Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
CAGL0L12298g8.265ON28627511391e-158
KLTH0G13618g8.265ON3021921465e-10
SAKL0H16962g8.265ON3362161211e-06
Kwal_56.237818.265ON2931111182e-06
ZYRO0C01584g8.265ON282125986e-04
YDR113C (PDS1)8.265ON373266840.039
TDEL0F039208.265ON322225840.042
Suva_2.2738.265ON376160800.13
Smik_4.3588.265ON371234770.27
AGR083W8.265ON295165750.52
Ecym_43058.265ON31144740.76
Skud_4.3748.265ON373233740.82
KLLA0F19206g8.265ON26362721.1
Kpol_543.418.265ON30672674.3
KLTH0G06622g5.291ON39292659.8
YLR014C (PPR1)5.235ON90422659.9
NOTE: 6 genes in the same pillar as CAGL0L12298g were not hit in these BLAST results
LIST: NCAS0B03830 TBLA0E04460 KAFR0B05510 KNAG0H03230 TPHA0A01780 NDAI0J01350

BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0L12298g
         (286 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0L12298g Chr12 complement(1331112..1331972) [861 bp, 286 aa]...   443   e-158
KLTH0G13618g Chr7 (1166359..1167267) [909 bp, 302 aa] {ON} weakl...    61   5e-10
SAKL0H16962g Chr8 (1489800..1490810) [1011 bp, 336 aa] {ON} weak...    51   1e-06
Kwal_56.23781 s56 (702900..703781) [882 bp, 293 aa] {ON} YDR113C...    50   2e-06
ZYRO0C01584g Chr3 (112438..113286) [849 bp, 282 aa] {ON} weakly ...    42   6e-04
YDR113C Chr4 complement(680496..681617) [1122 bp, 373 aa] {ON}  ...    37   0.039
TDEL0F03920 Chr6 complement(729845..730813) [969 bp, 322 aa] {ON...    37   0.042
Suva_2.273 Chr2 complement(475164..476294) [1131 bp, 376 aa] {ON...    35   0.13 
Smik_4.358 Chr4 complement(641799..642914) [1116 bp, 371 aa] {ON...    34   0.27 
AGR083W Chr7 (883948..884835) [888 bp, 295 aa] {ON} Syntenic hom...    33   0.52 
Ecym_4305 Chr4 (649254..650189) [936 bp, 311 aa] {ON} similar to...    33   0.76 
Skud_4.374 Chr4 complement(652139..653260) [1122 bp, 373 aa] {ON...    33   0.82 
KLLA0F19206g Chr6 complement(1780093..1780884) [792 bp, 263 aa] ...    32   1.1  
Kpol_543.41 s543 complement(90836..91756) [921 bp, 306 aa] {ON} ...    30   4.3  
KLTH0G06622g Chr7 (527870..529048) [1179 bp, 392 aa] {ON} simila...    30   9.8  
YLR014C Chr12 complement(172268..174982) [2715 bp, 904 aa] {ON} ...    30   9.9  

>CAGL0L12298g Chr12 complement(1331112..1331972) [861 bp, 286 aa]
           {ON} weakly similar to uniprot|P40316 Saccharomyces
           cerevisiae YDR113c cell cycle regulator
          Length = 286

 Score =  443 bits (1139), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 231/275 (84%), Positives = 231/275 (84%)

Query: 1   MGAVETDKENNVVGTLREKGPATPTQLLKRTRSTLLPKKNGQRQPLASKDKNYNRSSSYL 60
           MGAVETDKENNVVGTLREKGPATPTQLLKRTRSTLLPKKNGQRQPLASKDKNYNRSSSYL
Sbjct: 1   MGAVETDKENNVVGTLREKGPATPTQLLKRTRSTLLPKKNGQRQPLASKDKNYNRSSSYL 60

