Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
CAGL0L12276g8.264ON45245222320.0
Kpol_543.408.264ON4144237142e-89
ZYRO0C01606g8.264ON4324717128e-89
NDAI0B020008.264ON4334586919e-86
TDEL0F039108.264ON4294256743e-83
TPHA0A017908.264ON4394626571e-80
NCAS0B050308.264ON4334706483e-79
Suva_10.1748.264ON4564536276e-76
KLTH0G13640g8.264ON4144726176e-75
Smik_12.1498.264ON4604506181e-74
SAKL0H16984g8.264ON4354626135e-74
YLR090W (XDJ1)8.264ON4594486042e-72
Skud_12.1588.264ON4554486014e-72
AGR084C8.264ON4274625933e-71
Kwal_56.237828.264ON4144065532e-65
Ecym_43068.264ON4344255377e-63
KNAG0G020508.264ON4324285183e-60
KLLA0F19184g8.264ON5124374799e-54
TPHA0C031102.243ON4073933611e-37
Ecym_32812.243ON4093943565e-37
KAFR0J009402.243ON4113923558e-37
ZYRO0A01496g2.243ON4123943558e-37
CAGL0J09966g2.243ON4073873478e-36
ADL257C2.243ON4103913461e-35
KLLA0F03333g2.243ON4093733461e-35
Suva_14.2772.243ON4094103461e-35
TDEL0C046002.243ON4114193452e-35
Smik_14.2632.243ON4093953408e-35
NDAI0D010302.243ON4114133408e-35
KNAG0I019002.243ON4093913391e-34
Skud_14.2682.243ON4103953391e-34
Kpol_1003.122.243ON4083923372e-34
Kwal_23.48302.243ON4113923363e-34
TBLA0E038102.243ON4103933363e-34
YNL064C (YDJ1)2.243ON4093953355e-34
TDEL0C043502.218ON4624023304e-33
NCAS0G030002.243ON4103913171e-31
SAKL0E08734g2.243ON4113943143e-31
KLTH0G09394g2.243ON4113913135e-31
KLTH0G08756g2.218ON4624752999e-29
Kwal_23.30612.218ON4584582944e-28
CAGL0J10296g2.218ON4794162901e-27
SAKL0E09306g2.218ON4614002883e-27
Ecym_62368.730ON3743942791e-26
KNAG0M020202.218ON4603742751e-25
AER427W2.218ON4703962626e-24
Smik_14.2492.218ON5333462452e-21
KNAG0G028808.730ON3783902393e-21
NCAS0G028502.218ON4942772397e-21
Skud_14.2532.218ON5322752391e-20
Kpol_1002.1222.218ON5034252353e-20
YNL077W (APJ1)2.218ON5283422335e-20
SAKL0H05258g8.730ON3683922287e-20
Ecym_53842.218ON5033262282e-19
KLLA0E07899g2.218ON4952672192e-18
ZYRO0C15048g2.218ON4912652193e-18
Kwal_26.90248.730ON3753812154e-18
Suva_14.2622.218ON5362632175e-18
TPHA0D005508.61ON4863912141e-17
Suva_13.3978.730ON3753862092e-17
TPHA0G006308.730ON3933942102e-17
KLTH0D12496g8.730ON3753802066e-17
KLLA0C07260g8.730ON3683862049e-17
NCAS0B005308.730ON3753862031e-16
CAGL0F03729g8.730ON3613851994e-16
TDEL0B037908.730ON3733861994e-16
NDAI0F024502.218ON5302942007e-16
KAFR0A041608.730ON3783861987e-16
ZYRO0A06226g8.730ON3773981961e-15
Smik_13.4228.730ON3783861942e-15
TBLA0E036602.218ON4484581934e-15
NDAI0G032808.61ON5524461936e-15
YMR214W (SCJ1)8.730ON3773891899e-15
AER346W8.730ON3673751881e-14
KLLA0D07656g8.61ON4713241872e-14
TPHA0C029802.218ON5542841846e-14
Skud_13.3838.730ON3753861773e-13
SAKL0B02068g8.61ON5102631741e-12
YFL016C (MDJ1)8.61ON5113901732e-12
Kpol_1011.98.61ON4954391704e-12
KLTH0A02882g8.61ON4732651686e-12
Kwal_47.179578.61ON4782491677e-12
Suva_6.448.61ON5074191651e-11
NDAI0E008708.730ON3763811632e-11
CAGL0J04224g8.61ON5223051642e-11
Smik_6.638.61ON5103081581e-10
AFR507W8.61ON4742451552e-10
Ecym_43727.217ON579711535e-10
Skud_6.568.61ON5172451525e-10
NDAI0A028207.157ON482791517e-10
TBLA0J018707.157ON470711518e-10
KLLA0D19602g2.15ON620701518e-10
KLLA0E04423g7.217ON428711499e-10
TBLA0D042407.217ON389751481e-09
TDEL0H022907.217ON387721471e-09
CAGL0I06226g1.185ON455781481e-09
TBLA0C014801.398ON353701462e-09
Skud_9.1817.157ON421811462e-09
YIR004W (DJP1)7.157ON432801462e-09
KLLA0C02981g1.113ON162771382e-09
CAGL0J01936g7.157ON425791463e-09
TPHA0B037601.398ON355701453e-09
NDAI0C026101.398ON340701443e-09
KLLA0D13464g7.157ON433791453e-09
TDEL0H032107.157ON411721454e-09
KLTH0A03740g7.217ON395721444e-09
Skud_5.1587.217ON391741444e-09
NDAI0E045607.217ON394741435e-09
KNAG0I007407.157ON425791445e-09
KLLA0E01629g2.350ON231721395e-09
Smik_10.3851.113ON172731366e-09
TPHA0L007907.157ON446721436e-09
TBLA0G001702.15ON659701446e-09
TBLA0A011007.157ON434741436e-09
NCAS0A132107.157ON414791436e-09
TBLA0E024907.217ON366751427e-09
NDAI0G042501.398ON363701427e-09
YER048C (CAJ1)7.217ON391741427e-09
Smik_9.2037.157ON432801427e-09
KAFR0B047807.157ON423791429e-09
ADR015W7.157ON436791429e-09
ZYRO0E04598g1.398ON357701419e-09
NCAS0E029307.217ON387791411e-08
CAGL0H03707g1.398ON349701401e-08
ZYRO0D16390g7.217ON398721401e-08
TPHA0C012607.217ON380721401e-08
CAGL0L00957g7.217ON373721391e-08
KAFR0C031608.61ON4984081401e-08
Kpol_457.151.398ON357701391e-08
Suva_9.2137.157ON431801392e-08
Smik_5.1737.217ON391741392e-08
Suva_5.1507.217ON391741392e-08
Ecym_44697.157ON433791392e-08
KAFR0H031501.398ON359701382e-08
Kwal_47.181337.217ON393721382e-08
ZYRO0G03850g7.157ON418721382e-08
KLLA0D04818g1.398ON354691372e-08
SAKL0F08052g7.217ON393741382e-08
Skud_14.3201.398ON368701373e-08
CAGL0J02750g7.217ON382721373e-08
Ecym_56262.350ON243711343e-08
KLTH0F13398g7.157ON419791374e-08
ABL194C2.15ON552701374e-08
NCAS0G036101.398ON327701354e-08
KAFR0L007407.217ON364741364e-08
NCAS0C039508.61ON5194451374e-08
SAKL0F04444g7.157ON429791365e-08
Suva_14.1162.15ON600701365e-08
CAGL0C04565g1.113ON175761295e-08
TPHA0A028101.185ON492701356e-08
Smik_14.3211.398ON366701346e-08
Kpol_499.307.157ON408721346e-08
Ecym_14508.61ON4922451357e-08
NDAI0F038002.15ON638701357e-08
YNL007C (SIS1)1.398ON352701337e-08
ZYRO0F03652g8.61ON4622471348e-08
KAFR0C024507.217ON373771338e-08
Kpol_1064.408.730ON387721338e-08
Kpol_1070.227.217ON380711338e-08
Kpol_2000.321.113ON167731278e-08
TDEL0B059601.398ON369701338e-08
KNAG0C024501.185ON544731349e-08
KNAG0L013307.217ON396721339e-08
AAL008W1.398ON349691329e-08
KNAG0G011308.61ON500721349e-08
Skud_14.1102.15ON596701331e-07
Ecym_11101.113ON156841251e-07
NDAI0D005001.113ON190761271e-07
CAGL0J07370g2.15ON623701331e-07
Suva_14.3411.398ON359701311e-07
YNL227C (JJJ1)2.15ON590701322e-07
ZYRO0F15400g2.15ON525701322e-07
SAKL0E06050g2.350ON232721282e-07
Smik_14.1062.15ON593721322e-07
Kwal_55.209657.157ON421791312e-07
KNAG0B018901.92ON370791302e-07
NCAS0G013602.15ON616701312e-07
KNAG0H016801.398ON363701292e-07
YJR097W (JJJ3)1.113ON172731242e-07
ADR124C1.297ON611711312e-07
Kwal_23.44202.15ON592701303e-07
TBLA0J009701.185ON586731303e-07
YJL073W (JEM1)1.297ON645711303e-07
Suva_12.1851.113ON168751233e-07
Kwal_0.2071.398ON353691283e-07
KLTH0H12100g1.398ON350691283e-07
KLTH0F04906g1.185ON590731294e-07
Smik_10.1681.297ON649711294e-07
TDEL0C058801.113ON159731215e-07
KAFR0A079502.15ON551721285e-07
TDEL0A064308.698ON666711286e-07
KLTH0F09944g2.350ON233711236e-07
Skud_10.3191.113ON168781206e-07
KNAG0F008602.15ON626701277e-07
Kpol_529.212.15ON622701277e-07
AEL112C1.185ON535731267e-07
SAKL0D08778g1.398ON348691257e-07
Kwal_33.138601.185ON578731268e-07
NDAI0B002001.185ON594731269e-07
NCAS0C048901.398ON367701259e-07
TDEL0C008708.61ON4702451259e-07
AFL190C2.350ON235711229e-07
SAKL0E14234g2.15ON678701269e-07
Kpol_1072.48.698ON661711251e-06
TBLA0A057401.113ON170821181e-06
Suva_6.1481.297ON642711241e-06
KAFR0A016201.297ON665721251e-06
Skud_10.1691.297ON644711242e-06
KLTH0F03124g1.113ON162741172e-06
YMR161W (HLJ1)2.350ON224721192e-06
KLTH0B08338g2.15ON590701232e-06
Ecym_12921.398ON347761212e-06
KNAG0J018408.698ON650711222e-06
SAKL0C03476g1.113ON165741153e-06
TDEL0E005002.15ON581701213e-06
Suva_8.3038.698ON664721204e-06
Kwal_23.3578singletonOFF85661094e-06
NCAS0I028301.185ON491751205e-06
Smik_15.4378.698ON663721205e-06
NDAI0H031802.350ON229711165e-06
ZYRO0F15972g1.113ON162751136e-06
TBLA0B037308.698ON693711196e-06
Smik_13.3612.350ON224721156e-06
AFR639W1.113ON156761127e-06
SAKL0B01276gna 1ON292791168e-06
YOR254C (SEC63)8.698ON663721189e-06
TDEL0C036801.185ON556731189e-06
Ecym_63181.297ON624731171e-05
KNAG0D013601.113ON185731121e-05
ZYRO0D10934g8.698ON663711171e-05
ZYRO0A07502g2.350ON238741141e-05
Kpol_2001.271.185ON520701161e-05
Ecym_80931.185ON543731161e-05
TPHA0B041901.113ON168771111e-05
CAGL0H04499g2.350ON232711131e-05
NCAS0D009602.350ON224711131e-05
TBLA0C027201.297ON715711161e-05
KAFR0H023108.698ON655711161e-05
Skud_13.3232.350ON224721121e-05
TBLA0B034908.730ON384731152e-05
TPHA0C045902.350ON233711122e-05
KLLA0B07271g1.185ON653721162e-05
SAKL0C05456g1.185ON583731152e-05
TPHA0O019402.15ON598701152e-05
Skud_10.521.185ON559731152e-05
Skud_15.4208.698ON665721152e-05
SAKL0D06226g1.297ON615711152e-05
SAKL0H00858g5.4ON432741142e-05
YJL162C (JJJ2)1.185ON583731152e-05
AFR659W1.92ON273821132e-05
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0L12276g
         (452 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0L12276g Chr12 (1329467..1330825) [1359 bp, 452 aa] {ON} sim...   864   0.0  
Kpol_543.40 s543 (89534..90778) [1245 bp, 414 aa] {ON} (89534..9...   279   2e-89
ZYRO0C01606g Chr3 complement(113396..114694) [1299 bp, 432 aa] {...   278   8e-89
NDAI0B02000 Chr2 (497023..498324) [1302 bp, 433 aa] {ON} Anc_8.264    270   9e-86
TDEL0F03910 Chr6 (728488..729777) [1290 bp, 429 aa] {ON} Anc_8.2...   264   3e-83
TPHA0A01790 Chr1 complement(362209..363528) [1320 bp, 439 aa] {O...   257   1e-80
NCAS0B05030 Chr2 (934492..935793) [1302 bp, 433 aa] {ON} Anc_8.264    254   3e-79
Suva_10.174 Chr10 (325531..326901) [1371 bp, 456 aa] {ON} YLR090...   246   6e-76
KLTH0G13640g Chr7 complement(1167336..1168580) [1245 bp, 414 aa]...   242   6e-75
Smik_12.149 Chr12 (300591..301973) [1383 bp, 460 aa] {ON} YLR090...   242   1e-74
SAKL0H16984g Chr8 complement(1490925..1492232) [1308 bp, 435 aa]...   240   5e-74
YLR090W Chr12 (320701..322080) [1380 bp, 459 aa] {ON}  XDJ1Putat...   237   2e-72
Skud_12.158 Chr12 (303908..305275) [1368 bp, 455 aa] {ON} YLR090...   236   4e-72
AGR084C Chr7 complement(885020..886303) [1284 bp, 427 aa] {ON} S...   233   3e-71
Kwal_56.23782 s56 complement(703853..705097) [1245 bp, 414 aa] {...   217   2e-65
Ecym_4306 Chr4 complement(650450..651754) [1305 bp, 434 aa] {ON}...   211   7e-63
KNAG0G02050 Chr7 (466752..468050) [1299 bp, 432 aa] {ON} Anc_8.2...   204   3e-60
KLLA0F19184g Chr6 (1778227..1779765) [1539 bp, 512 aa] {ON} simi...   189   9e-54
TPHA0C03110 Chr3 complement(687136..688359) [1224 bp, 407 aa] {O...   143   1e-37
Ecym_3281 Chr3 complement(532720..533949) [1230 bp, 409 aa] {ON}...   141   5e-37
KAFR0J00940 Chr10 complement(170725..171960) [1236 bp, 411 aa] {...   141   8e-37
ZYRO0A01496g Chr1 complement(123559..124797) [1239 bp, 412 aa] {...   141   8e-37
CAGL0J09966g Chr10 complement(978692..979915) [1224 bp, 407 aa] ...   138   8e-36
ADL257C Chr4 complement(249512..250744) [1233 bp, 410 aa] {ON} S...   137   1e-35
KLLA0F03333g Chr6 complement(313991..315220) [1230 bp, 409 aa] {...   137   1e-35
Suva_14.277 Chr14 complement(504861..506090) [1230 bp, 409 aa] {...   137   1e-35
TDEL0C04600 Chr3 complement(833405..834640) [1236 bp, 411 aa] {O...   137   2e-35
Smik_14.263 Chr14 complement(486255..487484) [1230 bp, 409 aa] {...   135   8e-35
NDAI0D01030 Chr4 complement(232909..234144) [1236 bp, 411 aa] {O...   135   8e-35
KNAG0I01900 Chr9 (371556..372785) [1230 bp, 409 aa] {ON} Anc_2.2...   135   1e-34
Skud_14.268 Chr14 complement(496140..497372) [1233 bp, 410 aa] {...   135   1e-34
Kpol_1003.12 s1003 complement(35339..36565) [1227 bp, 408 aa] {O...   134   2e-34
Kwal_23.4830 s23 complement(885244..886479) [1236 bp, 411 aa] {O...   134   3e-34
TBLA0E03810 Chr5 complement(959045..960277) [1233 bp, 410 aa] {O...   134   3e-34
YNL064C Chr14 complement(505868..507097) [1230 bp, 409 aa] {ON} ...   133   5e-34
TDEL0C04350 Chr3 (777185..778573) [1389 bp, 462 aa] {ON} Anc_2.2...   131   4e-33
NCAS0G03000 Chr7 complement(552266..553498) [1233 bp, 410 aa] {O...   126   1e-31
SAKL0E08734g Chr5 (713258..714493) [1236 bp, 411 aa] {ON} simila...   125   3e-31
KLTH0G09394g Chr7 complement(782211..783446) [1236 bp, 411 aa] {...   125   5e-31
KLTH0G08756g Chr7 complement(715507..716895) [1389 bp, 462 aa] {...   119   9e-29
Kwal_23.3061 s23 complement(140207..141583) [1377 bp, 458 aa] {O...   117   4e-28
CAGL0J10296g Chr10 complement(1006624..1008063) [1440 bp, 479 aa...   116   1e-27
SAKL0E09306g Chr5 complement(773968..775353) [1386 bp, 461 aa] {...   115   3e-27
Ecym_6236 Chr6 (440622..441746) [1125 bp, 374 aa] {ON} similar t...   112   1e-26
KNAG0M02020 Chr13 complement(375304..376686) [1383 bp, 460 aa] {...   110   1e-25
AER427W Chr5 (1456998..1458410) [1413 bp, 470 aa] {ON} Syntenic ...   105   6e-24
Smik_14.249 Chr14 (461706..463307) [1602 bp, 533 aa] {ON} YNL077...    99   2e-21
KNAG0G02880 Chr7 (636899..638035) [1137 bp, 378 aa] {ON} Anc_8.7...    97   3e-21
NCAS0G02850 Chr7 (522548..524032) [1485 bp, 494 aa] {ON} Anc_2.218     97   7e-21
Skud_14.253 Chr14 (471602..473200) [1599 bp, 532 aa] {ON} YNL077...    97   1e-20
Kpol_1002.122 s1002 (305710..307221) [1512 bp, 503 aa] {ON} (305...    95   3e-20
YNL077W Chr14 (481391..482977) [1587 bp, 528 aa] {ON}  APJ1Putat...    94   5e-20
SAKL0H05258g Chr8 complement(474006..475112) [1107 bp, 368 aa] {...    92   7e-20
Ecym_5384 Chr5 (781017..782528) [1512 bp, 503 aa] {ON} similar t...    92   2e-19
KLLA0E07899g Chr5 complement(709306..710793) [1488 bp, 495 aa] {...    89   2e-18
ZYRO0C15048g Chr3 complement(1170614..1172089) [1476 bp, 491 aa]...    89   3e-18
Kwal_26.9024 s26 (1044497..1045624) [1128 bp, 375 aa] {ON} YMR21...    87   4e-18
Suva_14.262 Chr14 (480056..481666) [1611 bp, 536 aa] {ON} YNL077...    88   5e-18
TPHA0D00550 Chr4 complement(95500..96960) [1461 bp, 486 aa] {ON}...    87   1e-17
Suva_13.397 Chr13 (675784..676911) [1128 bp, 375 aa] {ON} YMR214...    85   2e-17
TPHA0G00630 Chr7 complement(118713..119894) [1182 bp, 393 aa] {O...    86   2e-17
KLTH0D12496g Chr4 (1020286..1021413) [1128 bp, 375 aa] {ON} simi...    84   6e-17
KLLA0C07260g Chr3 complement(632987..634093) [1107 bp, 368 aa] {...    83   9e-17
NCAS0B00530 Chr2 (79130..80257) [1128 bp, 375 aa] {ON} Anc_8.730       83   1e-16
CAGL0F03729g Chr6 complement(362972..364057) [1086 bp, 361 aa] {...    81   4e-16
TDEL0B03790 Chr2 complement(681870..682991) [1122 bp, 373 aa] {O...    81   4e-16
NDAI0F02450 Chr6 complement(585345..586937) [1593 bp, 530 aa] {O...    82   7e-16
KAFR0A04160 Chr1 (836039..837175) [1137 bp, 378 aa] {ON} Anc_8.7...    81   7e-16
ZYRO0A06226g Chr1 complement(499313..500446) [1134 bp, 377 aa] {...    80   1e-15
Smik_13.422 Chr13 (679417..680553) [1137 bp, 378 aa] {ON} YMR214...    79   2e-15
TBLA0E03660 Chr5 (916944..918290) [1347 bp, 448 aa] {ON} Anc_2.2...    79   4e-15
NDAI0G03280 Chr7 complement(769822..771480) [1659 bp, 552 aa] {O...    79   6e-15
YMR214W Chr13 (695350..696483) [1134 bp, 377 aa] {ON}  SCJ1One o...    77   9e-15
AER346W Chr5 (1271436..1272539) [1104 bp, 367 aa] {ON} Syntenic ...    77   1e-14
KLLA0D07656g Chr4 (658179..659594) [1416 bp, 471 aa] {ON} simila...    77   2e-14
TPHA0C02980 Chr3 (652607..654271) [1665 bp, 554 aa] {ON} Anc_2.2...    75   6e-14
Skud_13.383 Chr13 (669140..670267) [1128 bp, 375 aa] {ON} YMR214...    73   3e-13
SAKL0B02068g Chr2 complement(199274..200806) [1533 bp, 510 aa] {...    72   1e-12
YFL016C Chr6 complement(104701..106236) [1536 bp, 511 aa] {ON}  ...    71   2e-12
Kpol_1011.9 s1011 (23785..25272) [1488 bp, 495 aa] {ON} (23785.....    70   4e-12
KLTH0A02882g Chr1 (250221..251642) [1422 bp, 473 aa] {ON} simila...    69   6e-12
Kwal_47.17957 s47 (626415..627851) [1437 bp, 478 aa] {ON} YFL016...    69   7e-12
Suva_6.44 Chr6 complement(77690..79213) [1524 bp, 507 aa] {ON} Y...    68   1e-11
NDAI0E00870 Chr5 complement(176292..177422) [1131 bp, 376 aa] {O...    67   2e-11
CAGL0J04224g Chr10 (395856..397424) [1569 bp, 522 aa] {ON} simil...    68   2e-11
Smik_6.63 Chr6 complement(118121..119653) [1533 bp, 510 aa] {ON}...    65   1e-10
AFR507W Chr6 (1348057..1349481) [1425 bp, 474 aa] {ON} Syntenic ...    64   2e-10
Ecym_4372 Chr4 complement(790363..792102) [1740 bp, 579 aa] {ON}...    64   5e-10
Skud_6.56 Chr6 complement(106964..108517) [1554 bp, 517 aa] {ON}...    63   5e-10
NDAI0A02820 Chr1 complement(634394..635842) [1449 bp, 482 aa] {O...    63   7e-10
TBLA0J01870 Chr10 complement(438718..440130) [1413 bp, 470 aa] {...    63   8e-10
KLLA0D19602g Chr4 (1653096..1654958) [1863 bp, 620 aa] {ON} simi...    63   8e-10
KLLA0E04423g Chr5 complement(400495..401781) [1287 bp, 428 aa] {...    62   9e-10
TBLA0D04240 Chr4 (1048036..1049205) [1170 bp, 389 aa] {ON} Anc_7...    62   1e-09
TDEL0H02290 Chr8 (383876..385039) [1164 bp, 387 aa] {ON} Anc_7.2...    61   1e-09
CAGL0I06226g Chr9 (597520..598887) [1368 bp, 455 aa] {ON} some s...    62   1e-09
TBLA0C01480 Chr3 complement(341677..342738) [1062 bp, 353 aa] {O...    61   2e-09
Skud_9.181 Chr9 (334059..335324) [1266 bp, 421 aa] {ON} YIR004W ...    61   2e-09
YIR004W Chr9 (363221..364519) [1299 bp, 432 aa] {ON}  DJP1Cytoso...    61   2e-09
KLLA0C02981g Chr3 (268669..269157) [489 bp, 162 aa] {ON} similar...    58   2e-09
CAGL0J01936g Chr10 complement(192784..194061) [1278 bp, 425 aa] ...    61   3e-09
TPHA0B03760 Chr2 (889402..890469) [1068 bp, 355 aa] {ON} Anc_1.3...    60   3e-09
NDAI0C02610 Chr3 (606952..607974) [1023 bp, 340 aa] {ON}               60   3e-09
KLLA0D13464g Chr4 complement(1159251..1160552) [1302 bp, 433 aa]...    60   3e-09
TDEL0H03210 Chr8 (532389..533624) [1236 bp, 411 aa] {ON} Anc_7.1...    60   4e-09
KLTH0A03740g Chr1 complement(322936..324123) [1188 bp, 395 aa] {...    60   4e-09
Skud_5.158 Chr5 complement(244775..245950) [1176 bp, 391 aa] {ON...    60   4e-09
NDAI0E04560 Chr5 (1020784..1021968) [1185 bp, 394 aa] {ON}             60   5e-09
KNAG0I00740 Chr9 (130033..131310) [1278 bp, 425 aa] {ON} Anc_7.1...    60   5e-09
KLLA0E01629g Chr5 (155088..155783) [696 bp, 231 aa] {ON} similar...    58   5e-09
Smik_10.385 Chr10 (601299..601817) [519 bp, 172 aa] {ON} YJR097W...    57   6e-09
TPHA0L00790 Chr12 (150654..151994) [1341 bp, 446 aa] {ON} Anc_7....    60   6e-09
TBLA0G00170 Chr7 complement(26304..28283) [1980 bp, 659 aa] {ON}...    60   6e-09
TBLA0A01100 Chr1 (250770..252074) [1305 bp, 434 aa] {ON} Anc_7.1...    60   6e-09
NCAS0A13210 Chr1 (2599196..2600440) [1245 bp, 414 aa] {ON} Anc_7...    60   6e-09
TBLA0E02490 Chr5 complement(624528..625628) [1101 bp, 366 aa] {O...    59   7e-09
NDAI0G04250 Chr7 (1021818..1022909) [1092 bp, 363 aa] {ON} Anc_1...    59   7e-09
YER048C Chr5 complement(246982..248157) [1176 bp, 391 aa] {ON}  ...    59   7e-09
Smik_9.203 Chr9 (339194..340492) [1299 bp, 432 aa] {ON} YIR004W ...    59   7e-09
KAFR0B04780 Chr2 (994492..995763) [1272 bp, 423 aa] {ON}               59   9e-09
ADR015W Chr4 (732199..733509) [1311 bp, 436 aa] {ON} Syntenic ho...    59   9e-09
ZYRO0E04598g Chr5 complement(346758..347831) [1074 bp, 357 aa] {...    59   9e-09
NCAS0E02930 Chr5 (572593..573756) [1164 bp, 387 aa] {ON} Anc_7.217     59   1e-08
CAGL0H03707g Chr8 complement(341230..342279) [1050 bp, 349 aa] {...    59   1e-08
ZYRO0D16390g Chr4 complement(1366068..1367264) [1197 bp, 398 aa]...    59   1e-08
TPHA0C01260 Chr3 (287466..288608) [1143 bp, 380 aa] {ON} Anc_7.2...    59   1e-08
CAGL0L00957g Chr12 (112612..113733) [1122 bp, 373 aa] {ON} simil...    58   1e-08
KAFR0C03160 Chr3 complement(633466..634962) [1497 bp, 498 aa] {O...    59   1e-08
Kpol_457.15 s457 (41492..42565) [1074 bp, 357 aa] {ON} (41492..4...    58   1e-08
Suva_9.213 Chr9 (350204..351499) [1296 bp, 431 aa] {ON} YIR004W ...    58   2e-08
Smik_5.173 Chr5 complement(251699..252874) [1176 bp, 391 aa] {ON...    58   2e-08
Suva_5.150 Chr5 complement(223538..224713) [1176 bp, 391 aa] {ON...    58   2e-08
Ecym_4469 Chr4 complement(953409..954710) [1302 bp, 433 aa] {ON}...    58   2e-08
KAFR0H03150 Chr8 (601486..602565) [1080 bp, 359 aa] {ON} Anc_1.3...    58   2e-08
Kwal_47.18133 s47 complement(703122..704303) [1182 bp, 393 aa] {...    58   2e-08
ZYRO0G03850g Chr7 complement(307633..308889) [1257 bp, 418 aa] {...    58   2e-08
KLLA0D04818g Chr4 complement(411615..412679) [1065 bp, 354 aa] {...    57   2e-08
SAKL0F08052g Chr6 complement(616679..617860) [1182 bp, 393 aa] {...    58   2e-08
Skud_14.320 Chr14 complement(585268..586374) [1107 bp, 368 aa] {...    57   3e-08
CAGL0J02750g Chr10 complement(273009..274157) [1149 bp, 382 aa] ...    57   3e-08
Ecym_5626 Chr5 (1262223..1262954) [732 bp, 243 aa] {ON} similar ...    56   3e-08
KLTH0F13398g Chr6 (1101625..1102884) [1260 bp, 419 aa] {ON} simi...    57   4e-08
ABL194C Chr2 complement(42210..43868) [1659 bp, 552 aa] {ON} Syn...    57   4e-08
NCAS0G03610 Chr7 (674056..675039) [984 bp, 327 aa] {ON} Anc_1.398      57   4e-08
KAFR0L00740 Chr12 complement(141062..142156) [1095 bp, 364 aa] {...    57   4e-08
NCAS0C03950 Chr3 complement(798535..800094) [1560 bp, 519 aa] {O...    57   4e-08
SAKL0F04444g Chr6 complement(357126..358415) [1290 bp, 429 aa] {...    57   5e-08
Suva_14.116 Chr14 complement(214797..216599) [1803 bp, 600 aa] {...    57   5e-08
CAGL0C04565g Chr3 (435373..435900) [528 bp, 175 aa] {ON} similar...    54   5e-08
TPHA0A02810 Chr1 complement(606816..608294) [1479 bp, 492 aa] {O...    57   6e-08
Smik_14.321 Chr14 complement(576829..577929) [1101 bp, 366 aa] {...    56   6e-08
Kpol_499.30 s499 (76723..77949) [1227 bp, 408 aa] {ON} (76723..7...    56   6e-08
Ecym_1450 Chr1 (930504..931982) [1479 bp, 492 aa] {ON} similar t...    57   7e-08
NDAI0F03800 Chr6 (902416..904332) [1917 bp, 638 aa] {ON} Anc_2.15      57   7e-08
YNL007C Chr14 complement(618507..619565) [1059 bp, 352 aa] {ON} ...    56   7e-08
ZYRO0F03652g Chr6 complement(306692..308080) [1389 bp, 462 aa] {...    56   8e-08
KAFR0C02450 Chr3 (477069..478190) [1122 bp, 373 aa] {ON} Anc_7.2...    56   8e-08
Kpol_1064.40 s1064 (74841..76004) [1164 bp, 387 aa] {ON} (74841....    56   8e-08
Kpol_1070.22 s1070 (52022..53164) [1143 bp, 380 aa] {ON} (52022....    56   8e-08
Kpol_2000.32 s2000 complement(60585..61088) [504 bp, 167 aa] {ON...    54   8e-08
TDEL0B05960 Chr2 complement(1053955..1055064) [1110 bp, 369 aa] ...    56   8e-08
KNAG0C02450 Chr3 complement(477576..479210) [1635 bp, 544 aa] {O...    56   9e-08
KNAG0L01330 Chr12 complement(239806..240996) [1191 bp, 396 aa] {...    56   9e-08
AAL008W Chr1 (327127..328176) [1050 bp, 349 aa] {ON} Syntenic ho...    55   9e-08
KNAG0G01130 Chr7 (244979..246481) [1503 bp, 500 aa] {ON} Anc_8.6...    56   9e-08
Skud_14.110 Chr14 complement(209411..211201) [1791 bp, 596 aa] {...    56   1e-07
Ecym_1110 Chr1 (231686..232156) [471 bp, 156 aa] {ON} similar to...    53   1e-07
NDAI0D00500 Chr4 complement(103935..104507) [573 bp, 190 aa] {ON...    54   1e-07
CAGL0J07370g Chr10 (713487..715358) [1872 bp, 623 aa] {ON} simil...    56   1e-07
Suva_14.341 Chr14 complement(598475..599554) [1080 bp, 359 aa] {...    55   1e-07
YNL227C Chr14 complement(220659..222431) [1773 bp, 590 aa] {ON} ...    55   2e-07
ZYRO0F15400g Chr6 (1261048..1262625) [1578 bp, 525 aa] {ON} simi...    55   2e-07
SAKL0E06050g Chr5 (491382..492080) [699 bp, 232 aa] {ON} some si...    54   2e-07
Smik_14.106 Chr14 complement(199985..201766) [1782 bp, 593 aa] {...    55   2e-07
Kwal_55.20965 s55 (627332..628597) [1266 bp, 421 aa] {ON} YIR004...    55   2e-07
KNAG0B01890 Chr2 (358819..359931) [1113 bp, 370 aa] {ON} Anc_1.9...    55   2e-07
NCAS0G01360 Chr7 complement(242638..244488) [1851 bp, 616 aa] {O...    55   2e-07
KNAG0H01680 Chr8 complement(300014..301105) [1092 bp, 363 aa] {O...    54   2e-07
YJR097W Chr10 (612413..612931) [519 bp, 172 aa] {ON}  JJJ3Protei...    52   2e-07
ADR124C Chr4 complement(926129..927964) [1836 bp, 611 aa] {ON} S...    55   2e-07
Kwal_23.4420 s23 complement(711673..713451) [1779 bp, 592 aa] {O...    55   3e-07
TBLA0J00970 Chr10 (219487..221247) [1761 bp, 586 aa] {ON} Anc_1....    55   3e-07
YJL073W Chr10 (303181..305118) [1938 bp, 645 aa] {ON}  JEM1DnaJ-...    55   3e-07
Suva_12.185 Chr12 (290829..291335) [507 bp, 168 aa] {ON} YJR097W...    52   3e-07
Kwal_0.207 s0 complement(103950..105011) [1062 bp, 353 aa] {ON} ...    54   3e-07
KLTH0H12100g Chr8 complement(1032695..1033747) [1053 bp, 350 aa]...    54   3e-07
KLTH0F04906g Chr6 complement(434195..435967) [1773 bp, 590 aa] {...    54   4e-07
Smik_10.168 Chr10 (294947..296896) [1950 bp, 649 aa] {ON} YJL073...    54   4e-07
TDEL0C05880 Chr3 complement(1059324..1059803) [480 bp, 159 aa] {...    51   5e-07
KAFR0A07950 Chr1 (1592293..1593948) [1656 bp, 551 aa] {ON} Anc_2...    54   5e-07
TDEL0A06430 Chr1 complement(1125394..1127394) [2001 bp, 666 aa] ...    54   6e-07
KLTH0F09944g Chr6 complement(863160..863861) [702 bp, 233 aa] {O...    52   6e-07
Skud_10.319 Chr10 (569772..570278) [507 bp, 168 aa] {ON} YJR097W...    51   6e-07
KNAG0F00860 Chr6 complement(155142..157022) [1881 bp, 626 aa] {O...    54   7e-07
Kpol_529.21 s529 (62384..64252) [1869 bp, 622 aa] {ON} (62384..6...    54   7e-07
AEL112C Chr5 complement(412116..413723) [1608 bp, 535 aa] {ON} S...    53   7e-07
SAKL0D08778g Chr4 (729953..730999) [1047 bp, 348 aa] {ON} simila...    53   7e-07
Kwal_33.13860 s33 complement(427243..428979) [1737 bp, 578 aa] {...    53   8e-07
NDAI0B00200 Chr2 (25694..27478) [1785 bp, 594 aa] {ON} Anc_1.185       53   9e-07
NCAS0C04890 Chr3 (997613..998716) [1104 bp, 367 aa] {ON} Anc_1.398     53   9e-07
TDEL0C00870 Chr3 complement(140420..141832) [1413 bp, 470 aa] {O...    53   9e-07
AFL190C Chr6 complement(84145..84852) [708 bp, 235 aa] {ON} Synt...    52   9e-07
SAKL0E14234g Chr5 (1172804..1174840) [2037 bp, 678 aa] {ON} simi...    53   9e-07
Kpol_1072.4 s1072 (8361..10346) [1986 bp, 661 aa] {ON} (8361..10...    53   1e-06
TBLA0A05740 Chr1 (1424068..1424580) [513 bp, 170 aa] {ON} Anc_1....    50   1e-06
Suva_6.148 Chr6 complement(246008..247936) [1929 bp, 642 aa] {ON...    52   1e-06
KAFR0A01620 Chr1 (331073..333070) [1998 bp, 665 aa] {ON} Anc_1.2...    53   1e-06
Skud_10.169 Chr10 complement(313783..315717) [1935 bp, 644 aa] {...    52   2e-06
KLTH0F03124g Chr6 (271947..272435) [489 bp, 162 aa] {ON} similar...    50   2e-06
YMR161W Chr13 (577718..578392) [675 bp, 224 aa] {ON}  HLJ1Co-cha...    50   2e-06
KLTH0B08338g Chr2 (676591..678363) [1773 bp, 590 aa] {ON} simila...    52   2e-06
Ecym_1292 Chr1 complement(593715..594758) [1044 bp, 347 aa] {ON}...    51   2e-06
KNAG0J01840 Chr10 complement(334573..336525) [1953 bp, 650 aa] {...    52   2e-06
SAKL0C03476g Chr3 (329030..329527) [498 bp, 165 aa] {ON} similar...    49   3e-06
TDEL0E00500 Chr5 complement(112459..114204) [1746 bp, 581 aa] {O...    51   3e-06
Suva_8.303 Chr8 complement(544176..546170) [1995 bp, 664 aa] {ON...    51   4e-06
Kwal_23.3578 s23 complement(349005..349259) [255 bp, 85 aa] {OFF...    47   4e-06
NCAS0I02830 Chr9 (526309..527784) [1476 bp, 491 aa] {ON} Anc_1.1...    51   5e-06
Smik_15.437 Chr15 complement(754736..756727) [1992 bp, 663 aa] {...    51   5e-06
NDAI0H03180 Chr8 (757990..758679) [690 bp, 229 aa] {ON} Anc_2.350      49   5e-06
ZYRO0F15972g Chr6 complement(1311698..1312186) [489 bp, 162 aa] ...    48   6e-06
TBLA0B03730 Chr2 (860167..862248) [2082 bp, 693 aa] {ON} Anc_8.6...    50   6e-06
Smik_13.361 Chr13 (561431..562105) [675 bp, 224 aa] {ON} YMR161W...    49   6e-06
AFR639W Chr6 (1604427..1604897) [471 bp, 156 aa] {ON} Non-synten...    48   7e-06
SAKL0B01276g Chr2 (119226..120104) [879 bp, 292 aa] {ON} conserv...    49   8e-06
YOR254C Chr15 complement(805032..807023) [1992 bp, 663 aa] {ON} ...    50   9e-06
TDEL0C03680 Chr3 (646797..648467) [1671 bp, 556 aa] {ON} Anc_1.1...    50   9e-06
Ecym_6318 Chr6 complement(605055..606929) [1875 bp, 624 aa] {ON}...    50   1e-05
KNAG0D01360 Chr4 complement(229325..229882) [558 bp, 185 aa] {ON...    48   1e-05
ZYRO0D10934g Chr4 complement(921917..923908) [1992 bp, 663 aa] {...    50   1e-05
ZYRO0A07502g Chr1 complement(614282..614998) [717 bp, 238 aa] {O...    49   1e-05
Kpol_2001.27 s2001 (79675..81237) [1563 bp, 520 aa] {ON} (79675....    49   1e-05
Ecym_8093 Chr8 (198912..200543) [1632 bp, 543 aa] {ON} similar t...    49   1e-05
TPHA0B04190 Chr2 complement(984952..985458) [507 bp, 168 aa] {ON...    47   1e-05
CAGL0H04499g Chr8 complement(427509..428207) [699 bp, 232 aa] {O...    48   1e-05
NCAS0D00960 Chr4 complement(187021..187695) [675 bp, 224 aa] {ON...    48   1e-05
TBLA0C02720 Chr3 complement(651693..653840) [2148 bp, 715 aa] {O...    49   1e-05
KAFR0H02310 Chr8 (441168..443135) [1968 bp, 655 aa] {ON} Anc_8.6...    49   1e-05
Skud_13.323 Chr13 (550675..551349) [675 bp, 224 aa] {ON} YMR161W...    48   1e-05
TBLA0B03490 Chr2 complement(814731..815885) [1155 bp, 384 aa] {O...    49   2e-05
TPHA0C04590 Chr3 (991298..991999) [702 bp, 233 aa] {ON} Anc_2.35...    48   2e-05
KLLA0B07271g Chr2 complement(633724..635685) [1962 bp, 653 aa] {...    49   2e-05
SAKL0C05456g Chr3 complement(519700..521451) [1752 bp, 583 aa] {...    49   2e-05
TPHA0O01940 Chr15 (386610..388406) [1797 bp, 598 aa] {ON} Anc_2....    49   2e-05
Skud_10.52 Chr10 complement(88516..90195) [1680 bp, 559 aa] {ON}...    49   2e-05
Skud_15.420 Chr15 complement(743976..745973) [1998 bp, 665 aa] {...    49   2e-05
SAKL0D06226g Chr4 (510407..512254) [1848 bp, 615 aa] {ON} weakly...    49   2e-05
SAKL0H00858g Chr8 complement(101231..102529) [1299 bp, 432 aa] {...    49   2e-05
YJL162C Chr10 complement(113878..115629) [1752 bp, 583 aa] {ON} ...    49   2e-05
AFR659W Chr6 (1640624..1641445) [822 bp, 273 aa] {ON} Non-synten...    48   2e-05
Suva_13.340 Chr13 (556991..557668) [678 bp, 225 aa] {ON} YMR161W...    47   2e-05
TBLA0A05560 Chr1 complement(1380366..1381304) [939 bp, 312 aa] {...    48   2e-05
Smik_10.68 Chr10 complement(111694..113376) [1683 bp, 560 aa] {O...    49   2e-05
Suva_6.243 Chr6 (433682..435379) [1698 bp, 565 aa] {ON} YJL162C ...    49   2e-05
Kpol_526.6 s526 (7574..8260) [687 bp, 228 aa] {ON} (7574..8260) ...    47   2e-05
TDEL0D01640 Chr4 (328124..329938) [1815 bp, 604 aa] {ON} Anc_1.2...    49   3e-05
TDEL0G02800 Chr7 complement(538403..539080) [678 bp, 225 aa] {ON...    47   3e-05
Kwal_26.9495 s26 (1242662..1243948) [1287 bp, 428 aa] {ON} YGR28...    48   3e-05
CAGL0G07469g Chr7 complement(708261..710267) [2007 bp, 668 aa] {...    48   3e-05
NCAS0C01220 Chr3 (225905..227914) [2010 bp, 669 aa] {ON} Anc_8.698     48   3e-05
KNAG0I00860 Chr9 complement(162792..163451) [660 bp, 219 aa] {ON...    47   4e-05
TBLA0B09380 Chr2 complement(2231452..2232135) [684 bp, 227 aa] {...    47   4e-05
Kwal_33.13533 s33 (271635..272120) [486 bp, 161 aa] {ON} YJR097W...    45   4e-05
NCAS0A09320 Chr1 complement(1841541..1843448) [1908 bp, 635 aa] ...    48   4e-05
CAGL0H02827g Chr8 (261006..262976) [1971 bp, 656 aa] {ON} simila...    48   5e-05
TPHA0G01480 Chr7 (304449..306431) [1983 bp, 660 aa] {ON} Anc_8.6...    47   6e-05
KAFR0F01810 Chr6 complement(352130..353797) [1668 bp, 555 aa] {O...    47   6e-05
Kpol_1027.13 s1027 complement(27738..29663) [1926 bp, 641 aa] {O...    47   6e-05
Kpol_2000.56 s2000 (110867..111739) [873 bp, 290 aa] {ON} (11086...    46   7e-05
KLLA0D06402g Chr4 (547385..549280) [1896 bp, 631 aa] {ON} weakly...    47   7e-05
ZYRO0G21230g Chr7 complement(1742750..1744504) [1755 bp, 584 aa]...    47   8e-05
SAKL0H05984g Chr8 (530194..532170) [1977 bp, 658 aa] {ON} simila...    47   9e-05
KNAG0B05240 Chr2 (1014877..1016883) [2007 bp, 668 aa] {ON} Anc_1...    47   9e-05
Kwal_14.2452 s14 (763303..765126) [1824 bp, 607 aa] {ON} YJL073W...    47   1e-04
ZYRO0G18436g Chr7 (1520605..1522116) [1512 bp, 503 aa] {ON} simi...    46   1e-04
Ecym_2374 Chr2 (727001..728986) [1986 bp, 661 aa] {ON} similar t...    46   1e-04
TDEL0G00270 Chr7 (49939..51240) [1302 bp, 433 aa] {ON} Anc_5.4 Y...    45   2e-04
Kwal_26.8879 s26 complement(988264..990234) [1971 bp, 656 aa] {O...    46   2e-04
KLTH0F02596g Chr6 complement(224401..225249) [849 bp, 282 aa] {O...    45   2e-04
AAL103W Chr1 (161385..163394) [2010 bp, 669 aa] {ON} Syntenic ho...    46   2e-04
KAFR0B04890 Chr2 complement(1020109..1020771) [663 bp, 220 aa] {...    44   3e-04
KNAG0D01780 Chr4 (297877..299016) [1140 bp, 379 aa] {ON} Anc_7.2...    45   3e-04
CAGL0I09526g Chr9 (911397..912287) [891 bp, 296 aa] {ON} weakly ...    44   4e-04
Suva_7.582 Chr7 complement(1016872..1018296) [1425 bp, 474 aa] {...    44   5e-04
AGL339C Chr7 complement(77330..78622) [1293 bp, 430 aa] {ON} Syn...    44   5e-04
Kpol_1060.3 s1060 (4445..5743) [1299 bp, 432 aa] {ON} (4445..574...    44   5e-04
KLTH0D11770g Chr4 complement(961180..963138) [1959 bp, 652 aa] {...    44   6e-04
ADL111W Chr4 (487949..489685) [1737 bp, 578 aa] {ON} Syntenic ho...    44   6e-04
TBLA0C07160 Chr3 complement(1737406..1738698) [1293 bp, 430 aa] ...    44   6e-04
KLTH0H10032g Chr8 (865827..867650) [1824 bp, 607 aa] {ON} weakly...    44   6e-04
Smik_16.23 Chr16 (34403..35704) [1302 bp, 433 aa] {ON} YGR285C (...    44   7e-04
Skud_7.618 Chr7 complement(1036280..1037581) [1302 bp, 433 aa] {...    44   7e-04
KLTH0B09570g Chr2 (783747..785033) [1287 bp, 428 aa] {ON} highly...    44   8e-04
YGR285C Chr7 complement(1061852..1063153) [1302 bp, 433 aa] {ON}...    44   9e-04
ZYRO0C01210g Chr3 (81965..83266) [1302 bp, 433 aa] {ON} highly s...    43   0.001
KLLA0C09823g Chr3 (848641..850650) [2010 bp, 669 aa] {ON} simila...    43   0.001
NCAS0E04190 Chr5 complement(825586..826881) [1296 bp, 431 aa] {O...    43   0.001
KNAG0A05650 Chr1 complement(842844..843371) [528 bp, 175 aa] {ON...    41   0.001
KLTH0G18546g Chr7 complement(1599892..1600743) [852 bp, 283 aa] ...    42   0.001
ADL327W Chr4 (123851..124768) [918 bp, 305 aa] {ON} Syntenic hom...    42   0.001
KAFR0G00910 Chr7 complement(214974..215465) [492 bp, 163 aa] {ON...    41   0.001
TPHA0A05650 Chr1 complement(1281376..1282677) [1302 bp, 433 aa] ...    42   0.002
KLLA0F03124g Chr6 complement(289514..290815) [1302 bp, 433 aa] {...    42   0.002
TDEL0C06100 Chr3 (1102385..1103242) [858 bp, 285 aa] {ON} Anc_1....    42   0.002
NCAS0H00550 Chr8 complement(95349..95873) [525 bp, 174 aa] {ON} ...    40   0.003
TPHA0I01110 Chr9 (259489..261489) [2001 bp, 666 aa] {ON} Anc_1.2...    42   0.003
KAFR0I02680 Chr9 complement(545638..546939) [1302 bp, 433 aa] {O...    41   0.004
SAKL0C02904g Chr3 complement(275106..275951) [846 bp, 281 aa] {O...    41   0.005
NDAI0B00670 Chr2 complement(150183..151478) [1296 bp, 431 aa] {O...    41   0.005
NDAI0C00200 Chr3 (32604..33434) [831 bp, 276 aa] {ON} Anc_1.92         40   0.006
KNAG0E01220 Chr5 (236127..237431) [1305 bp, 434 aa] {ON} Anc_5.4...    40   0.008
KAFR0A01530 Chr1 (306299..307132) [834 bp, 277 aa] {ON} Anc_1.92...    40   0.008
NDAI0G05640 Chr7 (1400380..1402251) [1872 bp, 623 aa] {ON} Anc_1...    40   0.010
YGL128C Chr7 complement(269293..270144) [852 bp, 283 aa] {ON}  C...    40   0.010
CAGL0G00154g Chr7 (14591..15892) [1302 bp, 433 aa] {ON} highly s...    40   0.011
Ecym_1097 Chr1 complement(203901..204713) [813 bp, 270 aa] {ON} ...    39   0.012
Ecym_3476 Chr3 (892436..893311) [876 bp, 291 aa] {ON} similar to...    39   0.012
NDAI0K01230 Chr11 (280525..282567) [2043 bp, 680 aa] {ON} Anc_8....    40   0.012
TBLA0D02600 Chr4 complement(639981..641513) [1533 bp, 510 aa] {O...    39   0.021
Suva_7.135 Chr7 complement(265536..266393) [858 bp, 285 aa] {ON}...    39   0.026
KAFR0J00260 Chr10 (41749..42543) [795 bp, 264 aa] {ON} Anc_3.548...    37   0.051
Suva_7.261 Chr7 complement(449983..450537) [555 bp, 184 aa] {ON}...    36   0.075
Skud_7.144 Chr7 complement(273716..274567) [852 bp, 283 aa] {ON}...    37   0.092
YGL018C Chr7 complement(459110..459664) [555 bp, 184 aa] {ON}  J...    36   0.11 
Smik_7.143 Chr7 complement(263235..264086) [852 bp, 283 aa] {ON}...    36   0.12 
NCAS0A01690 Chr1 (330511..331077) [567 bp, 188 aa] {ON} Anc_4.10...    35   0.14 
KAFR0F03210 Chr6 complement(634603..635160) [558 bp, 185 aa] {ON...    35   0.14 
Smik_7.272 Chr7 complement(451118..451672) [555 bp, 184 aa] {ON}...    35   0.17 
NCAS0H03480 Chr8 complement(656664..657506) [843 bp, 280 aa] {ON...    36   0.19 
TBLA0I03430 Chr9 complement(828607..829449) [843 bp, 280 aa] {ON...    35   0.22 
Skud_6.132 Chr6 complement(232394..233278) [885 bp, 295 aa] {ON}...    35   0.25 
Skud_7.269 Chr7 complement(462239..462793) [555 bp, 184 aa] {ON}...    35   0.28 
ZYRO0F16456g Chr6 (1353540..1354355) [816 bp, 271 aa] {ON} weakl...    35   0.30 
Ecym_7402 Chr7 complement(827224..829044) [1821 bp, 606 aa] {ON}...    35   0.46 
TBLA0D02560 Chr4 (635410..636090) [681 bp, 226 aa] {ON} Anc_8.54...    34   0.54 
TDEL0F02440 Chr6 (455229..455807) [579 bp, 192 aa] {ON} Anc_4.10...    33   0.60 
NDAI0D03610 Chr4 (859564..860136) [573 bp, 190 aa] {ON} Anc_4.10...    32   2.1  
YMR092C Chr13 complement(451632..453479) [1848 bp, 615 aa] {ON} ...    33   2.2  
NDAI0A05220 Chr1 (1180958..1181935) [978 bp, 325 aa] {ON} Anc_3....    31   5.6  
TBLA0B08930 Chr2 complement(2117704..2119536) [1833 bp, 610 aa] ...    31   5.8  
Kwal_47.19198 s47 complement(1131232..1132134) [903 bp, 300 aa] ...    31   7.2  
TDEL0G04150 Chr7 (755159..756142) [984 bp, 327 aa] {ON} Anc_6.55...    31   7.7  
ZYRO0G09988g Chr7 complement(796338..796919) [582 bp, 193 aa] {O...    30   8.9  

