241

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.323    0.132    0.400 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 19,656,222
Number of extensions: 591390
Number of successful extensions: 1557
Number of sequences better than 10.0: 12
Number of HSP's gapped: 1586
Number of HSP's successfully gapped: 14
Length of query: 278
Length of database: 53,481,399
Length adjustment: 108
Effective length of query: 170
Effective length of database: 41,097,471
Effective search space: 6986570070
Effective search space used: 6986570070
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.5 bits)
S2: 65 (29.6 bits)