Query: 61  SLKRNSNQKKLKPAVTRAGSTANNANRRVTSLILKDIAXXXXXXXXXXXXXXXXXXXNPL 120
           SLKRNSNQKKLKPAVTRAGSTANNANRRVTSLILKDIA                   NPL
Sbjct: 61  SLKRNSNQKKLKPAVTRAGSTANNANRRVTSLILKDIASGDEKESASESDSEDDEESNPL 120

Query: 121 ALKIKQALTHSIASAEGKTGLLNGKSGLRKIFNDRDLDREIEVASVRXXXXXXXXXXXXX 180
           ALKIKQALTHSIASAEGKTGLLNGKSGLRKIFNDRDLDREIEVASVR             
Sbjct: 121 ALKIKQALTHSIASAEGKTGLLNGKSGLRKIFNDRDLDREIEVASVREPEKPYEPEGYEP 180

Query: 181 XXXXXXXXXXXXNAINRPTFIMDSPRAISIVGDDSPQLLPLDLEESKLEEGVLNDKNTTD 240
                       NAINRPTFIMDSPRAISIVGDDSPQLLPLDLEESKLEEGVLNDKNTTD
Sbjct: 181 LDDSDLEKLKLKNAINRPTFIMDSPRAISIVGDDSPQLLPLDLEESKLEEGVLNDKNTTD 240

Query: 241 EVITRANTQAKNANITESIDDCSSVEIDSIYDGRG 275
           EVITRANTQAKNANITESIDDCSSVEIDSIYDGRG
Sbjct: 241 EVITRANTQAKNANITESIDDCSSVEIDSIYDGRG 275

>KLTH0G13618g Chr7 (1166359..1167267) [909 bp, 302 aa] {ON} weakly
           similar to uniprot|P40316 Saccharomyces cerevisiae
           YDR113C PDS1
          Length = 302

 Score = 60.8 bits (146), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 64/192 (33%), Positives = 85/192 (44%), Gaps = 31/192 (16%)

Query: 1   MGAVETDKENNVVGTLREKGPATPTQLLKRTRSTL---LPKKNGQRQPLASKDKNYNRSS 57
           MG  E DKEN++        P TP  LL R++S +    PK+   R+PLASKD   NRS 
Sbjct: 1   MGRHE-DKENSIWS--ESNVPVTPRHLLSRSQSFMKNKSPKRAEARRPLASKDN--NRSV 55

Query: 58  SYLSLKRNSNQKKLKPAVTRAGSTANNAN------------RRVTSLILKD-IAXXXXXX 104
           SYL  K    +K+ +P V  AGS   NA              ++ SL+LKD I       
Sbjct: 56  SYLGTK-EPLRKRTRPGVNHAGSFVGNARLGPAPTLNASGAPKIKSLVLKDGIEEEGSQS 114

Query: 105 XXXXXXXXXXXXXNPLALKIKQALTHSIASAEG-KTGLLNGKSGLRKIFNDR-------- 155
                        N LA K++  L      AEG +TGLL    GL+ +   +        
Sbjct: 115 EGAEVDEDDDDDSNRLAAKLRTKLLSRDRDAEGEQTGLLGATGGLQSLLGPKLSQRAEES 174

Query: 156 DLDREIEVASVR 167
           D D+E+EV   R
Sbjct: 175 DSDQEVEVIPPR 186

>SAKL0H16962g Chr8 (1489800..1490810) [1011 bp, 336 aa] {ON} weakly
           similar to uniprot|P40316 Saccharomyces cerevisiae
           YDR113C PDS1 Securin that inhibits anaphase by binding
           separin Esp1p also blocks cyclin destruction and mitotic
           exit essential for cell cycle arrest in mitosis in the
           presence of DNA damage or aberrant mitotic spindles also
           present in meiotic nuclei
          Length = 336

 Score = 51.2 bits (121), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 62/216 (28%), Positives = 86/216 (39%), Gaps = 60/216 (27%)