>CAGL0L12276g Chr12 (1329467..1330825) [1359 bp, 452 aa] {ON}
           similar to uniprot|Q12014 Saccharomyces cerevisiae
           YLR090w
          Length = 452

 Score =  864 bits (2232), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 424/452 (93%), Positives = 424/452 (93%)

Query: 1   MDYYGLLGVGQDASQDEIKRAYRKLALRHHPDKARGNEGGEDSSDDLPDVDFKEVTAAYQ 60
           MDYYGLLGVGQDASQDEIKRAYRKLALRHHPDKARGNEGGEDSSDDLPDVDFKEVTAAYQ
Sbjct: 1   MDYYGLLGVGQDASQDEIKRAYRKLALRHHPDKARGNEGGEDSSDDLPDVDFKEVTAAYQ 60

Query: 61  VLSDASLRAEYDQKLAFEAQPYXXXXXXXXXXXXXXXXHPGHRSGFDSGRGARRYKSDDI 120
           VLSDASLRAEYDQKLAFEAQPY                HPGHRSGFDSGRGARRYKSDDI
Sbjct: 61  VLSDASLRAEYDQKLAFEAQPYGDDDFMNFFSGFNGGSHPGHRSGFDSGRGARRYKSDDI 120

Query: 121 EIDLKVKTSELYRGXXXXXXXXXXXXCQRCDGTGWKSHASIVKKKTAKFFWNVCEGCEGQ 180
           EIDLKVKTSELYRG            CQRCDGTGWKSHASIVKKKTAKFFWNVCEGCEGQ
Sbjct: 121 EIDLKVKTSELYRGKKVNFNLKRKKKCQRCDGTGWKSHASIVKKKTAKFFWNVCEGCEGQ 180

Query: 181 GVRQRLRQLAPGFVTTELIECRQCGGKGKLRNLPKSEKNKCPDCITSGTVGMVEENKVVT 240
           GVRQRLRQLAPGFVTTELIECRQCGGKGKLRNLPKSEKNKCPDCITSGTVGMVEENKVVT
Sbjct: 181 GVRQRLRQLAPGFVTTELIECRQCGGKGKLRNLPKSEKNKCPDCITSGTVGMVEENKVVT 240

Query: 241 INIKKGTLDGDKIVLKGEADEDLESTEVGDLVIKIQEVKEPQYDIVRNGYDLIIKKQIDL 300
           INIKKGTLDGDKIVLKGEADEDLESTEVGDLVIKIQEVKEPQYDIVRNGYDLIIKKQIDL
Sbjct: 241 INIKKGTLDGDKIVLKGEADEDLESTEVGDLVIKIQEVKEPQYDIVRNGYDLIIKKQIDL 300

Query: 301 ADAICGFDEKPLMETYDGRVLKWSSKRGKVIRPNDIVRIQNEGWPRREDANDNNTLLKNG 360
           ADAICGFDEKPLMETYDGRVLKWSSKRGKVIRPNDIVRIQNEGWPRREDANDNNTLLKNG
Sbjct: 301 ADAICGFDEKPLMETYDGRVLKWSSKRGKVIRPNDIVRIQNEGWPRREDANDNNTLLKNG 360

Query: 361 DLYVIVDIVFPPDNWTMEVNDYRAVRNIIPSTINKRESSTSGESILNVENINVSEIVKEI 420
           DLYVIVDIVFPPDNWTMEVNDYRAVRNIIPSTINKRESSTSGESILNVENINVSEIVKEI
Sbjct: 361 DLYVIVDIVFPPDNWTMEVNDYRAVRNIIPSTINKRESSTSGESILNVENINVSEIVKEI 420

Query: 421 PNCDELPKFQDTYDNTNDKGESPFWTPNCSQQ 452
           PNCDELPKFQDTYDNTNDKGESPFWTPNCSQQ
Sbjct: 421 PNCDELPKFQDTYDNTNDKGESPFWTPNCSQQ 452

>Kpol_543.40 s543 (89534..90778) [1245 bp, 414 aa] {ON}
           (89534..90778) [1245 nt, 415 aa]
          Length = 414

 Score =  279 bits (714), Expect = 2e-89,   Method: Compositional matrix adjust.
 Identities = 166/423 (39%), Positives = 237/423 (56%), Gaps = 42/423 (9%)

Query: 2   DYYGLLGVGQDASQDEIKRAYRKLALRHHPDKARGNEGGEDSSDDLPDVDFKEVTAAYQV 61
           DYY +LGV +DA+ +EIK+ YRKLAL++HPDK+      ++    + ++ FK++TAAYQ 
Sbjct: 12  DYYEILGVAEDATHEEIKKTYRKLALQYHPDKSI-----DEGQKLINEIKFKDITAAYQT 66

Query: 62  LSDASLRAEYDQKLAFEAQPYXXXXXXXXXXXXXXXXHPGHRSGFDSGRGARRYKSDDIE 121
           LSD   R EYD K  FE  PY                   H   ++S     R +S DI+
Sbjct: 67  LSDEDKRNEYDNKKNFE--PYFESDFAN-----------NHDGNYNS---RYRSRSKDIK 110

Query: 122 IDLKVKTSELYRGXXXXXXXXXXXXCQRCDGTGWKSHASIVKKKTAKFFWNV---CEGCE 178
           ++L +KTSELY G            C+ C+G GW++      KK  K +      C+ C 
Sbjct: 111 VELSLKTSELYNGKTIKFNNSRNRICKTCNGLGWRT------KKDGKPYVPPEIECQKCN 164

Query: 179 GQGVRQRLRQLAPGFVTTELIECRQCGGKGKLRNLPKSEKNKCPDCITSGTVGMVEENKV 238
           GQG +    QLAPGF TT+ + C  C G GK    P S KN C DC  +G   +++ +  
Sbjct: 165 GQGYKNMKVQLAPGFYTTQNVLCSYCKGNGKYYKKPNSPKNFCKDC--NGKC-LIKIDDP 221

Query: 239 VTINIKKGTLDGDKIVLKGEADEDLESTEVGDLVIKIQEVKEPQYDIVRNGYDLIIKKQI 298
           + ++I +G+ +GD I+LKGEADE+L     GDL+ +I E+ +   D+ R G  LI    I
Sbjct: 222 IVVSIPRGSSNGDNIILKGEADEELGKKNAGDLIFEINEIIDSNNDLERYGNHLINHTHI 281

Query: 299 DLADAICGFDEKPLMETYDGRVLKWSSKRGKVIRPNDIVRIQNEGWPRREDANDNNTLLK 358
            LA+AI GF+ K +++T+D R L  S+ +GKVIRP DI+ ++NEGWP  +          
Sbjct: 282 SLAEAITGFENKFIVKTFDDRDLYLSTPKGKVIRPGDILEVKNEGWPMDKYG------AS 335

Query: 359 NGDLYVIVDIVFPPDNWTMEVNDYRAVRNIIPSTINKRESSTSGESILNVENINVSEIVK 418
            G+LYVI++I FPPDNW  E ND   +RNI+P+   KR +       +N E I+  EIVK
Sbjct: 336 FGNLYVILEIEFPPDNWINEKNDIIKIRNILPNEKTKRNNIVDP---INSEYISTFEIVK 392

Query: 419 EIP 421
            +P
Sbjct: 393 SLP 395

>ZYRO0C01606g Chr3 complement(113396..114694) [1299 bp, 432 aa] {ON}
           similar to uniprot|P39102 Saccharomyces cerevisiae
           YLR090W XDJ1 Putative homolog of E. coli DnaJ closely
           related to Ydj1p
          Length = 432

 Score =  278 bits (712), Expect = 8e-89,   Method: Compositional matrix adjust.
 Identities = 175/471 (37%), Positives = 251/471 (53%), Gaps = 58/471 (12%)

Query: 1   MDYYGLLGVGQDASQDEIKRAYRKLALRHHPDKARGNEGGEDSSDDLPDVDFKEVTAAYQ 60
           M  Y  LGV QDA+Q EIK+AYRKLAL+HHPDK       +DS  +  +V FKE+TAAY+
Sbjct: 1   MSLYDTLGVSQDATQVEIKKAYRKLALQHHPDKVT-----DDSVREESEVRFKEITAAYE 55

Query: 61  VLSDASLRAEYDQK--------------LAFEAQPYXXXXXXXXXXXXXXXXHPGHRSGF 106
           VLSD   R++YD                + F  Q                   PG     
Sbjct: 56  VLSDEEKRSKYDTYGDTADGPDFEDESFMNFFTQFNSGFGFNGGGGGGFPGAQPGDD--- 112

Query: 107 DSGRGARRYKSDDIEIDLKVKTSELYRGXXXXXXXXXXXXCQRCDGTGWKSHASIVKKKT 166
                    +SDD+++ LKV  ++ Y G            C++C+G+GW+  +     +T
Sbjct: 113 ---------RSDDVQVPLKVSMADCYNGKVFKFQSKRKIVCEKCEGSGWRRRSGGPPPQT 163

Query: 167 AKFFWNVCEGCEGQGVRQRLRQLAPGFVTTELIECRQCGGKGKLRNLPKSEKNKCPDCIT 226
                  C+ C+G+G +++LR++APG V  + + C  C GKGK  + P SEKN+C  C  
Sbjct: 164 N------CKSCQGRGYKEQLRRVAPGMVAQQTVSCGMCHGKGKYVSKPTSEKNQCKKCRG 217

Query: 227 SGTVGMVEENKVVTINIKKGTLDGDKIVLKGEADEDLESTEVGDLVIKIQEVKEPQYDIV 286
               GM+EE K +T++I +G+  GD+IV +GEAD+++  ++ GDL+  + E  EP   + 
Sbjct: 218 Q---GMIEEAKPLTVSIPRGSRHGDRIVFEGEADQEVGKSKTGDLIFIVDEGTEPPEGVR 274

Query: 287 --RNGYDLIIKKQIDLADAICGFDEKPLMETYDGRVLKWSSKRGKVIRPNDIVRIQNEGW 344
             R GYDLI    I LA+AI G D + L +T DGRVLK S+  GKVI P  I++++ EGW
Sbjct: 275 LERRGYDLITNISISLAEAITGLD-RTLTKTLDGRVLKLSTPAGKVISPGKIIKVEQEGW 333

Query: 345 PRREDANDNNTLLKNGDLYVIVDIVFPPDNWTMEVNDYRAVRNIIPS-TINKRESSTSGE 403
           P       N+   K GDLYV+VDIVFP DNW  E +D   +RNI+PS   N    +  G 
Sbjct: 334 PL------NSHATKFGDLYVLVDIVFPRDNWFAEKSDLLKIRNILPSEAANNDVKADPG- 386

Query: 404 SILNVENINVSEIVKEIPNCDELPKFQDTYDNT-NDKGESP-FWTPNCSQQ 452
              N E ++  ++V ++P  D +    D Y +  +  G  P   TP C+QQ
Sbjct: 387 ---NTEQVSDMKLVDQLP--DYMGSNGDQYAHEGHASGAFPDDGTPQCAQQ 432

>NDAI0B02000 Chr2 (497023..498324) [1302 bp, 433 aa] {ON} Anc_8.264
          Length = 433

 Score =  270 bits (691), Expect = 9e-86,   Method: Compositional matrix adjust.
 Identities = 164/458 (35%), Positives = 248/458 (54%), Gaps = 34/458 (7%)

Query: 2   DYYGLLGVGQDASQDEIKRAYRKLALRHHPDKARGNEGGEDSSDDLPDVDFKEVTAAYQV 61
           D Y +LGV   A+  EIK+AYRKLAL++HPDK       E++     ++ FKE+T+AY++
Sbjct: 3   DLYSILGVTSSATDSEIKKAYRKLALQYHPDKVLDPNDREEN-----EIKFKEITSAYEI 57

Query: 62  LSDASLRAEYDQKLAFEAQPYXXXXXXXXXXXXXXXXHPGHRS-GFDSGRGARRYKSDDI 120
           LSD   RA YD  L  +A                    P + S  FD+       KS D+
Sbjct: 58  LSDEEKRAHYD--LYGDANENEYNNQNANDFFNFETDQPDYDSYAFDND------KSKDV 109

Query: 121 EIDLKVKTSELYRGXXXXXXXXXXXXCQRCDGTGWKSHASIVKKKTAKFFWNV-CEGCEG 179
           +I LK+   ELY G            C +C+G GW+      K         + C+ C G
Sbjct: 110 KIPLKLSIQELYNGKTFKFQSKRNIICVQCEGLGWRRR----KNGNVTIPHEIECKKCNG 165

Query: 180 QGVRQRLRQLAPGFVTTELIECRQCGGKGKLRNLPKSEKNKCPDCITSGTVGMVEENKVV 239
            G ++R R L PGFVTT+ I C  C GKG++   P SEKNKC +C      G++ ENK +
Sbjct: 166 LGYKERTRMLIPGFVTTDKIRCEDCHGKGEVYAKPNSEKNKCKNCHGK---GLLSENKQL 222

Query: 240 TINIKKGTLDGDKIVLKGEADEDLESTEVGDLVIKIQEVKEPQYDI--VRNGYDLIIKKQ 297
            +++ +G  + D I ++ EAD+++  ++ GD+++ I+E      D+  +R G D ++   
Sbjct: 223 LVSVPRGLQNKDTIRIENEADQEIGKSKTGDIILVIEEDTTMPSDVHFIRKGTDFVMYLS 282

Query: 298 IDLADAICGFDEKPLMETYDGRVLKWSSKRGKVIRPNDIVRIQNEGWPRREDANDNNTLL 357
           + LA+A+ GF +K L ++ DGR+L  S   GKVIRP +I++I+ EGWP    A+      
Sbjct: 283 LSLAEALTGFKDKFLSKSLDGRILTLSVPSGKVIRPGNIIKIKQEGWPVNPQAS------ 336

Query: 358 KNGDLYVIVDIVFPPDNWTMEVNDYRAVRNIIPSTINKRESSTSGESILNVENINVSEIV 417
           K GDLYVI+ I FPPDNW  E +D + +RN++PS IN   +S   +  LN E +   +I+
Sbjct: 337 KFGDLYVIIKIEFPPDNWFSEKSDIQLLRNVLPSGINGMMNSWKIDDPLNTETVTTFDIL 396

Query: 418 KEIPNCDELPKFQDTYDNTNDKGESPF---WTPNCSQQ 452
           +E+P+       +  YD T D+ ++ +     P CSQQ
Sbjct: 397 EELPDTLNESNNRSAYD-TGDQSDANYDREGPPQCSQQ 433

>TDEL0F03910 Chr6 (728488..729777) [1290 bp, 429 aa] {ON} Anc_8.264
           YLR090W
          Length = 429

 Score =  264 bits (674), Expect = 3e-83,   Method: Compositional matrix adjust.
 Identities = 161/425 (37%), Positives = 235/425 (55%), Gaps = 30/425 (7%)

Query: 4   YGLLGVGQDASQDEIKRAYRKLALRHHPDKARGNEGGEDSSDDLPDVDFKEVTAAYQVLS 63
           Y +LGV  DA+Q EIK+AYRK AL+HHPDK       E+S     +V FKE+ AAY+VL 
Sbjct: 5   YEILGVEIDATQLEIKKAYRKAALQHHPDKVADESLREES-----EVRFKEIAAAYEVLG 59

Query: 64  DASLRAEYDQKLAFEAQPYXXXXXXXXXXXXXXXXHP---GHRSGFDSGRGARRYKSDDI 120
           D   RA YD+    +   +                H      ++ +D     +  +S D+
Sbjct: 60  DEEKRARYDKYGDADGSDFFNGPNEFEDAAFMNFFHSFGSNPQNAYDHYGEQKVDRSADV 119

Query: 121 EIDLKVKTSELYRGXXXXXXXXXXXXCQRCDGTGWKS-HASIVKKKTAKFFWNVCEGCEG 179
           ++ L V  ++ Y G            C RC G+GW+  +  +V     +     C+ C G
Sbjct: 120 QVPLNVSMADCYNGKSFKFQSKRTLVCDRCLGSGWRRRNDHVVPPPQVE-----CKKCGG 174

Query: 180 QGVRQRLRQLAPGFVTTELIECRQCGGKGKLRNLPKSEKNKCPDCITSGTVGMVEENKVV 239
           QG +QR+R+LAPGF TTE I C  C GKGK  + P ++KNKC  C+ +   G+  E+K +
Sbjct: 175 QGFKQRIRRLAPGFATTENITCPTCDGKGKCASKPNNDKNKCKKCVGT---GVTTESKSL 231

Query: 240 TINIKKGTLDGDKIVLKGEADEDLESTEVGDLVIKIQEVKE-PQ-YDIVRNGYDLIIKKQ 297
           T+++ +G+   D+IVLKGEAD+++  ++ G+LV  I+E  E P+  D+ R+G+DLI    
Sbjct: 232 TVSLPRGSRQDDQIVLKGEADQEVGKSQTGNLVFTIKEGTECPEGVDLQRHGFDLITHLT 291

Query: 298 IDLADAICGFDEKPLMETYDGRVLKWSSKRGKVIRPNDIVRIQNEGWPRREDANDNNTLL 357
           + LA+AI GF  K L +T DGR+L+     GKVIRP +I++I +EGWP      D  T  
Sbjct: 292 LSLAEAITGF-SKTLTKTLDGRILQLQIPPGKVIRPGNIIQIPHEGWPI-----DTTT-- 343

Query: 358 KNGDLYVIVDIVFPPDNWTMEVNDYRAVRNIIPSTINKRESSTSGESILNVENINVSEIV 417
            +GDLYV+V I FPPDNW  E +D   V+N++P   N   +        N E +    IV
Sbjct: 344 -SGDLYVVVHIEFPPDNWFSERSDLTQVKNVLPGETNNNAAVEDDPG--NTETVTNINIV 400

Query: 418 KEIPN 422
           +EIP+
Sbjct: 401 EEIPD 405

>TPHA0A01790 Chr1 complement(362209..363528) [1320 bp, 439 aa] {ON}
           Anc_8.264 YLR090W
          Length = 439

 Score =  257 bits (657), Expect = 1e-80,   Method: Compositional matrix adjust.
 Identities = 159/462 (34%), Positives = 245/462 (53%), Gaps = 44/462 (9%)

Query: 2   DYYGLLGVGQDASQDEIKRAYRKLALRHHPDKARGNEGGEDSSDDLPDVDFKEVTAAYQV 61
           D Y +L V +  +QDE+K+ YRKLAL++HPDK +  +G ED      ++ FKE+ +AY++
Sbjct: 11  DLYAILEVDETITQDELKKQYRKLALKYHPDKVQTTDGDEDDVKLEYELKFKEIISAYEI 70

Query: 62  LSDASLRAEYDQKLAFEAQPYXXXXXXXXXXXXXXXXHPGHRSGFDSGRGARRYKSDDIE 121
           LSD   R +YD +  F                        +  G ++  G +   S DI 
Sbjct: 71  LSDEEKRKQYDLQKNFR----------------DANQGSDYGDGINTAFGNQT--SKDIS 112

Query: 122 IDLKVKTSELYRGXXXXXXXXXXXXCQRCDGTGWKSHASIVKKKTAKFF---WNVCEGCE 178
           I LKV   +LY G            C++C G GW+S      +K  K +      C+ C+
Sbjct: 113 IPLKVTIKDLYNGKIIRYDIKRNVICEKCVGLGWRS------RKNGKQYVPPLTECKTCD 166

Query: 179 GQGVRQRLRQLAPGFVTTELIECRQCGGKGKLRNLPKSEKNKCPDCITSGTVGMVEENKV 238
           G G +Q  +Q+APGF T + + C+ C GKG+    P S KN C  C      G++E ++ 
Sbjct: 167 GAGYKQVRQQIAPGFFTKQNLVCKNCDGKGRYYKKPASSKNFCLKC---NGKGIIEISES 223

Query: 239 VTINIKKGTLDGDKIVLKGEADEDLESTEVGDLVIKIQEVKEPQYDIVRNG-YDLIIKKQ 297
           +T+NI +G+ D D I++  +AD++L   + GDL+  ++E+ + Q  + R G  DLI +  
Sbjct: 224 ITVNIPRGSSDKDTIIIDNKADQELGKFKTGDLIFVLEEIDDEQTALKRYGDKDLITELT 283

Query: 298 IDLADAICGFDEKPLMETYDGRVLKWSSKRGKVIRPNDIVRIQNEGWPRREDANDNNTLL 357
           I LADAI GF EKP+++T DGR+L+ S   GKVIR  DI++++ EGWP  ++A       
Sbjct: 284 ISLADAITGFKEKPIVKTLDGRLLRLSIPVGKVIRFGDILKVEGEGWPLNKNAT------ 337

Query: 358 KNGDLYVIVDIVFPPDNWTMEVNDYRAVRNIIPSTINKRESSTSGESILNVENINV-SEI 416
           ++GDLY+  +I FP DNW  E+ND   +RN++P+  + +          ++ NI + SE 
Sbjct: 338 RSGDLYIKFNIEFPADNWNSEMNDIIKIRNLLPAISDAKADILGDMPKDDIFNITMNSED 397

Query: 417 VKEIPNCDELPKFQDTYDNT----NDKGESPFWT--PNCSQQ 452
           +       +LP   DT  N        G+S  +T  P CSQQ
Sbjct: 398 ISNYDFVKDLPDIIDTSHNNGAEYGHNGDSANFTEMPECSQQ 439

>NCAS0B05030 Chr2 (934492..935793) [1302 bp, 433 aa] {ON} Anc_8.264
          Length = 433

 Score =  254 bits (648), Expect = 3e-79,   Method: Compositional matrix adjust.
 Identities = 167/470 (35%), Positives = 251/470 (53%), Gaps = 58/470 (12%)

Query: 2   DYYGLLGVGQDASQDEIKRAYRKLALRHHPDKARGNEGGEDSSDD--LPDVDFKEVTAAY 59
           D Y +LGV  +A+  +IK+AYRKLAL+HHPDK   +     +SDD    ++ FKE++AAY
Sbjct: 3   DLYAVLGVASNATDSDIKKAYRKLALQHHPDKVVNS-----NSDDREASEIKFKEISAAY 57

Query: 60  QVLSDASLRAEYDQKLAFEAQPYXXXXXXXXXXXXXXXXHPGHRSGFDSGRG---ARRY- 115
           ++LSD   RA YD                          +    S F+  +    +R Y 
Sbjct: 58  EILSDEDKRAHYD------------LYGSEEEQQRQQRQYDPFESFFNFEQDEEPSRHYE 105

Query: 116 ---KSDDIEIDLKVKTSELYRGXXXXXXXXXXXXCQRCDGTGWK--SHASIVKKKTAKFF 170
              +S D++I LK+   ELY G            C  C+G GW+   +  +      +  
Sbjct: 106 DPKRSPDVKIPLKMTIQELYNGKTFKFKFKRNVICDNCEGLGWRRRKNGQVTVPPEVE-- 163

Query: 171 WNVCEGCEGQGVRQRLRQLAPGFVTTELIECRQCGGKGKLRNLPKSEKNKCPDCITSGTV 230
              C+ C+GQG  +++R LAPGF T E  +C+QC GKGK      SEKNKC  C      
Sbjct: 164 ---CKLCKGQGFTEKVRMLAPGFATREKRKCKQCDGKGKHYAKANSEKNKCKKCHGE--- 217

Query: 231 GMVEENKVVTINIKKGTLDGDKIVLKGEADEDLESTEVGDLVIKIQEVKEPQYDIV--RN 288
           G+  E+KV+T+++ +G  DGD I +  EAD++L   + GDL+  I+E +    D+   R 
Sbjct: 218 GLFAESKVLTVSVPRGLRDGDTIKVVNEADQELGKPKTGDLIFSIEEDQRCPKDVQLERK 277

Query: 289 GYDLIIKKQIDLADAICGFDEKPLMETYDGRVLKWSSKRGKVIRPNDIVRIQNEGWPRRE 348
           G + + +  I LA+A+ GF +K + +T+DGR+L  S   GKVIRP +I++I+ EGWP   
Sbjct: 278 GSNFMTELNISLAEALTGFKDKFVTKTFDGRILNLSIPPGKVIRPGNIIKIEQEGWPLNG 337

Query: 349 DANDNNTLLKNGDLYVIVDIVFPPDNWTMEVNDYRAVRNIIP-STINKRESSTSGESILN 407
           +A       K GDLY+ V+I FPPDNW  E +D   ++NI+P ST +K + S   +  LN
Sbjct: 338 EAT------KFGDLYISVNIEFPPDNWFTEKSDLTQIKNILPRSTSDKTKLS---DDPLN 388

Query: 408 VENINVSEIVKEIPNCDELPKFQDTYDNTND-----KGESPFWTPNCSQQ 452
            E +   E+++ +P  D L + QD  +N  +     +GE    +P C+QQ
Sbjct: 389 TELLLKFEVLETLP--DTLKEGQDQGENNAESHGEYRGEG---SPQCAQQ 433

>Suva_10.174 Chr10 (325531..326901) [1371 bp, 456 aa] {ON} YLR090W
           (REAL)
          Length = 456

 Score =  246 bits (627), Expect = 6e-76,   Method: Compositional matrix adjust.
 Identities = 154/453 (33%), Positives = 233/453 (51%), Gaps = 48/453 (10%)

Query: 4   YGLLGVGQDASQDEIKRAYRKLALRHHPDKARGNEGGEDSSDDLPDVDFKEVTAAYQVLS 63
           Y +LGV ++AS  EIK AYRKLAL+HHPDK+      +  S +L +  FKE+TAAY++LS
Sbjct: 11  YDVLGVTREASVQEIKTAYRKLALKHHPDKSV-----DQDSKELNETKFKEITAAYEILS 65

Query: 64  DASLRAEYD----------QKLAFEAQPYXXXXXXXXXXXXXXXXHPGHRSGFDSGRGAR 113
           D   ++ YD               +                     P     ++   G  
Sbjct: 66  DPEKKSHYDLYGDDNGTGGGDEFGDDDFMNFFNNFFNNGAHEANDFPNEHEMYE---GNE 122

Query: 114 RYKSDDIEIDLKVKTSELYRGXXXXXXXXXXXXCQRCDGTGWKSHASIVKKKTAKFFWNV 173
              S DI+IDL     +LY G            C +C G+GWK+     KKK        
Sbjct: 123 TTSSKDIDIDLSFTMKDLYMGKKLKFELKRQIICGKCQGSGWKA-----KKKVHVTHEME 177

Query: 174 CEGCEGQGVRQRLRQLAPGFVTTELIECRQCGGKGKLRNLPKSEKNKCPDCITSGTVGMV 233
           CE C G+G ++RL++  PG V ++ + C +C GKGK    PK+ KN CPDC    +VG+ 
Sbjct: 178 CESCGGKGSKERLKRFGPGLVASQWVVCEKCHGKGKYTKRPKNRKNFCPDC---ESVGLQ 234

Query: 234 EENKVVTINIKKGTLDGDKIVLKGEADEDLESTEVGDLVIKIQEVKE--PQYDIVRNGY- 290
            + +V+T+N+  G    D + +KG ADE+++    GDL+  + E  E   Q  ++   + 
Sbjct: 235 YKKEVITVNVPPGHHFNDVVTVKGMADEEIDKAVCGDLIFHLVEKPEDLQQKQVLMKKFG 294

Query: 291 -----DLIIKKQIDLADAICGFDEKPLMETYDGRVLKWSSKRGKVIRPNDIVRIQNEGWP 345
                DL +   + L++A+ GF EK L  T+D R+L  S K GKVIRP DI++I NEGWP
Sbjct: 295 GGNLQDLYVSITVSLSEALTGF-EKFLTRTFDDRLLTLSIKPGKVIRPGDIIKITNEGWP 353

Query: 346 RREDANDNNTLLKNGDLYVIVDIVFPPDNWTMEVNDYRAVRNIIPSTINKRESST----S 401
             +         + GDLYV VDI FPPDNW  E ++  A++  +PS+ ++  ++T    S
Sbjct: 354 ILDHPRG-----QCGDLYVFVDIEFPPDNWFNEKSELLAIKTHLPSSTSRPSNTTVNTGS 408

Query: 402 GESILNVENINVSEIVKEIPNCDELPKFQDTYD 434
             S +N E ++  +I+    + D+LP+   T++
Sbjct: 409 DNSPINSETVSNFQII----HSDDLPEGMKTFN 437

>KLTH0G13640g Chr7 complement(1167336..1168580) [1245 bp, 414 aa]
           {ON} similar to uniprot|P39102 Saccharomyces cerevisiae
           YLR090W XDJ1 Putative homolog of E. coli DnaJ closely
           related to Ydj1p
          Length = 414

 Score =  242 bits (617), Expect = 6e-75,   Method: Compositional matrix adjust.
 Identities = 165/472 (34%), Positives = 234/472 (49%), Gaps = 78/472 (16%)

Query: 1   MDYYGLLGVGQDASQDEIKRAYRKLALRHHPDKARGNEGGEDSSDDLPDVDFKEVTAAYQ 60
           MD Y  LGV  DA+QDEIK+AYR+LAL+HHPDK       ++S  D  ++ FKEV AAY+
Sbjct: 1   MDPYETLGVAPDATQDEIKKAYRRLALQHHPDKV-----SDESLRDESEIKFKEVAAAYE 55

Query: 61  VLSDASLRAEYDQKLAFEAQPYXXXXXXXXXXXXXXXXHPGHRSGFDSGRGAR------- 113
           +LS+   R  YD                            G  SGF  G  A        
Sbjct: 56  LLSNEEKRQNYD-------------------TYGDTNGFSGDYSGFQDGDFASFFGNFAS 96

Query: 114 -RY------------KSDDIEIDLKVKTSELYRGXXXXXXXXXXXXCQRCDGTGWKSHAS 160
            RY            ++DD  + +++   ELY G            C RC+GTG +  A 
Sbjct: 97  NRYQDEYEAQSPPSPRTDDAHVPIRLTMQELYNGKTIRFQAKRNVVCNRCEGTGVRRRAR 156

Query: 161 IVKKKTAKFFWNVCEGCEGQGVRQRLRQLAPGFVTTELIECRQCGGKGKLRNLPKSEKNK 220
                      + C  CEG GV+QRLR+L PGFVT E+++C +C G GK  NL +SE + 
Sbjct: 157 ---------HASACSQCEGHGVKQRLRRLGPGFVTREIVQCDKCKGLGK--NL-RSE-DM 203

Query: 221 CPDCITSGTVGMVEENKVVTINIKKGTLDGDKIVLKGEADEDLESTEVGDLVIKIQEVKE 280
           C  C       +  E+K + + I +G+  GD++VLKGEADE+      GDLV  I E   
Sbjct: 204 CKKCHGK---RVTPESKNLNVYIPRGSRHGDRVVLKGEADEEPGKIP-GDLVFDIAE-NS 258

Query: 281 PQYDIVRNGYDLIIKKQIDLADAICGFDEKPLMETYDGRVLKWSSKRGKVIRPNDIVRIQ 340
               + R G DL  K  I L+DA+ GF EK +  T DGR+LK     G+V+RP + VRI 
Sbjct: 259 ASSSLERRGSDLYAKITISLSDALTGF-EKEVCTTLDGRLLKLKVPLGQVVRPGNFVRID 317

Query: 341 NEGWPRREDANDNNTLLKNGDLYVIVDIVFPPDNWTMEVNDYRAVRNIIPSTINKRESST 400
           NEGWP  +  +      K GD+YV +DI FPPD+W  E +D ++++N++P  ++   +S 
Sbjct: 318 NEGWPLDDQGS------KFGDMYVQIDIEFPPDHWFSERSDVKSLQNLLPQAVSSSATSD 371

Query: 401 SGESILNVENINVSEIVKEIPNCDELPKFQDTYDNTNDKGESPFWTPNCSQQ 452
              S  +  N         + + +ELP++       ++ G      P C+QQ
Sbjct: 372 FNASASDPANTETPLKFSIVKSAEELPQY---LSEESEPG------PQCAQQ 414

>Smik_12.149 Chr12 (300591..301973) [1383 bp, 460 aa] {ON} YLR090W
           (REAL)
          Length = 460

 Score =  242 bits (618), Expect = 1e-74,   Method: Compositional matrix adjust.
 Identities = 157/450 (34%), Positives = 233/450 (51%), Gaps = 50/450 (11%)

Query: 4   YGLLGVGQDASQDEIKRAYRKLALRHHPDKARGNEGGEDSSDDLPDVDFKEVTAAYQVLS 63
           Y +LGV  DAS  EIK AYRKLAL+HHPDK       + +S ++ ++ FKE+TAAY++LS
Sbjct: 11  YDVLGVTSDASVQEIKTAYRKLALKHHPDKYV-----DQNSKEVNEIKFKEITAAYEILS 65

Query: 64  DASLRAEYDQKLAFEAQPYXXXXXXXX--------XXXXXXXXHPGHRSGFDSGRGARRY 115
           D   ++ YD         Y                        + G   G D  R    Y
Sbjct: 66  DPEKKSHYD----LYGDDYGTAGSTGADGFGDDDFMNFFNNFFNSGDHEGNDFPREYDTY 121

Query: 116 KSD------DIEIDLKVKTSELYRGXXXXXXXXXXXXCQRCDGTGWKSHASIVKKKTAKF 169
           + D      DI+ID+ +   +LY G            C  C G+GWK     +KKK    
Sbjct: 122 EEDKCKSSKDIDIDIFLTVKDLYMGKKLKFELKRQIVCMVCHGSGWK-----LKKKIHVT 176

Query: 170 FWNVCEGCEGQGVRQRLRQLAPGFVTTELIECRQCGGKGKLRNLPKSEKNKCPDCITSGT 229
               CE C G+G ++RL++  PG V ++ + C +C GKGK    PK+ KN CPDC     
Sbjct: 177 HEVECESCGGKGSKERLKRFGPGLVASQWVTCEKCHGKGKYVKRPKNPKNFCPDC---AG 233

Query: 230 VGMVEENKVVTINIKKGTLDGDKIVLKGEADEDLESTEVGDL---VIKIQEVKEPQYDIV 286
           VG+  + +++T+N+  G    D I +KG ADE+L+ +  GDL   +++ QE  E +   +
Sbjct: 234 VGLQSKKEIITVNVAPGHHFNDVITIKGMADEELDKSACGDLKFHLVEKQENLEQKQIFL 293

Query: 287 RN-----GYDLIIKKQIDLADAICGFDEKPLMETYDGRVLKWSSKRGKVIRPNDIVRIQN 341
           +N       DL     I L++A+ GF EK L  T+D R+L  S K G+VIRP D+++I N
Sbjct: 294 KNFDEGSAEDLYTSATISLSEALTGF-EKFLTRTFDDRLLTLSIKPGRVIRPGDVIKITN 352

Query: 342 EGWPRREDANDNNTLLKNGDLYVIVDIVFPPDNWTMEVNDYRAVRNIIP--STINKRESS 399
           EGWP  +D        + GDLYV + I FPPDNW  E ++  A++ ++P  S+   + ++
Sbjct: 353 EGWPIMDDPRG-----QRGDLYVFIHIEFPPDNWFNEKSELLAIKTMLPSSSSCTFQTTA 407

Query: 400 TSGESILN-VENINVSEIVKEIPNCDELPK 428
            +GE   N + N  +S    +I N +ELP+
Sbjct: 408 NTGEDDRNPINNETISNF--QIINMEELPE 435

>SAKL0H16984g Chr8 complement(1490925..1492232) [1308 bp, 435 aa]
           {ON} similar to uniprot|P39102 Saccharomyces cerevisiae
           YLR090W XDJ1 Putative homolog of E. coli DnaJ closely
           related to Ydj1p
          Length = 435

 Score =  240 bits (613), Expect = 5e-74,   Method: Compositional matrix adjust.
 Identities = 162/462 (35%), Positives = 238/462 (51%), Gaps = 44/462 (9%)

Query: 4   YGLLGVGQDASQDEIKRAYRKLALRHHPDKARGNEGGEDSSDDLPDVDFKEVTAAYQVLS 63
           Y +LGV  DASQ EIK+AYRKLAL+HHPDK       E+S     ++ FKE+TAAY++LS
Sbjct: 5   YEVLGVAPDASQTEIKKAYRKLALQHHPDKVADEVLREES-----EMKFKEITAAYEILS 59

Query: 64  DASLRAEYDQKLAFEAQPYXXXXXXXXXXXXXXXXHPGHRSG---FDSGRGA------RR 114
           D   R +YD  +  +  P                      +G   +D  R        R 
Sbjct: 60  DEDSRKKYD--VYGDDAPGASGGGGDPFGDDDFMNFFRTYAGGGFYDEPRQPYPEEENRS 117

Query: 115 YKSDDIEIDLKVKTSELYRGXXXXXXXXXXXXCQRCDGTGWKSHASIVKKKTAKFFWNVC 174
            ++ D  I LK+   ELY G            C RC G+G +       +K       VC
Sbjct: 118 VRTSDARIPLKLSMKELYNGKTFKFRSKRNVLCDRCQGSGLRKKFQQHPRKPV-----VC 172

Query: 175 EGCEGQGVRQRLRQLAPGFVTTELIECRQCGGKGKLRNLPKSEKNKCPDCITSGTVGMVE 234
           + CEG G ++R++++A GFV  E ++C +C GKG  R  P   ++ C  C   G   ++ 
Sbjct: 173 QSCEGHGHKERIKRVAQGFVIRETVKCERCNGKG--RTTPTKPEDHCKKC--HGKC-VIS 227

Query: 235 ENKVVTINIKKGTLDGDKIVLKGEADEDLESTEVGDLVIKIQEVKEPQYDIVRNGYDLII 294
           E K +T+ I +G+ +GD + L+GEAD++ +    GDL+  I+E  E   ++ R G DL  
Sbjct: 228 EEKTLTVYIPRGSRNGDIVKLEGEADQEPDKV-TGDLLFVIEENPETSTNLERRGDDLHT 286

Query: 295 KKQIDLADAICGFDEKPLMETYDGRVLKWSSKRGKVIRPNDIVRIQNEGWPRREDANDNN 354
           + +I L++AI GF EK +  T D R+LK    +GKVIRP + +R++NEGWP  +  N   
Sbjct: 287 RLKISLSEAITGF-EKVVTTTLDDRILKLKIPQGKVIRPGNYIRLENEGWPLDDSGN--- 342

Query: 355 TLLKNGDLYVIVDIVFPPDNWTMEVNDYRAVRNIIPSTINKRESSTSGESILNVENINVS 414
              K GD+YV V I FPPDNW  E +D   +R ++P   N R + T    + N E +   
Sbjct: 343 ---KFGDMYVQVHIEFPPDNWFSEKSDVEVLRTLLPEVPNARVADTG--DLNNTETVIDY 397

Query: 415 EIVKEIPNCDELPKFQDTYDNTNDKGES----PFWTPNCSQQ 452
            +VK   + DELP +  +Y+    +G+      F  P C+QQ
Sbjct: 398 SVVK---SADELPDYL-SYEKGEYQGQEQEYGAFEEPQCAQQ 435

>YLR090W Chr12 (320701..322080) [1380 bp, 459 aa] {ON}  XDJ1Putative
           chaperone, homolog of E. coli DnaJ, closely related to
           Ydj1p; the authentic, non-tagged protein is detected in
           highly purified mitochondria in high-throughput studies
          Length = 459

 Score =  237 bits (604), Expect = 2e-72,   Method: Compositional matrix adjust.
 Identities = 152/448 (33%), Positives = 233/448 (52%), Gaps = 47/448 (10%)

Query: 4   YGLLGVGQDASQDEIKRAYRKLALRHHPDKARGNEGGEDSSDDLPDVDFKEVTAAYQVLS 63
           Y +LGV +DA+  EIK AYRKLAL+HHPDK       +  S ++ ++ FKE+TAAY++LS
Sbjct: 11  YDVLGVTRDATVQEIKTAYRKLALKHHPDKYV-----DQDSKEVNEIKFKEITAAYEILS 65

Query: 64  DASLRAEYD----QKLAFEAQPYXXXXXXXXXXXXXXXXHPGHRSG------FDSGRGAR 113
           D   ++ YD       A  +                   + G   G      +D+     
Sbjct: 66  DPEKKSHYDLYGDDNGAASSGGANGFGDEDFMNFFNNFFNNGSHDGNNFPGEYDAYEEGN 125

Query: 114 RYKSDDIEIDLKVKTSELYRGXXXXXXXXXXXXCQRCDGTGWKSHASIVKKKTAKFFWNV 173
              S DI+ID+ +   +LY G            C +C G+GWK      K+K        
Sbjct: 126 STSSKDIDIDISLTLKDLYMGKKLKFDLKRQVICIKCHGSGWKP-----KRKIHVTHDVE 180

Query: 174 CEGCEGQGVRQRLRQLAPGFVTTELIECRQCGGKGKLRNLPKSEKNKCPDCITSGTVGMV 233
           CE C G+G ++RL++  PG V ++ + C +C GKGK    PK+ KN CPDC     +G++
Sbjct: 181 CESCAGKGSKERLKRFGPGLVASQWVVCEKCNGKGKYTKRPKNPKNFCPDC---AGLGLL 237

Query: 234 EENKVVTINIKKGTLDGDKIVLKGEADEDLESTEVGDLVIKI---QEVKEPQYDIVRN-- 288
            + +++T+N+  G    D I +KG ADE+++ T  GDL   +   QE  E +   ++N  
Sbjct: 238 SKKEIITVNVAPGHHFNDVITVKGMADEEIDKTTCGDLKFHLTEKQENLEQKQIFLKNFD 297

Query: 289 ---GYDLIIKKQIDLADAICGFDEKPLMETYDGRVLKWSSKRGKVIRPNDIVRIQNEGWP 345
              G DL     I L++A+ GF EK L +T+D R+L  S K G+V+RP D ++I NEGWP
Sbjct: 298 DGAGEDLYTSITISLSEALTGF-EKFLTKTFDDRLLTLSVKPGRVVRPGDTIKIANEGWP 356

Query: 346 RREDANDNNTLLKNGDLYVIVDIVFPPDNWTMEVNDYRAVRNIIPSTINKRESSTSGESI 405
             ++ +      + GDLYV V I FPPDNW  E ++  A++  +PS+     SS +  + 
Sbjct: 357 ILDNPHG-----RCGDLYVFVHIEFPPDNWFNEKSELLAIKTNLPSS-----SSCASHAT 406

Query: 406 LNVE---NINVSEIVK--EIPNCDELPK 428
           +N E   N+  +E +    I + D+LP+
Sbjct: 407 VNTEDDSNLTNNETISNFRIIHTDDLPE 434

>Skud_12.158 Chr12 (303908..305275) [1368 bp, 455 aa] {ON} YLR090W
           (REAL)
          Length = 455

 Score =  236 bits (601), Expect = 4e-72,   Method: Compositional matrix adjust.
 Identities = 151/448 (33%), Positives = 230/448 (51%), Gaps = 41/448 (9%)

Query: 4   YGLLGVGQDASQDEIKRAYRKLALRHHPDKARGNEGGEDSSDDLPDVDFKEVTAAYQVLS 63
           YG+LGV +DA   EIK AYRKLAL+HHPDK       +  S D+ ++ FKE+TAAY++LS
Sbjct: 11  YGVLGVTRDADVQEIKTAYRKLALKHHPDKYV-----DQDSKDVNEIKFKEITAAYEILS 65

Query: 64  DASLRAEYDQKLAFEAQPYXXXXXXXXXXXXXXXXHPGHRSGFDSGRG-ARRYK------ 116
           D   ++ YD                          +     G   G G +  YK      
Sbjct: 66  DPEKKSHYDLYGDDNGTANGGGTDGFGNDDFMNFFNNFFNDGGHEGNGFSNEYKMYEDND 125

Query: 117 ---SDDIEIDLKVKTSELYRGXXXXXXXXXXXXCQRCDGTGWKSHASIVKKKTAKFFWNV 173
              S DI+ID+ +   +LY G            C +C G+GWK+     KK+        
Sbjct: 126 SASSKDIDIDISLTMKDLYMGKKLRFDLKRQVVCMKCHGSGWKT-----KKRVHVTHEVE 180

Query: 174 CEGCEGQGVRQRLRQLAPGFVTTELIECRQCGGKGKLRNLPKSEKNKCPDCITSGTVGMV 233
           CE C G+G ++RL++  PG V ++ + C +C GKGK R  PK+ KN CPDC     VG+ 
Sbjct: 181 CESCGGKGSKERLKRFGPGLVASQWVMCEKCHGKGKYRKSPKNPKNFCPDC---AGVGLQ 237

Query: 234 EENKVVTINIKKGTLDGDKIVLKGEADEDLESTEVGDLVIKIQEVKEPQYD---IVR--- 287
            + +V+T+ +  G    D I ++G ADE++     GDL   + E +E  +     ++   
Sbjct: 238 SKKEVITVIVAPGHHFNDVITIEGMADEEIGKAACGDLRFHLNERQEDWFAKQVFLKNFG 297

Query: 288 --NGYDLIIKKQIDLADAICGFDEKPLMETYDGRVLKWSSKRGKVIRPNDIVRIQNEGWP 345
             N  D  +   I L++A+ GF EK L +T+D R+L  S K G+VIRP D+++I NEGWP
Sbjct: 298 DGNMEDSYVSVTISLSEALTGF-EKFLTKTFDDRLLTLSIKPGRVIRPGDVLKITNEGWP 356

Query: 346 RREDANDNNTLLKNGDLYVIVDIVFPPDNWTMEVNDYRAVRNIIPSTINKRESSTSGESI 405
             +DA       + GDLYV + I FPPDNW  E ++   ++  +PS+ +   +S     +
Sbjct: 357 ILDDARG-----RCGDLYVFIHIEFPPDNWFNEKSELLGIKTNLPSSSSSSCASGDANDL 411

Query: 406 LNVENINVSEIVKEIPNCDELPKFQDTY 433
           +N E ++  +I+    + D+LP+   T+
Sbjct: 412 INNETVSNFQII----HTDDLPEGVKTF 435

>AGR084C Chr7 complement(885020..886303) [1284 bp, 427 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR090W
           (XDJ1)
          Length = 427

 Score =  233 bits (593), Expect = 3e-71,   Method: Compositional matrix adjust.
 Identities = 154/462 (33%), Positives = 229/462 (49%), Gaps = 49/462 (10%)

Query: 2   DYYGLLGVGQDASQDEIKRAYRKLALRHHPDKARGNEGGEDSSDDLPDVDFKEVTAAYQV 61
           D Y +LG+   AS+ E+KRAYR+LALR+HPDK       ++S  +  +  FKE++AAY V
Sbjct: 4   DLYEVLGIASSASEQEVKRAYRQLALRYHPDKI-----SDESEREASEAKFKEISAAYAV 58

Query: 62  LSDASLRAEYDQKLAFEAQPYXXXXXXXXXXXXXXXXHPGHRSGFDSGRGARRYKSDDIE 121
           LSD   RAEYDQ    +   Y                  G      +GR   +++ DD E
Sbjct: 59  LSDEQKRAEYDQFGTVDGG-YGHDEFGHGDDDFMNFFRYG------AGRHGYQHEEDDFE 111

Query: 122 ---------IDLKVKTSELYRGXXXXXXXXXXXXCQRCDGTGWKSHASIVKKKTAKFFWN 172
                    + LK+ T +LY G            C RC G+G       ++K+ A     
Sbjct: 112 EVGRTADSTVPLKLTTKQLYLGKTFQFKARRKVLCPRCGGSG-------LRKRAAARPMI 164

Query: 173 VCEGCEGQGVRQRLRQLAPGFVTTELIECRQCGGKGKLRNLPKSEKNKCPDCITSGTVGM 232
            CEGCEGQG ++R+ ++ PG ++ E + C  CGGKGK   +P +  + C  C       +
Sbjct: 165 RCEGCEGQGYKERISRIGPGLISRERVSCADCGGKGK--RIPTTAADNCKKCTGK---CV 219

Query: 233 VEENKVVTINIKKGTLDGDKIVLKGEADEDLESTEVGDLVIKIQEVKEPQYDIVRNGYDL 292
           V+E  ++++ + +G+  GD++   G++D +    E GDLV  I E  +    + R G DL
Sbjct: 220 VQEESIISVYVPRGSQHGDRLRYPGQSDME-PGKETGDLVFVIDEQTDVSSSLERKGTDL 278

Query: 293 IIKKQIDLADAICGFDEKPLMETYDGRVLKWSSKRGKVIRPNDIVRIQNEGWPRREDAND 352
               +I LA+A+ GF  + +  T+D RVL+ +  RGKV+RP + ++  NEGWP  + A  
Sbjct: 279 YCTMKISLAEALTGFT-RIVTRTFDERVLRINIPRGKVLRPGNYLKFTNEGWPIEDGA-- 335

Query: 353 NNTLLKNGDLYVIVDIVFPPDNWTMEVNDYRAVRNIIPSTINKRESSTSGESILNVENIN 412
                + GD+YV V I FP DNW  E  +  A+RNI+P   +    ST  E   N E + 
Sbjct: 336 -----RFGDMYVQVLIEFPKDNWFNEKAELDAIRNILPGLADA--PSTKTEDPSNTEEVR 388

Query: 413 VSEIVKEIPNCDELPKFQDTYDN--TNDKGESPFWTPNCSQQ 452
              I   I N   LP + D  +   +  + ES   TP C  Q
Sbjct: 389 AYSI---IANHTGLPDYLDRENQGYSRQQHESTAGTPECPMQ 427

>Kwal_56.23782 s56 complement(703853..705097) [1245 bp, 414 aa] {ON}
           YLR090W (XDJ1) - Homolog of E. coli DnaJ [contig 173]
           FULL
          Length = 414

 Score =  217 bits (553), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 149/406 (36%), Positives = 205/406 (50%), Gaps = 61/406 (15%)

Query: 1   MDYYGLLGVGQDASQDEIKRAYRKLALRHHPDKARGNEGGEDSSDDLPDVDFKEVTAAYQ 60
           MD Y  LGV  DA+QDEIK+AYR+LAL+HHPDK       E+S     ++ FKEV AAY+
Sbjct: 1   MDPYDTLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLREES-----EIKFKEVAAAYE 55

Query: 61  VLSDASLRAEYDQKLAFEAQPYXXXXXXXXXXXXXXXXHPGHRSG--------FDSGR-- 110
           +LS+   R  YD                          + G + G        F SGR  
Sbjct: 56  LLSNEEKRRNYD---------------TYGDTNGYSDSYGGFQDGDFASFFGNFASGRYE 100

Query: 111 ------GARRYKSDDIEIDLKVKTSELYRGXXXXXXXXXXXXCQRCDGTGWKSHASIVKK 164
                    R ++DD  + L++   +LY G            C RC+G G +  A     
Sbjct: 101 DEEDFRAHARPRTDDAHVSLRLTMQDLYNGKTVRFQSTRNVVCNRCEGAGIRKRAR---- 156

Query: 165 KTAKFFWNVCEGCEGQGVRQRLRQLAPGFVTTELIECRQCGGKGKLRNLPKSEKNKCPDC 224
                  + C  CEG GV+QRLR+L PGFVT E ++C +C G GK  NL +SE + C  C
Sbjct: 157 -----HASACTHCEGHGVKQRLRRLGPGFVTRETVQCTKCRGLGK--NL-RSE-DLCKKC 207

Query: 225 ITSGTVGMVEENKVVTINIKKGTLDGDKIVLKGEADEDLESTEVGDLVIKIQEVKEPQYD 284
                  +  E K + + I +G+   D+IVL+GEADE+      GDLV  I E      +
Sbjct: 208 HGK---RVTPETKNLNVYIPRGSRHNDRIVLEGEADEE-PGKLTGDLVFDISE-DSTTSN 262

Query: 285 IVRNGYDLIIKKQIDLADAICGFDEKPLMETYDGRVLKWSSKRGKVIRPNDIVRIQNEGW 344
           + R G DL  K  I L+DA+ GF EK +  T DGR L+     G+VIRP + + ++NEGW
Sbjct: 263 LERRGSDLHTKIIISLSDALTGF-EKEVCTTLDGRDLRLKIPTGQVIRPGNYICLKNEGW 321

Query: 345 PRREDANDNNTLLKNGDLYVIVDIVFPPDNWTMEVNDYRAVRNIIP 390
           P  ++        K G++YV ++I FPPD+W  E  +  A+RNIIP
Sbjct: 322 PLDDEGK------KFGNMYVQINIEFPPDHWYSERGEIEALRNIIP 361

>Ecym_4306 Chr4 complement(650450..651754) [1305 bp, 434 aa] {ON}
           similar to Ashbya gossypii AGR084C
          Length = 434

 Score =  211 bits (537), Expect = 7e-63,   Method: Compositional matrix adjust.
 Identities = 132/425 (31%), Positives = 215/425 (50%), Gaps = 33/425 (7%)

Query: 2   DYYGLLGVGQDASQDEIKRAYRKLALRHHPDKARGNEGGEDSSDDLPDVDFKEVTAAYQV 61
           D Y +LG+  +A++ E+KRAYR LAL +HPDK       ++S     +  FKE++AAY +
Sbjct: 4   DLYSVLGIKSNATEQEVKRAYRNLALMYHPDKI-----SDESQRAESEAKFKEISAAYDI 58

Query: 62  LSDASLRAEYDQKLAFEAQPYXXXXXXXXXXXXXXXXHPGHRSG------FDSGRGARRY 115
           LSD   R+EYD    F+   +                    R G      ++        
Sbjct: 59  LSDEQKRSEYDHYGRFDEGSFPFGDFDDDYKRGNEDFMNFFRYGAGRYGQYEDAEQKTSQ 118

Query: 116 KSDDIEIDLKVKTSELYRGXXXXXXXXXXXXCQRCDGTGWKSHASIVKKKTAKFFWNVCE 175
           K+ D  + LK+ T +LY G            C +C+G G       ++K+ A      C 
Sbjct: 119 KTKDFVVPLKLSTKQLYLGKTFQFKLKRNVLCSKCEGLG-------LRKRAAHCMPMKCG 171

Query: 176 GCEGQGVRQRLRQLAPGFVTTELIECRQCGGKGKLRNLPKSEKNKCPDCITSGTVGMVEE 235
            C+G+G ++R+ +++PGF++ E + C +C GKG +  + +   + C  C   G   +V E
Sbjct: 172 ICDGRGFKERVSRISPGFISRERVPCDECDGKGTV--VSRDPSDNCKKC--HGKCVIV-E 226

Query: 236 NKVVTINIKKGTLDGDKIVLKGEADEDLESTEVGDLVIKIQEVKEPQYDIVRNGYDLIIK 295
           N ++T+ + +G    D I + G+AD +    E GDLV +I E+ +P  ++ R G DL   
Sbjct: 227 NSILTLYVPRGHRHADTIRIDGQADME-AGKETGDLVFEIDEITDPDAELERKGTDLHCS 285

Query: 296 KQIDLADAICGFDEKPLMETYDGRVLKWSSKRGKVIRPNDIVRIQNEGWPRREDANDNNT 355
             I LA+A+ GF  + +  T+D R+L+ +   GKV+RP + ++  NEGWP        N 
Sbjct: 286 ITISLAEALTGF-TRLVARTFDDRLLRITIPSGKVLRPGNYLKFTNEGWPI-------NN 337

Query: 356 LLKNGDLYVIVDIVFPPDNWTMEVNDYRAVRNIIPSTINKRESSTS-GESILNVENINVS 414
             + GDLYV V+I FP DNW  E ++  A+++I+P   N   S    G+   N E+IN  
Sbjct: 338 GSRFGDLYVKVNIEFPKDNWLNEKSELEAIKHILPGLKNSSNSHQGDGDDPANTEDINSY 397

Query: 415 EIVKE 419
            ++++
Sbjct: 398 YVIQD 402

>KNAG0G02050 Chr7 (466752..468050) [1299 bp, 432 aa] {ON} Anc_8.264
           YLR090W
          Length = 432

 Score =  204 bits (518), Expect = 3e-60,   Method: Compositional matrix adjust.
 Identities = 131/428 (30%), Positives = 219/428 (51%), Gaps = 37/428 (8%)

Query: 1   MDYYGLLGVGQDASQDEIKRAYRKLALRHHPDKARGNEGGEDSSDDLPDVDFKEVTAAYQ 60
           ++ Y +LGV +D++ DEI++AYRKLAL+ HPDK    E  E +S+++    FKE+T AY+
Sbjct: 4   LNPYDILGVDRDSTDDEIRKAYRKLALKFHPDKVIDPE--EKASNEM---KFKEITTAYE 58

Query: 61  VLSDASLRAEYDQKLAFEAQPYXXXXXXXXXXXXXXXXHP--GHRSGFDSGRGARRYKSD 118
           +LS+     E +++   +   +                HP  GH    D         ++
Sbjct: 59  ILSNGEYVEEMEEEYEGQGYGFNFGDDFMNFFNEGRNAHPMGGHPQREDES------TNE 112

Query: 119 DIEIDLKVKTSELYRGXXXXXXXXXXXXCQRCDGTGWKSHASIVKKKTAKFFWN---VCE 175
             +I+++V   +LY G            C  CDG  W+      ++K    +      C 
Sbjct: 113 ATQIEIEVTLKDLYNGKNVKFQLTRNVICTLCDGNCWR------RRKNGDLYSPPVLSCT 166

Query: 176 GCEGQGVRQRLRQLAPGFVTTELIECRQCGGKGKLRNLPKSEKNKCPDCITSGTVGMVEE 235
            C+G G  +RL   +P F   + I CR+C GKG+    P S+KNKC  C   G   +++E
Sbjct: 167 KCKGAGYVERLVGDSPFFQYVQRISCRKCFGKGEYTAKPTSDKNKCKLCHGEG---LIKE 223

Query: 236 NKVVTINIKKGTLDGDKIVLKGEADEDLESTEVGDLVIKIQEVKEPQYD-----IVRNGY 290
            + + + I +G+ + + I+ K + DEDL +   GD+V +++   EP        + + G 
Sbjct: 224 KQQLLVTIPRGSENSNTIIFKEKGDEDLRTRRAGDIVFRLKLHDEPNGGDPDILVTKEGT 283

Query: 291 DLIIKKQIDLADAICGFDEKPLMETYDGRVLKWSSKRGKVIRPNDIVRIQNEGWPRREDA 350
           DL +  +I L +AI G   + L +T+D RVLK +  +GKV+RP D + I+ EGWP+  + 
Sbjct: 284 DLHMNIEIPLIEAISGTQGRFLTKTFDDRVLKLTMPQGKVLRPGDTIVIKGEGWPKTPNG 343

Query: 351 NDNNTLLKNGDLYVIVDIVFPPDNWTMEVNDYRAVRNIIPSTINKRESSTSGESILNVEN 410
            +       GD++V V++ FPPDNW  E ND   + N++P+  +    + +G++  N E 
Sbjct: 344 TE------FGDMFVHVNVEFPPDNWISERNDITTLTNVLPAGKSDDGHAQTGDAN-NAEF 396

Query: 411 INVSEIVK 418
           +   EI+K
Sbjct: 397 VKDYEILK 404

>KLLA0F19184g Chr6 (1778227..1779765) [1539 bp, 512 aa] {ON} similar
           to uniprot|P39102 Saccharomyces cerevisiae YLR090W XDJ1
           Putative homolog of E. coli DnaJ closely related to
           Ydj1p
          Length = 512

 Score =  189 bits (479), Expect = 9e-54,   Method: Compositional matrix adjust.
 Identities = 141/437 (32%), Positives = 213/437 (48%), Gaps = 44/437 (10%)

Query: 4   YGLLGVGQDASQDEIKRAYRKLALRHHPDKARGNEGGEDSSDDLPDVDFKEVTAAYQVLS 63
           Y +LGV +DA++ EI++AYRKLAL++HPDK   +E   ++S+ +    FKEVTAAY++LS
Sbjct: 74  YDVLGVEKDATEVEIRKAYRKLALKYHPDKII-DEAERETSEAM----FKEVTAAYEILS 128

Query: 64  DASLRAEYDQK---------LAFEAQPYXXXXXXXXXXXXXXXXHPGHRSGFDSGRGAR- 113
           D  L++ YD             F    +                H  H S  +  +    
Sbjct: 129 DPELKSRYDMYGDSAFGSGGNGFPEDDHEFDDFMNFFQQYQRQQHGPHASYSNRHQYGEP 188

Query: 114 -RYKSDDIEIDLKVKTSELYRGXXXXXXXXXXXXCQRCDGTGWKSHASIVKKKTAKFFWN 172
              ++ D  I  K+ T +LY G            C  C GTG       ++KK  +    
Sbjct: 189 ESKRTPDSRISYKMTTRQLYMGKTVTFQLKRKCLCPHCSGTG-------LRKKHFQKPEI 241

Query: 173 VCEGCEGQGVRQRLRQLAPGFVTTELIECRQCGGKGKLRNLPKSEKNKCPDCITSGTVGM 232
            C  C GQG ++R+ +LA G++  +   C  C GKG+ R   KS  + C  C  SG  G+
Sbjct: 242 SCTSCNGQGFKERITRLAGGYMVKDHTVCDACKGKGRYRK--KSASDTCKHC--SGK-GL 296

Query: 233 VEENKVVTINIKKGTLDGDKIVLKGEADEDLESTEVGDLVIKIQEVKEPQYDIVRNGYDL 292
           + E K  T+ I +G+  GD+  L   AD +    E GD++I I E     + + R   DL
Sbjct: 297 INEEKSQTVYIPRGSRHGDEFRLPQMADMEY-GKETGDVIIVIDEDSSKSH-LERKSNDL 354

Query: 293 IIKKQIDLADAICGFDEKPLMETYDGRVLKWSSKRGKVIRPNDIVRIQNEGWPRREDAND 352
                I L DA+ GF    + ETYD R L+ +   GKVIRP +  + + EGWP     ++
Sbjct: 355 HTTLNISLVDALTGFS-TIVCETYDNRRLRVNVPAGKVIRPGNYFKFKGEGWP----LSN 409

Query: 353 NNTLLKNGDLYVIVDIVFPPDNWTMEVNDYRAVRNIIPSTINKRESSTSGESILNVENIN 412
            ++    GD+YV ++I FP DNW  E ++  A+RNI+P   +K    T     LN E++ 
Sbjct: 410 GDSF---GDMYVQINIEFPKDNWFNEKSEITALRNILPGLKSK---DTKDPDPLNTEDVL 463

Query: 413 VSEIVKEIPNCDELPKF 429
              ++    + DELP +
Sbjct: 464 SYSVLH---SHDELPDY 477

>TPHA0C03110 Chr3 complement(687136..688359) [1224 bp, 407 aa] {ON}
           Anc_2.243 YNL064C
          Length = 407

 Score =  143 bits (361), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 121/393 (30%), Positives = 181/393 (46%), Gaps = 49/393 (12%)

Query: 3   YYGLLGVGQDASQDEIKRAYRKLALRHHPDKARGNEGGEDSSDDLPDVDFKEVTAAYQVL 62
           +Y LLGV  +AS+ EIK+ YRK AL++HPDK    E  E          FKE +AAY+VL
Sbjct: 7   FYDLLGVSPNASETEIKKGYRKQALKYHPDKNPSEEAAE---------KFKECSAAYEVL 57

Query: 63  SDASLRAEYDQKLAFEAQPYXXXXXXXXXXXXXXXXHPGHRSGFDSGRGARR----YKSD 118
           SD+  R  YDQ                              S F  G GA+R     +  
Sbjct: 58  SDSQKREVYDQYGEEGLNGGGAGGFPGGGFGFGDDIF----SQFFGGAGAQRPSGPQRGR 113

Query: 119 DIEIDLKVKTSELYRGXXXXXXXXXXXXCQRCDGTGWKSHASIVKKKTAKFFWNVCEGCE 178
           DI+ +++    ELY+G            C+ C+G G K+ A  VKK         C  C 
Sbjct: 114 DIKHEIQNTLEELYKGRTAKLALNKQILCKTCEGRGGKAGA--VKK---------CTSCN 162

Query: 179 GQGVRQRLRQLAPGFVTTELIECRQCGGKGKLRNLPKSEKNKCPDCITSGTVGMVEENKV 238
           GQG++   RQ+ P  +     EC  C G G + +     K++C DC       +  E KV
Sbjct: 163 GQGIKFVTRQMGP-MIQRFQTECDVCHGSGDIID----PKDRCKDCKGK---KIANERKV 214

Query: 239 VTINIKKGTLDGDKIVLKGEADEDLESTEVGDLVIKIQEVKEPQYDIVRNGYDLIIKKQI 298
           + ++++ G  +G KIV KGEAD+  +    GD++  +  V++P     R G DL+ + +I
Sbjct: 215 LEVHVEPGMREGQKIVFKGEADQAPDVIP-GDVIFVV--VEKPHKHFKRAGDDLLYEAEI 271

Query: 299 DLADAICGFDEKPLMETYDGRVLKWSSKRGKVIRPNDIVRIQNEGWPRREDANDNNTLLK 358
           DL  AI G +    ++   G  LK S+  G+VI       I+ +G P  +          
Sbjct: 272 DLLTAIAGGEF--AIQHVSGDWLKVSTVPGEVISSGMKKVIEGKGMPVPKYGG------- 322

Query: 359 NGDLYVIVDIVFPPDNWTMEVNDYRAVRNIIPS 391
            G+L V   I FP +N+  E +  + + NI+P+
Sbjct: 323 YGNLIVTFKIKFPENNFATE-DKLKELENILPA 354

>Ecym_3281 Chr3 complement(532720..533949) [1230 bp, 409 aa] {ON}
           similar to Ashbya gossypii ADL257C
          Length = 409

 Score =  141 bits (356), Expect = 5e-37,   Method: Compositional matrix adjust.
 Identities = 119/394 (30%), Positives = 182/394 (46%), Gaps = 48/394 (12%)

Query: 4   YGLLGVGQDASQDEIKRAYRKLALRHHPDKARGNEGGEDSSDDLPDVDFKEVTAAYQVLS 63
           Y LLGV  DA+  +IK+AYRK AL++HPDK   +E  +          FK++TAAY++LS
Sbjct: 8   YDLLGVSADANDAQIKKAYRKAALKYHPDKNPSSEAAD---------KFKQMTAAYEILS 58

Query: 64  DASLRAEYDQKLAFEAQPYXXXXXXXXXXXXXXXXHPGHRSGFDSGRGARR----YKSDD 119
           D+  R  YDQ                              S F  G GA R     K  D
Sbjct: 59  DSQKREVYDQFGEEGLNGGGGGPGGFGGFGGFGED---IFSQFFGGGGASRPRGPQKGRD 115

Query: 120 IEIDLKVKTSELYRGXXXXXXXXXXXXCQRCDGTGWKSHASIVKKKTAKFFWNVCEGCEG 179
           I+ D+      LY+G            C+ C+G G KS +  VKK         C  C G
Sbjct: 116 IKHDISCTLENLYKGRTAKLALNKTVLCKSCEGRGGKSGS--VKK---------CSSCGG 164

Query: 180 QGVRQRLRQLAPGFVTTELIECRQCGGKGKLRNLPKSEKNKCPDCITSGTVGMVEENKVV 239
            GV+   RQ+ P  +      C  C G+G + +     K++C +C  SG   +  E K++
Sbjct: 165 HGVKFVTRQMGP-MIQRFQTTCEACNGEGDVID----PKDRCREC--SGK-KISNERKIL 216

Query: 240 TINIKKGTLDGDKIVLKGEADEDLESTEVGDLVIKIQEVKEPQYDIVRNGYDLIIKKQID 299
            +NI+ G  +G K+V +GEAD+       GD+V  + E + P++  VRNG +L  + QID
Sbjct: 217 EVNIEPGMKNGQKVVFQGEADQQPGQIP-GDVVFVVNEQEHPKF--VRNGDNLHYEAQID 273

Query: 300 LADAICGFDEKPLMETYDGRVLKWSSKRGKVIRPNDIVRIQNEGWPRREDANDNNTLLKN 359
           L  A+ G   +  +E   G  LK     G+VI P  +  I+ +G P ++  +  N L+K 
Sbjct: 274 LLTAVAG--GQFALEHVSGDWLKVDIVPGEVIAPGMVKVIEGKGMPIQKYGSYGNLLIK- 330

Query: 360 GDLYVIVDIVFPPDNWTMEVNDYRAVRNIIPSTI 393
                  ++ FP  ++  +  D + +  I+P  +
Sbjct: 331 ------FNVKFPKSHFASDA-DLKKLEEILPPRV 357

>KAFR0J00940 Chr10 complement(170725..171960) [1236 bp, 411 aa] {ON}
           Anc_2.243 YNL064C
          Length = 411

 Score =  141 bits (355), Expect = 8e-37,   Method: Compositional matrix adjust.
 Identities = 121/392 (30%), Positives = 177/392 (45%), Gaps = 49/392 (12%)

Query: 4   YGLLGVGQDASQDEIKRAYRKLALRHHPDKARGNEGGEDSSDDLPDVDFKEVTAAYQVLS 63
           Y +LGV   AS  EIK+AYRK AL++HPDK    E  E          FKE ++AY+VLS
Sbjct: 8   YDILGVSPTASDSEIKKAYRKQALKYHPDKNPSEEAAE---------KFKEASSAYEVLS 58

Query: 64  DASLRAEYDQKLAFEAQPYXXXXXXXXXXXXXXXXHPGHRSGFDSGRGARR----YKSDD 119
           D+  R  YDQ      Q                       S F  G GA R     +  D
Sbjct: 59  DSEKRDIYDQF----GQDGLSGNGGMPGGAGGFGFGEDLFSQFFGGAGASRPRGPQRGRD 114

Query: 120 IEIDLKVKTSELYRGXXXXXXXXXXXXCQRCDGTGWKSHASIVKKKTAKFFWNVCEGCEG 179
           I+ ++ V   ELY+G            C+ C+G G K  A  VKK         C  C G
Sbjct: 115 IKHEISVSLEELYKGKTSKLALNKQILCKTCEGRGGKKGA--VKK---------CSSCNG 163

Query: 180 QGVRQRLRQLAPGFVTTELIECRQCGGKGKLRNLPKSEKNKCPDCITSGTVGMVEENKVV 239
           QG++   RQ+ P  +     EC  C G G + +     K++C DC       +  E K++
Sbjct: 164 QGIKFVTRQMGP-MIQRFQTECDVCHGTGDIIDA----KDRCKDCHGK---KIANERKIL 215

Query: 240 TINIKKGTLDGDKIVLKGEADEDLESTEVGDLVIKIQEVKEPQYDIVRNGYDLIIKKQID 299
            +N+  G  +G K+V KGEAD+  +    GD++  I E  +P     R G DLI + +ID
Sbjct: 216 QVNVDPGMKNGQKVVFKGEADQAPDIIP-GDVIFVISE--KPHKHFQRVGDDLIYEAEID 272

Query: 300 LADAICGFDEKPLMETYDGRVLKWSSKRGKVIRPNDIVRIQNEGWPRREDANDNNTLLKN 359
           L  A+ G +    +E   G  LK S   G+VI PN    ++ +G P ++     N ++K 
Sbjct: 273 LLTAVAGGEF--ALEHVSGEWLKVSIVPGEVIAPNMRKVVEGKGMPIQKYGGYGNLIIK- 329

Query: 360 GDLYVIVDIVFPPDNWTMEVNDYRAVRNIIPS 391
                   I FP +++  E +  + +  I+P+
Sbjct: 330 ------FSIKFPENHFADE-DTLKKLEEILPA 354

>ZYRO0A01496g Chr1 complement(123559..124797) [1239 bp, 412 aa] {ON}
           highly similar to gnl|GLV|CAGL0J09966g Candida glabrata
           CAGL0J09966g and similar to YNL064C uniprot|P25491
           Saccharomyces cerevisiae YNL064C YDJ1 yeast dnaJ homolog
           (nuclear envelope protein) heat shock protein
          Length = 412

 Score =  141 bits (355), Expect = 8e-37,   Method: Compositional matrix adjust.
 Identities = 125/394 (31%), Positives = 176/394 (44%), Gaps = 50/394 (12%)

Query: 3   YYGLLGVGQDASQDEIKRAYRKLALRHHPDKARGNEGGEDSSDDLPDVDFKEVTAAYQVL 62
           +Y LLGV   AS+ EIK+AYRK AL++HPDK    E  E          FKE ++AY+VL
Sbjct: 7   FYDLLGVSATASETEIKKAYRKTALKYHPDKNPSEEAAEK---------FKEASSAYEVL 57

Query: 63  SDASLRAEYDQKLAFEAQPYXXXXXXXXXXXXXXXXHPGHRSGFDS--GRGARR----YK 116
            DA  R  YDQ   F  +                         F    G GA R     +
Sbjct: 58  MDAEKREAYDQ---FGEEGLSGAGAAGGGFGGFGGFGGFGDDLFSQFFGGGASRPRGPQR 114

Query: 117 SDDIEIDLKVKTSELYRGXXXXXXXXXXXXCQRCDGTGWKSHASIVKKKTAKFFWNVCEG 176
             DI+ ++ V   ELY+G            C+ C+G G K  A  VKK         C  
Sbjct: 115 GRDIKHEITVTLEELYKGRTSKLALNKQILCKTCEGRGGKEGA--VKK---------CTS 163

Query: 177 CEGQGVRQRLRQLAPGFVTTELIECRQCGGKGKLRNLPKSEKNKCPDCITSGTVGMVEEN 236
           C GQGV+   RQ+ P  +     EC  C G G + N     K++C  C  SG   +  E 
Sbjct: 164 CNGQGVKFITRQMGP-MIQRFQTECDACDGTGDIIN----PKDRCKAC--SGK-KVANER 215

Query: 237 KVVTINIKKGTLDGDKIVLKGEADEDLESTEVGDLVIKIQEVKEPQYDIVRNGYDLIIKK 296
           K++ +++  G  DG KIV KGEAD+  +    GD++  + E   P     R+  DL+ + 
Sbjct: 216 KILEVHVDPGMKDGQKIVFKGEADQAPDIIP-GDVIFVVSE--RPHKHFRRDSDDLVYEA 272

Query: 297 QIDLADAICGFDEKPLMETYDGRVLKWSSKRGKVIRPNDIVRIQNEGWPRREDANDNNTL 356
            IDL  AI G +    +E   G  LK     G+VI P     I+ +G P  +     N L
Sbjct: 273 DIDLLTAIAGGEF--AIEHVSGDWLKVEIVPGEVISPGMRKVIEGKGMPVLKYGGFGNLL 330

Query: 357 LKNGDLYVIVDIVFPPDNWTMEVNDYRAVRNIIP 390
           +K        +IVFP D++T  + + + +  I+P
Sbjct: 331 VK-------FNIVFPKDHFT-SLENMKKLEEILP 356

>CAGL0J09966g Chr10 complement(978692..979915) [1224 bp, 407 aa]
           {ON} highly similar to uniprot|P25491 Saccharomyces
           cerevisiae YNL064c YDJ1
          Length = 407

 Score =  138 bits (347), Expect = 8e-36,   Method: Compositional matrix adjust.
 Identities = 120/387 (31%), Positives = 171/387 (44%), Gaps = 42/387 (10%)

Query: 4   YGLLGVGQDASQDEIKRAYRKLALRHHPDKARGNEGGEDSSDDLPDVDFKEVTAAYQVLS 63
           Y  LGV   AS  EIK+AYRK AL++HPDK    E  E          FKEV++AY++LS
Sbjct: 8   YDTLGVSPGASDAEIKKAYRKSALKYHPDKNPSEEAAEK---------FKEVSSAYEILS 58

Query: 64  DASLRAEYDQKLAFEAQPYXXXXXXXXXXXXXXXXHPGHRSGFDSGRGARRYKSDDIEID 123
           D+  R  YDQ    E                          G   GR     +  DI+ +
Sbjct: 59  DSQKREVYDQ-FGEEGLSGNGGAGFPGGFGFGEDIFSQFFGGATGGRPRGPQRGRDIKHE 117

Query: 124 LKVKTSELYRGXXXXXXXXXXXXCQRCDGTGWKSHASIVKKKTAKFFWNVCEGCEGQGVR 183
           +     ELY+G            C+ C+G G K  A  VKK         C  C GQG++
Sbjct: 118 MAASLEELYKGRTAKLALNKQILCKSCEGRGGKEGA--VKK---------CSSCNGQGIK 166

Query: 184 QRLRQLAPGFVTTELIECRQCGGKGKLRNLPKSEKNKCPDCITSGTVGMVEENKVVTINI 243
              RQ+ P  +     EC  C G G + +     K++C  C       +  E K++ + I
Sbjct: 167 FVTRQMGP-MIQRFQTECDVCHGTGDIIDA----KDRCKSC---NGKKVDNERKILEVRI 218

Query: 244 KKGTLDGDKIVLKGEADEDLESTEVGDLVIKIQEVKEPQYDIVRNGYDLIIKKQIDLADA 303
           + G  DG KIV KGEAD+  +    GD+V  I E  +P     R G DLI + +IDL  A
Sbjct: 219 EPGMKDGQKIVFKGEADQAPDVIP-GDVVFVISE--KPHKHFQRAGDDLIYEAEIDLLTA 275

Query: 304 ICGFDEKPLMETYDGRVLKWSSKRGKVIRPNDIVRIQNEGWPRREDANDNNTLLKNGDLY 363
           + G   +  +E   G  LK     G+VI P     ++ +G P ++     N L+K     
Sbjct: 276 LAG--GQFALEHVSGDWLKVDIVPGEVIAPGARKIVEGKGMPIQKYGGYGNLLIK----- 328