Query: 7   DKENNVVGTLREKGPATPTQLLKRTRSTLLP-------KKNGQRQPLASKDKNY------ 53
           +KEN +  +  E  P TP+ LLKR++S + P       KK+G+R PLASKD N       
Sbjct: 6   NKENVIFSS--ENLPTTPSHLLKRSQSFMKPLASNSPTKKSGKRLPLASKDNNKSNTLIN 63

Query: 54  NRSSSYL-------SLKRNSNQKKLKPAVTRAGSTAN----------------------- 83
           N   S L       SL      K+ +P V+  GS  N                       
Sbjct: 64  NGQKSALVNLAPNNSLLHGGKLKRNRPVVSNTGSFINTNTSKSSFPLLPDSRLKKYGSVL 123

Query: 84  --NANRRVTSLILKD-----IAXXXXXXXXXXXXXXXXXXXNPLALKIKQALTHSIAS-- 134
             N   RV SL+LKD     +                    NPLA K+ +AL +      
Sbjct: 124 GYNGLPRVKSLVLKDVDERKVGKSEEGEEEEEDDDEEEEEDNPLAAKLLKALNNHNEDDK 183

Query: 135 AEGKTGLLNGKSGLRKIFNDRDL------DREIEVA 164
            EG  GLL   +GL+++   R++      D EIE+ 
Sbjct: 184 EEGSIGLLGSNTGLQQLLKHRNVEEGENSDFEIEIV 219

>Kwal_56.23781 s56 (702900..703781) [882 bp, 293 aa] {ON} YDR113C
           (PDS1) - 42-kDa nuclear protein [contig 173] FULL
          Length = 293

 Score = 50.1 bits (118), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 42/111 (37%), Positives = 57/111 (51%), Gaps = 21/111 (18%)

Query: 1   MGAVETDKENNVVGTLREKGPATPTQLLKRTRSTLL---PKKNGQRQPLASKDKNYNRSS 57
           MGA E +KEN +        P TPT LL R++S +    PK+  QR+PLASKD   N+S+
Sbjct: 1   MGARE-NKENAIWS--ERSVPVTPTHLLSRSQSFMKNISPKRAEQRKPLASKDN--NKST 55

Query: 58  SYLSLKRNSNQKKLKPAVTRAGSTANNAN------------RRVTSLILKD 96
            +L  K    +K+ +P V  AGS   N               R+ SL+LKD
Sbjct: 56  GFLGAKE-PLRKRTRPTVNHAGSFIGNTRPGVVPILNTNGAPRIKSLVLKD 105

>ZYRO0C01584g Chr3 (112438..113286) [849 bp, 282 aa] {ON} weakly
           similar to uniprot|P40316 Saccharomyces cerevisiae
           YDR113C PDS1 Securin that inhibits anaphase by binding
           separin Esp1p also blocks cyclin destruction and mitotic
           exit essential for cell cycle arrest in mitosis in the
           presence of DNA damage or aberrant mitotic spindles also
           present in meiotic nuclei
          Length = 282

 Score = 42.4 bits (98), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 45/125 (36%), Positives = 64/125 (51%), Gaps = 35/125 (28%)

Query: 1   MGAVETDKENNVVGTLREKG----PATPTQLLKRTRSTLL-PKKN-------------GQ 42
           +G V+ +KENNVV    E G    P TP  LLKR++  +L P++N             GQ
Sbjct: 2   VGKVQDNKENNVVLDPGENGSLALPQTPIHLLKRSQPNVLKPEENTPVKKSRSVSPVRGQ 61

Query: 43  RQ-PLASKDKNYNRSSSYLSLKRN---------SNQKKLKPAVTRAGSTANNAN-RRVTS 91
           R+ PLASKD  +N+SS+   +K+          SN +KL+    + GS     +  R  S
Sbjct: 62  RRLPLASKD--HNKSSAAGPVKKRQPTLQGELLSNPRKLQ----KYGSVLGYTDLPRTKS 115