Query: 364 VIVDIVFPPDNWTMEVNDYRAVRNIIP 390
              +I FP +++T E N  + +  I+P
Sbjct: 329 --FNIKFPENHFTSEEN-LKKLEEILP 352

>ADL257C Chr4 complement(249512..250744) [1233 bp, 410 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YNL064C
           (YDJ1)
          Length = 410

 Score =  137 bits (346), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 119/391 (30%), Positives = 175/391 (44%), Gaps = 47/391 (12%)

Query: 4   YGLLGVGQDASQDEIKRAYRKLALRHHPDKARGNEGGEDSSDDLPDVDFKEVTAAYQVLS 63
           Y LLGV  DA+  +IK+AYRK AL++HPDK    E  +          FK++T AY++LS
Sbjct: 8   YDLLGVSPDANDAQIKKAYRKSALKYHPDKNPSEEAADK---------FKQITGAYEILS 58

Query: 64  DASLRAEYDQKLAFEAQPYXXXXXXXXXXXXXXXXHPGHRSGFDSGRGARR----YKSDD 119
           D+  R  YDQ                              S F  G GA R     K  D
Sbjct: 59  DSQKREMYDQFGEEGLNGGGQGGPGGFGGFGGFGEDI--FSQFFGGGGASRPRGPQKGRD 116

Query: 120 IEIDLKVKTSELYRGXXXXXXXXXXXXCQRCDGTGWKSHASIVKKKTAKFFWNVCEGCEG 179
           I  D+      LY+G            C+RC+G G K  A  VKK         C  C G
Sbjct: 117 IRHDISCTLENLYKGRAAKLALNKTVLCKRCEGRGGK--AGSVKK---------CTSCNG 165

Query: 180 QGVRQRLRQLAPGFVTTELIECRQCGGKGKLRNLPKSEKNKCPDCITSGTVGMVEENKVV 239
           QGV+   R + P  +      C  C G+G +  +P +  ++C DC       +  E K++
Sbjct: 166 QGVKFVTRHMGP-MIQRFQTTCEVCNGEGDV--IPAA--DRCKDCDGKK---IASERKIL 217

Query: 240 TINIKKGTLDGDKIVLKGEADEDLESTEVGDLVIKIQEVKEPQYDIVRNGYDLIIKKQID 299
            +NI+ G   G KIV +GEAD+       GD+V  + E + P++  VRNG +L  + +ID
Sbjct: 218 EVNIQPGMKHGQKIVFQGEADQQPGQIP-GDVVFVVNEQEHPRF--VRNGDNLHYEAEID 274

Query: 300 LADAICGFDEKPLMETYDGRVLKWSSKRGKVIRPNDIVRIQNEGWPRREDANDNNTLLKN 359
           L  AI G   +  +E   G  LK     G+VI P  +  I+ +G P ++  +        
Sbjct: 275 LLTAIAG--GQFALEHVSGDWLKIDIVPGEVIAPGMVKVIEGKGMPIQKYGS-------Y 325

Query: 360 GDLYVIVDIVFPPDNWTMEVNDYRAVRNIIP 390
           GDL +  ++ FP  ++  E    + +  I+P
Sbjct: 326 GDLLIKFNVKFPKSHFADE-EALKKLEAILP 355

>KLLA0F03333g Chr6 complement(313991..315220) [1230 bp, 409 aa] {ON}
           highly similar to uniprot|P25491 Saccharomyces
           cerevisiae YNL064C YDJ1 yeast dnaJ homolog (nuclear
           envelope protein) heat shock protein
          Length = 409

 Score =  137 bits (346), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 116/373 (31%), Positives = 165/373 (44%), Gaps = 42/373 (11%)

Query: 4   YGLLGVGQDASQDEIKRAYRKLALRHHPDKARGNEGGEDSSDDLPDVDFKEVTAAYQVLS 63
           Y LLGV   A  ++IK+AYRK AL+ HPDK    E  E          FKE+T+AY++LS
Sbjct: 8   YDLLGVSPGADDNQIKKAYRKSALKFHPDKNPSEEAAE---------KFKEITSAYEILS 58

Query: 64  DASLRAEYDQKLAFEAQPYXXXXXXXXXXXXXXXXHPGHRSGFDSGRGARRYKSDDIEID 123
           D+  R  YDQ    E                          G  S R     K  DI  +
Sbjct: 59  DSQKREVYDQ-FGLEGLSGQGAGGPGGFGGFGEDLFSQFFGG-GSSRPRGPQKGRDIRHE 116

Query: 124 LKVKTSELYRGXXXXXXXXXXXXCQRCDGTGWKSHASIVKKKTAKFFWNVCEGCEGQGVR 183
           +     +L++G            C+ C+G G K  +  VKK         C  C GQG +
Sbjct: 117 IPATLEQLFKGRTAKLALNKQLICKSCEGRGGKEGS--VKK---------CTACSGQGFK 165

Query: 184 QRLRQLAPGFVTTELIECRQCGGKGKLRNLPKSEKNKCPDCITSGTVGMVEENKVVTINI 243
              RQ+ P  +    +EC  C G G++ +     K +C  C  SG   +V E KV+ +NI
Sbjct: 166 FVTRQMGP-MIQRFQVECESCHGAGEIID----PKGRCKVC--SGK-KVVNERKVLEVNI 217

Query: 244 KKGTLDGDKIVLKGEADEDLESTEVGDLVIKIQEVKEPQYDIVRNGYDLIIKKQIDLADA 303
           + G  DG +IV +GEAD+       GD+V  + E   P +   R+G DL    +IDL  A
Sbjct: 218 EPGMKDGQRIVFQGEADQS-PGIIPGDVVFVVSEQPHPVFK--RDGNDLHYDAEIDLLSA 274

Query: 304 ICGFDEKPLMETYDGRVLKWSSKRGKVIRPNDIVRIQNEGWPRREDANDNNTLLKNGDLY 363
           I G   +  ++   G  LK     G+VI P  +  I+ +G P  +     N L+K     
Sbjct: 275 IAG--GQFAVKHVSGEYLKVEIVPGEVISPGSVKVIEGKGMPIPKYGGYGNLLIK----- 327

Query: 364 VIVDIVFPPDNWT 376
              +I FPP ++T
Sbjct: 328 --FNIKFPPAHFT 338

>Suva_14.277 Chr14 complement(504861..506090) [1230 bp, 409 aa] {ON}
           YNL064C (REAL)
          Length = 409

 Score =  137 bits (346), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 126/410 (30%), Positives = 182/410 (44%), Gaps = 50/410 (12%)

Query: 3   YYGLLGVGQDASQDEIKRAYRKLALRHHPDKARGNEGGEDSSDDLPDVDFKEVTAAYQVL 62
           +Y +LGV   A+  EIK+AYRK AL+ HPDK    E  E          FKE ++AY+VL
Sbjct: 7   FYDILGVSVTATDVEIKKAYRKCALKFHPDKNPSEEAAE---------KFKEASSAYEVL 57

Query: 63  SDASLRAEYDQKLAFEAQPYXXXXXXXXXXXXXXXXHPGHRSGFDSGRGARRYKSD---- 118
           SD+  R  YDQ   F                          S F    GA+R K      
Sbjct: 58  SDSEKREVYDQ---FGEDGLSGAGGAGGFPGGGFGFGDDIFSQFFGAGGAQRPKGPQRGR 114

Query: 119 DIEIDLKVKTSELYRGXXXXXXXXXXXXCQRCDGTGWKSHASIVKKKTAKFFWNVCEGCE 178
           DI+ ++     ELY+G            C+ C+G G K  A  VKK         C GC 
Sbjct: 115 DIKHEISASLEELYKGRTAKLALNKQILCKECEGRGGKKGA--VKK---------CTGCN 163

Query: 179 GQGVRQRLRQLAPGFVTTELIECRQCGGKGKLRNLPKSEKNKCPDCITSGTVGMVEENKV 238
           GQG++   RQ+ P  +     EC  C G G + +     K++C  C       +  E K+
Sbjct: 164 GQGIKFVTRQMGP-MIQRFQTECDACHGTGDIVD----PKDRCKSC---NGKKIENERKI 215

Query: 239 VTINIKKGTLDGDKIVLKGEADEDLESTEVGDLVIKIQEVKEPQYDIVRNGYDLIIKKQI 298
           + ++++ G  DG KIV KGEAD+  +    GD+V  + E   P     R+G DL+ + +I
Sbjct: 216 LEVHVEPGMKDGQKIVFKGEADQAPDVIP-GDVVFLVSE--RPHKHFKRDGDDLVYEAEI 272

Query: 299 DLADAICGFDEKPLMETYDGRVLKWSSKRGKVIRPNDIVRIQNEGWPRREDANDNNTLLK 358
           DL  AI G +    +E   G  LK     G+VI P     I+ +G P  +          
Sbjct: 273 DLLTAIAGGEF--ALEHVSGDWLKVGIVPGEVIAPGMRKVIEGKGMPVPKYGG------- 323

Query: 359 NGDLYVIVDIVFPPDNWTMEVNDYRAVRNIIP--STINKRESSTSGESIL 406
            G+L V   I FP +++T E N  + +  I+P  +T    + +T  E +L
Sbjct: 324 YGNLIVKFTIKFPENHFTTEEN-LKKLEEILPPRATPTIPKKATVDECVL 372

>TDEL0C04600 Chr3 complement(833405..834640) [1236 bp, 411 aa] {ON}
           Anc_2.243 YNL064C
          Length = 411

 Score =  137 bits (345), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 126/419 (30%), Positives = 188/419 (44%), Gaps = 54/419 (12%)

Query: 3   YYGLLGVGQDASQDEIKRAYRKLALRHHPDKARGNEGGEDSSDDLPDVDFKEVTAAYQVL 62
           YY LLGV   A++ EIK+AYRK AL++HPDK    E  E          FKEV++AY+VL
Sbjct: 7   YYDLLGVSVSATEIEIKKAYRKSALKYHPDKNPSAEAAEK---------FKEVSSAYEVL 57

Query: 63  SDASLRAEYDQKLAFEAQPYXXXXXXXXXXXXXXXXHPGHRSGF-----DSGRGARRYKS 117
           SD+  R  YDQ   F  +                       S F       GR     + 
Sbjct: 58  SDSEKRQVYDQ---FGEEGLSGGAGGAGGFGGFGGYGDDIFSQFFGGAPGGGRPRGPQRG 114

Query: 118 DDIEIDLKVKTSELYRGXXXXXXXXXXXXCQRCDGTGWKSHASIVKKKTAKFFWNVCEGC 177
            DI+ ++ V   ELY+G            C+ C+G G K  A  VKK         C  C
Sbjct: 115 RDIKHEIAVTLEELYKGRTAKLALNKQILCKGCNGRGGKEGA--VKK---------CSSC 163

Query: 178 EGQGVRQRLRQLAPGFVTTELIECRQCGGKGKLRNLPKSEKNKCPDCITSGTVGMVEENK 237
            GQG +   RQ+ P  +     EC  C G G + +     K++C  C       +  E K
Sbjct: 164 NGQGYKFVTRQMGP-MIQRFQTECEACAGTGDIID----PKDRCKSC---NGKKVANERK 215

Query: 238 VVTINIKKGTLDGDKIVLKGEADEDLESTEVGDLVIKIQEVKEPQYDIVRNGYDLIIKKQ 297
           ++ +++  G  DG KIV KGEAD+  +    GD++  + E  +P  +  R G DL+ + +
Sbjct: 216 ILEVHVDPGMKDGQKIVFKGEADQAPDVIP-GDVIFVVSE--KPHKNFQRVGDDLVYEAE 272

Query: 298 IDLADAICGFDEKPLMETYDGRVLKWSSKRGKVIRPNDIVRIQNEGWPRREDANDNNTLL 357
           IDL  A+ G +    +E   G  LK +   G+VI P     ++ +G P  +         
Sbjct: 273 IDLLTAVAGGEFS--LEHVSGDWLKVAIVPGEVISPGMRKVVEGKGMPIAKFGG------ 324

Query: 358 KNGDLYVIVDIVFPPDNWTMEVNDYRAVRNIIPSTINKRESSTSGESILNVENINVSEI 416
             G+L V   I FPP+++T + N  + +  I+P       + T+  S  +VE+  +SE 
Sbjct: 325 -YGNLLVTFKINFPPNHFTSDEN-LKKLEEILPP-----RAKTTIPSKAHVEDCVLSEF 376

>Smik_14.263 Chr14 complement(486255..487484) [1230 bp, 409 aa] {ON}
           YNL064C (REAL)
          Length = 409

 Score =  135 bits (340), Expect = 8e-35,   Method: Compositional matrix adjust.
 Identities = 118/395 (29%), Positives = 177/395 (44%), Gaps = 48/395 (12%)

Query: 3   YYGLLGVGQDASQDEIKRAYRKLALRHHPDKARGNEGGEDSSDDLPDVDFKEVTAAYQVL 62
           +Y +LGV   A+  EIK+AYRK AL++HPDK    E  E          FKE ++AY++L
Sbjct: 7   FYDILGVSVTATDVEIKKAYRKCALKYHPDKNPSEEAAE---------KFKEASSAYEIL 57

Query: 63  SDASLRAEYDQKLAFEAQPYXXXXXXXXXXXXXXXXHPGHRSGFDSGRGARR----YKSD 118
           SD+  R  YDQ   F  +                       S F    GA+R     +  
Sbjct: 58  SDSEKREVYDQ---FGEEGLSGAGGAGGFPGGGFGFGDDIFSQFFGAGGAQRPRGPQRGK 114

Query: 119 DIEIDLKVKTSELYRGXXXXXXXXXXXXCQRCDGTGWKSHASIVKKKTAKFFWNVCEGCE 178
           DI+ ++     ELY+G            C+ C+G G K  A  VKK         C  C 
Sbjct: 115 DIKHEISASLEELYKGRTAKLALNKQILCKGCEGRGGKKGA--VKK---------CSSCN 163

Query: 179 GQGVRQRLRQLAPGFVTTELIECRQCGGKGKLRNLPKSEKNKCPDCITSGTVGMVEENKV 238
           GQG++   RQ+ P  +     EC  C G G + +     K++C  C       +  E K+
Sbjct: 164 GQGIKFVTRQMGP-MIQRFQTECDVCHGTGDIID----PKDRCKSC---NGKKVENERKI 215

Query: 239 VTINIKKGTLDGDKIVLKGEADEDLESTEVGDLVIKIQEVKEPQYDIVRNGYDLIIKKQI 298
           + ++++ G  DG +IV KGEAD+  +    GD+V  + E   P  +  R+G DL+ + +I
Sbjct: 216 LEVHVEPGMKDGQRIVFKGEADQAPDVIP-GDVVFIVSE--RPHKNFKRDGDDLVYEAEI 272

Query: 299 DLADAICGFDEKPLMETYDGRVLKWSSKRGKVIRPNDIVRIQNEGWPRREDANDNNTLLK 358
           DL  AI G +    +E   G  LK     G+VI P     I+ +G P  +     N ++K
Sbjct: 273 DLLTAIAGGEF--ALEHVSGDWLKVGIVPGEVISPGMRKVIEGKGMPIPKYGGYGNLVIK 330

Query: 359 NGDLYVIVDIVFPPDNWTMEVNDYRAVRNIIPSTI 393
                    I FP +++T E N  + +  I+P  I
Sbjct: 331 -------FTIKFPENHFTTEEN-LKKLEEILPPRI 357

>NDAI0D01030 Chr4 complement(232909..234144) [1236 bp, 411 aa] {ON}
           Anc_2.243
          Length = 411

 Score =  135 bits (340), Expect = 8e-35,   Method: Compositional matrix adjust.
 Identities = 124/413 (30%), Positives = 183/413 (44%), Gaps = 52/413 (12%)

Query: 3   YYGLLGVGQDASQDEIKRAYRKLALRHHPDKARGNEGGEDSSDDLPDVDFKEVTAAYQVL 62
           +Y +LGV   AS  EIK+AYRK AL++HPDK    E  E          FKE +AAY+VL
Sbjct: 7   FYDILGVSPSASSSEIKKAYRKFALKYHPDKNPSEEAAEK---------FKEASAAYEVL 57

Query: 63  SDASLRAEYDQKLAFEAQPYXXXXXXXXXXXXXXXXHPGHRSGF------DSGRGARRYK 116
           SD   R  YDQ   F  +                       S F       +GR     +
Sbjct: 58  SDDEKREMYDQ---FGPEGMNGGPGGPGGFGGFGGFGDDIFSQFFGGAGAGAGRPRGPQR 114

Query: 117 SDDIEIDLKVKTSELYRGXXXXXXXXXXXXCQRCDGTGWKSHASIVKKKTAKFFWNVCEG 176
             DI+ +L     ELY+G            C+ C+G G K  A  VKK         C  
Sbjct: 115 GRDIKHELSATLEELYKGRTAKLALNKQILCKTCEGRGGKKGA--VKK---------CSS 163

Query: 177 CEGQGVRQRLRQLAPGFVTTELIECRQCGGKGKLRNLPKSEKNKCPDCITSGTVGMVEEN 236
           C GQGV+   RQ+ P     +  EC  C G G + +     K++C  C       +  E 
Sbjct: 164 CNGQGVKFVTRQMGPMLQRFQA-ECEVCHGTGDIID----PKDRCKTC---NAKKVTNER 215

Query: 237 KVVTINIKKGTLDGDKIVLKGEADEDLESTEVGDLVIKIQEVKEPQYDIVRNGYDLIIKK 296
           K++ ++I+ G  DG K+V KGEAD+  +    GD++  + +  +P     R G DL+ + 
Sbjct: 216 KILEVHIEPGMKDGQKVVFKGEADQAPDIIP-GDVIFVVSQ--KPHEHFQRAGDDLVYEA 272

Query: 297 QIDLADAICGFDEKPLMETYDGRVLKWSSKRGKVIRPNDIVRIQNEGWPRREDANDNNTL 356
           +IDL  AI G +    ++   G  LK +   G+VI P     I ++G P  +        
Sbjct: 273 EIDLLTAIAGGEF--AIKHVSGEWLKVAIVPGEVISPGARKIISDKGMPIPKYGG----- 325

Query: 357 LKNGDLYVIVDIVFPPDNWTMEVNDYRAVRNIIP--STINKRESSTSGESILN 407
              G+L V  +I FPP+++T E    + +  I+P  +  N  E +   E +L+
Sbjct: 326 --YGNLIVKFNIKFPPNHFTDE-ESLKKLEEILPPRTKTNIPEGAVIDECVLS 375

>KNAG0I01900 Chr9 (371556..372785) [1230 bp, 409 aa] {ON} Anc_2.243
           YNL064C
          Length = 409

 Score =  135 bits (339), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 119/391 (30%), Positives = 174/391 (44%), Gaps = 49/391 (12%)

Query: 4   YGLLGVGQDASQDEIKRAYRKLALRHHPDKARGNEGGEDSSDDLPDVDFKEVTAAYQVLS 63
           Y +LGV   A+  EIK+AYRK+AL+ HPDK    E  E          FKE ++AY+VLS
Sbjct: 8   YDVLGVSVTATDVEIKKAYRKMALKFHPDKNPSEEAAEK---------FKEASSAYEVLS 58

Query: 64  DASLRAEYDQKLAFEAQPYXXXXXXXXXXXXXXXXHPGHRSGFDSGRGARR----YKSDD 119
           DA  R  YDQ    E                         S F  G GA+R     +  D
Sbjct: 59  DADKRDTYDQ-FGLEGLSGAGGMGGAGGGFGFGDDI---FSQFFGGAGAQRPRGPQRGRD 114

Query: 120 IEIDLKVKTSELYRGXXXXXXXXXXXXCQRCDGTGWKSHASIVKKKTAKFFWNVCEGCEG 179
           I+ ++ V   ELYRG            C+ C+G G K  A  VKK         C  C G
Sbjct: 115 IKHEINVTLEELYRGKTSKLALNKQILCKTCEGRGGKKGA--VKK---------CSSCNG 163

Query: 180 QGVRQRLRQLAPGFVTTELIECRQCGGKGKLRNLPKSEKNKCPDCITSGTVGMVEENKVV 239
           QG++   RQ+ P  +     EC  C G G + +     K++C  C       +  E K++
Sbjct: 164 QGIKFVTRQMGP-MIQRFQTECDVCHGAGDIVD----PKDRCKSC---NGKKVASERKIL 215

Query: 240 TINIKKGTLDGDKIVLKGEADEDLESTEVGDLVIKIQEVKEPQYDIVRNGYDLIIKKQID 299
            +++  G  +G K+V KGEAD+  +    GD+V  I E  +P     R+G +L+ + ++D
Sbjct: 216 EVHVDPGMKNGQKVVFKGEADQAPDVIP-GDVVFVINE--KPHKHFQRSGDNLVYEAEVD 272

Query: 300 LADAICGFDEKPLMETYDGRVLKWSSKRGKVIRPNDIVRIQNEGWPRREDANDNNTLLKN 359
           L  AI G +    +E   G  LK +   G+VI P     I  +G P  +     N ++K 
Sbjct: 273 LLTAIAGGEF--AIEHVSGDWLKVAIVPGEVIAPGARKVIDGKGMPVAKYGGYGNLIIK- 329

Query: 360 GDLYVIVDIVFPPDNWTMEVNDYRAVRNIIP 390
                   + FP  ++T E N  + +  I+P
Sbjct: 330 ------FTVKFPEPHFTTEEN-LKKLEEILP 353

>Skud_14.268 Chr14 complement(496140..497372) [1233 bp, 410 aa] {ON}
           YNL064C (REAL)
          Length = 410

 Score =  135 bits (339), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 117/395 (29%), Positives = 175/395 (44%), Gaps = 46/395 (11%)

Query: 3   YYGLLGVGQDASQDEIKRAYRKLALRHHPDKARGNEGGEDSSDDLPDVDFKEVTAAYQVL 62
           +Y +LGV   A+  EIK+AYRK AL++HPDK    E  E          FKE ++AY++L
Sbjct: 7   FYDILGVSVTATDVEIKKAYRKCALKYHPDKNPSEEAAEK---------FKEASSAYEIL 57

Query: 63  SDASLRAEYDQ----KLAFEAQPYXXXXXXXXXXXXXXXXHPGHRSGFDSGRGARRYKSD 118
           SD+  R  YDQ     L+                        G   G    RG +R K  
Sbjct: 58  SDSEKRDVYDQFGEDGLSGAGGAGGFPGGGFGFGDDIFSQFFGGAGGAQRPRGPQRGK-- 115

Query: 119 DIEIDLKVKTSELYRGXXXXXXXXXXXXCQRCDGTGWKSHASIVKKKTAKFFWNVCEGCE 178
           DI+ ++     ELY+G            C+ C+G G K  A  VKK         C  C 
Sbjct: 116 DIKHEISASLEELYKGRTAKLALNKQILCKGCEGRGGKKGA--VKK---------CSSCN 164

Query: 179 GQGVRQRLRQLAPGFVTTELIECRQCGGKGKLRNLPKSEKNKCPDCITSGTVGMVEENKV 238
           GQG++   RQ+ P  +     EC  C G G + +     K++C  C       +  E K+
Sbjct: 165 GQGIKFVTRQMGP-MIQRFQTECDVCHGTGDIVD----PKDRCKSCNGKK---VENERKI 216

Query: 239 VTINIKKGTLDGDKIVLKGEADEDLESTEVGDLVIKIQEVKEPQYDIVRNGYDLIIKKQI 298
           + ++++ G  DG +IV KGEAD+  +    GD+V  + E   P     R+G DL+ + +I
Sbjct: 217 LEVHVEPGMKDGQRIVFKGEADQAPDVIP-GDVVFLVSE--RPHKSFKRDGDDLVYEAEI 273

Query: 299 DLADAICGFDEKPLMETYDGRVLKWSSKRGKVIRPNDIVRIQNEGWPRREDANDNNTLLK 358
           DL  AI G +    +E   G  LK     G+VI P     I+ +G P  +     N ++K
Sbjct: 274 DLLTAIAGGEF--ALEHVSGDWLKVGIVPGEVIAPGMRKVIEGKGMPVPKYGGYGNLIIK 331

Query: 359 NGDLYVIVDIVFPPDNWTMEVNDYRAVRNIIPSTI 393
                    + FP +++T E N  +    + P T+
Sbjct: 332 -------FTVKFPENHFTAEENLKKLEEILPPRTV 359

>Kpol_1003.12 s1003 complement(35339..36565) [1227 bp, 408 aa] {ON}
           complement(35339..36565) [1227 nt, 409 aa]
          Length = 408

 Score =  134 bits (337), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 117/392 (29%), Positives = 178/392 (45%), Gaps = 49/392 (12%)

Query: 3   YYGLLGVGQDASQDEIKRAYRKLALRHHPDKARGNEGGEDSSDDLPDVDFKEVTAAYQVL 62
           +Y LLGV  +AS+ EIK+ YRK AL++HPDK   +E  E          FKE + AY+VL
Sbjct: 7   FYDLLGVSPNASESEIKKGYRKAALKYHPDKNPTDEAAEK---------FKECSGAYEVL 57

Query: 63  SDASLRAEYDQKLAFEAQPYXXXXXXXXXXXXXXXXHPGHRSGFDSGRGARR----YKSD 118
           SD+  R  YDQ      +                       S F  G GA R     +  
Sbjct: 58  SDSQKREIYDQY----GEEGLSGGGPGAGFGGFGGFGDDIFSQFFGGAGASRPRGPQRGK 113

Query: 119 DIEIDLKVKTSELYRGXXXXXXXXXXXXCQRCDGTGWKSHASIVKKKTAKFFWNVCEGCE 178
           DI  +++    ELY+G            C+ C+G G K  A  VKK         C  C 
Sbjct: 114 DIRHEIQNTLEELYKGRTAKLALNKQILCKGCEGRGGKEGA--VKK---------CSSCG 162

Query: 179 GQGVRQRLRQLAPGFVTTELIECRQCGGKGKLRNLPKSEKNKCPDCITSGTVGMVEENKV 238
           GQGV+   RQ+ P  +     EC  C G G + +     K++C +C  +    +  E KV
Sbjct: 163 GQGVKFVTRQMGP-MIQRFQTECDVCHGSGDIID----PKDRCKECKGNK---VANERKV 214

Query: 239 VTINIKKGTLDGDKIVLKGEADEDLESTEVGDLVIKIQEVKEPQYDIVRNGYDLIIKKQI 298
           + ++++ G  +G K+  KGEAD+  +    GD++  + E  +P     R+G DL+ + ++
Sbjct: 215 LEVHVEPGMREGQKVTFKGEADQAPDIIP-GDVIFVVTE--KPHKHFKRSGDDLLYEAEV 271

Query: 299 DLADAICGFDEKPLMETYDGRVLKWSSKRGKVIRPNDIVRIQNEGWPRREDANDNNTLLK 358
           DL  AI G D    +E   G  LK +   G+VI P     I  +G P ++          
Sbjct: 272 DLLTAIAGGDF--AIEHVSGDWLKVTIVPGEVISPGVRKVIDGKGMPVQKYGG------- 322

Query: 359 NGDLYVIVDIVFPPDNWTMEVNDYRAVRNIIP 390
            G+L +   I FP +++  E    +A+ +I+P
Sbjct: 323 YGNLIITFKIKFPENHFADEAK-LKALEDILP 353

>Kwal_23.4830 s23 complement(885244..886479) [1236 bp, 411 aa] {ON}
           YNL064C (YDJ1) - yeast dnaJ homolog (nuclear envelope
           protein); heat shock protein [contig 5] FULL
          Length = 411

 Score =  134 bits (336), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 118/392 (30%), Positives = 173/392 (44%), Gaps = 47/392 (11%)

Query: 3   YYGLLGVGQDASQDEIKRAYRKLALRHHPDKARGNEGGEDSSDDLPDVDFKEVTAAYQVL 62
           +Y LLGV  DA+  +IK+AYRK AL+ HPDK    E  +          FKE+T AY++L
Sbjct: 7   FYDLLGVSPDANDAQIKKAYRKQALKFHPDKNPSEEAADK---------FKELTVAYEIL 57

Query: 63  SDASLRAEYDQKLAFEAQPYXXXXXXXXXXXXXXXXHPGHRSGFDSGRGARR----YKSD 118
           SD+  R  YDQ                              S F  G G++R     K  
Sbjct: 58  SDSQKRDIYDQLGEEGLSGGGAGGAGGFGGFGGFGEDI--FSQFFGGGGSQRPRGPQKGR 115

Query: 119 DIEIDLKVKTSELYRGXXXXXXXXXXXXCQRCDGTGWKSHASIVKKKTAKFFWNVCEGCE 178
           DI+ ++     ELY+G            C+ C+G G K+ A  VKK         C  C 
Sbjct: 116 DIKHEMSASLEELYKGRTAKLALNKQILCKTCEGRGGKAGA--VKK---------CSSCN 164

Query: 179 GQGVRQRLRQLAPGFVTTELIECRQCGGKGKLRNLPKSEKNKCPDCITSGTVGMVEENKV 238
           GQG++   RQ+ P  +     EC  C G G + +     K++C  C       +  E K+
Sbjct: 165 GQGIKFITRQMGP-MIQRFQAECDVCSGTGDIID----PKDRCKSC---NGKKIDNERKI 216

Query: 239 VTINIKKGTLDGDKIVLKGEADEDLESTEVGDLVIKIQEVKEPQYDIVRNGYDLIIKKQI 298
           + ++I+ G  DG KIV +GEAD+       GD+V  I +   P     R G DL+ + ++
Sbjct: 217 LEVHIEPGMKDGQKIVFQGEADQ-APGIIPGDVVFVISQ--RPHKHFERKGDDLLYQAEV 273

Query: 299 DLADAICGFDEKPLMETYDGRVLKWSSKRGKVIRPNDIVRIQNEGWPRREDANDNNTLLK 358
           DL  AI G +    +E   G  LK S   G+VI P     I+ +G P ++          
Sbjct: 274 DLLSAIAGGEF--AIEHVSGEWLKVSIVPGEVISPGMTKVIEGKGMPIQKYGG------- 324

Query: 359 NGDLYVIVDIVFPPDNWTMEVNDYRAVRNIIP 390
            G+L V   I FP +++  E    + +  I+P
Sbjct: 325 YGNLIVTFKINFPTNHFADE-ESLKKLEEILP 355

>TBLA0E03810 Chr5 complement(959045..960277) [1233 bp, 410 aa] {ON}
           Anc_2.243 YNL064C
          Length = 410

 Score =  134 bits (336), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 118/393 (30%), Positives = 174/393 (44%), Gaps = 49/393 (12%)

Query: 3   YYGLLGVGQDASQDEIKRAYRKLALRHHPDKARGNEGGEDSSDDLPDVDFKEVTAAYQVL 62
           +Y +LGV   AS+ EIK+ YRK AL++HPDK    E  E          FKE +AAY+VL
Sbjct: 7   FYDILGVSPTASESEIKKGYRKAALKYHPDKNPTAEAAEK---------FKECSAAYEVL 57

Query: 63  SDASLRAEYDQ--KLAFEAQPYXXXXXXXXXXXXXXXXHPGHRSGFDSGRGARRYKSDDI 120
           SD   R  YDQ  +    +                         G  S R     K  DI
Sbjct: 58  SDPEKRDVYDQYGEEGLSSGGPGGPGGFGGFGGFGDDIFSQFFGGGASQRPRGPQKGRDI 117

Query: 121 EIDLKVKTSELYRGXXXXXXXXXXXXCQRCDGTGWKSHASIVKKKTAKFFWNVCEGCEGQ 180
           + ++     ELY+G            C+ C+G G K+ A  VKK         C  C GQ
Sbjct: 118 KHEIAATLEELYKGRTAKLALNKQILCKSCEGRGGKADA--VKK---------CSSCGGQ 166

Query: 181 GVRQRLRQLAPGFVTTELIECRQCGGKGKLRNLPKSEKNKCPDCITSGTVGMVEENKVVT 240
           G++   +Q+ P  +     EC  C G G + +     K +C  C       +  E K++ 
Sbjct: 167 GIKFVTKQMGP-MIQRFQTECDVCHGTGDIID----PKGRCKSCHGKK---IANERKILE 218

Query: 241 INIKKGTLDGDKIVLKGEADEDLESTEVGDLVIKIQEVKEPQYDIVRNGYDLIIKKQIDL 300
           + I+ G  DG +IV KGE+D+  +    GD+V  + E  +P     R+G DL+   +IDL
Sbjct: 219 VKIEPGMKDGQRIVFKGESDQAPDIIP-GDVVFVVNE--KPHKHFQRSGNDLVYLAEIDL 275

Query: 301 ADAICGFDEKPLMETYDGRVLKWSSKRGKVIRPNDIVRIQNEGWPRREDANDNNTLLK-- 358
             AI G +    +E   G  LK +   G+VI P     I+ +G P          +LK  
Sbjct: 276 LTAIAGGEF--ALEHVSGEWLKIAIVAGEVIAPGAKKVIEGKGMP----------ILKYG 323

Query: 359 -NGDLYVIVDIVFPPDNWTMEVNDYRAVRNIIP 390
             G+L +  +I FP +++T E N  + +  I+P
Sbjct: 324 GYGNLIIQFNIKFPENHFTDESN-LKKLEEILP 355

>YNL064C Chr14 complement(505868..507097) [1230 bp, 409 aa] {ON}
           YDJ1Type I HSP40 co-chaperone involved in regulation of
           the HSP90 and HSP70 functions; involved in protein
           translocation across membranes; member of the DnaJ
           family
          Length = 409

 Score =  133 bits (335), Expect = 5e-34,   Method: Compositional matrix adjust.
 Identities = 119/395 (30%), Positives = 174/395 (44%), Gaps = 48/395 (12%)

Query: 3   YYGLLGVGQDASQDEIKRAYRKLALRHHPDKARGNEGGEDSSDDLPDVDFKEVTAAYQVL 62
           +Y +LGV   A+  EIK+AYRK AL++HPDK    E  E          FKE +AAY++L
Sbjct: 7   FYDILGVPVTATDVEIKKAYRKCALKYHPDKNPSEEAAEK---------FKEASAAYEIL 57

Query: 63  SDASLRAEYDQKLAFEAQPYXXXXXXXXXXXXXXXXHPGHRSGFDSGRGARR----YKSD 118
           SD   R  YDQ   F                          S F    GA+R     +  
Sbjct: 58  SDPEKRDIYDQ---FGEDGLSGAGGAGGFPGGGFGFGDDIFSQFFGAGGAQRPRGPQRGK 114

Query: 119 DIEIDLKVKTSELYRGXXXXXXXXXXXXCQRCDGTGWKSHASIVKKKTAKFFWNVCEGCE 178
           DI+ ++     ELY+G            C+ C+G G K  A  VKK         C  C 
Sbjct: 115 DIKHEISASLEELYKGRTAKLALNKQILCKECEGRGGKKGA--VKK---------CTSCN 163

Query: 179 GQGVRQRLRQLAPGFVTTELIECRQCGGKGKLRNLPKSEKNKCPDCITSGTVGMVEENKV 238
           GQG++   RQ+ P  +     EC  C G G + +     K++C  C       +  E K+
Sbjct: 164 GQGIKFVTRQMGP-MIQRFQTECDVCHGTGDIID----PKDRCKSC---NGKKVENERKI 215

Query: 239 VTINIKKGTLDGDKIVLKGEADEDLESTEVGDLVIKIQEVKEPQYDIVRNGYDLIIKKQI 298
           + ++++ G  DG +IV KGEAD+  +    GD+V  + E   P     R+G DL+ + +I
Sbjct: 216 LEVHVEPGMKDGQRIVFKGEADQAPDVIP-GDVVFIVSE--RPHKSFKRDGDDLVYEAEI 272

Query: 299 DLADAICGFDEKPLMETYDGRVLKWSSKRGKVIRPNDIVRIQNEGWPRREDANDNNTLLK 358
           DL  AI G +    +E   G  LK     G+VI P     I+ +G P  +     N ++K
Sbjct: 273 DLLTAIAGGEF--ALEHVSGDWLKVGIVPGEVIAPGMRKVIEGKGMPIPKYGGYGNLIIK 330

Query: 359 NGDLYVIVDIVFPPDNWTMEVNDYRAVRNIIPSTI 393
                    I FP +++T E N  + +  I+P  I
Sbjct: 331 -------FTIKFPENHFTSEEN-LKKLEEILPPRI 357

>TDEL0C04350 Chr3 (777185..778573) [1389 bp, 462 aa] {ON} Anc_2.218
           YNL077W
          Length = 462

 Score =  131 bits (330), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 120/402 (29%), Positives = 176/402 (43%), Gaps = 71/402 (17%)

Query: 4   YGLLGVGQDASQDEIKRAYRKLALRHHPDKARGNEGGEDSSDDLPDVDFKEVTAAYQVLS 63
           Y +L V  +AS  EI++AYR LAL+HHPDK   N   E+S        F EV  AY++L 
Sbjct: 8   YDVLNVSPEASAVEIRKAYRLLALKHHPDK---NNHSEESKSK-----FLEVNEAYEILI 59

Query: 64  DASLRAEYDQ-----------KLAFEAQPYXXXXXXXXXXXXXXXXHPG--HRSGFD--- 107
           D   R+ YDQ            +  E                      G    S FD   
Sbjct: 60  DEKKRSLYDQYGTIDENAIQQSMPQEDPVMSSFFNTGSPMGMGMGMSAGDLFASFFDKMS 119

Query: 108 --SGRGARRYKS----DDIEIDLKVKTSELYRGXXXXXXXXXXXXCQRCDGTGWKSHASI 161
             S  G +  KS     DI+ DLK   S LY G            C+ C G G       
Sbjct: 120 SPSFGGKKTKKSMDHGPDIKHDLKCTLSSLYEGKNTKLGLNRRRVCKACKGRGS------ 173

Query: 162 VKKKTAKFFWNVCEGCEGQGVRQRLRQLAPGFVTTELIECRQCGGKGKLRNLPKSEKNKC 221
           +K +T       C+ C G+G + R RQ+ P  + T    C  C G G        + + C
Sbjct: 174 MKVRT-------CKACRGRGQQSRSRQMGP-MMQTWTQTCSDCNGMGTF----TKDSDVC 221

Query: 222 PDCITSGTVGMVEENKVVTINIKKGTLDGDKIVLKGEADEDL------ESTEVGDLVIKI 275
            DC   G +    E K+  + +K G   G +I+L GEADE +      E+   GD++I I
Sbjct: 222 RDCEGEGCI---RERKIFDVEVKPGMCQGQQIILPGEADEVIKTRFGNETVIPGDVIITI 278

Query: 276 QEVKEPQYDIV-RNGYDLIIKK-QIDLADAICG----FDEKPLMETYDGRVLKWSSKRGK 329
            ++K+P++  V RNG DL+++  +I L  ++CG     D  P     +G+++  +   G+
Sbjct: 279 IQIKDPKFQRVNRNGCDLMVRNCKIPLVTSLCGGKLSIDGHP-----NGKLINVTILPGE 333

Query: 330 VIRPNDIVRIQNEGWPRREDANDNNTLLKNGDLYVIVDIVFP 371
           +I+PN    I+N G PR E+          G+LY+   + FP
Sbjct: 334 LIKPNHFKSIENLGMPRYEEKRAPEGY---GNLYIQFQVEFP 372

>NCAS0G03000 Chr7 complement(552266..553498) [1233 bp, 410 aa] {ON}
           Anc_2.243
          Length = 410

 Score =  126 bits (317), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 116/391 (29%), Positives = 172/391 (43%), Gaps = 45/391 (11%)

Query: 4   YGLLGVGQDASQDEIKRAYRKLALRHHPDKARGNEGGEDSSDDLPDVDFKEVTAAYQVLS 63
           Y +LGV   A   EIK+AYRK AL++HPDK    EG E          FKEV+AAY++LS
Sbjct: 8   YDVLGVSPTAGDSEIKKAYRKSALKYHPDKNPTEEGAEK---------FKEVSAAYEILS 58

Query: 64  DASLRAEYDQKLAFEAQPYXXXXXXXXXXXXXXX----XHPGHRSGFDSGRGARRYKSDD 119
           D+  R  YDQ                                  +G  +GR     +  D
Sbjct: 59  DSEKREIYDQFGEEGLNGGGPGGPGGFGGFGGFGDDIFSQFFGGAGAGAGRPRGPQRGRD 118

Query: 120 IEIDLKVKTSELYRGXXXXXXXXXXXXCQRCDGTGWKSHASIVKKKTAKFFWNVCEGCEG 179
           I+ ++     ELY+G            C+ C+G G K  A  VKK         C  C G
Sbjct: 119 IKHEIAATLEELYKGRTAKLALNKQILCKTCEGRGGKKGA--VKK---------CSSCNG 167

Query: 180 QGVRQRLRQLAPGFVTTELIECRQCGGKGKLRNLPKSEKNKCPDCITSGTVGMVEENKVV 239
           QGV+   RQ+ P  +     EC  C G G + +     K++C  C       +  E K++
Sbjct: 168 QGVKFVTRQMGP-MIQRFQAECDVCSGTGDIID----PKDRCKTC---NAKKVTNERKIL 219

Query: 240 TINIKKGTLDGDKIVLKGEADEDLESTEVGDLVIKIQEVKEPQYDIVRNGYDLIIKKQID 299
            ++I+ G  DG  IV KGEAD+  +    GD++  +   ++P     R+G DL+ + +ID
Sbjct: 220 EVHIEPGMKDGQNIVFKGEADQAPDVIP-GDVIFVV--AQKPHKHFQRSGDDLVYEAEID 276

Query: 300 LADAICGFDEKPLMETYDGRVLKWSSKRGKVIRPNDIVRIQNEGWPRREDANDNNTLLKN 359
           L  AI G +    +E   G  LK S   G+VI P     I+ +G P  +          +
Sbjct: 277 LLTAIAGGEF--ALEHVSGDWLKVSILPGEVISPGSKKVIEGKGMPIPKYGG-------H 327

Query: 360 GDLYVIVDIVFPPDNWTMEVNDYRAVRNIIP 390
           G+L V   + FP  ++  E +  + +  I+P
Sbjct: 328 GNLIVHFTVKFPQKHFADE-DSLKKLEEILP 357

>SAKL0E08734g Chr5 (713258..714493) [1236 bp, 411 aa] {ON} similar
           to uniprot|P25491 Saccharomyces cerevisiae YNL064C YDJ1
           yeast dnaJ homolog (nuclear envelope protein) heat shock
           protein
          Length = 411

 Score =  125 bits (314), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 111/394 (28%), Positives = 169/394 (42%), Gaps = 47/394 (11%)

Query: 4   YGLLGVGQDASQDEIKRAYRKLALRHHPDKARGNEGGEDSSDDLPDVDFKEVTAAYQVLS 63
           Y L+GV   A   +IK+AYRK AL++HPDK    E  E          FKE+++AY++LS
Sbjct: 8   YDLIGVSPGADDAQIKKAYRKAALKYHPDKNPTEEAAEK---------FKEISSAYEILS 58

Query: 64  DASLRAEYDQKLAFEAQPYXXXXXXXXXXXXXX----XXHPGHRSGFDSGRGARRYKSDD 119
           D+  R  YDQ                               G   G    RG +  K  D
Sbjct: 59  DSQKREMYDQFGEEGLNGGGAGAGGFGGFGGFGDDIFSQFFGGAGGSSRPRGPQ--KGRD 116

Query: 120 IEIDLKVKTSELYRGXXXXXXXXXXXXCQRCDGTGWKSHASIVKKKTAKFFWNVCEGCEG 179
           I  ++     ELY+G            C+ C+G G K+ A  VKK         C  C G
Sbjct: 117 IRHEISATLEELYKGRTAKLALNKQILCKSCEGRGGKAGA--VKK---------CSSCNG 165

Query: 180 QGVRQRLRQLAPGFVTTELIECRQCGGKGKLRNLPKSEKNKCPDCITSGTVGMVEENKVV 239
           QG +   RQ+ P  +     EC  C G G + +     K++C  C       +  E K++
Sbjct: 166 QGFKFITRQMGP-MIQRFQAECDACNGTGDIIDA----KDRCKAC---NGKKIANERKIL 217

Query: 240 TINIKKGTLDGDKIVLKGEADEDLESTEVGDLVIKIQEVKEPQYDIVRNGYDLIIKKQID 299
            ++I+ G  DG KIV +GEAD   ++ +V    +     + P     R G DL  + ++D
Sbjct: 218 EVHIEPGMKDGQKIVFQGEAD---QAPDVVPGDVVFVVSERPHERFNRKGDDLYYEAEVD 274

Query: 300 LADAICGFDEKPLMETYDGRVLKWSSKRGKVIRPNDIVRIQNEGWPRREDANDNNTLLKN 359
           L  AI G +    ++   G  LK     G+VI P     I+ +G P ++     N ++K 
Sbjct: 275 LLTAIAGGEF--AVQHVSGDWLKVEIVPGEVIAPGATKIIEGKGMPVQKYGGFGNLIVK- 331

Query: 360 GDLYVIVDIVFPPDNWTMEVNDYRAVRNIIPSTI 393
                   I FPP+++  E +  + + NI+P  +
Sbjct: 332 ------FKIKFPPNHFADEAS-LKQLENILPPRV 358

>KLTH0G09394g Chr7 complement(782211..783446) [1236 bp, 411 aa] {ON}
           highly similar to uniprot|P25491 Saccharomyces
           cerevisiae YNL064C YDJ1 yeast dnaJ homolog (nuclear
           envelope protein) heat shock protein
          Length = 411

 Score =  125 bits (313), Expect = 5e-31,   Method: Compositional matrix adjust.
 Identities = 116/391 (29%), Positives = 166/391 (42%), Gaps = 46/391 (11%)

Query: 3   YYGLLGVGQDASQDEIKRAYRKLALRHHPDKARGNEGGEDSSDDLPDVDFKEVTAAYQVL 62
           +Y LLGV  DA+  +IK+ YRK AL+ HPDK    E  +          FKE+T AY+VL
Sbjct: 7   FYDLLGVPVDANDAQIKKGYRKQALKFHPDKNPSAEAADK---------FKELTVAYEVL 57

Query: 63  SDASLRAEYDQKLAFEAQPYXXXXXXXXXXXXXXXXHPGHRSGFDSGRGARR---YKSDD 119
           SD+  R  YDQ                              S F  G  +R     K  D
Sbjct: 58  SDSQKRDIYDQLGEEGLSGGGAGGAGGFGGFGGFGED--IFSQFFGGGASRPRGPQKGRD 115

Query: 120 IEIDLKVKTSELYRGXXXXXXXXXXXXCQRCDGTGWKSHASIVKKKTAKFFWNVCEGCEG 179
           I+ ++     ELY+G            C+ C+G G K  A  VKK         C  C G
Sbjct: 116 IKHEMSASLEELYKGRTAKLALNKQVLCKTCEGRGGKEGA--VKK---------CASCNG 164

Query: 180 QGVRQRLRQLAPGFVTTELIECRQCGGKGKLRNLPKSEKNKCPDCITSGTVGMVEENKVV 239
           QGV+   RQ+ P  +     EC  C G G + + PK        C T     +  E K++
Sbjct: 165 QGVKFITRQMGP-MIQRFQAECDACNGTGDIVD-PKDR------CKTCNGKKIDNERKIL 216

Query: 240 TINIKKGTLDGDKIVLKGEADEDLESTEVGDLVIKIQEVKEPQYDIVRNGYDLIIKKQID 299
            ++I+ G  DG KIV +GEAD+       GD++  I +   P     R G +L  + ++D
Sbjct: 217 EVHIEPGMKDGQKIVFQGEADQ-APGVIPGDVIFVISQ--RPHKHFERKGDNLYYQAEVD 273

Query: 300 LADAICGFDEKPLMETYDGRVLKWSSKRGKVIRPNDIVRIQNEGWPRREDANDNNTLLKN 359
           L  AI G +    +E   G  LK     G+VI P     I+ +G P ++           
Sbjct: 274 LLSAIAGGEF--AIEHVSGEWLKVGIVPGEVISPGMTKVIEGKGMPVQKYGG-------F 324

Query: 360 GDLYVIVDIVFPPDNWTMEVNDYRAVRNIIP 390
           GDL V   + FP +++  E    + +  I+P
Sbjct: 325 GDLIVTFKVNFPTNHFADE-ESLKKLEEILP 354

>KLTH0G08756g Chr7 complement(715507..716895) [1389 bp, 462 aa] {ON}
           similar to uniprot|P53940 Saccharomyces cerevisiae
           YNL077W APJ1 Putative chaperone of the HSP40 (DNAJ)
           family overexpression interferes with propagation of the
           [Psi ] prion
          Length = 462

 Score =  119 bits (299), Expect = 9e-29,   Method: Compositional matrix adjust.
 Identities = 122/475 (25%), Positives = 196/475 (41%), Gaps = 83/475 (17%)

Query: 2   DYYGLLGVGQDASQDEIKRAYRKLALRHHPDKARGNEGGEDSSDDLPDVDFKEVTAAYQV 61
           + Y +LGV   AS+ +IK+AYR  AL+HHPDK   N   E+S      + F+++  AY++
Sbjct: 8   ELYDILGVSASASRQDIKKAYRVNALKHHPDK---NGHSEESK-----LKFQQICKAYEI 59

Query: 62  LSDASLRAEYDQ-------KLAFEAQPYXXXXXXXXXXXXXXXXHPGHRSG--------- 105
           L D   R  YD+       +   E+  Y                  G  +G         
Sbjct: 60  LKDERKREMYDRFGTADESQWHTESTSYQEQSGMSAGDLFAQFFGGGSTTGSFFNDDMSF 119

Query: 106 FDSGRGARRYKS-------DDIEIDLKVKTSELYRGXXXXXXXXXXXXCQRCDGTGWKSH 158
           F   +GA    S        DI+  LK    E+Y G            C++C G G    
Sbjct: 120 FGKRQGAHTAPSRRELPRGPDIKHYLKCTLEEVYHGKRAKLALKRTRLCKKCKGEGGLKA 179

Query: 159 ASIVKKKTAKFFWNVCEGCEGQGVRQRLRQLAPGFVTTELIECRQCGGKGKLRNLPKSEK 218
           +              C  C G+G+R   ++  P  V T    C  C G+G        +K
Sbjct: 180 SQ-------------CYTCGGRGIRTETKRHGP-MVQTWSSTCSDCAGRGSFMK----QK 221

Query: 219 NKCPDCITSGTVGMVEENKVVTINIKKGTLDGDKIVLKGEADE----DLESTEV--GDLV 272
           + C DC   G +    E ++  I + KG  +G ++VL GEADE    +L S  V  GD++
Sbjct: 222 DICRDCNGQGCI---RERRIFDIEVHKGMENGQEVVLPGEADEVVGSELGSEHVIPGDVI 278

Query: 273 IKIQEVKEPQYDIVRNGYDLIIKKQIDLADAICG----FDEKPLMETYDGRVLKWSSKRG 328
           I ++++    +   R+   ++   ++DL  ++CG     D  P      G++LK     G
Sbjct: 279 IILEQLPHKAFWRHRDASLVLDHCKVDLKTSLCGGPVWVDSHP-----SGKLLKIDVLPG 333

Query: 329 KVIRPNDIVRIQNEGWPRREDANDNNTLLKNGDLYVIVDIVFPPDNWTMEVNDYRAVRNI 388
           ++++P  I  ++  G P+           + G+LY+  D+ FP       V   RA    
Sbjct: 334 EILKPGAIKCVEGMGMPKSGG--------RFGNLYIRFDVAFPESLKPETVEALRAALGQ 385

Query: 389 IPSTINKRESSTSGESILNVENINVSEIVKEIPN-CDELPKFQDTYDNTNDKGES 442
            P       +S +GE  + VE   V E V  + N   +L   +D+Y     +G+S
Sbjct: 386 EPGA-----NSGAGEPAVAVEGREVEEHV--LSNFAPDLELSRDSYRKRQARGQS 433

>Kwal_23.3061 s23 complement(140207..141583) [1377 bp, 458 aa] {ON}
           YNL077W - Hypothetical ORF [contig 248] FULL
          Length = 458

 Score =  117 bits (294), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 118/458 (25%), Positives = 185/458 (40%), Gaps = 98/458 (21%)

Query: 2   DYYGLLGVGQDASQDEIKRAYRKLALRHHPDKARGNEGGEDSSDDLPDVDFKEVTAAYQV 61
           D Y  LGV  +AS+ EIK+AYR  AL+HHPDK        +   +   + F+++  AY++
Sbjct: 8   DLYDTLGVAANASRQEIKKAYRLKALKHHPDK--------NGHSEQSKLKFQQICKAYEI 59

Query: 62  LSDASLRAEYDQ-------KLAFEAQPYXXXXXXXXXXXXXXXXHP-------------- 100
           L D   R  YD+       +   EA  Y                                
Sbjct: 60  LGDDKKREMYDRFGTADETQWHTEATNYEEPSGMSAGDLFSQFFGGGSTTGGFFSEGMDF 119

Query: 101 -GHRSGFDSGRGARR---YKSDDIEIDLKVKTSELYRGXXXXXXXXXXXXCQRCDGTGWK 156
            G   GF + +G+RR    +  DI+  LK    E+Y G            CQ C G G K
Sbjct: 120 FGSSRGFRA-QGSRRSAPQRGPDIKHYLKCTLEEMYNGKRAKLALKRTRLCQTCQGEGSK 178

Query: 157 SHASIVKKKTAKFFWNVCEGCEGQGVRQRLRQLAPGFVTTELIECRQCGGKGKLRNLPKS 216
              S             C  C G+G++ + ++  P  + T    C  CGG G +   P  
Sbjct: 179 KATS-------------CYACRGKGMQTQTKRQGP-IMQTWSSTCGTCGGSGTIVK-PSD 223

Query: 217 EKNKCPDCITSGTVGMVEENKVVTINIKKGTLDGDKIVLKGEADEDL------ESTEVGD 270
             N C         G V E K+  I ++KG  +G  +V+  EADE +      E    GD
Sbjct: 224 ICNGCHG------QGWVRERKIFEIEVQKGMENGQTVVVPAEADEVVISKYGSERVIPGD 277

Query: 271 LVIKIQEVKEPQYDIVRNGYD---LIIKKQIDLADAICG----FDEKPLMETYDGRVLKW 323
           ++I ++++  P   + R G+D   L+ + Q+DL  ++CG     D  P      G+VLK 
Sbjct: 278 VIIILEQL--PHRSLKR-GHDSSLLLSECQVDLKTSLCGGTVWVDSHP-----SGKVLKI 329

Query: 324 SSKRGKVIRPNDIVRIQNEGWPRREDANDNNTLLKNGDLYVIVDIVFPPDNWTMEVNDYR 383
               G++++P  I  +Q+ G P+ +           GDL++   ++FP            
Sbjct: 330 DVIPGELLKPGAIKCVQSMGMPKSKGG--------YGDLFIKFKVIFPD----------- 370

Query: 384 AVRNIIPSTINKRESSTSGESILNVENINVSEIVKEIP 421
              N+ P TI   +++   E  +        EI + IP
Sbjct: 371 ---NLKPDTIQTMQAALDKEPSMQTSATTQPEIDEGIP 405

>CAGL0J10296g Chr10 complement(1006624..1008063) [1440 bp, 479 aa]
           {ON} similar to uniprot|P53940 Saccharomyces cerevisiae
           YNL077w
          Length = 479

 Score =  116 bits (290), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 114/416 (27%), Positives = 172/416 (41%), Gaps = 80/416 (19%)

Query: 4   YGLLGVGQDASQDEIKRAYRKLALRHHPDKARGNEGGEDSSDDLPDVDFKEVTAAYQVLS 63
           Y LL V  DASQ  IK+A+   ALR HPDK   N   E+S        F+E++ AY+VLS
Sbjct: 8   YDLLNVECDASQVTIKKAFHAAALRCHPDK---NNHSEESKKQ-----FQEISKAYEVLS 59

Query: 64  DASLRAEYDQKLAFEAQPYXXXXXXXXXXXXXXXXHPGHRSGFDSG-------------- 109
           D   R  YD+    +                    +P H  G  +G              
Sbjct: 60  DPKSREMYDRYGTTDESAIASQEPFGEGMSFYSGGNPMHMFGTSAGDLFAQFFNSSGDAG 119

Query: 110 ------------------RGAR---RYKSDDIEIDLKVKTSELYRGXXXXXXXXXXXXCQ 148
                              GAR        DI+  LK   S+LY+G            C 
Sbjct: 120 PSFGFGSRFDGFGNSAQAHGARDGHMRTGPDIKHYLKCNLSDLYQGKKTKLGLNRMRVCS 179

Query: 149 RCDGTGWKSHASIVKKKTAKFFWNVCEGCEGQGVRQRLRQLAPGFVTTELIECRQCGGKG 208
            CDG G    AS             C  C+GQG   + R++ P  V T    C  C G G
Sbjct: 180 SCDGKGGMRVAS-------------CRTCKGQGEVVKTRRVGP-MVQTMSSTCNSCHGTG 225

Query: 209 KLRNLPKSEKNKCPDCITSGTVGMVEENKVVTINIKKGTLDGDKIVLKGEADEDLEST-- 266
                   + + C  C  SG   + +E K+  + +K G      IVL GEADE +E++  
Sbjct: 226 TFIK----DSDLCFVCKGSG---VSKERKIFDVEVKAGMTHNQVIVLPGEADEVIETSHG 278

Query: 267 ----EVGDLVIKIQEVKEPQYDIVRNGYDLIIKK-QIDLADAICGFDEKPLMETY-DGRV 320
               + GD+VI I  VK  Q+ +V N +DL++K  ++ L   +CG   + ++E +  G++
Sbjct: 279 LIKVQPGDVVIVIDLVKNTQFQVV-NDHDLVLKNCEVPLKTCLCG--GEIMIEGHPSGKI 335

Query: 321 LKWSSKRGKVIRPNDIVRIQNEGWPRREDANDNNTLLKN-----GDLYVIVDIVFP 371
           +K S    ++++P+    ++  G P+    +D+  +        G+LYV   + FP
Sbjct: 336 IKLSIIPNELLKPSCFKTVEGLGMPKVIANSDHANIAGTDIDGYGNLYVQFQVKFP 391

>SAKL0E09306g Chr5 complement(773968..775353) [1386 bp, 461 aa] {ON}
           similar to uniprot|P53940 Saccharomyces cerevisiae
           YNL077W APJ1 Putative chaperone of the HSP40 (DNAJ)
           family overexpression interferes with propagation of the
           [Psi ] prion
          Length = 461

 Score =  115 bits (288), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 109/400 (27%), Positives = 166/400 (41%), Gaps = 69/400 (17%)

Query: 2   DYYGLLGVGQDASQDEIKRAYRKLALRHHPDKARGNEGGEDSSDDLPDVDFKEVTAAYQV 61
           + Y  L +  DA+  EIK+AYR  AL+ HPDK   N   EDS        F+E+  AY++
Sbjct: 8   ELYDTLNISVDATPQEIKKAYRLAALKSHPDK---NNHSEDSKRK-----FQEICKAYEI 59

Query: 62  LSDASLRAEYD----------QKLAFEAQPYXXXXXXXXXXXXXXXXHPGHRSG------ 105
           L DA  +  YD          Q+   E   Y                     S       
Sbjct: 60  LGDAKKKLLYDRYGTVDESVIQEQQQEGVYYGSSGMSAGDLFSQFFGGGSTTSASSFFND 119

Query: 106 ---FDSGR--GARRY-KSDDIEIDLKVKTSELYRGXXXXXXXXXXXXCQRCDGTGWKSHA 159
              F +G+    RR  +  DI+ +L+    ELY G            C+ C G G  S +
Sbjct: 120 DTMFFTGKKNSQRRVSRGPDIKHNLRCSLEELYHGKKSKLRLDRTRLCKTCKGNGGTSSS 179

Query: 160 SIVKKKTAKFFWNVCEGCEGQGVRQRLRQLAPGFVTTELIECRQCGGKGKLRNLPKSEKN 219
           +             C  C GQG   + R+  P  V T    C+ CGG G         K+
Sbjct: 180 A-------------CRACNGQGFYTQTRRHGP-MVQTWSTTCQDCGGSGTFVR----RKD 221

Query: 220 KCPDCITSGTVGMVEENKVVTINIKKGTLDGDKIVLKGEADEDL------ESTEVGDLVI 273
            C +C   G +   +E K+  I ++ G   G +IVL  EADE +      E    GD++I
Sbjct: 222 VCSECKGQGCI---KERKIFEIEVQPGMHHGQEIVLPEEADEIVYTTYGKEQVNPGDVII 278

Query: 274 KIQEVKEPQYDIVRNGYDLIIKK-QIDLADAICGFDEKPLMETYD-GRVLKWSSKRGKVI 331
            +Q+VK P + I  N  DL++    +DL  ++CG +   L+E +  G  LK     G+++
Sbjct: 279 IVQQVKHPLFQI-HNDTDLVMNDCHVDLKTSLCGGE--VLIENHPCGSALKIEVLPGEIL 335

Query: 332 RPNDIVRIQNEGWPRREDANDNNTLLKNGDLYVIVDIVFP 371
           +P  +  +++ G P  +           G+LY+   + FP
Sbjct: 336 KPGCVKCVESMGMPHPQSQG-------FGNLYIRFQVDFP 368

>Ecym_6236 Chr6 (440622..441746) [1125 bp, 374 aa] {ON} similar to
           Ashbya gossypii AER346W
          Length = 374

 Score =  112 bits (279), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 114/394 (28%), Positives = 173/394 (43%), Gaps = 56/394 (14%)

Query: 2   DYYGLLGVGQDASQDEIKRAYRKLALRHHPDKARGNEGGEDSSDDLPDVDFKEVTAAYQV 61
           DYY +LGVG+ AS  +IK AYR+L+ ++HPDK   N G ED+ +      F EV  AY+ 
Sbjct: 21  DYYAILGVGRGASDKDIKSAYRQLSKKYHPDK---NPGDEDAHN-----RFIEVGEAYEA 72

Query: 62  LSDASLRAEYDQKLAFEAQPYXXXXXXXXXXXXXXXXH-----------PGHRSGFDSGR 110
           LSD   R  YDQ   F A+                  H            G  S F  G 
Sbjct: 73  LSDPEKRKIYDQ---FGAEALKNGGDRAGGGGAGGGFHDPFDIFDQMFGGGAGSRFHGGG 129

Query: 111 GARR-YKSDDIEIDLKVKTSELYRGXXXXXXXXXXXXCQRCDGTGWKSHASIVKKKTAKF 169
           G RR  +   +++  ++   + Y G            C  CDG+G  S    V+K     
Sbjct: 130 GQRRKQRGQSLQVQDELNLKKFYHGTSIEFTMSLNDFCDACDGSG--SQDGKVEK----- 182

Query: 170 FWNVCEGCEGQG-VRQRLRQLAPGFVTTELIE-CRQCGGKGKLRNLPKSEKNKCPDCITS 227
               C  C G+G V Q +RQ   GF+T ++ + C++C G+G++       KNKC  C  S
Sbjct: 183 ----CGQCGGRGMVVQVIRQ---GFITQQIQQMCQKCEGRGEVI------KNKCKTCHGS 229

Query: 228 GTVGMVEENKVVTINIKKGTLDGDKIVLKGEADEDLESTEVGDLVIKIQEVKEPQYDIVR 287
               +V++NK   +++  G       V++GEA++  + TE GD+ +K+ E         R
Sbjct: 230 ---KVVKKNKSFHVDVPAGAPRDFVAVIRGEAEKSPD-TEPGDIYVKVVESPVQNMGYRR 285

Query: 288 NGYDLIIKKQIDLADAICGFDEKPLMETYDGRVLKWSSKRGKVIRPNDIVRIQNEGWPRR 347
            G DL   + + L +A+ G   + L      + +  S  +G  ++  ++  I+  G P  
Sbjct: 286 RGPDLFRTEVLSLTEALKGGWVRELEFLDSKKKVVLSRSKGTPVQHGEVECIKGFGMPLE 345

Query: 348 EDANDNNTLLKNGDLYVIVDIVFPPDNWTMEVND 381
                     K GDLYV   IV P       +ND
Sbjct: 346 SGT-------KYGDLYVDYVIVMPSKYKPAPLND 372

>KNAG0M02020 Chr13 complement(375304..376686) [1383 bp, 460 aa] {ON}
           Anc_2.218 YNL077W
          Length = 460

 Score =  110 bits (275), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 104/374 (27%), Positives = 157/374 (41%), Gaps = 57/374 (15%)

Query: 4   YGLLGVGQDASQDEIKRAYRKLALRHHPDKARGNEGGEDSSDDLPDVDFKEVTAAYQVLS 63
           Y +LGV  DASQ EIK+AYRKLALR+HPDK  G+E   ++        F++++ AY VL 
Sbjct: 5   YDVLGVASDASQSEIKKAYRKLALRYHPDKNNGDEKCHEA--------FQKISHAYGVLG 56

Query: 64  DASLRAEYDQK--LAFEAQPYXXXXXXXXXXXXXXXXHPGHRSGFDSGRGARRYKSDDIE 121
           D + R  YDQ        QP                      S    G      +  +I 
Sbjct: 57  DVAQRQRYDQSGDENESLQPTGSNAADLFSSFFNGGGVYPSGSSGGPGPSRGPSRGPNII 116

Query: 122 IDLKVKTSELYRGXXXXXXXXXXXXCQRCDGTGWKSHASIVKKKTAKFFWNVCEGCEGQG 181
            +LK    +LYRG            C+RC                     NVC  C G G
Sbjct: 117 HELKCTLQDLYRGKVIKLALRRTAPCERCSLGA----------------ANVCSSCNGSG 160

Query: 182 VRQRLRQLAPGFVTTELIECRQCGGKGKLRNLPKSEKNKCPDCITSGTVGMVEENKVVTI 241
              R+ ++ P    T    C  C G+G++            DC   G    + E  V  +
Sbjct: 161 NITRIERVGP-LTQTWSSTCNACQGQGRMS----------VDCSQCGGAQYLNERVVFKV 209

Query: 242 NIKKGTLDGDKIVLKGEADE-------DLESTEVGDLVIKIQEVKEPQY--DIVRNGYDL 292
           ++K G  DG  IVL GEAD+        L   E GD+VI I+E+ + ++    +    +L
Sbjct: 210 HVKPGMHDGQTIVLDGEADQCVRDRLGHLTVAESGDVVIVIRELADAKFKRSALNKRENL 269

Query: 293 IIKK-QIDLADAICGFDEKPLMETY-DGRVLKWSSKRGKVIRPNDIVRIQNEGWPRREDA 350
            + + ++DL  A+ G +   L+E +  G ++K +   G+ +  N I  ++  G P  +  
Sbjct: 270 FVDQVKVDLTTALTGGN--VLLEDHPSGNLMKINILPGEFLPENCIKCVEGLGMPIDDTG 327

Query: 351 NDNNTLLKNGDLYV 364
                  + GDLY+
Sbjct: 328 -------QRGDLYI 334

>AER427W Chr5 (1456998..1458410) [1413 bp, 470 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YNL077W (APJ1)
          Length = 470

 Score =  105 bits (262), Expect = 6e-24,   Method: Compositional matrix adjust.
 Identities = 102/396 (25%), Positives = 156/396 (39%), Gaps = 68/396 (17%)

Query: 4   YGLLGVGQDASQDEIKRAYRKLALRHHPDKARGNEGGEDSSDDLPDVDFKEVTAAYQVLS 63
           Y +LGV    S  E+K++Y+  ALR+HPDK   +E  +          F+++  AY+VL 
Sbjct: 8   YDVLGVQPGVSAAELKKSYKLAALRYHPDKNGHSEASKQR--------FQQIADAYRVLG 59

Query: 64  DASLRAEYD--------QKLAFEAQPYXXXXXXXXXXXXXXXXHPGH---------RSGF 106
           D  LR  YD        +  A  A                     G           SG 
Sbjct: 60  DERLRKIYDRYGTVDEGEVAAMAAAERRHAGGITPGDLFAHFFGDGQGLGSFAIFGESGA 119

Query: 107 DSGRGARRYKSDDIEIDLKVKTSELYRGXXXXXXXXXXXXCQRCDGTGWKSHASIVKKKT 166
            S R +R  +  DI+  L+    ELY G            C  C G G  S AS      
Sbjct: 120 SSARCSRVSRGPDIKHKLRCTLEELYGGKVVRLALTRTRLCTLCAGRGG-SRAS------ 172

Query: 167 AKFFWNVCEGCEGQGVRQRLRQLAPGFVTTELIECRQCGGKGKLRNLPKSEKNKCPDCIT 226
                  C  C GQG+  + ++     V T    CR C G G +          C  C +
Sbjct: 173 ------TCTACSGQGICSQTKRQG-SLVQTWSSTCRVCSGSGTI-------VKDCDTCTS 218

Query: 227 SGTVGMVEENKVVTINIKKGTLDGDKIVLKGEADEDL------ESTEVGDLVIKIQEVKE 280
            G  G + E KV  + I+ G   G ++V  GEADE +      E    GDL I I+E   
Sbjct: 219 CGGAGYLRERKVFEVEIRPGMRAGSEVVFPGEADEVVNTPYGKEQVLPGDLAITIEEATP 278

Query: 281 PQYDIVRNGYDLIIKK-QIDLADAICG----FDEKPLMETYDGRVLKWSSKRGKVIRPND 335
                 R   +L++ +  +DL  ++CG     ++ P      G++++     G+++ P  
Sbjct: 279 ATRYQCRGDANLLLTELHVDLRTSLCGGTVYIEDHP-----SGKLIQLEIIPGELLEPGA 333

Query: 336 IVRIQNEGWPRREDANDNNTLLKNGDLYVIVDIVFP 371
           I  I++ G P  +D +      + G L++   + FP
Sbjct: 334 IKCIEHLGMPHPDDPS------QYGHLFIKFHVDFP 363

>Smik_14.249 Chr14 (461706..463307) [1602 bp, 533 aa] {ON} YNL077W
           (REAL)
          Length = 533

 Score = 99.0 bits (245), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 90/346 (26%), Positives = 148/346 (42%), Gaps = 62/346 (17%)

Query: 119 DIEIDLKVKTSELYRGXXXXXXXXXXXXCQRCDGTGWKSHASIVKKKTAKFFWNVCEGCE 178
           DI+ +LK    ELY G            C  CDG G       ++K T       C+ C+
Sbjct: 185 DIKHNLKCTLKELYMGKTAKLGLNRTRICHVCDGHGG------LRKYT-------CKPCK 231

Query: 179 GQGVRQRLRQLAPGFVTTELIECRQCGGKGKLRNLPKSEKNKCPDCITSGTVGMVEENKV 238
           GQG++ + +++ P  V +    C  CGG G         K+ C  C     +G +++ K+
Sbjct: 232 GQGIQTQTKRMGP-LVQSWSQTCADCGGAGTFV----KNKDICEQC---QGLGFIKQRKI 283

Query: 239 VTINIKKGTLDGDKIVLKGEADEDL-------ESTEVGDLVIKIQEVKEPQYDIVRNGYD 291
           + + ++ G+     IVL GE DE +       E    GD+VI I  +K+P++ I  N  D
Sbjct: 284 LQVTVQPGSCHNQLIVLTGEGDEVISTKGGGREKVIPGDVVITILRLKDPKFQITDN-CD 342

Query: 292 LIIKK-QIDLADAICG----FDEKPLMETYDGRVLKWSSKRGKVIRPNDIVRIQNEGWPR 346
           LI KK ++DL  ++CG     +  P      G+++K     G+V++P     ++N G P+
Sbjct: 343 LICKKCEVDLMTSLCGGIVYIEGHP-----SGKLIKIDIIPGEVLKPGCFKTVENMGMPK 397

Query: 347 REDANDNNTLLKNGDLYVIVDIVFPPDNWTMEVNDYRAVRNIIPSTINKRESSTSGESIL 406
                 N      G LYV  D+ +P     +E  +   V++I+                 
Sbjct: 398 F----INGVRSGFGHLYVKFDVTYPE---RLEPENAAKVKSILA---------------- 434

Query: 407 NVENINVSEIVKEIPNCDELPKFQDTYDNTNDKGESPFWTPNCSQQ 452
           N + IN      E  + D     + +YDN  +   S F  P+ S +
Sbjct: 435 NDKYINAERSAMETTDADCYCDLEKSYDNVEEHVLSSFEAPDLSSK 480

 Score = 54.3 bits (129), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 32/70 (45%), Positives = 40/70 (57%), Gaps = 8/70 (11%)

Query: 4  YGLLGVGQDASQDEIKRAYRKLALRHHPDKARGNEGGEDSSDDLPDVDFKEVTAAYQVLS 63
          Y  L V   AS  EIK+AYR  AL++HPDK   N   E+S        F+E+  AY+VL 
Sbjct: 8  YDSLNVTATASTSEIKKAYRNAALKYHPDK---NNHTEESKR-----KFQEICQAYEVLK 59

Query: 64 DASLRAEYDQ 73
          D  LR+ YDQ
Sbjct: 60 DNHLRSLYDQ 69

>KNAG0G02880 Chr7 (636899..638035) [1137 bp, 378 aa] {ON} Anc_8.730
           YMR214W
          Length = 378

 Score = 96.7 bits (239), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 100/390 (25%), Positives = 159/390 (40%), Gaps = 63/390 (16%)

Query: 2   DYYGLLGVGQDASQDEIKRAYRKLALRHHPDKARGNEGGEDSSDDLPDVDFKEVTAAYQV 61
           DYY +LGV +DAS+ +IK AYR+++ + HPDK  G        DD     F E+  AY+V
Sbjct: 19  DYYAILGVAKDASEKDIKSAYRQMSKKWHPDKNAG--------DDEAHHKFIEIGEAYEV 70

Query: 62  LSDASLRAEYDQKLAFEAQPYXXXXXXXXXXXXXXX-----------------XHPGHRS 104
           LSD+  RA YD+   F A                                    HPG   
Sbjct: 71  LSDSEKRATYDR---FGADALKNGGGGGGGHPGGFGGGGFHDPFDLFNQMFGDSHPG--- 124

Query: 105 GFDSGRGARRYKSDDIEIDLKVKTSELYRGXXXXXXXXXXXXCQRCDGTGWKSHASIVKK 164
               G+  R  K  ++ +   V  +  Y G            C+ C G+G + +      
Sbjct: 125 ----GQNVR--KGSNLIVKDSVTLNGFYHGFYANLTLDLNDDCEHCHGSGAEDNQ----- 173

Query: 165 KTAKFFWNVCEGCEGQGVRQRLRQLAPGFVTTELIE-CRQCGGKGKLRNLPKSEKNKCPD 223
                 +  CE C+G+GV  ++ Q+  GF+T ++ + C  C GKG      K+ K+ C  
Sbjct: 174 ------FATCETCQGRGVIIQVIQM--GFMTQQIQQVCGACQGKG------KTIKHVCKI 219

Query: 224 CITSGTVGMVEENKVVTINIKKGTLDGDKIVLKGEADEDLESTEVGDLVIKIQEVKEPQY 283
           C  +    +V+  K   I++  G      +V  G+A E +   + GDLV   +E      
Sbjct: 220 CRGA---RVVKTPKTFEISVPAGAQRNYNVVKSGQA-EKVPDMQSGDLVFVFEENSHENL 275

Query: 284 DIVRNGYDLIIKKQIDLADAICGFDEKPLMETYDGRVLKWSSKRGKVIRPNDIVRIQNEG 343
              R G  L   + +   +A+ G  E+ +    D + +     +  V  P +I R+ N G
Sbjct: 276 GYRRRGDHLYRTEVLHWKEALLGGWERRIAFFDDQKQVVVKRDKNVVTAPGEIERVPNLG 335

Query: 344 WPRREDANDNNTLLKNGDLYVIVDIVFPPD 373
            P+      +      GDL++   IV P +
Sbjct: 336 MPKLNSKGKSTNAY--GDLFIEYVIVSPKE 363

>NCAS0G02850 Chr7 (522548..524032) [1485 bp, 494 aa] {ON} Anc_2.218
          Length = 494

 Score = 96.7 bits (239), Expect = 7e-21,   Method: Compositional matrix adjust.
 Identities = 76/277 (27%), Positives = 123/277 (44%), Gaps = 41/277 (14%)

Query: 115 YKSDDIEIDLKVKTSELYRGXXXXXXXXXXXXCQRCDGTGWKSHASIVKKKTAKFFWNVC 174
           ++  DI+  LK    ELY G            C  C+G G     +             C
Sbjct: 149 HRGPDIKHVLKCTLRELYNGKMAKLALNRTRLCLPCNGFGGLQRTT-------------C 195

Query: 175 EGCEGQGVRQRLRQLAPGFVTTELIECRQCGGKGKLRNLPKSEKNKCPDCITSGTVGMVE 234
           E C+G G + + R++ P  V T    C  C G G          + CP C   G    + 
Sbjct: 196 ESCQGDGFQTQTRRMGP-MVQTWTQTCASCDGAGCF----IKPNDVCPHCHGEG---FIR 247

Query: 235 ENKVVTINIKKGTLDGDKIVLKGEADEDLESTEV------GDLVIKIQEVKEPQ--YDIV 286
           E K+  + +K G  DG  ++++GEADE + +  V      GD+VI I++ ++    + ++
Sbjct: 248 ERKIFHVEVKPGFQDGKDVIMQGEADEIMLNNLVKEKVIPGDVVITIKQSRDENNCFQMI 307

Query: 287 RNGYDLIIKKQIDLADAICG----FDEKPLMETYDGRVLKWSSKRGKVIRPNDIVRIQNE 342
            N   L+    +DL  ++CG     D  P      G+++K     G++++PN    I+  
Sbjct: 308 NNKDLLMNGCPVDLVTSLCGGEVYIDNHP-----SGKLIKLDIIPGEILKPNCFKIIEGL 362

Query: 343 GWPRREDANDNNTLLKNGDLYVIVDIVFPP--DNWTM 377
           G P  ED  D +T+L+ GDLY+   I +P   +N TM
Sbjct: 363 GMPYLEDGKD-DTMLRRGDLYIQFKIQYPEQLENETM 398

 Score = 30.8 bits (68), Expect = 9.1,   Method: Compositional matrix adjust.
 Identities = 30/69 (43%), Positives = 40/69 (57%), Gaps = 8/69 (11%)

Query: 4  YGLLGVGQDASQDEIKRAYRKLALRHHPDKARGNEGGEDSSDDLPDVDFKEVTAAYQVLS 63
          Y  L V   A+  +IK+AY+KLAL++HPDK   N   EDS        F+ V  AY++L+
Sbjct: 8  YETLNVPITATTLDIKKAYKKLALKYHPDK---NNHSEDSK-----TKFQAVCQAYEILN 59

Query: 64 DASLRAEYD 72
          D   RA YD
Sbjct: 60 DKQSRAIYD 68

>Skud_14.253 Chr14 (471602..473200) [1599 bp, 532 aa] {ON} YNL077W
           (REAL)
          Length = 532

 Score = 96.7 bits (239), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 79/275 (28%), Positives = 126/275 (45%), Gaps = 43/275 (15%)

Query: 109 GRGARRYKSDDIEIDLKVKTSELYRGXXXXXXXXXXXXCQRCDGTGWKSHASIVKKKTAK 168
           G G    +  DI+ +LK    ELY G            CQ CDG G         KK A 
Sbjct: 172 GEGRHLNRGPDIKHNLKCTLKELYMGKTAKLGLNRTRICQVCDGHGGL-------KKYA- 223

Query: 169 FFWNVCEGCEGQGVRQRLRQLAPGFVTTELIECRQCGGKGKLRNLPKSEKNKCPDCITSG 228
                C+ C+GQGV+ +  ++ P  V +    C  CGG G    +    K+ C  C    
Sbjct: 224 -----CKTCKGQGVQTQTNRMGP-LVQSWSQTCADCGGAG----IFVESKDICQQC---Q 270

Query: 229 TVGMVEENKVVTINIKKGTLDGDKIVLKGEADEDLESTE-------VGDLVIKIQEVKEP 281
            +G V++ K++ + ++ G+     IVL GE DE + S          GD+VI I  +K+P
Sbjct: 271 GLGFVKQRKILQVAVQPGSCHNQLIVLTGEGDEVISSKGGGHEKIIPGDVVITILRLKDP 330

Query: 282 QYDIVRNGYDLIIKK-QIDLADAICG----FDEKPLMETYDGRVLKWSSKRGKVIRPNDI 336
           ++ IV + Y+LI KK ++DL  ++CG     +  P      G+++K     G+V++P   
Sbjct: 331 RFQIVDD-YNLIYKKCKVDLMTSLCGGVVYIEGHP-----SGKLIKLDIIPGEVLKPGCF 384

Query: 337 VRIQNEGWPRREDANDNNTLLKNGDLYVIVDIVFP 371
             ++N G P+      N      G +YV  ++ +P
Sbjct: 385 KTVENMGMPKF----INGVRSGFGHMYVKFEVTYP 415

 Score = 52.4 bits (124), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 31/70 (44%), Positives = 39/70 (55%), Gaps = 8/70 (11%)

Query: 4  YGLLGVGQDASQDEIKRAYRKLALRHHPDKARGNEGGEDSSDDLPDVDFKEVTAAYQVLS 63
          Y  L V   AS  EIK+AYR  AL++HPDK   N   E+S        F+E+  AY+ L 
Sbjct: 8  YDSLNVTATASTSEIKKAYRNAALKYHPDK---NNHTEESKR-----KFQEICQAYETLK 59

Query: 64 DASLRAEYDQ 73
          D  LR+ YDQ
Sbjct: 60 DNHLRSLYDQ 69

>Kpol_1002.122 s1002 (305710..307221) [1512 bp, 503 aa] {ON}
           (305710..307221) [1512 nt, 504 aa]
          Length = 503

 Score = 95.1 bits (235), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 99/425 (23%), Positives = 175/425 (41%), Gaps = 81/425 (19%)

Query: 2   DYYGLLGVGQDASQDEIKRAYRKLALRHHPDKARGNEGGE-------DSSDDLPDVDFKE 54
           + Y +L +  +A   +IK+AYR LAL++HPDK   +E  +       ++ + L DV+ ++
Sbjct: 6   ELYDILNISSNADAKDIKKAYRVLALKYHPDKNNHSEESKVMFQKISEAYEVLIDVEKRK 65

Query: 55  VTAAYQVLSDASL--------RAEYDQK--------------------LA-----FEAQP 81
           +   Y  + ++ +        ++E+ Q+                    LA       AQ 
Sbjct: 66  LYDQYGTVDESVIEQMKERKRKSEFMQQRQGMYPSDPFGNVNPLFGSDLAASAGDLFAQF 125

Query: 82  YXXXXXXXXXXXXXXXXHPGH---RSGFDSGRGARRYKSDDIEIDLKVKTSELYRGXXXX 138
           +                 P      + F++       +  DI+  L+    +LY G    
Sbjct: 126 FGNSNKNSSRFNPFGNMKPNFSNFNNTFENTASVELERGPDIKHTLRCSLKDLYYGKKTK 185

Query: 139 XXXXXXXXCQRCDGTGWKSHASIVKKKTAKFFWNVCEGCEGQGVRQRLRQLAPGFVTTEL 198
                   C  C G G     S+ K K        C  C G G   + R++ P  + T  
Sbjct: 186 LRLDRTRLCVLCMGQG-----SMKKSK--------CFTCNGLGSLTQTRRMGP-MIQTFS 231

Query: 199 IECRQCGGKGKLRNLPKSEKNKCPDCITSGTVGMVEENKVVTINIKKGTLDGDKIVLKGE 258
             C  C G G          + C  C  SG  G VEE K+  + I+ G ++G  I+L GE
Sbjct: 232 QSCPDCQGSGMFV----KRSDTCQSC--SGN-GYVEERKIFDVEIQPGMVNGQVIILPGE 284

Query: 259 ADEDLESTE------VGDLVIKIQEVKEPQYDIVRNGYDLIIKKQIDLADAICG----FD 308
           ADE + ++        GD+V+ I ++K+  ++++ +   L+    ++L+ A+CG      
Sbjct: 285 ADEVVNTSFGKQKVIAGDIVLTINQLKDNNFEVINDCDLLLDNFSVNLSKALCGGTIFIS 344

Query: 309 EKPLMETYDGRVLKWSSKRGKVIRPNDIVRIQNEGWPRREDANDNNTL--LKNGDLYVIV 366
             P      G ++K     G+++ P  I  + N G P+ E  + + ++  +  G+LYV  
Sbjct: 345 NHP-----SGNLIKIDIIPGEILSPGVIKTVANLGMPKEEKRDPDVSIINISKGNLYVKF 399

Query: 367 DIVFP 371
           DI FP
Sbjct: 400 DIKFP 404

>YNL077W Chr14 (481391..482977) [1587 bp, 528 aa] {ON}  APJ1Putative
           chaperone of the HSP40 (DNAJ) family; overexpression
           interferes with propagation of the [Psi+] prion; the
           authentic, non-tagged protein is detected in highly
           purified mitochondria in high-throughput studies
          Length = 528

 Score = 94.4 bits (233), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 87/342 (25%), Positives = 145/342 (42%), Gaps = 62/342 (18%)

Query: 119 DIEIDLKVKTSELYRGXXXXXXXXXXXXCQRCDGTGWKSHASIVKKKTAKFFWNVCEGCE 178
           DI+ +LK    ELY G            C  CDG G       +KK T       C+ C+
Sbjct: 178 DIKHNLKCTLKELYMGKTAKLGLNRTRICSVCDGHGG------LKKCT-------CKTCK 224

Query: 179 GQGVRQRLRQLAPGFVTTELIECRQCGGKGKLRNLPKSEKNKCPDCITSGTVGMVEENKV 238
           GQG++ + R++ P  V +    C  CGG G         K+ C  C     +G ++E K+
Sbjct: 225 GQGIQTQTRRMGP-LVQSWSQTCADCGGAGVFV----KNKDICQQC---QGLGFIKERKI 276

Query: 239 VTINIKKGTLDGDKIVLKGEADEDL-------ESTEVGDLVIKIQEVKEPQYDIVRNGYD 291
           + + ++ G+     IVL GE DE +       E    GD+VI I  +K+P + ++ N  +
Sbjct: 277 LQVTVQPGSCHNQLIVLTGEGDEVISTKGGGHEKVIPGDVVITILRLKDPNFQVI-NYSN 335

Query: 292 LIIKK-QIDLADAICG----FDEKPLMETYDGRVLKWSSKRGKVIRPNDIVRIQNEGWPR 346
           LI KK +ID   ++CG     +  P      G+++K     G++++P     +++ G P+
Sbjct: 336 LICKKCKIDFMTSLCGGVVYIEGHP-----SGKLIKLDIIPGEILKPGCFKTVEDMGMPK 390