Query: 92  LILKD 96
           L+LKD
Sbjct: 116 LVLKD 120

>YDR113C Chr4 complement(680496..681617) [1122 bp, 373 aa] {ON}
           PDS1Securin, inhibits anaphase by binding separin Esp1p;
           blocks cyclin destruction and mitotic exit, essential
           for meiotic progression and mitotic cell cycle arrest;
           localization is cell-cycle dependent and regulated by
           Cdc28p phosphorylation
          Length = 373

 Score = 37.0 bits (84), Expect = 0.039,   Method: Compositional matrix adjust.
 Identities = 63/266 (23%), Positives = 95/266 (35%), Gaps = 100/266 (37%)

Query: 1   MGAVETDKENNVVGTLREKG----PATPTQLLKRTRSTLL-------------------- 36
           M     DKENN+V T  E      P TP  LLKR+ S +L                    
Sbjct: 1   MMPANEDKENNIVYTGNESSGINFPQTPAHLLKRSHSNILKPPVRLDQLKRDANSNNGNT 60

Query: 37  -----------PKK----NGQRQ---PLASKDKNYNRSSSY------------------L 60
                      P K    + Q+Q   PLA+KD N ++S  +                  L
Sbjct: 61  LKYIQGGKEVSPTKRLHTHAQQQGRLPLAAKDNNRSKSFIFPETSNQSKDADLPQLQNTL 120

Query: 61  SLKRNSNQKKLKPAVTRAGSTAN--------------------NANRRVTSLILKDIAXX 100
           S+++N   +KL   ++R+ S AN                    NA  ++ SL+LKD+A  
Sbjct: 121 SIRKNDQLRKLS-QISRSRSRANHNDLLSNSRKLQKYGSVLGYNALPKMKSLVLKDLADS 179

Query: 101 XXXXXXXXXXXXXXXXXNPLALKIKQALTHSIAS-----AEGKTGLLNGKSGLRKIF--- 152
                            + L  K++ AL    +S       G  GL N + GL+++    
Sbjct: 180 GKNEESSDDDEGNEDSESKLGKKLQSALLKQDSSDGENELNGGLGLFNEQGGLQQLIKNS 239

Query: 153 -----------NDRDLDREIEVASVR 167
                      +D+  D +IE+A  R
Sbjct: 240 TKNEQKTKNDKSDKTDDYDIEIAPQR 265

>TDEL0F03920 Chr6 complement(729845..730813) [969 bp, 322 aa] {ON}
           Anc_8.265 YDR113C
          Length = 322

 Score = 37.0 bits (84), Expect = 0.042,   Method: Compositional matrix adjust.
 Identities = 62/225 (27%), Positives = 84/225 (37%), Gaps = 68/225 (30%)

Query: 4   VETDKENNVVGTLREKG----PATPTQLLKRTRSTLLPKKNGQ----------------- 42
           +  +KEN++V  L E G    P TP  LLKR++S ++ K +G+                 
Sbjct: 3   INENKENDLVLNLPESGGVSFPQTPAHLLKRSQSAMM-KPSGEENPSNLTYRDCDAPVKR 61

Query: 43  ----------RQPLASKDKNYNRSSSY----------LSLKRNSNQKKLKPAVTRAGSTA 82
                     R PLASKD   NRS+ +           SLKRN +Q K + A    G   
Sbjct: 62  ASPSRRVQQGRPPLASKDN--NRSTGFLPQLQKLQQQPSLKRNLSQSKKRNANVVDGQLL 119

Query: 83  NNANR--------------RVTSLILKDIAXXXXXXXXXXXXXXXXXXXNPLALKIKQAL 128
            N  R              ++ SL+LKD+                      L LK+  A+
Sbjct: 120 TNPRRLKKYGSVLGYNALPKMKSLVLKDVDQVGEQGEDENDDEDEDHI---LRLKLHNAI 176

Query: 129 THSIASAEGKTGLLNGKSGLRKIFNDRDL------DREIEVASVR 167
             S    E   GL + KSGL  +  D         DREIE    R
Sbjct: 177 DRSDEEGEEVGGLFD-KSGLLHLVRDSKKDEDDWEDREIEYGPQR 220

>Suva_2.273 Chr2 complement(475164..476294) [1131 bp, 376 aa] {ON}
           YDR113C (REAL)
          Length = 376

 Score = 35.4 bits (80), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 42/160 (26%), Positives = 72/160 (45%), Gaps = 26/160 (16%)

Query: 26  QLLKRTRSTLLPKKNGQRQPLASKDKNYNRSSSYLSLKRNSNQKKLKPAVTRAGST-ANN 84
           +++ + ++TL  +KN Q + L+   +N NR  +Y  +  NS  +KL+    + GS    N
Sbjct: 112 EIVPQQQNTLSTRKNDQLRKLSQVSRNRNR-GNYNGMLNNS--RKLQ----KYGSVLGYN 164

Query: 85  ANRRVTSLILKDIAXXXXXXXXXXXXXXXXXXXNPLALKIKQALTHSIASAE-----GKT 139
           A  ++ SL+LKD+A                   N L+ K++ A     +S +     G  
Sbjct: 165 ALPKMKSLVLKDLADPAKNQESSDDDDGSEGTDNKLSQKLQSAFFQQHSSEDEHEFSGGI 224

Query: 140 GLLNGKSGLRKIF------------NDRDLDREIEVASVR 167
           GL N + GL+++              D D D +IE+A  R
Sbjct: 225 GLFNNQGGLQQLIKNTAKGKEGPGKEDGD-DHDIEIAPQR 263

>Smik_4.358 Chr4 complement(641799..642914) [1116 bp, 371 aa] {ON}
           YDR113C (REAL)
          Length = 371

 Score = 34.3 bits (77), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 54/234 (23%), Positives = 82/234 (35%), Gaps = 90/234 (38%)

Query: 7   DKENNVV----GTLREKGPATPTQLLKRTRSTLL-------------------------- 36
           DKENN+V    G+     P TP  LLKR+ S +L                          
Sbjct: 6   DKENNIVYSGNGSSNLNFPQTPAHLLKRSHSNVLKPPTRLDQLKKDVNSNNCNALKYIQG 65

Query: 37  -----PKK----NGQRQ---PLASKDKNYNRSSSYLSLKRNSNQKKLKPAVTRAGST--- 81
                P K    + Q+Q   PLA+KD   NR+ S++ +  NSNQ K    + +  +T   
Sbjct: 66  GKEVSPTKRLHTHAQQQGRLPLAAKDN--NRAKSFIFIPENSNQSKDADIIPQQQNTLSI 123

Query: 82  ------------ANNANR--------------------------RVTSLILKDIAXXXXX 103
                       + N NR                          ++ SL+LKD+      
Sbjct: 124 RKNDQLRKLSQISRNRNRVNHSDLLNNTRKLQKYGSVLGYNALPKMKSLVLKDLVDPGKN 183

Query: 104 XXXXXXXXXXXXXXNPLALKIKQALTHSIASAE-----GKTGLLNGKSGLRKIF 152
                         N L+ K++ AL    +S +     G  GL N + GL+++ 
Sbjct: 184 EESSDDDDGSEGSENKLSKKLQNALLQQHSSDDEHEFSGDIGLFNNQGGLQQLI 237

>AGR083W Chr7 (883948..884835) [888 bp, 295 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR113C (PDS1)
          Length = 295

 Score = 33.5 bits (75), Expect = 0.52,   Method: Compositional matrix adjust.
 Identities = 47/165 (28%), Positives = 65/165 (39%), Gaps = 32/165 (19%)