Query: 347 REDANDNNTLLKNGDLYVIVDIVFPPDNWTMEVNDYRAVRNIIPSTINKRESSTSGESIL 406
                 N      G LYV  D+ +P     +E  + + ++NI+                 
Sbjct: 391 FI----NGVRSGFGHLYVKFDVTYPE---RLEPENAKKIQNILA---------------- 427

Query: 407 NVENINVSEIVKEIPNCDELPKFQDTYDNTNDKGESPFWTPN 448
           N + I       E  + D     + +YD+  +   S F  PN
Sbjct: 428 NDKYIKAERSTMETADSDCYCDLEKSYDSVEEHVLSSFEAPN 469

 Score = 54.7 bits (130), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 32/70 (45%), Positives = 40/70 (57%), Gaps = 8/70 (11%)

Query: 4  YGLLGVGQDASQDEIKRAYRKLALRHHPDKARGNEGGEDSSDDLPDVDFKEVTAAYQVLS 63
          Y  L V   AS  EIK+AYR  AL++HPDK   N   E+S        F+E+  AY++L 
Sbjct: 8  YDSLNVTAAASTSEIKKAYRNAALKYHPDK---NNHTEESKR-----KFQEICQAYEILK 59

Query: 64 DASLRAEYDQ 73
          D  LRA YDQ
Sbjct: 60 DNRLRALYDQ 69

>SAKL0H05258g Chr8 complement(474006..475112) [1107 bp, 368 aa] {ON}
           similar to uniprot|P25303 Saccharomyces cerevisiae
           YMR214W SCJ1 dnaJ homolog
          Length = 368

 Score = 92.4 bits (228), Expect = 7e-20,   Method: Compositional matrix adjust.
 Identities = 108/392 (27%), Positives = 160/392 (40%), Gaps = 57/392 (14%)

Query: 2   DYYGLLGVGQDASQDEIKRAYRKLALRHHPDKARGNEGGEDSSDDLPDVDFKEVTAAYQV 61
           DYY +LGV + A   +IK AYR+L+ ++HPDK        +  DD     F EV  AY+V
Sbjct: 20  DYYSILGVSKGAGDKDIKSAYRQLSKKYHPDK--------NPDDDSAHNKFIEVGEAYEV 71

Query: 62  LSDASLRAEYDQKLAFEAQPYXXXXXXXXXXXXXXXXHPGHRSGFD-----------SGR 110
           LSD   R  YDQ  A EA                    P     FD             R
Sbjct: 72  LSDPEKRKIYDQYGA-EALKNNGGQGGGQGPRGGGFHDP-----FDIFEQMFGGGGGGQR 125

Query: 111 GARRYKSDDIEIDLKVKTSELYRGXXXXXXXXXXXXCQRCDGTGWKSHASIVKKKTAKFF 170
             RR +  ++E   ++   E YRG            C+ C+G+G  S    V K      
Sbjct: 126 QRRRARGHNLETREELTLKEYYRGTSIDFNLNLNDFCEHCEGSG--SQDGKVTK------ 177

Query: 171 WNVCEGCEGQGVRQRLRQLAPGFVTTELIE-CRQCGGKGKLRNLPKSEKNKCPDCITSGT 229
              C  C+G GV  ++ ++ P  VT ++ + C +C G+G       + KNKC  C     
Sbjct: 178 ---CPDCKGHGVVVQIVRMGP--VTQQIQQMCGKCQGRGS------TIKNKCKHCHGEK- 225

Query: 230 VGMVEENKVVTINIKKGTLDGDKIVLKGEADEDLESTEVGDLVIKIQEVKEPQYDIVRNG 289
             +V + K   +++  G       V +GE+D+  +  + GDL IK  E         R G
Sbjct: 226 --VVRKPKSFHVDVPPGAPRNFVEVKQGESDKGPD-FDAGDLFIKFSETSRDNLGYRRRG 282

Query: 290 YDLIIKKQIDLADAICGFDEKPLMETYDGRVLKWSSKRGKVIRPNDIVRIQNEGWPRRED 349
            DL   + + L +A+ G  E+ +      R +K       V    +I RI   G P+  +
Sbjct: 283 DDLFRTEALSLREALKGGWEREIEFLDAKRKVKIKRASSMVTNNGEIERIPGFGMPKEHN 342

Query: 350 ANDNNTLLKNGDLYVIVDIVFPPDNWTMEVND 381
                   K GDLY+   ++ P D  T  + D
Sbjct: 343 --------KFGDLYIDYVVIVPDDIATSPIKD 366

>Ecym_5384 Chr5 (781017..782528) [1512 bp, 503 aa] {ON} similar to
           Ashbya gossypii AER427W
          Length = 503

 Score = 92.4 bits (228), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 89/326 (27%), Positives = 138/326 (42%), Gaps = 59/326 (18%)

Query: 119 DIEIDLKVKTSELYRGXXXXXXXXXXXXCQRCDGTGWKSHASIVKKKTAKFFWNVCEGCE 178
           DI+ +LK +  ELY G            C RC G     H S+          +VC  C 
Sbjct: 154 DIKHNLKCELKELYSGKVAKLGLTRTRLCHRCSG-----HGSMTS--------SVCGECR 200

Query: 179 GQGVRQRLRQLAPGFVTTELIECRQCGGKGKLRNLPKSEKNKCPDCITSGTVGMVEENKV 238
           GQGV  + R+  P  V T    CR C G G          + C  C   GT G + E K+
Sbjct: 201 GQGVYSQTRRHGP-LVQTWSSSCRNCSGAGTF----VKSNDVCQTC--RGT-GYIRERKI 252

Query: 239 VTINIKKGTLDGDKIVLKGEADEDLESTE------VGDLVIKIQE-VKEPQYDIVRNGYD 291
             + IK G  +  +I+L GEAD+ + +         GD++I +QE     +Y   R    
Sbjct: 253 FEVEIKPGLSNKSEIILPGEADQVISTVYGKQQVIPGDVIIIVQEQCSTGRYRRFRESDL 312

Query: 292 LIIKKQIDLADAICG----FDEKPLMETYDGRVLKWSSKRGKVIRPNDIVRIQNEGWPRR 347
           ++ +  +DL  ++CG     D+ P      GR +K     G+++ P  I  ++N G P+R
Sbjct: 313 VLTRCVVDLRTSLCGGSIYIDDHP-----SGRPIKLEVIPGELLNPGSIKCVENLGMPKR 367

Query: 348 EDANDNNTLLKNGDLYVIVDIVFPPDNWTMEVNDYRAVRNIIPSTINKRESSTSGES-IL 406
           ++ +      + GDLY+   + FP                + P T+N   S+ + +S I+
Sbjct: 368 DNPS------QYGDLYIKFCVNFP--------------ERLEPETMNVISSALASDSNII 407

Query: 407 NVENIN-VSEIVKEIPNCDELPKFQD 431
             ENI   S      P+C E   F +
Sbjct: 408 RQENITEPSSAQTRNPDCYEEHVFSN 433

 Score = 49.7 bits (117), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 26/71 (36%), Positives = 40/71 (56%), Gaps = 8/71 (11%)

Query: 3  YYGLLGVGQDASQDEIKRAYRKLALRHHPDKARGNEGGEDSSDDLPDVDFKEVTAAYQVL 62
          +Y LL V    S  E+K++Y+  ALR+HPDK   +E  + +        F+++T AY +L
Sbjct: 7  FYDLLNVSPTVSPQELKKSYKLAALRYHPDKNGHSESAKQA--------FQQITEAYGIL 58

Query: 63 SDASLRAEYDQ 73
          SD   R  YD+
Sbjct: 59 SDERKRKIYDR 69

>KLLA0E07899g Chr5 complement(709306..710793) [1488 bp, 495 aa] {ON}
           similar to gnl|GLV|CAGL0J10296g Candida glabrata
           CAGL0J10296g and weakly similar to YNL077W
           uniprot|P53940 Saccharomyces cerevisiae YNL077W APJ1
           Putative chaperone of the HSP40 (DNAJ) family
           overexpression interferes with propagation of the [Psi ]
           prion
          Length = 495

 Score = 89.0 bits (219), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 74/267 (27%), Positives = 119/267 (44%), Gaps = 48/267 (17%)

Query: 120 IEIDLKVKTSELYRGXXXXXXXXXXXXCQRCDGTGWKSHASIVKKKTAKFFWNVCEGCEG 179
           I  +LK    +L+ G            CQRC G G K                 C GC+G
Sbjct: 165 IRHNLKCNLYDLFHGKRAKLALNRTRLCQRCQGYGGKKATQ-------------CRGCQG 211

Query: 180 QGVRQRLRQLAPGFVTTELIECRQCGGKGKLRNLPKSEKNKCPDCITSGTVGMVEENKVV 239
            G+    +++ P  V T    C++C G GK        K+ C +C  SG  G ++E K  
Sbjct: 212 TGLFTTTKRMGP-MVQTWQTTCKECSGTGKY----IRSKDACTEC--SGN-GFIKERKFF 263

Query: 240 TINIKKGTLDGDKIVLKGEADEDL------ESTEVGDLVIKIQ----EVKEPQYDIVRNG 289
            + +  G  +G++I+L GEADE +      E    GD++I IQ    E    +Y  + + 
Sbjct: 264 DVEVLPGMRNGNEIILPGEADEVINTEYGKERVIPGDVIITIQLTRNEESNMRYKYLVHD 323

Query: 290 YDLIIKK-QIDLADAICG----FDEKPLMETYDGRVLKWSSKRGKVIRPNDIVRIQNEGW 344
           +DLI+   ++DL  ++CG     ++ P      G   K     G++++P  I  ++N+G 
Sbjct: 324 HDLILDNFEVDLKTSLCGGTIIIEDHP-----SGNPFKIEVLSGELLKPGCIKCVENKGM 378

Query: 345 PRREDANDNNTLLKNGDLYVIVDIVFP 371
           P   D+N N      G+LY+   + FP
Sbjct: 379 PV--DSNGN-----FGNLYIRFRVKFP 398

>ZYRO0C15048g Chr3 complement(1170614..1172089) [1476 bp, 491 aa]
           {ON} similar to gnl|GLV|CAGL0J10296g Candida glabrata
           CAGL0J10296g and some similarites with YNL077W
           uniprot|P53940 Saccharomyces cerevisiae YNL077W APJ1
           Putative chaperone of the HSP40 (DNAJ) family
           overexpression interferes with propagation of the [Psi ]
           prion
          Length = 491

 Score = 89.0 bits (219), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 78/265 (29%), Positives = 119/265 (44%), Gaps = 44/265 (16%)

Query: 119 DIEIDLKVKTSELYRGXXXXXXXXXXXXCQRCDGTGWKSHASIVKKKTAKFFWNVCEGCE 178
           DI+ +LK   +ELY G            CQ C G G       ++++T       C+ C 
Sbjct: 164 DIKHNLKCTLAELYDGKITKLGLNRRRMCQSCQGQGS------LRRRT-------CKTCR 210

Query: 179 GQGVRQRLRQLAPGFVTTELIECRQCGGKGKLRNLPKSEKNKCPDCITSGTVGMVEENKV 238
           GQG +   R+  P  V T    C  C G G        + + C +C        ++E K+
Sbjct: 211 GQGQQTETRRTGP-MVQTWTQTCPDCNGLGTY----TKQADVCHECRGES---YIKERKI 262

Query: 239 VTINIKKGTLDGDKIVLKGEADE------DLESTEVGDLVIKIQEVKEPQYDIV-RNGYD 291
             + + KG   G  IVL GEADE       +E    GD+VI I +VK+ ++  V R G D
Sbjct: 263 FDVEVSKGMCHGQTIVLPGEADELIKTSFGVEKVIPGDVVITIDQVKDSKFHRVNRYGCD 322

Query: 292 LIIKK-QIDLADAICG----FDEKPLMETYDGRVLKWSSKRGKVIRPNDIVRIQNEGWPR 346
           L++    IDL+ ++CG     D  P      G++LK S   G++I PN +  I+  G P+
Sbjct: 323 LVMGSCSIDLSTSLCGGDIYIDGHP-----SGKLLKVSIVPGELIGPNCLKSIEGMGMPK 377

Query: 347 REDANDNNTLLKNGDLYVIVDIVFP 371
               +D       G+LY+   + +P
Sbjct: 378 Y--GHDGG----KGNLYIQFQLEYP 396

 Score = 53.5 bits (127), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 30/70 (42%), Positives = 42/70 (60%), Gaps = 8/70 (11%)

Query: 4  YGLLGVGQDASQDEIKRAYRKLALRHHPDKARGNEGGEDSSDDLPDVDFKEVTAAYQVLS 63
          Y  L V  DA+  EIKRAY+ +AL++HPDK   N   ED+ +      F+EV  AY++L+
Sbjct: 8  YDTLKVSPDATISEIKRAYKVMALKYHPDK---NHHSEDAKN-----KFQEVCKAYEILA 59

Query: 64 DASLRAEYDQ 73
          D   R  YD+
Sbjct: 60 DEDKRVMYDR 69

>Kwal_26.9024 s26 (1044497..1045624) [1128 bp, 375 aa] {ON} YMR214W
           (SCJ1) - dnaJ homolog [contig 68] FULL
          Length = 375

 Score = 87.4 bits (215), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 110/381 (28%), Positives = 159/381 (41%), Gaps = 53/381 (13%)

Query: 2   DYYGLLGVGQDASQDEIKRAYRKLALRHHPDKARGNEGGEDSSDDLPDVDFKEVTAAYQV 61
           DYYG+LGV +DAS  EIK AYR+L+ + HPDK   N G ED+        F EV  AY+V
Sbjct: 25  DYYGILGVSKDASDKEIKSAYRQLSKKFHPDK---NPGDEDAHH-----KFIEVGEAYEV 76

Query: 62  LSDASLRAEYDQKLAFEAQPYXXXXXXXXXXXXXXXXH------PGHRSGFDSGRGARRY 115
           LSD   R  YDQ  A   +                  H           G   G G  R 
Sbjct: 77  LSDDQKRQIYDQHGAEALKNGGPGGPGGPGGGFGGGFHDPMDIFEQMFGGHRGGGGRGRP 136

Query: 116 KSDDIEIDLKVKTSELYRGXXXXXXXXXXXXCQRCDGTGWKSHASIVKKKTAKFFWNVCE 175
           +  ++E   ++   + Y+G            C+ C G+G +        KT       C 
Sbjct: 137 RGHNLEAREELTLKQYYQGTSLDFTLNLNDFCENCHGSGSQD------GKTTH-----CS 185

Query: 176 GCEGQGVRQRLRQLAPGFVTTELIE--CRQCGGKGKLRNLPKSEKNKCPDCITSGTVGMV 233
            C GQGV  ++ ++ P    T+ I+  C  C GKG++       KNKC  C  +    + 
Sbjct: 186 ECRGQGVVIQVVRMGP---LTQKIQQMCGACQGKGQVI------KNKCKRCHGA---KVE 233

Query: 234 EENKVVTINIKKGTLDGDKIVLKGEADE--DLESTEVGDLVIKIQEVKEPQYDIVRNGYD 291
            + K   +++  G       V  GEAD+  D +S   GD+ IK  E         R G  
Sbjct: 234 RKAKHFHVDVPAGAPRDFVDVKAGEADKGPDFDS---GDVFIKFSESSRDNMGYRRRGPH 290

Query: 292 LIIKKQIDLADAICGFDEKPLMETYD-GRVLKWSSKRGKVIRPNDIVRIQNEGWPRREDA 350
           L   + + L +A+ G   K  +E +D  + LK    +G  +R  +I R+   G P     
Sbjct: 291 LYRTEVLSLKEALLG-GWKREIEFFDPNKKLKLQRGQGVPVRNGEIERVPGFGMPTGGHG 349

Query: 351 NDNNTLLKNGDLYVIVDIVFP 371
                  K+GDL+V   +V P
Sbjct: 350 -------KHGDLFVDYVVVIP 363

>Suva_14.262 Chr14 (480056..481666) [1611 bp, 536 aa] {ON} YNL077W
           (REAL)
          Length = 536

 Score = 88.2 bits (217), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 71/263 (26%), Positives = 117/263 (44%), Gaps = 40/263 (15%)

Query: 119 DIEIDLKVKTSELYRGXXXXXXXXXXXXCQRCDGTGWKSHASIVKKKTAKFFWNVCEGCE 178
           DI+  LK    ELY G            C  C+G G       ++K T       C+ C+
Sbjct: 189 DIKHTLKCTLRELYMGKTAKLGLNRTRICHVCEGHGG------LQKYT-------CKTCK 235

Query: 179 GQGVRQRLRQLAPGFVTTELIECRQCGGKGKLRNLPKSEKNKCPDCITSGTVGMVEENKV 238
           GQGV+ + + + P  V +    C  CGG G    +    K+ C  C     +G +++ K+
Sbjct: 236 GQGVQTQTKCMGP-LVQSWSQTCADCGGAG----IFVESKDICQQC---QGLGFIKQRKI 287

Query: 239 VTINIKKGTLDGDKIVLKGEADEDL------ESTEVGDLVIKIQEVKEPQYDIVRNGYDL 292
           + + ++ GT     IVL GE DE +      E    GD+VI I  +K+P++ +  N   +
Sbjct: 288 LQVTVQPGTSHNQLIVLTGEGDEVISKGGGHEKVIPGDVVITILRLKDPKFQVTDNCSLI 347

Query: 293 IIKKQIDLADAICG----FDEKPLMETYDGRVLKWSSKRGKVIRPNDIVRIQNEGWPRRE 348
             K ++DL  ++CG     +  P      G+++K     G+V++P+    I+  G P+  
Sbjct: 348 YKKCKVDLMTSLCGGIVYIEGHP-----SGKLIKLDIIPGEVLKPSCFKTIEGMGMPKF- 401

Query: 349 DANDNNTLLKNGDLYVIVDIVFP 371
               N      G LYV  D+ +P
Sbjct: 402 ---INGVRSGFGHLYVKFDVSYP 421

 Score = 55.1 bits (131), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 33/70 (47%), Positives = 40/70 (57%), Gaps = 8/70 (11%)

Query: 4  YGLLGVGQDASQDEIKRAYRKLALRHHPDKARGNEGGEDSSDDLPDVDFKEVTAAYQVLS 63
          Y  L V   AS  EIK+AYR  ALR+HPDK   N   E+S        F+E+  AY+VL 
Sbjct: 8  YDSLNVTTTASTSEIKKAYRNAALRYHPDK---NNHTEESKR-----KFQEICQAYEVLK 59

Query: 64 DASLRAEYDQ 73
          D  LR+ YDQ
Sbjct: 60 DNHLRSLYDQ 69

>TPHA0D00550 Chr4 complement(95500..96960) [1461 bp, 486 aa] {ON}
           Anc_8.61 YFL016C
          Length = 486

 Score = 87.0 bits (214), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 103/391 (26%), Positives = 157/391 (40%), Gaps = 71/391 (18%)

Query: 2   DYYGLLGVGQDASQDEIKRAYRKLALRHHPDKARGNEGGEDSSDDLPDVDFKEVTAAYQV 61
           D Y  LGV +DAS  +IKRAY KLA ++HPD  +  E G D +       F  +  AY++
Sbjct: 48  DPYKTLGVSRDASPSDIKRAYYKLAKKYHPDINK--EPGADKT-------FHNLQNAYEI 98

Query: 62  LSDASLRAEYDQ--KLAFEAQ----------PYXXXXXXXXXX----------XXXXXXH 99
           LSD   + +YDQ    AF+            P+                           
Sbjct: 99  LSDEKKKLQYDQYGSSAFDQNGNANGAGGFNPFGGGASASGFADFGGLNFEDLFGAAFGR 158

Query: 100 PGHRSGFDSG------RGARRYKSDDIEIDLKVKTSELYRGXXXXXXXXXXXX-CQRCDG 152
            G R+G D+G         R Y+ D IEI   V   +   G             C  C G
Sbjct: 159 SGFRNGGDAGGFNGRANIVREYQGDSIEIQHVVSFKDAVFGLNNVSLKYKSLDPCGTCHG 218

Query: 153 TGWKSHASIVKKKTAKFFWNVCEGCEGQGVRQRLRQLAPGFVTTELIECRQCGGKGKLRN 212
           +G K +    K+KT       C  C G G +  ++    GF       C  C G+G    
Sbjct: 219 SGLK-NGEQHKRKT-------CSYCNGTGTQVHVKS---GFQMAS--TCMHCHGEG---- 261

Query: 213 LPKSEKNKCPDCITSGTVGMVEENKVVTINIKKGTLDGDKIVLKGEAD-------EDLES 265
              + ++ C  C   G    +   K + +N   G  DGD I + GE         E+ +S
Sbjct: 262 TTIAREDTCSACDGDGV--KINSKKSLNVNFPSGLSDGDVIRIPGEGSYPNIAVGENDKS 319

Query: 266 TEV--GDLVIKIQEVKEPQYDIVRNGYDLIIKKQIDLADAICGFDEKPLMETYDGRVLKW 323
            ++  GDL+++I+   +P++  V+N YD+   K+I +  A  G   +  +ET DG+ ++ 
Sbjct: 320 IKLSRGDLLVRIRVKSDPKF-FVKNKYDIWTIKEIPITTAALGGTVE--IETVDGKNIRL 376

Query: 324 SSKRGKVIRPNDIVRIQNEGWPRREDANDNN 354
               G   + + +  I N G P R      N
Sbjct: 377 KVISG--TQHDQVTSIPNMGIPYRNGTGRGN 405

>Suva_13.397 Chr13 (675784..676911) [1128 bp, 375 aa] {ON} YMR214W
           (REAL)
          Length = 375

 Score = 85.1 bits (209), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 92/386 (23%), Positives = 160/386 (41%), Gaps = 63/386 (16%)

Query: 2   DYYGLLGVGQDASQDEIKRAYRKLALRHHPDKARGNEGGEDSSDDLPDVDFKEVTAAYQV 61
           DYY +L +G+DAS+ EIK AYR+L+ ++HPDK  G+        D     F E+  AY+V
Sbjct: 23  DYYAILDIGKDASEKEIKSAYRQLSKKYHPDKNAGS--------DEAHHKFIEIGEAYEV 74

Query: 62  LSDASLRAEYDQKLAFEAQPYXXXXXXXXXXXXXXXXHPGHRSGFD-------------- 107
           LSD   +  YDQ   F A                    P     FD              
Sbjct: 75  LSDPEKKKIYDQ---FGADAVKNGGGGAGGPGGGGFHDP-----FDIFERMFQGGQGGPG 126

Query: 108 -SGRGARRYKSDDIEIDLKVKTSELYRGXXXXXXXXXXXXCQRCDGTGWKSHASIVKKKT 166
                 +R +   I++   +   + Y G            C  C G+G           +
Sbjct: 127 GGFGQRQRQRGPTIKVHENLSLKQFYSGTSIEFTLSLNDECDGCHGSG-----------S 175

Query: 167 AKFFWNVCEGCEGQGVRQRLRQLAPGFVTTELIE-CRQCGGKGKLRNLPKSEKNKCPDCI 225
           A      C  C+G+G+  ++ ++  G +T ++ + C +C G G++       KN+C  C 
Sbjct: 176 ADGKLAQCPDCQGRGIIVQVVRM--GIMTQQIQQICGRCAGTGQVI------KNQCKTCH 227

Query: 226 TSGTVGMVEENKVVTINIKKGTLDGDKIVLKGEADEDLESTEVGDLVIKIQEVKEPQYDI 285
                 + ++NK   +++  G          GEA++  +  + GDLVI+ +E+       
Sbjct: 228 GK---KVTKKNKFFHVDVPPGAPRNYMDTRAGEAEKGPD-FDAGDLVIEFREMDTENMGY 283

Query: 286 VRNGYDLIIKKQIDLADAICGFDEKPLMETYDGRVLKWSSKRGKVIRPNDIVRIQNEGWP 345
            R G++L   + +  A+A+ G  E+ +    + + +K S     V+   +I  ++  G P
Sbjct: 284 RRRGHNLYRTEVLSAAEALYGGWERTIEFLDENKPVKLSRPAHAVVSTGEIEVVKGFGMP 343

Query: 346 RREDANDNNTLLKNGDLYVIVDIVFP 371
           +   + D      +GDLY+   +V P
Sbjct: 344 K--GSRD------HGDLYIDYVVVMP 361

>TPHA0G00630 Chr7 complement(118713..119894) [1182 bp, 393 aa] {ON}
           Anc_8.730 YMR214W
          Length = 393

 Score = 85.5 bits (210), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 100/394 (25%), Positives = 161/394 (40%), Gaps = 67/394 (17%)

Query: 2   DYYGLLGVGQDASQDEIKRAYRKLALRHHPDKARGNEGGEDSSDDLPDVDFKEVTAAYQV 61
           DYY +LG+ ++AS+  IK AYR+L+ ++HPDK + +E   +         F E+  AY+V
Sbjct: 29  DYYKILGIPKEASEKAIKSAYRQLSKKYHPDKNQNDEEAHNH--------FIEIGEAYEV 80

Query: 62  LSDASLRAEYDQKLAFEAQPYXXXXXXXXXXXXXXXXHPGHRSGFDSGRGA--------- 112
           LSD   R  YDQ   F +  +                   H   FD              
Sbjct: 81  LSDPEKRRTYDQ---FGSDAFQNGGQGQGGPGGPGGPGGFHDP-FDLFNQMFGGNKGNFG 136

Query: 113 -------------RRYKSDDIEIDLKVKTSELYRGXXXXXXXXXXXXCQRCDGTGWKSHA 159
                        RR K+  I++   +   E + G            C  C G+G  S  
Sbjct: 137 GFGGFGGGGFADDRRRKAQSIQVTYPLSLREYFTGANVNFQMDFKDTCDHCKGSG--SED 194

Query: 160 SIVKKKTAKFFWNVCEGCEGQGVRQRLRQLAPGFVTTEL-IECRQCGGKGKLRNLPKSEK 218
             V K         C+ C G G   ++ ++ P  VT ++  +C +C G G       + K
Sbjct: 195 GKVDK---------CKECGGNGFVVQVIRMGP--VTQQMHTQCPKCHGAGS------TIK 237

Query: 219 NKCPDCITSGTVGMVEENKVVTINIKKGT-LDGDKIVLKGEADEDLESTEVGDLVIKIQE 277
           N C  C       +V ++K + + +  G   D  KIV  G  D++L + E GDL+++ QE
Sbjct: 238 NHCKKCHGQK---LVTKSKEINVKVPAGAPRDFLKIVENG-GDKEL-NAEAGDLLVQFQE 292

Query: 278 VKEPQYDIVRNGYDLIIKKQIDLADAICGFDEKPLMETYDGRVLKWSSKRGKVIRPNDIV 337
           + +      R G DL   + +   DA+ G   + +      R +K S K G  +   +I 
Sbjct: 293 IAQNNLGYRRRGNDLFRTEALVFKDAMEGGWNRTIPFFDPKRDVKISRKPGIPVLNKEIE 352

Query: 338 RIQNEGWPRREDANDNNTLLKNGDLYVIVDIVFP 371
           ++   G P +   +D     + GDLY+   I+ P
Sbjct: 353 KLVGFGMPIQ--GSD-----RFGDLYIDYVIIVP 379

>KLTH0D12496g Chr4 (1020286..1021413) [1128 bp, 375 aa] {ON} similar
           to uniprot|P25303 Saccharomyces cerevisiae YMR214W SCJ1
           dnaJ homolog
          Length = 375

 Score = 84.0 bits (206), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 101/380 (26%), Positives = 158/380 (41%), Gaps = 50/380 (13%)

Query: 2   DYYGLLGVGQDASQDEIKRAYRKLALRHHPDKARGNEGGEDSSDDLPDVDFKEVTAAYQV 61
           DYY +LGV +DAS+ EIK AYR+L+ ++HPDK  G+E             F EV  AY+V
Sbjct: 24  DYYAILGVSKDASEKEIKSAYRQLSKKYHPDKNPGDETAHHK--------FIEVGEAYEV 75

Query: 62  LSDASLRAEYDQKLAFEAQPYXXXXXXXXXXXXXXXXHPGH--RSGFDSGRGAR------ 113
           LSD   R  Y+Q  A EA                      H     F+   GA+      
Sbjct: 76  LSDDQKRQIYNQYGA-EALKNGGPGGSGGPGGPGGFGGGFHDPMDIFEQMFGAQRGGGGR 134

Query: 114 -RYKSDDIEIDLKVKTSELYRGXXXXXXXXXXXXCQRCDGTGWKSHASIVKKKTAKFFWN 172
            R +  ++E   ++   E Y+G            C  C GTG +        KT +    
Sbjct: 135 GRPRGHNLEAREEITLKEYYQGTSLDFTLNLNDFCDNCKGTGSQD------GKTTR---- 184

Query: 173 VCEGCEGQGVRQRLRQLAPGFVTTELIE-CRQCGGKGKLRNLPKSEKNKCPDCITSGTVG 231
            C  C+GQGV  ++ ++ P  +T ++ + C  C GKG++       KNKC  C  +    
Sbjct: 185 -CSDCQGQGVVIQIIRMGP--ITQQIQQMCGACQGKGQII------KNKCKQCHGA---K 232

Query: 232 MVEENKVVTINIKKGTLDGDKIVLKGEADEDLESTEVGDLVIKIQEVKEPQYDIVRNGYD 291
           +  + K   +++  G       V  GEAD+  +  + GD+ IK  E         R G  
Sbjct: 233 VERKTKHFHVDVPAGAPRDFVDVKNGEADKGPD-FDAGDVYIKFSESSRDNMGYRRRGVH 291

Query: 292 LIIKKQIDLADAICGFDEKPLMETYDGRVLKWSSKRGKVIRPNDIVRIQNEGWPRREDAN 351
           L   + + L +A+ G  ++ +      + +K     G  +R  +  R+   G P+     
Sbjct: 292 LHRTEVLTLKEALQGGWKREIEFLDHTKKVKLHRDAGVPVRHGETERVPGFGMPK----- 346

Query: 352 DNNTLLKNGDLYVIVDIVFP 371
           D       GDL+V   ++ P
Sbjct: 347 DGRHF---GDLFVDYVVLTP 363

>KLLA0C07260g Chr3 complement(632987..634093) [1107 bp, 368 aa] {ON}
           similar to uniprot|P25303 Saccharomyces cerevisiae
           YMR214W SCJ1 dnaJ homolog
          Length = 368

 Score = 83.2 bits (204), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 101/386 (26%), Positives = 159/386 (41%), Gaps = 46/386 (11%)

Query: 2   DYYGLLGVGQDASQDEIKRAYRKLALRHHPDKARGNEGGEDSSDDLPDVDFKEVTAAYQV 61
           DYY +LGV + AS+ EIK AYR+L+ ++HPDK  GN        D     F EV  AY V
Sbjct: 20  DYYAILGVDKQASEKEIKSAYRQLSKKYHPDKNPGN--------DEAHHHFIEVGEAYDV 71

Query: 62  LSDASLRAEYDQKLAFEAQPYXXXXXXXXXXXXXXXXHPGHRSG---FDSGRGARRYKSD 118
           LSD   R  YD+  A   +                        G   ++  RG  R ++ 
Sbjct: 72  LSDPEKRQIYDRHGADALKNGHPGGPGGGNGFHDPFDLFEQMFGSNMYNRARGKPRGQNL 131

Query: 119 DIEIDLKVKTSELYRGXXXXXXXXXXXXCQRCDGTGWKSHASIVKKKTAKFFWNVCEGCE 178
            +  D+ +KT   Y G            C  CDG+G +   +             C  C 
Sbjct: 132 QVNHDISLKT--FYLGTEFEFTLNLNDICDACDGSGSEDGKT-----------ETCPDCG 178

Query: 179 GQGVRQRLRQLAPGFVTTELIE-CRQCGGKGKLRNLPKSEKNKCPDCITSGTVGMVEENK 237
           G G  Q ++    G +   + + C +C G+G+L       K+ C  C     V +V+++K
Sbjct: 179 GSG--QIMKVFRAGPIEQRVRQPCSRCQGRGQLI------KHVCKKC---KGVKVVQKSK 227

Query: 238 VVTINIKKGTLDGDKIVLKGEADEDLESTEVGDLVIKIQEVKEPQYDIVRNGYDLIIKKQ 297
           V T  ++ G       V++G++ E     E GDL    +E ++      R G  L   + 
Sbjct: 228 VFTAKVEPGMERNHIHVMQGQS-EKHPDIEPGDLYQYFRESEKDSMGYRRRGNTLYRTEI 286

Query: 298 IDLADAICGFDEKPLMETYDG-RVLKWSSKRGKVIRPNDIVRIQNEGWPRREDANDNNTL 356
           +   +A+ G  E+ + E +D  + L  S   G  ++  +   I++ G P    A D    
Sbjct: 287 LSFKEALQGGWERNI-EFFDKEKSLVLSRPVGHTVQNGETEVIKSFGMP-IPSATD---- 340

Query: 357 LKNGDLYVIVDIVFPPDNWTMEVNDY 382
            K GDL +I  ++  P  W+     Y
Sbjct: 341 -KFGDL-IIDYVILLPGEWSTSSKGY 364

>NCAS0B00530 Chr2 (79130..80257) [1128 bp, 375 aa] {ON} Anc_8.730
          Length = 375

 Score = 82.8 bits (203), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 97/386 (25%), Positives = 158/386 (40%), Gaps = 61/386 (15%)

Query: 2   DYYGLLGVGQDASQDEIKRAYRKLALRHHPDKARGNEGGEDSSDDLPDVDFKEVTAAYQV 61
           DYY +LG+ +DA+  EIK AYR+L+ + HPDK  GNE             F EV  AY+V
Sbjct: 21  DYYQILGIAKDATDKEIKSAYRQLSKKFHPDKNPGNEDAHQK--------FIEVGEAYEV 72

Query: 62  LSDASLRAEYDQKLAFEAQ---------------PYXXXXXXXXXXXXXXXXHPGHRSGF 106
           LSD   R  +DQ  A   +               P+                  G R   
Sbjct: 73  LSDPQKRQTFDQFGADAVKNGGQGQPGGGAQFHDPFDIFEQMFGGQGGGGNPFGGQRQ-- 130

Query: 107 DSGRGARRYKSDDIEIDLKVKTSELYRGXXXXXXXXXXXXCQRCDGTGWKSHASIVKKKT 166
              RG      ++I +       + Y G            C  C GTG     S   K T
Sbjct: 131 -KPRGPNIMAREEISL------KDYYTGYELNFTLNVNDLCDHCHGTG-----SDDGKLT 178

Query: 167 AKFFWNVCEGCEGQGVRQRLRQLAPGFVTTELIE-CRQCGGKGKLRNLPKSEKNKCPDCI 225
                  C  C+G+GV  +L ++  G +T ++ + C +CGGKG+L       K +C  C 
Sbjct: 179 P------CPDCQGRGVIIQLIRM--GMMTQQIQQMCGRCGGKGQLF------KKQCRKCH 224

Query: 226 TSGTVGMVEENKVVTINIKKGTLDGDKIVLKGEADEDLESTEVGDLVIKIQEVKEPQYDI 285
            +    ++ + K   + + KG       V  GEAD++ +  E GDL+I+  E  +     
Sbjct: 225 GN---KVMPQKKEFQVKLPKGAKRHYMDVKHGEADKNPD-LEAGDLLIEFNENDKSNMGY 280

Query: 286 VRNGYDLIIKKQIDLADAICGFDEKPLMETYDGRVLKWSSKRGKVIRPNDIVRIQNEGWP 345
            R G +L   + +++ +A+ G  ++ +      + L+   +   V+   ++ RI   G P
Sbjct: 281 RRRGQNLYRTEVLNVTEALYGGWQREIPFLDPKKKLQVGRESNIVVSHGEVERIPGFGMP 340

Query: 346 RREDANDNNTLLKNGDLYVIVDIVFP 371
             +   +       GDL++   ++ P
Sbjct: 341 TGKGKKET-----FGDLFIDYVVIMP 361

>CAGL0F03729g Chr6 complement(362972..364057) [1086 bp, 361 aa] {ON}
           similar to uniprot|P25303 Saccharomyces cerevisiae
           YMR214w SCJ1
          Length = 361

 Score = 81.3 bits (199), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 99/385 (25%), Positives = 155/385 (40%), Gaps = 50/385 (12%)

Query: 2   DYYGLLGVGQDASQDEIKRAYRKLALRHHPDKARGNEGGEDSSDDLPDVDFKEVTAAYQV 61
           DYY +LG+ +DAS  EIK AYR+L+ ++HPDK  G+E             F EV  AY +
Sbjct: 20  DYYAILGLSKDASDKEIKSAYRQLSKKYHPDKNPGDEEAHHK--------FIEVGEAYDI 71

Query: 62  LSDASLRAEYDQKLA--FEAQPYXXXXXXXXXXXXXXXXHPGHRSGFDSGRGARRY-KSD 118
           L D   R  YD   A  F+                      G + G     G R+  +S 
Sbjct: 72  LGDPEKRKTYDVHGADAFKNGGQGQRGGGFHDPFDMFEQMFGRQGG-----GFRQTQRSQ 126

Query: 119 DIEIDLKVKTSELYRGXXXXXXXXXXXXCQRCDGTGWKSHASIVKKKTAKFFWNVCEGCE 178
           + ++  +V   E Y G            C  C G+G           +A     VC  C+
Sbjct: 127 NYQVRNQVSLKEFYSGGEVEFEIPLNDICDSCHGSG-----------SADGKVKVCPACQ 175

Query: 179 GQGVRQRLRQLAPGFVTTELIECRQCGGKGKLRNLPKSEKNKCPDCITSGTVGMVEENKV 238
           G+GV  ++ ++ P       I  +     G+     K+ +N C  C       +V +NK 
Sbjct: 176 GRGVVVQVIRMGP-------ITQQIQQQCGQCGGKGKTIENPCKTCKGHK---VVRKNKP 225

Query: 239 VTINIKKGTLDGDKIVLKGEADE--DLESTEVGDLVIKIQEVKEPQYDIVRNGYDLIIKK 296
                  G          GE+D+  D+ES   GD++I+  E ++      R G +L   +
Sbjct: 226 FHFEFPGGIPRNHIDKKSGESDKSPDMES---GDIIIEYNESEKENLGYRRRGNNLYRTE 282

Query: 297 QIDLADAICGFDEKPLMETYDGRVLKWSSKRGKVIRPNDIVRIQNEGWPRREDANDNNTL 356
            I   +AI G   + +    + + +K S  +G ++   DI RI+  G P     N     
Sbjct: 283 IITANEAINGGWTREIEFLDEKKKVKLSRPKGSIVNNGDIERIKGFGMPIMGSKN----- 337

Query: 357 LKNGDLYVIVDIVFPPDNWTMEVND 381
              GDLY+   +V  P + T  ++D
Sbjct: 338 --FGDLYIDY-VVLVPKSQTSPIDD 359

>TDEL0B03790 Chr2 complement(681870..682991) [1122 bp, 373 aa] {ON}
           Anc_8.730 YMR214W
          Length = 373

 Score = 81.3 bits (199), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 93/386 (24%), Positives = 155/386 (40%), Gaps = 61/386 (15%)

Query: 2   DYYGLLGVGQDASQDEIKRAYRKLALRHHPDKARGNEGGEDSSDDLPDVDFKEVTAAYQV 61
           DYY +LG+ +DAS  EIK +YR+L+ + HPDK  G+E             F E+  AY+V
Sbjct: 21  DYYAILGLNKDASDKEIKSSYRQLSKKFHPDKNPGDEEAHHK--------FIEIGEAYEV 72

Query: 62  LSDASLRAEYDQKLAFEAQPYXXXXXXXXXXXXXXXXHPGHRSGFD-------------- 107
           LSD   R  +DQ        Y                  G    FD              
Sbjct: 73  LSDPEKRKIFDQ--------YGADALKNGGPGGPGGGGGGFNDPFDIFEQMFNRGGGGGG 124

Query: 108 -SGRGARRYKSDDIEIDLKVKTSELYRGXXXXXXXXXXXXCQRCDGTGWKSHASIVKKKT 166
                 +R +  ++++  ++   E Y G            C  CDGTG          K 
Sbjct: 125 GGFGRMQRPRGHNLKVREQLSLKEYYTGATLEFTLALNDICDHCDGTGS------ADGKV 178

Query: 167 AKFFWNVCEGCEGQGVRQRLRQLAPGFVTTELIE-CRQCGGKGKLRNLPKSEKNKCPDCI 225
           AK     C  C+G+GV  ++ ++  G +T ++ + C +CGGKG +       KN C  C 
Sbjct: 179 AK-----CSDCQGRGVVIQVIRM--GMMTQQIQQMCGRCGGKGSVI------KNHCKTCH 225

Query: 226 TSGTVGMVEENKVVTINIKKGTLDGDKIVLKGEADEDLESTEVGDLVIKIQEVKEPQYDI 285
            S    +V++ K   + +  G          GE+D+  +  + GD+ I+  E        
Sbjct: 226 GS---KVVKKQKPFHVEVPPGAARHYTETRSGESDKGAD-FDAGDVFIEFNEKTTNNLGY 281

Query: 286 VRNGYDLIIKKQIDLADAICGFDEKPLMETYDGRVLKWSSKRGKVIRPNDIVRIQNEGWP 345
            R G  L   + +   +A+ G  ++ +    + + +K +  +  V+   ++ RI   G P
Sbjct: 282 RRRGPHLYRTEVLSAREALKGDWQREVEFLDEKKKVKIARAKNVVVHNGEVERIPGFGMP 341

Query: 346 RREDANDNNTLLKNGDLYVIVDIVFP 371
           +    N  +     GDL++   +V P
Sbjct: 342 Q---PNGKHAF---GDLFIEYVVVMP 361

>NDAI0F02450 Chr6 complement(585345..586937) [1593 bp, 530 aa] {ON}
           Anc_2.218
          Length = 530

 Score = 81.6 bits (200), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 70/294 (23%), Positives = 127/294 (43%), Gaps = 50/294 (17%)

Query: 119 DIEIDLKVKTSELYRGXXXXXXXXXXXXCQRCDGTGWKSHASIVKKKTAKFFWNVCEGCE 178
           DI+  L     ELY+G            C  C+G G  +               +C  C+
Sbjct: 172 DIKHVLNCTLKELYQGKKCKLGLNRTRSCHSCNGMGGMNTI-------------ICNECQ 218

Query: 179 GQGVRQRLRQLAPGFVTTELIECRQCGGKGKLRNLPKSEKNKCPDCITSGTVGMVEENKV 238
           G+G+    + L P  V +    C  C G G   +     ++ C +C   G    + E  +
Sbjct: 219 GKGINTETKMLGP-MVQSWSSTCFNCSGMGYFID----SQSGCKECQGEG---YLRERTI 270

Query: 239 VTINIKKGTLDGDKIVLKGEADEDL-------ESTEVGDLVIKIQEVK------------ 279
            T+ +K G  +  KIVLKGEAD+ +       E    GD++I I +++            
Sbjct: 271 FTVTVKPGMRNNQKIVLKGEADQVMLVGKLNKEKVIPGDVIIVINQIEGKSWKNDSNIDQ 330

Query: 280 -----EPQYDIVRNGYDLIIKK-QIDLADAICGFDEKPLMETYDGRVLKWSSKRGKVIRP 333
                +  ++I+ N  DL+++  QIDL  ++CG  E  +     G+++K      ++++P
Sbjct: 331 GENKNKFHFEII-NEKDLLLRNCQIDLITSLCG-GEIYIKNHPSGKLIKLDIIPSEILKP 388

Query: 334 NDIVRIQNEGWPR--REDANDNNTLLKNGDLYVIVDIVFPPDNWTMEVNDYRAV 385
           + +  ++N G PR   ++ N+    L NGDLY+   + +P       ++  R++
Sbjct: 389 DCLKCVENLGMPRYIEDETNNGEEYLPNGDLYIQFKVKYPTKLENETIDKLRSI 442

 Score = 50.8 bits (120), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 29/69 (42%), Positives = 40/69 (57%), Gaps = 8/69 (11%)

Query: 4  YGLLGVGQDASQDEIKRAYRKLALRHHPDKARGNEGGEDSSDDLPDVDFKEVTAAYQVLS 63
          Y +L V   A+  EIK AY+KLAL++HPDK   N   E+S      + F+E+  AY+VL 
Sbjct: 15 YSILQVPTAATLFEIKNAYKKLALKYHPDK---NNHSEESK-----LKFQEICKAYEVLH 66

Query: 64 DASLRAEYD 72
          D   +  YD
Sbjct: 67 DKDKKLLYD 75

>KAFR0A04160 Chr1 (836039..837175) [1137 bp, 378 aa] {ON} Anc_8.730
           YMR214W
          Length = 378

 Score = 80.9 bits (198), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 97/386 (25%), Positives = 159/386 (41%), Gaps = 57/386 (14%)

Query: 2   DYYGLLGVGQDASQDEIKRAYRKLALRHHPDKARGNEGGEDSSDDLPDVDFKEVTAAYQV 61
           DYY +LGV +DA+  EIK AYR+L+ ++HPDK  G+E   +         F EV  AY V
Sbjct: 22  DYYKILGVNKDANDKEIKSAYRQLSKKYHPDKNPGDEEAHNK--------FIEVGEAYDV 73

Query: 62  LSDASLRAEYDQKLA-------------FEAQPYXXXXXXXXXXXXXXXXHPGHRSGFDS 108
           LSD+  R  YDQ  A                 P+                +P   +    
Sbjct: 74  LSDSEKRNIYDQYGADAIKNGGNGQRPGGGGSPFHDPFEMFEKMFNG---NPFGGAARGG 130

Query: 109 GRGARRYKSDDIEIDLKVKTSELYRGXXXXXXXXXXXXCQRCDGTGWKSHASIVKKKTAK 168
             G  R +  ++ +  +V   + Y G            C++C GTG K    + +     
Sbjct: 131 PGGRGRPRGQNLLLREEVSLMDFYNGREFKYNLQLNDFCEKCHGTGSKD-GKVTR----- 184

Query: 169 FFWNVCEGCEGQGVRQRLRQLAPGFVTTELIE--CRQCGGKGKLRNLPKSEKNKCPDCIT 226
                C  C+G+GV  ++ Q+    + T+ I+  C +C G G++       KN CP C  
Sbjct: 185 -----CPDCQGRGVIVQVIQMG---IMTQQIQHVCDRCSGSGEII------KNPCPHCHG 230

Query: 227 SGTVGMVEENKVVTINIKKGTLDGDKIVLKGEADEDLESTEVGDLVIKIQEVKEPQYDIV 286
                M   +K  T+ +  G       +  GEA++  +  + GDL+ + +E         
Sbjct: 231 HKVAKM---DKEFTVKLPNGAQRNYVDIKHGEAEKGAD-FDAGDLMFEFRENSMNNMGYR 286

Query: 287 RNGYDLIIKKQIDLADAICGFDEKPLMETYDG-RVLKWSSKRGKVIRPNDIVRIQNEGWP 345
           R G  L   + + + +A+ G  E+ L E +D  + +K      +V+   +I  +   G P
Sbjct: 287 RRGDHLYRTEVLSVQEALKGGWEREL-EFFDKDKNVKLKRDANQVVITGEIECVPGFGMP 345

Query: 346 RREDANDNNTLLKNGDLYVIVDIVFP 371
                  N+   K GDL++   I+ P
Sbjct: 346 IL-----NSQGRKFGDLFIDYVILMP 366

>ZYRO0A06226g Chr1 complement(499313..500446) [1134 bp, 377 aa] {ON}
           similar to uniprot|P25303 Saccharomyces cerevisiae
           YMR214W SCJ1 dnaJ homolog
          Length = 377

 Score = 80.1 bits (196), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 91/398 (22%), Positives = 150/398 (37%), Gaps = 81/398 (20%)

Query: 2   DYYGLLGVGQDASQDEIKRAYRKLALRHHPDKARGNEGGEDSSDDLPDVDFKEVTAAYQV 61
           DYY +LG+ +DAS  ++K AYR+L+ ++HPDK  G+E             F EV  AY+V
Sbjct: 19  DYYSILGLNKDASDKDVKSAYRQLSKKYHPDKNPGDESAHQR--------FIEVGEAYEV 70

Query: 62  LSDASLRAEYDQKLA--------------------------FEAQPYXXXXXXXXXXXXX 95
           LSD   R  +DQ  A                          FE Q +             
Sbjct: 71  LSDPEKRGIFDQYGADGLKNGAGGGGGPGGGFGGFHDPFDIFE-QMFNRGGGGGGFGGGF 129

Query: 96  XXXHPGHRSGFDSGRGARRYKSDDIEIDLKVKTSELYRGXXXXXXXXXXXXCQRCDGTGW 155
              H G              K   + +  ++   + Y G            C  C+G+G 
Sbjct: 130 GGMHRG--------------KGPSLRVHEELSLKDYYSGTGVEFELMLNDICDHCEGSGS 175

Query: 156 KSHASIVKKKTAKFFWNVCEGCEGQGVRQRLRQLAPGFVTTELIE--CRQCGGKGKLRNL 213
           +                 C  C GQG+   L Q+    + T+ I+  C +C G+G +   
Sbjct: 176 EDGKV-----------ETCPDCGGQGI---LIQIIRMGIMTQRIQQPCGRCSGRGHII-- 219

Query: 214 PKSEKNKCPDCITSGTVGMVEENKVVTINIKKGTLDGDKIVLKGEADEDLESTEVGDLVI 273
               KN+C  C   G   +V++ K   + +  G       V   EAD+  +  E GD+ +
Sbjct: 220 ----KNQCKAC---GGHKVVKKPKSFQVEVPAGAPRDHVEVRHQEADQSTD-MEAGDIFV 271

Query: 274 KIQEVKEPQYDIVRNGYDLIIKKQIDLADAICGFDEKPLMETYDGRVLKWSSKRGKVIRP 333
           +  E  +      R G  L   + +   +A+ G   + +    D + +K    +G ++  
Sbjct: 272 EFTESDKNNMGYRRRGDHLFRTEVLSAREALAGGWSREIEFLDDAKKVKLQRPKGNIVHH 331

Query: 334 NDIVRIQNEGWPRREDANDNNTLLKNGDLYVIVDIVFP 371
            +I +I   G P+       ++    GDL+V   +V P
Sbjct: 332 GEIEQIPGFGMPK------GSSGKSFGDLFVEYAVVMP 363

>Smik_13.422 Chr13 (679417..680553) [1137 bp, 378 aa] {ON} YMR214W
           (REAL)
          Length = 378

 Score = 79.3 bits (194), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 92/386 (23%), Positives = 155/386 (40%), Gaps = 60/386 (15%)

Query: 2   DYYGLLGVGQDASQDEIKRAYRKLALRHHPDKARGNEGGEDSSDDLPDVDFKEVTAAYQV 61
           DYY +L V +DAS+ EIK AYR+L+ ++HPDK  G+E             F EV  AY V
Sbjct: 23  DYYAILEVDKDASEKEIKSAYRQLSKKYHPDKNSGSEEAHHK--------FIEVGEAYDV 74

Query: 62  LSDASLRAEYDQKLAFEAQPYXXXXXXXXXXXXXXXXHPGHRSGFD-------------- 107
           LSD   +  YDQ  A   +                   P     FD              
Sbjct: 75  LSDPEKKKIYDQFGADAVKNGGGGGGGAGGPGGGGFHDP-----FDIFEHMFQGGHGGPG 129

Query: 108 -SGRGARRYKSDDIEIDLKVKTSELYRGXXXXXXXXXXXXCQRCDGTGWKSHASIVKKKT 166
                 +R +   I++  K+   + Y G            C  C G+G           +
Sbjct: 130 GGFGQRQRQRGPMIKVQEKLSLKQFYSGTSIEFTLSLNDECDVCHGSG-----------S 178

Query: 167 AKFFWNVCEGCEGQGVRQRLRQLAPGFVTTELIE-CRQCGGKGKLRNLPKSEKNKCPDCI 225
           A      C  C+G+GV   ++ L  G +T ++ + C +CGG G++       KN+C  C 
Sbjct: 179 ADGKLAQCPDCQGRGV--IIQVLRMGIMTQQIQQMCGRCGGTGQII------KNQCKTCH 230

Query: 226 TSGTVGMVEENKVVTINIKKGTLDGDKIVLKGEADEDLESTEVGDLVIKIQEVKEPQYDI 285
                 ++++NK   +++  G          GEA++  +  + GDLVI+ +E        
Sbjct: 231 GK---KVIKKNKFFHVDVPPGAPRNYLDTRAGEAEKGPD-FDAGDLVIEFKEKDTENMGY 286

Query: 286 VRNGYDLIIKKQIDLADAICGFDEKPLMETYDGRVLKWSSKRGKVIRPNDIVRIQNEGWP 345
            R G +L   + +   +A+ G  ++ +    + + +K S     V+   +I  ++  G P
Sbjct: 287 RRRGDNLYRTEVLSAEEALYGGWQRTIEFFDENKPVKLSRPAHVVVSNGEIEVLKGFGMP 346

Query: 346 RREDANDNNTLLKNGDLYVIVDIVFP 371
           +            +GDLY+   ++ P
Sbjct: 347 KSGKG--------HGDLYIDYVVIMP 364

>TBLA0E03660 Chr5 (916944..918290) [1347 bp, 448 aa] {ON} Anc_2.218
           YNL077W
          Length = 448

 Score = 79.0 bits (193), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 105/458 (22%), Positives = 174/458 (37%), Gaps = 80/458 (17%)

Query: 4   YGLLGVGQDASQDEIKRAYRKLALRHHPDKARGNEGGEDSSDD-------LPDVDFKEVT 56
           Y  L +   ASQ +IK+AYR  ALR+HPDK   +E  +    D       L D + +++ 
Sbjct: 8   YNALNIPPTASQSDIKKAYRVQALRYHPDKNNESEESKKKFQDISEAYSILRDENQRKMY 67

Query: 57  AAYQVLSDASLRAEYDQKLAFEAQPYXXXXXXXXXXXXXXXXHPGHRSG----------- 105
             Y  ++   ++ +  +       P+                H   +S            
Sbjct: 68  DKYGTVNPTEIQQQNQRTNVPFTDPFGMSAADLFSQFFDTQNHNSGQSNSSPPFGFPFNS 127

Query: 106 ------------------FDSGRGARRYKSDDIEIDLKVKTSELYRGXXXXXXXXXXXXC 147
                             F + +     K  DI  +LK    +LYRG            C
Sbjct: 128 SRNGNGNNNRAADGVFGDFFNTKSRPLQKGPDINHNLKCTIKDLYRGKRSKLRLERSKLC 187

Query: 148 QRCDGTGWKSHASIVKKKTAKFFWNVCEGCEGQGVRQRLRQLAPGFVTTELIECRQCGGK 207
             C G G       VK+       ++C  C G G      +L P  + T    C  C G 
Sbjct: 188 SICKGDGG------VKR-------SMCNQCHGDGNITETTRLGP-MLQTFTHTCNICNGN 233

Query: 208 GKLRNLPKSEKNKCPDCITSGTVGMVEENKVVTINIKKGTLDGDKIVLKGEADEDLESTE 267
           G +       +  C  C     VG   E K+  + I  G  DG +IV   E DE +    
Sbjct: 234 GWV----IISQETCQGC---NGVGFYNEMKIFDVEIYPGMKDGTQIVFNNEGDEIVNKRR 286

Query: 268 V--GDLVIKIQEVKEPQYDIVRNGYDLII-KKQIDLADAICG----FDEKPLMETYDGRV 320
           V  G+++I I E+++ ++  V +G DL     +IDL  ++CG        P     + ++
Sbjct: 287 VIPGNVIIHINEIEDNKFKRVNDGQDLYYWNYEIDLFTSLCGGVIYIKGHP-----NNKL 341

Query: 321 LKWSSKRGKVIRPNDIVRIQNEGWPRREDANDNNTLLKNGDLYVIVDIVFPPDNWTMEVN 380
           +K     G++I    +  +++ G P+    N  N     G LY+   + + P+   ME  
Sbjct: 342 IKVDILPGEIIESGSVKGVESLGMPK----NKGNEY---GILYIQFQVKY-PEKLNME-- 391

Query: 381 DYRAVRNIIPSTINKRESSTSGESI-LNVENINVSEIV 417
             +A+  I+    N ++   + E+I L+ + I V E V
Sbjct: 392 SIKAIEKILLKDENVKQMQKNDENIGLDDDCIEVEEYV 429

>NDAI0G03280 Chr7 complement(769822..771480) [1659 bp, 552 aa] {ON}
           Anc_8.61
          Length = 552

 Score = 79.0 bits (193), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 108/446 (24%), Positives = 169/446 (37%), Gaps = 93/446 (20%)

Query: 2   DYYGLLGVGQDASQDEIKRAYRKLALRHHPDKARGNEGGEDSSDDLPDVD--FKEVTAAY 59
           D Y +LGV   AS  EIK+AY KLA ++HPD  +            PD +  F ++  AY
Sbjct: 79  DPYSVLGVNNSASTSEIKKAYYKLAKKYHPDINK-----------QPDAEKKFHDLQNAY 127

Query: 60  QVLSDASLRAEYD--------------------------------QKLAFEAQPYXXXXX 87
           ++LSD + R +YD                                Q  +    P+     
Sbjct: 128 EILSDENKRKQYDTFGPSAFQDAQQGGAGGPGGGPGGFPGGYPFGQTSSGSGNPFADFGI 187

Query: 88  XXXXXXXXXXXHPGHRSGFDSGRGA----RRYKSDDIEIDLKVKTSELYRGXXXXXXXXX 143
                      +  H +G    R      R +K D IEI   +   +   G         
Sbjct: 188 NFEDLFGAAFGNGPHATGGGRARRQSNIYREFKGDPIEIVHNLNFKDAVFGVQNVNLKFN 247

Query: 144 XX-XCQRCDGTGWKSHASIVKKKTAKFFWNVCEGCEGQGVRQRLRQLAPGFVTTELIECR 202
               C +C G+G   +A    K+T       C  C G G +  +R    GF       C 
Sbjct: 248 SMDPCNKCSGSGLNRNA----KRT------TCPSCHGSGQKVHIRS---GFQMVS--TCN 292

Query: 203 QCGGKGKLRNLPKSEKNKCPDCITSGTVGMVEENKVVTINIKKGTLDGDKIVLKGEADED 262
            C G+G + +     K+ C  C   G    +  NK + +N+  G  DGD I + G+ +  
Sbjct: 293 HCHGEGTIID----SKDICSSCHGDGV--ELNHNKSIDVNLPNGLQDGDVIRVPGQGNYP 346

Query: 263 LESTEV------------GDLVIKIQEVKEPQYDIVRNGYDLIIKKQIDLADAICGFDEK 310
                +            GDL+++++  K+P + I R+ YD+   KQI +  AI G   K
Sbjct: 347 QTGASIDPAMMNSIKLSRGDLLVRVRVNKDPNFSI-RDKYDIWFTKQIPITTAILGGVVK 405

Query: 311 PLMETYDGRVLKWSSKRGKVIRPNDIVRIQNEGWPRREDANDNNTLLKNGDLYVIVDIVF 370
             + T DG  ++     G   + + I+ I N G PR     DN      G++ V   I+ 
Sbjct: 406 --IPTVDGTQIRLKVSPG--TKHDQIISIPNLGVPRSSINKDN-----RGNMKVQYKIIM 456

Query: 371 PPDNWTMEVNDYRAVRNIIPSTINKR 396
                  E   + A+ ++   T+ KR
Sbjct: 457 KTPQSQAEKCLWEALADVTNDTMAKR 482

>YMR214W Chr13 (695350..696483) [1134 bp, 377 aa] {ON}  SCJ1One of
           several homologs of bacterial chaperone DnaJ, located in
           the ER lumen where it cooperates with Kar2p to mediate
           maturation of proteins
          Length = 377

 Score = 77.4 bits (189), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 91/389 (23%), Positives = 155/389 (39%), Gaps = 67/389 (17%)

Query: 2   DYYGLLGVGQDASQDEIKRAYRKLALRHHPDKARGNEGGEDSSDDLPDVDFKEVTAAYQV 61
           DYY +L + +DA++ EIK AYR+L+ ++HPDK  G+E             F EV  AY V
Sbjct: 23  DYYAILEIDKDATEKEIKSAYRQLSKKYHPDKNAGSEEAHQK--------FIEVGEAYDV 74

Query: 62  LSDASLRAEYDQKLAFEAQ------------------PYXXXXXXXXXXXXXXXXHPGHR 103
           LSD   +  YDQ  A   +                  P+                  G R
Sbjct: 75  LSDPEKKKIYDQFGADAVKNGGGGGGPGGPGAGGFHDPFDIFERMFQGGHGGPGGGFGQR 134

Query: 104 SGFDSGRGARRYKSDDIEIDLKVKTSELYRGXXXXXXXXXXXXCQRCDGTGWKSHASIVK 163
                    +R +   I++  K+   + Y G            C  C G+G         
Sbjct: 135 ---------QRQRGPMIKVQEKLSLKQFYSGSSIEFTLNLNDECDACHGSG--------- 176

Query: 164 KKTAKFFWNVCEGCEGQGVRQRLRQLAPGFVTTELIE-CRQCGGKGKLRNLPKSEKNKCP 222
             +A      C  C+G+GV   ++ L  G +T ++ + C +CGG G++       KN+C 
Sbjct: 177 --SADGKLAQCPDCQGRGV--IIQVLRMGIMTQQIQQMCGRCGGTGQII------KNECK 226

Query: 223 DCITSGTVGMVEENKVVTINIKKGTLDGDKIVLKGEADEDLESTEVGDLVIKIQEVKEPQ 282
            C       + ++NK   +++  G          GEA++  +  + GDLVI+ +E     
Sbjct: 227 TCHGK---KVTKKNKFFHVDVPPGAPRNYMDTRVGEAEKGPD-FDAGDLVIEFKEKDTEN 282

Query: 283 YDIVRNGYDLIIKKQIDLADAICGFDEKPLMETYDGRVLKWSSKRGKVIRPNDIVRIQNE 342
               R G +L   + +  A+A+ G  ++ +    + + +K S     V+   ++  ++  
Sbjct: 283 MGYRRRGDNLYRTEVLSAAEALYGGWQRTIEFLDENKPVKLSRPAHVVVSNGEVEVVKGF 342

Query: 343 GWPRREDANDNNTLLKNGDLYVIVDIVFP 371
           G P+             GDLY+   +V P
Sbjct: 343 GMPKGSKG--------YGDLYIDYVVVMP 363

>AER346W Chr5 (1271436..1272539) [1104 bp, 367 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR214W (SCJ1)
          Length = 367

 Score = 77.0 bits (188), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 95/375 (25%), Positives = 155/375 (41%), Gaps = 44/375 (11%)

Query: 2   DYYGLLGVGQDASQDEIKRAYRKLALRHHPDKARGNEGGEDSSDDLPDVDFKEVTAAYQV 61
           DYY +LGV ++A++ +IK AYR+L+ ++HPDK  G        D     +F EV  AY+ 
Sbjct: 21  DYYAILGVDREATEKDIKSAYRQLSKKYHPDKNPG--------DTTAHHNFIEVGEAYEA 72

Query: 62  LSDASLRAEYDQ--KLAFEAQPYXXXXXXXXXXXXXXXXHPGHRSGFDSGRGARRYKSDD 119
           LSD   R  YDQ    A +                              G   RR +S  
Sbjct: 73  LSDPEKRRIYDQYGAEALKNGGGAEGGHGGFHDPFDIFEQMFGGGARFGGGQRRRQRSQS 132

Query: 120 IEIDLKVKTSELYRGXXXXXXXXXXXXCQRCDGTGWKSHASIVKKKTAKFFWNVCEGCEG 179
           +++  ++   + Y G            C  C  TG  S    V++         C  C  
Sbjct: 133 LQVQEELTLRQYYHGTAVEFTLSLNDHCDHCGATG--SQDGKVER---------CTQCSV 181

Query: 180 QGVRQRL-RQLAPGFVTTELIE-CRQCGGKGKLRNLPKSEKNKCPDCITSGTVGMVEENK 237
           +GV  ++ RQ   GF+T +  + C +  G       PK+   KC  C        +++NK
Sbjct: 182 RGVIVQVGRQ---GFMTQQFQQVCPRLLGP-----WPKALPKKCKVCQGHKA---IKKNK 230

Query: 238 VVTINIKKGTLDGDKIVLKGEADEDLESTEVGDLVIKIQEVKEPQYDIVRNGYDLIIKKQ 297
              + +  G       V +GEA E +   + GD+ +K+ E         R G +L   + 
Sbjct: 231 SFRVEVPPGAPRDFVAVQQGEA-EKVPDMDPGDIYVKVFENTRDNMGYRRQGANLFRTEV 289

Query: 298 IDLADAICGFDEKPLMETYD-GRVLKWSSKRGKVIRPNDIVRIQNEGWPRREDANDNNTL 356
           + L +A+ G D K  +E  D  + + +S K+G+ ++  ++ R+   G P  + A      
Sbjct: 290 LSLKEALHG-DWKRELEFLDPSKKVPFSRKKGQTVQHGEVERVPGFGMPLPDSAG----- 343

Query: 357 LKNGDLYVIVDIVFP 371
              GDLYV   ++ P
Sbjct: 344 --FGDLYVDYVVILP 356

>KLLA0D07656g Chr4 (658179..659594) [1416 bp, 471 aa] {ON} similar
           to uniprot|P35191 Saccharomyces cerevisiae YFL016C MDJ1
           Protein involved in folding of mitochondrially
           synthesized proteins in the mitochondrial matrix
           localizes to the mitochondrial inner membrane member of
           the DnaJ family of molecular chaperones
          Length = 471

 Score = 76.6 bits (187), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 84/324 (25%), Positives = 136/324 (41%), Gaps = 56/324 (17%)

Query: 102 HRSGFDSGRGARRYKSDDIEIDLKVKTSELYRGXXXXXXXXX-XXXCQRCDGTGWKSHAS 160
           H +GF      R YK +++ +  +V   +   G             C  CDG+G K+  S
Sbjct: 154 HGAGFGGSDFVREYKGENVTVPFQVSFKDAVFGVKNVKLNYQCYDPCSSCDGSGLKAGHS 213

Query: 161 IVKKKTAKFFWNVCEGCEGQGVRQRLRQLAPGFVTTELIECRQCGGKGKLRNLPKSEKNK 220
                      +VC  C G G +  +R    GF       C+ C G+G        + +K
Sbjct: 214 ----------RSVCPTCHGTGTQVHVR---AGFQMAST--CQTCDGEGST----IKDSDK 254

Query: 221 CPDCITSGTVGMVEENKVVTINIKKGTLDGDKIVLKGEA-------DEDLES---TEVGD 270
           C  C + G    +  NK +T+++  G  DGD I +  +        D  ++S      GD
Sbjct: 255 CGTCHSHGF--KLNSNKTITVDLPHGLQDGDTIRVPNQGSYPGMAIDPSMKSELHLTRGD 312

Query: 271 LVIKIQEVKEPQYDIVRNGYDLIIKKQIDLAD-AICGFDEKPLMETYDGRVLKWSSKRGK 329
           L+I+++  K+ ++  V N YD+I  ++I +   A+ G  E P +E    R LK SS    
Sbjct: 313 LLIRVRVRKDTRFQ-VSNNYDIIYTQEIPITTAALGGVIEVPTVEEEKIR-LKVSSG--- 367

Query: 330 VIRPNDIVRIQNEGWPRREDANDNNTLLKNGDLYVIVDIVF--PPD--------NWTMEV 379
             + + ++RI N+G PR    +        GD+ V   IV   P D              
Sbjct: 368 -TQHDQVIRIPNKGVPRGARGD-------RGDMLVKFKIVIKKPKDETERYLWETLAHLT 419

Query: 380 NDYRAVRNIIPSTINKRESSTSGE 403
           ND  A R I PS  + +++S+S +
Sbjct: 420 NDTTARRTITPSGSSAKDNSSSAD 443

 Score = 35.4 bits (80), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 29/72 (40%), Positives = 44/72 (61%), Gaps = 9/72 (12%)

Query: 2  DYYGLLGVGQDASQDEIKRAYRKLALRHHPDKARGNEGGEDSSDDLPDVDFKEVTAAYQV 61
          D Y +LG+ +++SQ +IK+AY KLA ++HPD  +     EDS        F ++  AY++
Sbjct: 25 DPYKVLGINKNSSQSDIKKAYYKLAKKYHPDINK----EEDSQK-----KFHDLQNAYEI 75

Query: 62 LSDASLRAEYDQ 73
          LSD   R +YDQ
Sbjct: 76 LSDEDKRKQYDQ 87

>TPHA0C02980 Chr3 (652607..654271) [1665 bp, 554 aa] {ON} Anc_2.218
           YNL077W
          Length = 554

 Score = 75.5 bits (184), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 70/284 (24%), Positives = 117/284 (41%), Gaps = 39/284 (13%)

Query: 119 DIEIDLKVKTSELYRGXXXXXXXXXXXXCQRCDGTGWKSHASIVKKKTAKFFWNVCEGCE 178
           DI+  LK   S LY G            C +C G G  +  S             C  C 
Sbjct: 232 DIKHTLKCTLSNLYSGKRSKLRLERTRCCLKCKGFGSLNIKS-------------CSKCN 278

Query: 179 GQGVRQRLRQLAPGFVTTELIECRQCGGKGKLRNLPKSEKNKCPDCITSGTVGMVEENKV 238
           G+G   + ++  P    T    C  CGG G   +     ++ C +C   G    + E K+
Sbjct: 279 GRGSLTQTKKFGP-MTQTFTQTCDGCGGNGTFAD----AQDICNECQGEG---FLNEKKI 330

Query: 239 VTINIKKGTLDGDKIVLKGEADEDL------ESTEVGDLVIKIQEVKEPQYDIVRNGYDL 292
             + I  G  DG  I+L GEADE +      E    GD+++ I  + +P + +V+    L
Sbjct: 331 FEVEITPGMTDGQLIILTGEADEVISTNLGKERVIPGDIILTINLLPDPTFKVVQGADLL 390

Query: 293 IIKKQIDLADAICGFDEKPLMETYDGRVLKWSSKRGKVIRPNDIVRIQNEGWPR------ 346
               +I+L  ++CG     +       ++K +   G++I+   I  ++N G P+      
Sbjct: 391 YANYKINLLTSLCG-GSIYIKNHPSEHLIKINIIPGELIKNGAIKTVENLGMPKIDLSVG 449

Query: 347 -REDANDNNTLLKNGDLYVIVDIVFPPDNWTMEVNDYRAVRNII 389
              D   N   LK G+L +  +IV+P     +E +    ++NI+
Sbjct: 450 HSNDIQANKPTLK-GNLVIHFEIVYPD---MLETDTVIELQNIL 489

 Score = 48.1 bits (113), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 28/70 (40%), Positives = 41/70 (58%), Gaps = 8/70 (11%)

Query: 4  YGLLGVGQDASQDEIKRAYRKLALRHHPDKARGNEGGEDSSDDLPDVDFKEVTAAYQVLS 63
          Y +L V  D+ +  IK+AYR LAL++HPDK   N   E+S        F++++ AY VLS
Sbjct: 8  YDILQVRYDSDESVIKKAYRTLALKYHPDK---NNLSEESKQ-----MFQKISEAYVVLS 59

Query: 64 DASLRAEYDQ 73
          +   R  YD+
Sbjct: 60 NKDKRQMYDK 69

>Skud_13.383 Chr13 (669140..670267) [1128 bp, 375 aa] {ON} YMR214W
           (REAL)
          Length = 375

 Score = 72.8 bits (177), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 92/386 (23%), Positives = 154/386 (39%), Gaps = 63/386 (16%)

Query: 2   DYYGLLGVGQDASQDEIKRAYRKLALRHHPDKARGNEGGEDSSDDLPDVDFKEVTAAYQV 61
           DYY +L + + AS+ EIK AYR+L+ + HPDK   N G E++        F EV  AY V
Sbjct: 23  DYYAILEIDKGASEKEIKSAYRQLSKKFHPDK---NAGSEEAHQ-----KFIEVGEAYDV 74

Query: 62  LSDASLRAEYDQKLAFEAQPYXXXXXXXXXXXXXXXXHPGHRSGFD-------------- 107
           LSD   +  YDQ   F A+                   P     FD              
Sbjct: 75  LSDPEKKKIYDQ---FGAEAVKNGGDGAGGPGAGGFHDP-----FDIFERMFQGGHGGTG 126

Query: 108 -SGRGARRYKSDDIEIDLKVKTSELYRGXXXXXXXXXXXXCQRCDGTGWKSHASIVKKKT 166
                 +R +   I++  K+   + Y G            C  C G+G           +
Sbjct: 127 GGFGQRQRQRGPMIKVQEKLSLKQFYSGSSIEFTLSLNDECDVCHGSG-----------S 175

Query: 167 AKFFWNVCEGCEGQGVRQRLRQLAPGFVTTELIE-CRQCGGKGKLRNLPKSEKNKCPDCI 225
           A      C  C+G+GV   ++ L  G +T ++ + C +CGG G++       KN+C  C 
Sbjct: 176 ADGKLAQCPDCQGRGV--IIQVLRMGIMTQQIQQMCGRCGGTGQVI------KNECKTCH 227

Query: 226 TSGTVGMVEENKVVTINIKKGTLDGDKIVLKGEADEDLESTEVGDLVIKIQEVKEPQYDI 285
            +    + + NK   +++  G          GEA++  +  + GDLVI+ +E        
Sbjct: 228 GN---KVTKRNKFFHVDVPPGAPRNYMDTRAGEAEKGPD-FDAGDLVIEFKEKDSENMGY 283

Query: 286 VRNGYDLIIKKQIDLADAICGFDEKPLMETYDGRVLKWSSKRGKVIRPNDIVRIQNEGWP 345
            R G +L   + + + +A+ G  E+ +    + + +K S      +   +I  ++  G P
Sbjct: 284 RRRGDNLYRTEVLSIEEALYGGWERTIEFLDENKPVKLSRPAYVGVSNGEIEVMKGFGMP 343

Query: 346 RREDANDNNTLLKNGDLYVIVDIVFP 371
           +             GDLY+   ++ P
Sbjct: 344 KGGKG--------YGDLYIDYVVIMP 361

>SAKL0B02068g Chr2 complement(199274..200806) [1533 bp, 510 aa] {ON}
           some similarities with uniprot|P35191 Saccharomyces
           cerevisiae YFL016C MDJ1 Protein involved in folding of
           mitochondrially synthesized proteins in the
           mitochondrial matrix localizes to the mitochondrial
           inner membrane member of the DnaJ family of molecular
           chaperones
          Length = 510

 Score = 71.6 bits (174), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 70/263 (26%), Positives = 111/263 (42%), Gaps = 44/263 (16%)

Query: 113 RRYKSDDIEIDLKVKTSELYRGXXXXXXXXXXX-XCQRCDGTGWKSHASIVKKKTAKFFW 171
           R YK D IEI  ++   +   G             C  C  +G KS AS           
Sbjct: 190 REYKGDSIEITHRISFKDAVFGVKNVNLNYAALDPCNSCHSSGLKSGAS----------R 239

Query: 172 NVCEGCEGQGVRQRLRQLAPGFVTTELIECRQCGGKGKLRNLPKSEKNKCPDCITSGTVG 231
             C GC+G G R  +R    GF       C QC G+G +        + C  C   G V 
Sbjct: 240 TTCPGCQGTGTRVHVRA---GFQMAS--TCTQCDGEGSVIR----GSDMCGTCHGEGVV- 289

Query: 232 MVEENKVVTINIKKGTLDGDKIVLKGEA-------DEDLEST---EVGDLVIKIQEVKEP 281
            +   K + +++  G  DGD I +  E        D  ++++     GDL+++++  K+P
Sbjct: 290 -MNRGKQIKVDLPHGLQDGDAIRISREGSYPHISIDPSMKNSVHLRRGDLLLRVRVDKDP 348

Query: 282 QYDIVRNGYDLIIKKQIDLADAICGFDEKPLMETYDGRVLKWSSKRGKVIRPNDIVRIQN 341
           ++ I +N YD+   ++I L  A  G      + T DG+ ++   K+G   + +D+V I  
Sbjct: 349 RFSI-KNNYDIWFTQEIPLTTAALG--GVVTVPTVDGQQIRLKVKQG--TQHDDVVSIPQ 403

Query: 342 EGWPRREDANDNNTLLKNGDLYV 364
           +G PR        TL   GD+ V
Sbjct: 404 QGVPR-------GTLGSRGDMKV 419

 Score = 34.3 bits (77), Expect = 0.76,   Method: Compositional matrix adjust.
 Identities = 29/72 (40%), Positives = 42/72 (58%), Gaps = 9/72 (12%)

Query: 2   DYYGLLGVGQDASQDEIKRAYRKLALRHHPDKARGNEGGEDSSDDLPDVDFKEVTAAYQV 61
           D Y  LGV Q AS  EIK+AY KLA ++HPD  +     ED+        F ++  AY++
Sbjct: 56  DPYKTLGVSQSASGSEIKKAYYKLAKKYHPDINK----AEDAQK-----KFHDLQNAYEI 106

Query: 62  LSDASLRAEYDQ 73
           LSD + + ++DQ
Sbjct: 107 LSDETKKQQWDQ 118

>YFL016C Chr6 complement(104701..106236) [1536 bp, 511 aa] {ON}
           MDJ1Co-chaperone that stimulates the ATPase activity of
           the HSP70 protein Ssc1p; involved in protein
           folding/refolding in the mitochodrial matrix; required
           for proteolysis of misfolded proteins; member of the
           HSP40 (DnaJ) family of chaperones
          Length = 511

 Score = 71.2 bits (173), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 97/390 (24%), Positives = 149/390 (38%), Gaps = 82/390 (21%)

Query: 2   DYYGLLGVGQDASQDEIKRAYRKLALRHHPDKARGNEGGEDSSDDLPDVD--FKEVTAAY 59
           D Y  LG+ + A+  EIK+AY KLA ++HPD            +  PD +  F ++  AY
Sbjct: 61  DPYDTLGLKKSATGAEIKKAYYKLAKKYHPD-----------INKEPDAEKKFHDLQNAY 109

Query: 60  QVLSDASLRAEYDQKLAFEAQPYXXXXXXXXXXXXXXXXHPGHRSGFDSGRGA------- 112
           ++LSD + R +YDQ                              SGF S  G+       
Sbjct: 110 EILSDETKRQQYDQFGPAAFGGGGAAGGAGGGSGSPFGSQFHDFSGFTSAGGSPFGGINF 169

Query: 113 -------------------------RRYKSDDIEIDLKVKTSELYRGXXXXXXXXXXX-X 146
                                    R+Y+ D IEI  KV   +   G             
Sbjct: 170 EDLFGAAFGGGGRGSGGASRSSSMFRQYRGDPIEIVHKVSFKDAVFGSKNVQLRFSALDP 229

Query: 147 CQRCDGTGWKSHASIVKKKTAKFFWNVCEGCEGQGVRQRLRQLAPGFVTTELIECRQCGG 206
           C  C GTG K +   V           C  C G G    +R    GF    +  C  C G
Sbjct: 230 CSTCSGTGMKPNTHKVS----------CSTCHGTGTTVHIRG---GF--QMMSTCPTCNG 274

Query: 207 KGKLRNLPKSEKNKCPDCITSGTVGMVEENKVVTINIKKGTLDGDKIVLKG--------- 257
           +G +    K  ++ C  C   G    V   K +T+++  G  DGD + + G         
Sbjct: 275 EGTM----KRPQDNCTKCHGEGV--QVNRAKTITVDLPHGLQDGDVVRIPGQGSYPDIAV 328

Query: 258 EAD-EDLESTEVGDLVIKIQEVKEPQYDIVRNGYDLIIKKQIDLADAICGFDEKPLMETY 316
           EAD +D      GD++++I+  K+P + I +N YD+   K+I +  A  G      + T 
Sbjct: 329 EADLKDSVKLSRGDILVRIRVDKDPNFSI-KNKYDIWYDKEIPITTAALG--GTVTIPTV 385

Query: 317 DGRVLKWSSKRGKVIRPNDIVRIQNEGWPR 346
           +G+ ++     G   + N ++ I N G P+
Sbjct: 386 EGQKIRIKVAPG--TQYNQVISIPNMGVPK 413

>Kpol_1011.9 s1011 (23785..25272) [1488 bp, 495 aa] {ON}
           (23785..25272) [1488 nt, 496 aa]
          Length = 495

 Score = 70.1 bits (170), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 110/439 (25%), Positives = 167/439 (38%), Gaps = 81/439 (18%)

Query: 2   DYYGLLGVGQDASQDEIKRAYRKLALRHHPDKARGNEGGEDSSDDLPDVD--FKEVTAAY 59
           D Y  LGV + ASQ EIK+AY KLA ++HPD  +            PD +  F  +  AY
Sbjct: 56  DPYKTLGVARSASQSEIKKAYYKLAKKYHPDINKE-----------PDAEKTFHNLQNAY 104

Query: 60  QVLSDASLRAEYDQ--KLAFEAQ-----------PYXXXXXXXXXXXXXXXXH------- 99
           ++LSD   RA++DQ    AF              P+                        
Sbjct: 105 EILSDEDKRAQFDQFGASAFSQNAGPSGGSGGFNPFANGNGGGFGDFGGLNFEDLFGAAF 164

Query: 100 ---PGHRS--GFDSG-RGARRYKSDDIEIDLKVKTSELYRGXXXXXXXXXXXX-CQRCDG 152
                 RS  GF S     R YK D IEI   +   +   G             C  C G
Sbjct: 165 GGGASGRSNGGFGSRVNMVREYKGDTIEIIHNLSFKDAVFGVNNVSLTFNALDPCDTCHG 224

Query: 153 TGWKSHASIVKKKTAKFFWNVCEGCEGQGVRQRLRQLAPGFVTTELIECRQCGGKGKLRN 212
           +G K   +  ++         C  C G G +  +R    GF       C  C G+G +  
Sbjct: 225 SGLKKGENHKRRS--------CSYCNGTGTQIHVRS---GFQMAS--TCNHCHGEGTIIA 271

Query: 213 LPKSEKNKCPDCITSGTVGMVEENKVVTINIKKGTLDGDKIVLKGEA----------DED 262
                ++ C  C   G    ++  K + +N+     DGD I + GE           D+D
Sbjct: 272 F----EDMCTKCHGDGV--KLDAQKKINVNLPSSLSDGDVIRIPGEGSFPNIAVPEEDKD 325

Query: 263 LESTEVGDLVIKIQEVKEPQYDIVRNGYDLIIKKQIDLADAICGFDEKPLMETYDGRVLK 322
                 GDL+++I+   +P Y I +N YD+   K+I +  A  G      ++T D + ++
Sbjct: 326 RVKLSRGDLLVRIRVKPDPDYTI-KNKYDIWSVKEIPITTAALG--GTITIKTIDDKQIR 382

Query: 323 WSSKRGKVIRPNDIVRIQNEGWPRREDANDNNTLLKNGDLYVIVDIVFPPDNWTMEVNDY 382
                G   + + +  I N G PRR         L  GD+ +   +V    +  +E   +
Sbjct: 383 LKVMAG--TQHDQVTSIPNMGVPRRNG-------LGRGDMKIQYKVVIRKPSTEVETCLW 433

Query: 383 RAVRNIIPSTINKRESSTS 401
            A+ ++   T  KR  S S
Sbjct: 434 EALADVSKDTTAKRTMSNS 452

>KLTH0A02882g Chr1 (250221..251642) [1422 bp, 473 aa] {ON} similar
           to uniprot|P35191 Saccharomyces cerevisiae YFL016C MDJ1
           Protein involved in folding of mitochondrially
           synthesized proteins in the mitochondrial matrix
           localizes to the mitochondrial inner membrane member of
           the DnaJ family of molecular chaperones
          Length = 473

 Score = 69.3 bits (168), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 66/265 (24%), Positives = 109/265 (41%), Gaps = 43/265 (16%)

Query: 147 CQRCDGTGWKSHASIVKKKTAKFFWNVCEGCEGQGVRQRLRQLAPGFVTTELIECRQCGG 206
           C  CDG+G K  AS             C GC G G R  +R    GF       C QCGG
Sbjct: 206 CGTCDGSGLKPGAS----------RTTCPGCSGTGTRVHIRA---GFQMAS--TCNQCGG 250

Query: 207 KGKLRNLPKSEKNKCPDCITSGTVGMVEENKVVTINIKKGTLDGDKIVLKGE-------- 258
           +G +      + + C  C   G    + ++  + +++  G  DGD I + G+        
Sbjct: 251 EGSVVR----DSDTCATCHGEG--ASLNKDHAIKVDLPHGLQDGDVIRISGQGSYPNIAV 304

Query: 259 --ADEDLESTEVGDLVIKIQEVKEPQYDIVRNGYDLIIKKQIDLADAICGFDEKPLMETY 316
             A +D      GD++++I+  K+P++ I +N YD+ + + I +  A  G      + T 
Sbjct: 305 DPAMKDTVRLSRGDVLLRIRVDKDPRFQI-KNKYDIWLTQDIPITTAALG--GIVTVPTV 361

Query: 317 DGRVLKWSSKRGKVIRPNDIVRIQNEGWPRREDANDNNTLLKNGDLYVIVDIVFPPDNWT 376
           DG  ++     G   + ND+V I  +G PR             GD+ V   I        
Sbjct: 362 DGEQVRLKVAPG--TQHNDVVSISQKGVPR-------GAFGSRGDMKVQYKISIKKPQSQ 412

Query: 377 MEVNDYRAVRNIIPSTINKRESSTS 401
            E   + A+ ++   T+ +R   +S
Sbjct: 413 AERCLWEALADVTGDTLARRSVLSS 437

 Score = 35.0 bits (79), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 28/72 (38%), Positives = 41/72 (56%), Gaps = 9/72 (12%)

Query: 2   DYYGLLGVGQDASQDEIKRAYRKLALRHHPDKARGNEGGEDSSDDLPDVDFKEVTAAYQV 61
           D Y  LGV + AS  EIK+AY KLA ++HPD  +  +  +          F ++  AY++
Sbjct: 40  DPYATLGVSKSASGSEIKKAYYKLAKKYHPDINKAEDAQK---------KFHDLQNAYEI 90

Query: 62  LSDASLRAEYDQ 73
           LSD S R ++DQ
Sbjct: 91  LSDDSKRQQWDQ 102

>Kwal_47.17957 s47 (626415..627851) [1437 bp, 478 aa] {ON} YFL016C
           (MDJ1) - DnaJ homolog involved in mitochondrial
           biogenesis and protein folding [contig 202] FULL
          Length = 478