Query: 7   DKENNVVGTLR-EKGPATPTQLLKRTRSTLLPKKNGQRQPLASKDKNYNRSSSYL----- 60
           DKEN V    R    P TP   LKR+ S L   +N  R PLASKD+N ++    L     
Sbjct: 6   DKENLVTSAGRGAMMPRTPIHQLKRSSSNLA-GRNSTRMPLASKDRNQSQGVFGLKTSGA 64

Query: 61  ----------------SLKRNSNQKKLKPAVTRAGSTANNANRRVTSLILKDIAXXXXXX 104
                           S+ +N    KLK   +  G     +  +  SL+LKD +      
Sbjct: 65  GGAGGAQAQSKRPASSSIAKNMPDSKLKKYGSVLG-VGYGSLAKAKSLVLKDTS-----D 118

Query: 105 XXXXXXXXXXXXXNPLALKIKQALTHSIASA---EGKTGLLNGKS 146
                        NPLA K+K  L  +       +G +GLL G++
Sbjct: 119 CESANEESEEEEGNPLAAKLKSRLCSAEEGGNEDDGSSGLLLGEA 163

>Ecym_4305 Chr4 (649254..650189) [936 bp, 311 aa] {ON} similar to
          Ashbya gossypii AGR083W
          Length = 311

 Score = 33.1 bits (74), Expect = 0.76,   Method: Compositional matrix adjust.
 Identities = 22/44 (50%), Positives = 27/44 (61%), Gaps = 3/44 (6%)

Query: 21 PATPTQLLKRTRSTLLPKKNGQRQPLASKDKNYNRSSSYLSLKR 64
          P TP   LKR+ S +   KN  R PLASKD+  NRS S  +LK+
Sbjct: 22 PRTPMHQLKRSTSNVH-LKNNSRLPLASKDR--NRSQSGFNLKQ 62

>Skud_4.374 Chr4 complement(652139..653260) [1122 bp, 373 aa] {ON}
           YDR113C (REAL)
          Length = 373

 Score = 33.1 bits (74), Expect = 0.82,   Method: Compositional matrix adjust.
 Identities = 53/233 (22%), Positives = 84/233 (36%), Gaps = 88/233 (37%)

Query: 7   DKENNVVGTLREKG----PATPTQLLKRTRSTLL-------------------------- 36
           DKENN+V T  E      P TP  LLKR+ S +L                          
Sbjct: 6   DKENNIVYTGNESSGINFPQTPAHLLKRSHSNVLKPPVRLDQLKKDLNSNNGKGLKYIQG 65

Query: 37  -----PKK----NGQRQ---PLASKDKNYNRSSSY--------------------LSLKR 64
                P K    + Q+Q   PLA+KD N ++S  +                    LS+++
Sbjct: 66  GKEVSPTKRLHTHAQQQGRLPLAAKDNNRSKSFVFVSETTNLSKDSEAIPQQQNTLSIRK 125

Query: 65  NSNQKKLKPAVTRAGSTAN--------------------NANRRVTSLILKDIAXXXXXX 104
           N   ++L   ++R  + AN                    NA  ++ SL+LKD+A      
Sbjct: 126 NDQLRQLS-QISRNRTRANYNELLNNSRKLQKYGSVLGYNALPKMKSLVLKDLAGPAKNQ 184

Query: 105 XXXXXXXXXXXXXNPLALKIKQALTHSIAS-----AEGKTGLLNGKSGLRKIF 152
                        + L +K++ A     +S     + G  GL N + GL+++ 
Sbjct: 185 ESSDDDDGSEGPESKLGVKLQNAFLQQHSSDDEHESNGDIGLFNNQGGLQQLI 237

>KLLA0F19206g Chr6 complement(1780093..1780884) [792 bp, 263 aa]
          {ON} weakly similar to uniprot|P40316 Saccharomyces
          cerevisiae YDR113C PDS1 Securin that inhibits anaphase
          by binding separin Esp1p also blocks cyclin destruction
          and mitotic exit essential for cell cycle arrest in
          mitosis in the presence of DNA damage or aberrant
          mitotic spindles also present in meiotic nuclei
          Length = 263

 Score = 32.3 bits (72), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 25/62 (40%), Positives = 33/62 (53%), Gaps = 6/62 (9%)

Query: 20 GPATPTQLLKRTRSTLLPKKNGQRQPLASKDKNYNRSSSYLSLKRNSNQKKLKPAVTRAG 79
          G  TP   +KRT S +     G R+PLASKD   NR+ S LS+K N+   K    + R  
Sbjct: 20 GLRTPLNQMKRTDSLV----RGNRRPLASKDN--NRTQSILSVKNNAALGKSDHPLKRPA 73

Query: 80 ST 81
          S+
Sbjct: 74 SS 75

>Kpol_543.41 s543 complement(90836..91756) [921 bp, 306 aa] {ON}
          complement(90836..91756) [921 nt, 307 aa]
          Length = 306

 Score = 30.4 bits (67), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 27/72 (37%), Positives = 35/72 (48%), Gaps = 22/72 (30%)

Query: 4  VETDKENNVV-GTLREKGPATPTQLLKRTRSTLLPKKNG----------------QRQPL 46
          ++ +KENN+    + +  P TP  LLKRT S L   K G                +R PL
Sbjct: 1  MDQNKENNIFRHAMLKDMPQTPNNLLKRTHSKL---KTGIAKDIQGGNVINTSPQKRLPL 57

Query: 47 ASKDKNYNRSSS 58
          ASKD   NRS+S
Sbjct: 58 ASKDN--NRSNS 67

>KLTH0G06622g Chr7 (527870..529048) [1179 bp, 392 aa] {ON} similar
           to uniprot|Q05648 Saccharomyces cerevisiae YDR282C
           Hypothetical ORF
          Length = 392

 Score = 29.6 bits (65), Expect = 9.8,   Method: Compositional matrix adjust.
 Identities = 24/92 (26%), Positives = 40/92 (43%), Gaps = 12/92 (13%)

Query: 4   VETDKENNVVGTLREKGPATPTQLL---KRTRSTLLPKKNGQRQPLASKDKNYNRSSSYL 60
           V+  + NN +GT + +    P   L   K  R + LP K G    +   + N N+ + +L
Sbjct: 28  VKILQANNEIGTSKVRSVKVPRGSLSAAKNLRRSFLPNKKGTHSQMVVNNPNTNKLAYFL 87

Query: 61  SLKRNSNQKKLKPAVTRAGSTANNANRRVTSL 92
                    K KP  T   S + + N+ ++SL
Sbjct: 88  ---------KTKPCTTVTTSESYDLNKVISSL 110

>YLR014C Chr12 complement(172268..174982) [2715 bp, 904 aa] {ON}
           PPR1Zinc finger transcription factor containing a
           Zn(2)-Cys(6) binuclear cluster domain, positively
           regulates transcription of URA1, URA3, URA4, and URA10,
           which are involved in de novo pyrimidine biosynthesis,
           in response to pyrimidine starvation; activity may be
           modulated by interaction with Tup1p
          Length = 904

 Score = 29.6 bits (65), Expect = 9.9,   Method: Compositional matrix adjust.
 Identities = 12/22 (54%), Positives = 17/22 (77%)

Query: 246 ANTQAKNANITESIDDCSSVEI 267
           A+T+ K  N+TE ID CSSV++
Sbjct: 345 AHTEPKRENVTEKIDVCSSVDV 366

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.309    0.127    0.338 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 24,938,779
Number of extensions: 974855
Number of successful extensions: 3915
Number of sequences better than 10.0: 33
Number of HSP's gapped: 4024
Number of HSP's successfully gapped: 35
Length of query: 286
Length of database: 53,481,399
Length adjustment: 108
Effective length of query: 178
Effective length of database: 41,097,471
Effective search space: 7315349838
Effective search space used: 7315349838
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.7 bits)
S2: 65 (29.6 bits)