 Score = 68.9 bits (167), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 65/249 (26%), Positives = 104/249 (41%), Gaps = 37/249 (14%)

Query: 109 GRGARRYKSDDIEIDLKVKTSELYRGXXXXXXXXXXX-XCQRCDGTGWKSHASIVKKKTA 167
           G   R Y+   IEI  ++   +   G             C  CDG+G K  AS       
Sbjct: 171 GSMYREYQGSPIEISHRISFKDSVFGTKNVNLKYSAYDPCNTCDGSGLKPGAS------- 223

Query: 168 KFFWNVCEGCEGQGVRQRLRQLAPGFVTTELIECRQCGGKGKLRNLPKSEKNKCPDCITS 227
               + C GC G G R  +R    GF       C QCGG+G +      + + C  C   
Sbjct: 224 ---RSTCPGCSGTGTRVHVRA---GFQMAS--TCNQCGGEGSVLR----DADTCQTC--H 269

Query: 228 GTVGMVEENKVVTINIKKGTLDGDKIVLKGE----------ADEDLESTEVGDLVIKIQE 277
           G    +++N  + +++  G  DGD I + G+          A +D      GDL+++I+ 
Sbjct: 270 GEGAKLDKNHELKVDLPHGLQDGDVIRISGKGSYPNIAVDPAMKDTVRLSRGDLLLRIRV 329

Query: 278 VKEPQYDIVRNGYDLIIKKQIDLADAICGFDEKPLMETYDGRVLKWSSKRGKVIRPNDIV 337
            K+P++ I +N YD+   + I +  A  G      + T DG  ++     G   + +D+V
Sbjct: 330 DKDPRFQI-KNKYDIWFTQDIPITTAALG--GVVTIPTVDGEQVRLKVSPG--TQHHDVV 384

Query: 338 RIQNEGWPR 346
            I  +G PR
Sbjct: 385 SIPQKGVPR 393

 Score = 32.0 bits (71), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 26/72 (36%), Positives = 39/72 (54%), Gaps = 9/72 (12%)

Query: 2   DYYGLLGVGQDASQDEIKRAYRKLALRHHPDKARGNEGGEDSSDDLPDVDFKEVTAAYQV 61
           D Y  LGV   A+  EIK+AY KLA ++HPD  +  +  +          F ++  AY++
Sbjct: 39  DPYSTLGVSNSATSSEIKKAYYKLAKKYHPDINKAADAQK---------KFHDLQNAYEI 89

Query: 62  LSDASLRAEYDQ 73
           LSD   R ++DQ
Sbjct: 90  LSDDCKRQQWDQ 101

>Suva_6.44 Chr6 complement(77690..79213) [1524 bp, 507 aa] {ON}
           YFL016C (REAL)
          Length = 507

 Score = 68.2 bits (165), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 103/419 (24%), Positives = 156/419 (37%), Gaps = 98/419 (23%)

Query: 2   DYYGLLGVGQDASQDEIKRAYRKLALRHHPDKARGNEGGEDSSDDLPDVD--FKEVTAAY 59
           D Y  LG+ + A+  EIK+AY KLA ++HPD            +  PD +  F ++  AY
Sbjct: 61  DPYDTLGLKKSATGAEIKKAYYKLAKKYHPD-----------INKEPDAEKKFHDLQNAY 109

Query: 60  QVLSDASLRAEYDQKLAFEAQPYXXXXXXXXXXXXXXXXHPGHRSGFDSGRGA------- 112
           ++LSD + R ++DQ                         H    SGF +  G        
Sbjct: 110 EILSDDTKRQQFDQFGPAAFGGGGGGGAGGAGSPFGSQFH--DFSGFTNASGGSPFGGIN 167

Query: 113 -------------------------------RRYKSDDIEIDLKVKTSE-LYRGXXXXXX 140
                                          R+Y+ D IEI  KV   + ++        
Sbjct: 168 FEDLFGAAFGGGGAGAGAGRGGSGGRSSPMYRQYRGDPIEIVHKVSFKDAVFGAKNVQLK 227

Query: 141 XXXXXXCQRCDGTGWKSHASIVKKKTAKFFWNVCEGCEGQGVRQRLRQLAPGFVTTELIE 200
                 C  C GTG K +   V           C  C G G    +R    GF    +  
Sbjct: 228 FSALDPCGTCSGTGMKPNTHKVS----------CTTCHGSGSTVHVRG---GF--QMMST 272

Query: 201 CRQCGGKGKLRNLPKSEKNKCPDCITSGTVGMVEENKVVTINIKKGTLDGDKIVLKG--- 257
           C  C G+G +    K  ++ C  C   G        K +T+++  G  DGD + + G   
Sbjct: 273 CPTCNGEGTM----KRPQDNCTSCHGEGV--QANRGKSITVDLPHGLQDGDVVRIPGQGS 326

Query: 258 ------EAD-EDLESTEVGDLVIKIQEVKEPQYDIVRNGYDLIIKKQIDLADAICGFDEK 310
                 EAD +D      GD++++I+  K+P + I RN YD+   K+I +  A  G    
Sbjct: 327 YPDIAVEADLQDSIKLSRGDILVRIRVDKDPSFSI-RNKYDIWYDKEIPITTAALG--GT 383

Query: 311 PLMETYDGRVLKWSSKRGKVIRPNDIVRIQNEGWPRREDANDNNTLLKNGDLYVIVDIV 369
             + T DG+ ++     G   + N ++ I N G PR        T    GD+ V   IV
Sbjct: 384 ITIPTVDGQKIRIKVAPG--TQYNQVISIPNMGVPR--------TATLRGDMKVQYKIV 432

>NDAI0E00870 Chr5 complement(176292..177422) [1131 bp, 376 aa] {ON}
           Anc_8.730
          Length = 376

 Score = 67.4 bits (163), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 90/381 (23%), Positives = 148/381 (38%), Gaps = 51/381 (13%)

Query: 2   DYYGLLGVGQDASQDEIKRAYRKLALRHHPDKARGNEGGEDSSDDLPDVDFKEVTAAYQV 61
           DYY +L + +DA+  +I+ AYR+L+ ++HPDK   N   ED+        F EV  AY++
Sbjct: 22  DYYKILELDKDATDKDIRSAYRQLSKKYHPDK---NPNDEDAHH-----KFIEVGQAYEI 73

Query: 62  LSDASLRAEYDQKLAFEAQPYXXXXXXXXXXXXXXXXHPGHRSGFDSGRGA--------- 112
           LSD   R  YDQ   F  +                         F  G G          
Sbjct: 74  LSDPEKRQRYDQ---FGPEGVNGQNGGGPGGAGFHDPFDIFEQMFGGGGGMGGHGGNPFQ 130

Query: 113 -RRYKSDDIEIDLKVKTSELYRGXXXXXXXXXXXXCQRCDGTGWKSHASIVKKKTAKFFW 171
            +R +  ++           Y G            C  C G+G     S           
Sbjct: 131 QQRQRGQNVVARESTSLKNYYNGYVLKFSINLNDICDHCHGSGSNDGKS----------- 179

Query: 172 NVCEGCEGQGVRQRLRQLAPGFVTTELIE-CRQCGGKGKLRNLPKSEKNKCPDCITSGTV 230
             C  C+G+GV  ++ ++  G +T ++ + C +CGGKG++       KN C  C  S   
Sbjct: 180 TKCPDCQGRGVTVQVIRM--GMMTQQIQQVCGKCGGKGQII------KNPCKTCHGS--- 228

Query: 231 GMVEENKVVTINIKKGTLDGDKIVLKGEADEDLESTEVGDLVIKIQEVKEPQYDIVRNGY 290
            +V++ K   I +  G          G AD+  +  + GD+ I+  E  +      R G 
Sbjct: 229 KVVQKPKDFEIELPAGAPRKFVHAEHGAADKHPD-YDSGDVYIEFTENDKDNMGYRRRGP 287

Query: 291 DLIIKKQIDLADAICGFDEKPLMETYDGRVLKWSSKRGKVIRPNDIVRIQNEGWPRREDA 350
            L   + ++  +A+ G  E+ L      +++    +  K+I+  +  RI   G P     
Sbjct: 288 HLYRTEVLNATEALYGGWERQLAFLDSSKIVTIKREPNKIIQNGETERIAGFGMPL---- 343

Query: 351 NDNNTLLKNGDLYVIVDIVFP 371
              N     GDL++   +V P
Sbjct: 344 --GNGRKGFGDLFIDYVVVMP 362

>CAGL0J04224g Chr10 (395856..397424) [1569 bp, 522 aa] {ON} similar
           to uniprot|P35191 Saccharomyces cerevisiae YFL016c MDJ1
           heat shock protein - chaperone
          Length = 522

 Score = 67.8 bits (164), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 73/305 (23%), Positives = 124/305 (40%), Gaps = 40/305 (13%)

Query: 113 RRYKSDDIEI--DLKVKTSELYRGXXXXXXXXXXXXCQRCDGTGWKSHASIVKKKTAKFF 170
           R YK D IE+  +L  K + ++              C  C+G+G KS AS          
Sbjct: 188 REYKGDTIEVIQNLDFKDA-VFGKKNVSIKFRALDPCGTCNGSGLKSGAS---------- 236

Query: 171 WNVCEGCEGQGVRQRLRQLAPGFVTTELIECRQCGGKGKLRNLPKSEKNKCPDCITSGTV 230
              C  C G G    +R    GF    +  C+ CGG+G   N      + C  C   G  
Sbjct: 237 KTTCPSCHGSGTTVHVRA---GF--QMMSTCQTCGGEGTTVN----ASDFCKSCHGEGV- 286

Query: 231 GMVEENKVVTINIKKGTLDGDKIVLKGEAD--------EDLESTEV--GDLVIKIQEVKE 280
             V   K +T+++  G  DGD + + G+          E  +S ++  GD++++I+  K+
Sbjct: 287 -NVNTQKTITVDLPHGLQDGDVVRIPGQGSYPDIAVDKEMAKSVKLSRGDILVRIRVNKD 345

Query: 281 PQYDIVRNGYDLIIKKQIDLADAICGFDEKPLMETYDGRVLKWSSKRGKVIRPNDIVRIQ 340
           P + I +N YD+   K+I +  A  G      + T +G  ++     G    P  ++ I 
Sbjct: 346 PHFSI-KNKYDIWYTKEIPITTAALGGTVS--IPTIEGTKIRIKVPAGTA--PEQVISIP 400

Query: 341 NEGWPRREDANDNNTLLKNGDLYVIVDIVFPPDNWTMEVNDYRAVRNIIPSTINKRESST 400
           N G P+      N+ +   GD+ +   +V        E   + A+ ++   T  KR   +
Sbjct: 401 NMGVPKSSPYR-NSAVQARGDMKIQYKVVIRKPQSKAEQCLWEALADVTNDTNAKRTMES 459

Query: 401 SGESI 405
              S+
Sbjct: 460 FASSV 464

 Score = 37.0 bits (84), Expect = 0.086,   Method: Compositional matrix adjust.
 Identities = 30/72 (41%), Positives = 43/72 (59%), Gaps = 9/72 (12%)

Query: 2   DYYGLLGVGQDASQDEIKRAYRKLALRHHPDKARGNEGGEDSSDDLPDVDFKEVTAAYQV 61
           D Y  LGV + +SQ +IK+AY KLA ++HPD  +  E G +         F ++  AY++
Sbjct: 47  DPYETLGVKKSSSQSDIKKAYYKLAKKYHPDINK--EAGAEKK-------FHDLQNAYEI 97

Query: 62  LSDASLRAEYDQ 73
           LSD S R +YDQ
Sbjct: 98  LSDESKRKQYDQ 109

>Smik_6.63 Chr6 complement(118121..119653) [1533 bp, 510 aa] {ON}
           YFL016C (REAL)
          Length = 510

 Score = 65.5 bits (158), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 75/308 (24%), Positives = 124/308 (40%), Gaps = 47/308 (15%)

Query: 113 RRYKSDDIEIDLKVKTSELYRGXXXXXXXXXXX-XCQRCDGTGWKSHASIVKKKTAKFFW 171
           R+Y+ D IEI  KV   +   G             C  C GTG K +   V         
Sbjct: 194 RQYRGDPIEIVHKVSFKDAVFGSNNVQLKFSALDPCSTCSGTGMKPNTHKVN-------- 245

Query: 172 NVCEGCEGQGVRQRLRQLAPGFVTTELIECRQCGGKGKLRNLPKSEKNKCPDCITSGTVG 231
             C  C G G    +R    GF    +  C  C G+G +    K  ++ C  C   G   
Sbjct: 246 --CSTCHGTGTTVHIRG---GF--QMMSTCPTCNGEGTM----KRPQDSCTKCHGEGV-- 292

Query: 232 MVEENKVVTINIKKGTLDGDKIVLKGEA-------DEDLEST---EVGDLVIKIQEVKEP 281
            V   K +T+++  G  DGD + + G+        + DL+ T     GD++++I+  K+P
Sbjct: 293 QVNRAKTITVDLPHGLQDGDVVRIPGQGSYPDIAVEADLKDTVKLSRGDILVRIRVDKDP 352

Query: 282 QYDIVRNGYDLIIKKQIDLADAICGFDEKPLMETYDGRVLKWSSKRGKVIRPNDIVRIQN 341
            + I +N YD+   K+I +  A  G      + T +G+ ++     G   + N ++ I N
Sbjct: 353 NFSI-KNKYDIWYDKEIPITTAALG--GTVTIPTVEGQKIRIKVAPG--TQYNQVISIPN 407

Query: 342 EGWPRREDANDNNTLLKNGDLYVIVDIVFPPDNWTMEVNDYRAVRNIIPSTINKR--ESS 399
            G P+        T    GD+ +   IV        E   + A+ ++    + K+  E  
Sbjct: 408 MGVPK--------TTTIRGDMKIQYKIVVKKPQSLAEKCLWEALADVTNDDMAKKTMEPG 459

Query: 400 TSGESILN 407
           T+  + LN
Sbjct: 460 TAAGTALN 467

 Score = 30.8 bits (68), Expect = 9.2,   Method: Compositional matrix adjust.
 Identities = 26/72 (36%), Positives = 41/72 (56%), Gaps = 9/72 (12%)

Query: 2   DYYGLLGVGQDASQDEIKRAYRKLALRHHPDKARGNEGGEDSSDDLPDVDFKEVTAAYQV 61
           D Y  LG+ + A+  EIK+AY KLA ++HPD  +  +          +  F ++  AY++
Sbjct: 61  DPYDTLGLKKSATGAEIKKAYYKLAKKYHPDINKEVDA---------EKKFHDLQNAYEI 111

Query: 62  LSDASLRAEYDQ 73
           LSD + R +YDQ
Sbjct: 112 LSDENKRQQYDQ 123

>AFR507W Chr6 (1348057..1349481) [1425 bp, 474 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YFL016C (MDJ1)
          Length = 474

 Score = 64.3 bits (155), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 63/245 (25%), Positives = 101/245 (41%), Gaps = 37/245 (15%)

Query: 113 RRYKSDDIEIDLKVKTSELYRGXXXXXXXXXXX-XCQRCDGTGWKSHASIVKKKTAKFFW 171
           R +K D I++  K+   +   G             C  C G+G K+ A            
Sbjct: 168 REFKGDSIQVPFKLSFRDAVFGLKDVPLRYAVYDQCGTCSGSGLKAGAQ----------R 217

Query: 172 NVCEGCEGQGVRQRLRQLAPGFVTTELIECRQCGGKGKLRNLPKSEKNKCPDCITSGTVG 231
           +VC GC G G +  +R    GF       C QC G+G          ++C  C   G V 
Sbjct: 218 SVCGGCHGTGTQVHVR---AGFQMAS--TCSQCSGEG----YSIRRGDRCGTCSGEGVV- 267

Query: 232 MVEENKVVTINIKKGTLDGDKIVLKGEA-------DEDLEST---EVGDLVIKIQEVKEP 281
               NK V ++   G  DGD + + G+        D     T     GDL++++Q  ++P
Sbjct: 268 -FNRNKEVKMDFPHGLQDGDVVKVPGQGSFPHIQVDPKTAHTMRLRRGDLLVQVQVERDP 326

Query: 282 QYDIVRNGYDLIIKKQIDLADAICGFDEKPLMETYDGRVLKWSSKRGKVIRPNDIVRIQN 341
           ++ I +N YD+   ++I +  A  G      + T DG  ++     G   +P+ +V I N
Sbjct: 327 RFQI-KNNYDIWYVQEIPITTAALGGTVS--IPTVDGDQIRLKVIPG--TQPDQVVSIPN 381

Query: 342 EGWPR 346
           +G PR
Sbjct: 382 KGVPR 386

 Score = 52.8 bits (125), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 32/72 (44%), Positives = 43/72 (59%), Gaps = 9/72 (12%)

Query: 2   DYYGLLGVGQDASQDEIKRAYRKLALRHHPDKARGNEGGEDSSDDLPDVDFKEVTAAYQV 61
           D Y  LGV +DAS  +IK+AY KLA + HPD  + +EG E    DL +        AY++
Sbjct: 41  DPYETLGVAKDASASQIKKAYYKLAKQFHPDINK-DEGAEKKFHDLQN--------AYEI 91

Query: 62  LSDASLRAEYDQ 73
           LSD + R +YDQ
Sbjct: 92  LSDENKRRQYDQ 103

>Ecym_4372 Chr4 complement(790363..792102) [1740 bp, 579 aa] {ON}
          similar to Ashbya gossypii ADL111W
          Length = 579

 Score = 63.5 bits (153), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 32/71 (45%), Positives = 46/71 (64%), Gaps = 8/71 (11%)

Query: 3  YYGLLGVGQDASQDEIKRAYRKLALRHHPDKARGNEGGEDSSDDLPDVDFKEVTAAYQVL 62
          YY +LGV  DA+ ++IK+AYRK A++ HPDK        + +D      F+EV+ AY+VL
Sbjct: 7  YYDVLGVQPDATAEQIKKAYRKKAIQTHPDK--------NPNDPEAQAKFQEVSKAYKVL 58

Query: 63 SDASLRAEYDQ 73
          SD  LR+ YD+
Sbjct: 59 SDGELRSRYDE 69

>Skud_6.56 Chr6 complement(106964..108517) [1554 bp, 517 aa] {ON}
           YFL016C (REAL)
          Length = 517

 Score = 63.2 bits (152), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 62/245 (25%), Positives = 102/245 (41%), Gaps = 37/245 (15%)

Query: 113 RRYKSDDIEIDLKVKTSELYRGXXXXXXXXXXX-XCQRCDGTGWKSHASIVKKKTAKFFW 171
           R+Y+ D IEI   V   +   G             C  C GTG K +   V         
Sbjct: 200 RQYRGDPIEIVHNVSFKDAVFGSNNVQLKFSALDPCGTCSGTGMKPNTHKVN-------- 251

Query: 172 NVCEGCEGQGVRQRLRQLAPGFVTTELIECRQCGGKGKLRNLPKSEKNKCPDCITSGTVG 231
             C  C G G    +R    GF    +  C  C G+G +    K  ++ C  C   G   
Sbjct: 252 --CGTCHGTGTTVHIRG---GF--QMMSTCPTCNGEGTM----KRPQDSCSKCHGEGV-- 298

Query: 232 MVEENKVVTINIKKGTLDGDKIVLKGEA-------DEDLEST---EVGDLVIKIQEVKEP 281
            V   K +T+++  G  DGD + + G+        +EDL+ +     GD++++I+  K+P
Sbjct: 299 QVNRGKTITVDLPHGLQDGDVVRIPGQGSYPDIAVEEDLKDSVKLSRGDILVRIRVDKDP 358

Query: 282 QYDIVRNGYDLIIKKQIDLADAICGFDEKPLMETYDGRVLKWSSKRGKVIRPNDIVRIQN 341
            + I +N YD+   K+I +  A  G      + T +G+ ++     G   + N ++ I N
Sbjct: 359 NFSI-KNKYDIWYNKEIPITTAALG--GTVTIPTVEGQKIRIKVAPG--TQYNQVISIPN 413

Query: 342 EGWPR 346
            G P+
Sbjct: 414 MGVPK 418

 Score = 33.5 bits (75), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 29/74 (39%), Positives = 42/74 (56%), Gaps = 13/74 (17%)

Query: 2   DYYGLLGVGQDASQDEIKRAYRKLALRHHPDKARGNEGGEDSSDDLPDVD--FKEVTAAY 59
           D Y  LG+ + A+  EIK+AY KLA ++HPD            +  PD +  F ++  AY
Sbjct: 61  DPYDTLGLKKSATGAEIKKAYYKLAKKYHPD-----------INKEPDAEKKFHDLQNAY 109

Query: 60  QVLSDASLRAEYDQ 73
           ++LSD S R +YDQ
Sbjct: 110 EILSDESKRQQYDQ 123

>NDAI0A02820 Chr1 complement(634394..635842) [1449 bp, 482 aa]
          {ON} Anc_7.157
          Length = 482

 Score = 62.8 bits (151), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 35/79 (44%), Positives = 48/79 (60%), Gaps = 8/79 (10%)

Query: 3  YYGLLGVGQDASQDEIKRAYRKLALRHHPDKARGNEGGEDSSDDLPDVDFKEVTAAYQVL 62
          YY LLG+   A+Q EIK+AYRK +++ HPDK        + +D      F+ ++ AYQVL
Sbjct: 7  YYDLLGIEPSATQGEIKKAYRKKSIKEHPDK--------NPNDPQATERFQAISEAYQVL 58

Query: 63 SDASLRAEYDQKLAFEAQP 81
          SD SLR +YD+    EA P
Sbjct: 59 SDESLRLKYDKYGKKEAIP 77

>TBLA0J01870 Chr10 complement(438718..440130) [1413 bp, 470 aa]
          {ON} Anc_7.157 YIR004W
          Length = 470

 Score = 62.8 bits (151), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 31/71 (43%), Positives = 44/71 (61%), Gaps = 8/71 (11%)

Query: 3  YYGLLGVGQDASQDEIKRAYRKLALRHHPDKARGNEGGEDSSDDLPDVDFKEVTAAYQVL 62
          YY +LG+   A+Q EIK+AYRK +++ HPDK        + +D      F++++ AYQVL
Sbjct: 7  YYDILGITPTATQAEIKKAYRKKSIKEHPDK--------NPNDPTATERFQQISEAYQVL 58

Query: 63 SDASLRAEYDQ 73
          SD  LR  YDQ
Sbjct: 59 SDEHLRNNYDQ 69

>KLLA0D19602g Chr4 (1653096..1654958) [1863 bp, 620 aa] {ON}
          similar to uniprot|P53863 Saccharomyces cerevisiae
          YNL227C JJJ1 Protein that may function as a cochaperone
          as suggested by the presence of a DnaJ-like domain
          Length = 620

 Score = 62.8 bits (151), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 35/70 (50%), Positives = 45/70 (64%), Gaps = 7/70 (10%)

Query: 3  YYGLLGVGQDASQDEIKRAYRKLALRHHPDKARGNEGGEDSSDDLPDVDFKEVTAAYQVL 62
          YY LL V  DA+  ++KRAYRK AL +HPDK R N       ++  +V F ++ AAY+VL
Sbjct: 5  YYDLLDVKSDATDTDLKRAYRKKALLYHPDKNRNN------IEEATEV-FAQIRAAYEVL 57

Query: 63 SDASLRAEYD 72
          SDA  RA YD
Sbjct: 58 SDAQERAWYD 67

>KLLA0E04423g Chr5 complement(400495..401781) [1287 bp, 428 aa]
          {ON} similar to uniprot|P39101 YER048C Saccharomyces
          cerevisiae CAJ1 Nuclear type II J heat shock protein of
          the E. coli dnaJ family
          Length = 428

 Score = 62.0 bits (149), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 33/71 (46%), Positives = 42/71 (59%), Gaps = 8/71 (11%)

Query: 3  YYGLLGVGQDASQDEIKRAYRKLALRHHPDKARGNEGGEDSSDDLPDVDFKEVTAAYQVL 62
          YY +L V  DAS  EIK++YRKLA++ HPDK        +  D      F+E+  AYQVL
Sbjct: 7  YYDILQVSVDASPQEIKKSYRKLAIKTHPDK--------NPDDPQAQTKFQELAKAYQVL 58

Query: 63 SDASLRAEYDQ 73
           D  LR +YDQ
Sbjct: 59 IDDDLRKKYDQ 69

>TBLA0D04240 Chr4 (1048036..1049205) [1170 bp, 389 aa] {ON}
          Anc_7.217 YER048C
          Length = 389

 Score = 61.6 bits (148), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 34/75 (45%), Positives = 45/75 (60%), Gaps = 12/75 (16%)

Query: 1  MDYYGLLGVGQDASQDEIKRAYRKLALRHHPDKARGNEGGEDSSDDLPDVD--FKEVTAA 58
          M+YY +LG+  DA+  EIK+AYR+ A++ HPDK            D PD    F+ V  A
Sbjct: 5  MEYYDVLGIQPDATPAEIKKAYRRKAMQTHPDK----------HPDDPDAQSKFQAVGEA 54

Query: 59 YQVLSDASLRAEYDQ 73
          YQVLSD  L++ YDQ
Sbjct: 55 YQVLSDPQLKSRYDQ 69

>TDEL0H02290 Chr8 (383876..385039) [1164 bp, 387 aa] {ON}
          Anc_7.217 YER048C
          Length = 387

 Score = 61.2 bits (147), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 33/72 (45%), Positives = 43/72 (59%), Gaps = 8/72 (11%)

Query: 2  DYYGLLGVGQDASQDEIKRAYRKLALRHHPDKARGNEGGEDSSDDLPDVDFKEVTAAYQV 61
          +YY +LGV   A+  EIK+AYRK A++ HPDK        +  D   +  F+ V  AYQV
Sbjct: 6  EYYDVLGVSPTATAMEIKKAYRKKAMQTHPDK--------NPDDPEAETKFQAVGEAYQV 57

Query: 62 LSDASLRAEYDQ 73
          LSD  LR+ YDQ
Sbjct: 58 LSDTELRSRYDQ 69

>CAGL0I06226g Chr9 (597520..598887) [1368 bp, 455 aa] {ON} some
          similarities with uniprot|P46997 Saccharomyces
          cerevisiae YJL162c
          Length = 455

 Score = 61.6 bits (148), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 32/78 (41%), Positives = 46/78 (58%), Gaps = 9/78 (11%)

Query: 3  YYGLLGVGQDASQDEIKRAYRKLALRHHPDKARGNEGGEDSSDDLPDVDFKEVTAAYQVL 62
          YY +LGV  +AS +EI+++Y KLA + HPDK +     E          FK V  A+ +L
Sbjct: 13 YYSILGVPTNASTNEIRKSYMKLAKKLHPDKTKSEHTAE---------LFKLVVDAHSIL 63

Query: 63 SDASLRAEYDQKLAFEAQ 80
          ++  LRAEYD+KL  E +
Sbjct: 64 NNDQLRAEYDKKLILEGR 81

>TBLA0C01480 Chr3 complement(341677..342738) [1062 bp, 353 aa]
          {ON} Anc_1.398 YNL007C
          Length = 353

 Score = 60.8 bits (146), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 31/70 (44%), Positives = 43/70 (61%), Gaps = 11/70 (15%)

Query: 4  YGLLGVGQDASQDEIKRAYRKLALRHHPDKARGNEGGEDSSDDLPDVDFKEVTAAYQVLS 63
          Y LLGV   AS  EIK+ YRK AL++HPDK  G+              FKE++ A+++LS
Sbjct: 8  YDLLGVSSSASDAEIKKGYRKAALKYHPDKPTGDT-----------EKFKEISEAFEILS 56

Query: 64 DASLRAEYDQ 73
          D++ R+ YDQ
Sbjct: 57 DSNKRSVYDQ 66

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 30/119 (25%), Positives = 55/119 (46%), Gaps = 6/119 (5%)

Query: 239 VTINIKKGTLDGDKIVLKGEADEDLESTEVGDLVIKIQEVKEPQYDIVRNGYDLIIKKQI 298
           + IN+K G  +G K+  K   D +  +     L   I+E K P Y   R+G ++I    +
Sbjct: 218 IDINLKPGWKEGTKLTYKNHGDYNPSTGGRKTLQFIIKEKKHPLYK--RDGDNIIYTLPL 275

Query: 299 DLADAICGFDEKPLMETYDGRVLKWSSKRGKVIRPNDIVRIQNEGWPRREDANDNNTLL 357
              +++ GF +   ++T DGR L  S  R + ++P +      +G P  ++      L+
Sbjct: 276 TFKESLLGFSK--TLQTLDGRTLPLS--RSQPVQPTEENTYPGQGMPISKNPGQRGNLI 330

>Skud_9.181 Chr9 (334059..335324) [1266 bp, 421 aa] {ON} YIR004W
          (REAL)
          Length = 421

 Score = 60.8 bits (146), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 36/81 (44%), Positives = 49/81 (60%), Gaps = 10/81 (12%)

Query: 2  DYYGLLGVGQDASQDEIKRAYRKLALRHHPDKARGNEGGEDSSDDLPDVD-FKEVTAAYQ 60
          +YY LLGV   AS  EIK+AYRK +++ HPDK         + +DL   + F+ ++ AYQ
Sbjct: 6  EYYDLLGVSTTASAIEIKKAYRKKSIQEHPDK---------NPNDLKATERFQAISEAYQ 56

Query: 61 VLSDASLRAEYDQKLAFEAQP 81
          VL D  LRA+YD+    EA P
Sbjct: 57 VLGDDELRAKYDKFGRKEAIP 77

>YIR004W Chr9 (363221..364519) [1299 bp, 432 aa] {ON}
          DJP1Cytosolic J-domain-containing protein, required for
          peroxisomal protein import and involved in peroxisome
          assembly, homologous to E. coli DnaJ
          Length = 432

 Score = 60.8 bits (146), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 35/80 (43%), Positives = 47/80 (58%), Gaps = 8/80 (10%)

Query: 2  DYYGLLGVGQDASQDEIKRAYRKLALRHHPDKARGNEGGEDSSDDLPDVDFKEVTAAYQV 61
          +YY LLGV   AS  EIK+AYRK +++ HPDK        + +D      F+ ++ AYQV
Sbjct: 6  EYYDLLGVSTTASSIEIKKAYRKKSIQEHPDK--------NPNDPTATERFQAISEAYQV 57

Query: 62 LSDASLRAEYDQKLAFEAQP 81
          L D  LRA+YD+    EA P
Sbjct: 58 LGDDDLRAKYDKYGRKEAIP 77

>KLLA0C02981g Chr3 (268669..269157) [489 bp, 162 aa] {ON} similar
          to uniprot|P47138 Saccharomyces cerevisiae YJR097W JJJ3
          Protein required along with Dph1p Dph2p Kti11p and
          Dph5p for synthesis of diphthamide which is a modified
          histidine residue of translation elongation factor 2
          (Eft1p or Eft2p) contains a DnaJ-like domain,
          Length = 162

 Score = 57.8 bits (138), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 34/77 (44%), Positives = 44/77 (57%), Gaps = 8/77 (10%)

Query: 3  YYGLLGVGQDASQDEIKRAYRKLALRHHPDKARGN---EGGEDSSDDLPDVDFKEVTAAY 59
          +Y +LG+  DAS  EIKRAYR + L  HPDK+  N    G   SS  + D     +  AY
Sbjct: 5  FYEILGIESDASNIEIKRAYRAMLLETHPDKSGLNYNSNGNNTSSHSVTD-----IQEAY 59

Query: 60 QVLSDASLRAEYDQKLA 76
          Q L D  LR +YD++LA
Sbjct: 60 QTLIDQDLRKKYDEELA 76

>CAGL0J01936g Chr10 complement(192784..194061) [1278 bp, 425 aa]
          {ON} highly similar to uniprot|P40564 Saccharomyces
          cerevisiae YIR004w DJP1
          Length = 425

 Score = 60.8 bits (146), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 34/79 (43%), Positives = 47/79 (59%), Gaps = 8/79 (10%)

Query: 3  YYGLLGVGQDASQDEIKRAYRKLALRHHPDKARGNEGGEDSSDDLPDVDFKEVTAAYQVL 62
          YY LLG+G  A+  EIK+AYRK +++ HPDK        + +D      F+ ++ AYQVL
Sbjct: 7  YYDLLGIGPTATAVEIKKAYRKKSIQEHPDK--------NPNDPTATERFQAISEAYQVL 58

Query: 63 SDASLRAEYDQKLAFEAQP 81
          S   LRA+YD+    EA P
Sbjct: 59 SSEELRAKYDKFGKQEAIP 77

>TPHA0B03760 Chr2 (889402..890469) [1068 bp, 355 aa] {ON}
          Anc_1.398 YNL007C
          Length = 355

 Score = 60.5 bits (145), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 31/70 (44%), Positives = 42/70 (60%), Gaps = 11/70 (15%)

Query: 4  YGLLGVGQDASQDEIKRAYRKLALRHHPDKARGNEGGEDSSDDLPDVDFKEVTAAYQVLS 63
          Y LLGV   A+  EIK+ YRK AL++HPDK  GN              FKE++ A+++LS
Sbjct: 8  YDLLGVSPSANDQEIKKGYRKAALKYHPDKPTGNTE-----------KFKEISEAFEILS 56

Query: 64 DASLRAEYDQ 73
          D++ R  YDQ
Sbjct: 57 DSNKREVYDQ 66

>NDAI0C02610 Chr3 (606952..607974) [1023 bp, 340 aa] {ON} 
          Length = 340

 Score = 60.1 bits (144), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 31/70 (44%), Positives = 42/70 (60%), Gaps = 11/70 (15%)

Query: 4  YGLLGVGQDASQDEIKRAYRKLALRHHPDKARGNEGGEDSSDDLPDVDFKEVTAAYQVLS 63
          Y LLGV   A+  EIK+ YRK AL++HPDK  GN              FK+++ AY++LS
Sbjct: 8  YDLLGVSPSANDQEIKKGYRKAALQYHPDKPTGN-----------TEKFKQISEAYEILS 56

Query: 64 DASLRAEYDQ 73
          D++ R  YDQ
Sbjct: 57 DSNKREVYDQ 66

 Score = 50.8 bits (120), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 38/141 (26%), Positives = 65/141 (46%), Gaps = 12/141 (8%)

Query: 231 GMVEENKVVTINIKKGTLDGDKIVLKGEADEDLESTEVGDLVIKIQEVKEPQYDIVRNGY 290
           G  +E K + I +K+G   G KI  K E D +  +     L   +QE   P +   R+G 
Sbjct: 197 GGSQEKKQIDIQLKRGWKAGTKITYKNEGDFNPRTGGRKTLQFVLQEKAHPLFK--RDGE 254

Query: 291 DLIIKKQIDLADAICGFDEKPLMETYDGRVLKWSSKRGKVIRPNDIVRIQNEGWPRREDA 350
           +L+    +   +++ GF +   ++T DGR L  S  R + I+P +      +G P  ++ 
Sbjct: 255 NLLYTVPLSFQESLLGFSK--TVQTIDGRSLSLS--RTQPIQPTETTTYPGQGMPNPKNP 310

Query: 351 NDNNTLLKNGDLYVIVDIVFP 371
           N      + GDL +   I +P
Sbjct: 311 N------QRGDLIITYKIDYP 325

>KLLA0D13464g Chr4 complement(1159251..1160552) [1302 bp, 433 aa]
          {ON} similar to uniprot|P40564 YIR004W Saccharomyces
          cerevisiae DJP1 Cytosolic J-domain-containing protein,
          required for peroxisomal protein import
          Length = 433

 Score = 60.5 bits (145), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 34/79 (43%), Positives = 45/79 (56%), Gaps = 8/79 (10%)

Query: 3  YYGLLGVGQDASQDEIKRAYRKLALRHHPDKARGNEGGEDSSDDLPDVDFKEVTAAYQVL 62
          YY LLGV  DA Q +IK+AYRK +++ HPDK        +  D      F+ ++ AYQVL
Sbjct: 7  YYDLLGVATDAKQIDIKKAYRKKSVKEHPDK--------NPDDPTATERFQAISEAYQVL 58

Query: 63 SDASLRAEYDQKLAFEAQP 81
          S   LR +YD+    EA P
Sbjct: 59 SSEELRMKYDKFGKEEAMP 77

>TDEL0H03210 Chr8 (532389..533624) [1236 bp, 411 aa] {ON}
          Anc_7.157 YIR004W
          Length = 411

 Score = 60.5 bits (145), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 31/72 (43%), Positives = 44/72 (61%), Gaps = 8/72 (11%)

Query: 2  DYYGLLGVGQDASQDEIKRAYRKLALRHHPDKARGNEGGEDSSDDLPDVDFKEVTAAYQV 61
          +YY LLG+   A+  EIK+AYRK ++  HPDK   + G  +         F+ ++ AYQV
Sbjct: 6  EYYELLGIETTATAVEIKKAYRKKSIEEHPDKNPNDPGATER--------FQAISEAYQV 57

Query: 62 LSDASLRAEYDQ 73
          LSD+ LRA YD+
Sbjct: 58 LSDSDLRANYDK 69

>KLTH0A03740g Chr1 complement(322936..324123) [1188 bp, 395 aa]
          {ON} similar to uniprot|P39101 YER048C Saccharomyces
          cerevisiae CAJ1 Nuclear type II J heat shock protein of
          the E. coli dnaJ family
          Length = 395

 Score = 60.1 bits (144), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 33/72 (45%), Positives = 41/72 (56%), Gaps = 8/72 (11%)

Query: 2  DYYGLLGVGQDASQDEIKRAYRKLALRHHPDKARGNEGGEDSSDDLPDVDFKEVTAAYQV 61
          +YY LLG+  DAS  EIK+AYRK A+  HPDK           D      F+ +  AYQV
Sbjct: 6  EYYDLLGIQPDASATEIKKAYRKKAMLTHPDK--------HPDDPEAQAKFQAIGQAYQV 57

Query: 62 LSDASLRAEYDQ 73
          LSD  LR+ YD+
Sbjct: 58 LSDPELRSRYDE 69

>Skud_5.158 Chr5 complement(244775..245950) [1176 bp, 391 aa] {ON}
          YER048C (REAL)
          Length = 391

 Score = 60.1 bits (144), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 33/74 (44%), Positives = 44/74 (59%), Gaps = 12/74 (16%)

Query: 2  DYYGLLGVGQDASQDEIKRAYRKLALRHHPDKARGNEGGEDSSDDLPDVD--FKEVTAAY 59
          +YY +LG+  DA+  EIK+AYR+ A+  HPDK            D PD    F+ V  AY
Sbjct: 6  EYYDILGIKPDATSTEIKKAYRRKAMETHPDK----------HPDDPDAQAKFQAVGEAY 55

Query: 60 QVLSDASLRAEYDQ 73
          QVLSD  LR++YD+
Sbjct: 56 QVLSDPGLRSKYDE 69

>NDAI0E04560 Chr5 (1020784..1021968) [1185 bp, 394 aa] {ON} 
          Length = 394

 Score = 59.7 bits (143), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 34/74 (45%), Positives = 44/74 (59%), Gaps = 12/74 (16%)

Query: 2  DYYGLLGVGQDASQDEIKRAYRKLALRHHPDKARGNEGGEDSSDDLPDVD--FKEVTAAY 59
          +YY +LGV  DA+  EIK+AYR+ A++ HPDK            D PD    F+ V  AY
Sbjct: 6  EYYDILGVEPDATPTEIKKAYRRKAMQTHPDK----------HPDDPDAQAKFQAVGEAY 55

Query: 60 QVLSDASLRAEYDQ 73
          QVLSD  LR+ YD+
Sbjct: 56 QVLSDPGLRSRYDE 69

>KNAG0I00740 Chr9 (130033..131310) [1278 bp, 425 aa] {ON}
          Anc_7.157 YIR004W
          Length = 425

 Score = 60.1 bits (144), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 34/79 (43%), Positives = 46/79 (58%), Gaps = 8/79 (10%)

Query: 3  YYGLLGVGQDASQDEIKRAYRKLALRHHPDKARGNEGGEDSSDDLPDVDFKEVTAAYQVL 62
          YY +LGV   A+  EIK+AYRK +++ HPDK R         D +    F+ ++ AYQVL
Sbjct: 7  YYEILGVTPTATAVEIKKAYRKKSVQEHPDKNR--------DDPMATERFQAISEAYQVL 58

Query: 63 SDASLRAEYDQKLAFEAQP 81
          SD  LR +YD+    EA P
Sbjct: 59 SDEDLRGKYDRFGKTEAVP 77

>KLLA0E01629g Chr5 (155088..155783) [696 bp, 231 aa] {ON} similar
          to uniprot|P48353 Saccharomyces cerevisiae YMR161W
          Length = 231

 Score = 58.2 bits (139), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 31/72 (43%), Positives = 45/72 (62%), Gaps = 9/72 (12%)

Query: 2  DYYGLLGVGQDASQDEIKRAYRKLALRHHPDKARGNEGGEDSSDDLPDVDFKEVTAAYQV 61
          ++Y +L VG+ AS+ +IK+AYRKLA++ HPDK R     E          FK++  A++V
Sbjct: 22 EFYEMLKVGKSASESDIKKAYRKLAIKLHPDKNRHPRASE---------AFKKINRAFEV 72

Query: 62 LSDASLRAEYDQ 73
          LSD S R  +DQ
Sbjct: 73 LSDDSKRRIFDQ 84

>Smik_10.385 Chr10 (601299..601817) [519 bp, 172 aa] {ON} YJR097W
          (REAL)
          Length = 172

 Score = 57.0 bits (136), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 31/73 (42%), Positives = 42/73 (57%), Gaps = 5/73 (6%)

Query: 1  MDYYGLLGVGQDASQDEIKRAYRKLALRHHPDKARGNEGGEDSSDDLPDVDFKEVTAAYQ 60
          + +Y +L +  DA+Q+EIKRAYR   L  HPDK   N  G  SS     V   ++  AY+
Sbjct: 7  LTHYEILRIPSDATQEEIKRAYRDQLLHTHPDKLTKNTHGTISS-----VTINKIQDAYR 61

Query: 61 VLSDASLRAEYDQ 73
          +LSD   R EYD+
Sbjct: 62 ILSDIRSRCEYDR 74

>TPHA0L00790 Chr12 (150654..151994) [1341 bp, 446 aa] {ON}
          Anc_7.157 YIR004W
          Length = 446

 Score = 59.7 bits (143), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 30/72 (41%), Positives = 44/72 (61%), Gaps = 8/72 (11%)

Query: 2  DYYGLLGVGQDASQDEIKRAYRKLALRHHPDKARGNEGGEDSSDDLPDVDFKEVTAAYQV 61
          +YY LLG+   A+  EIK+AYRK +++ HPDK        + +D      F+ ++ AYQV
Sbjct: 6  EYYDLLGISTTATDIEIKKAYRKKSIKEHPDK--------NPNDPSATERFQAISEAYQV 57

Query: 62 LSDASLRAEYDQ 73
          LSD  LR+ YD+
Sbjct: 58 LSDKQLRSNYDK 69

>TBLA0G00170 Chr7 complement(26304..28283) [1980 bp, 659 aa] {ON}
          Anc_2.15 YNL227C
          Length = 659

 Score = 60.1 bits (144), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 35/70 (50%), Positives = 45/70 (64%), Gaps = 7/70 (10%)

Query: 3  YYGLLGVGQDASQDEIKRAYRKLALRHHPDKARGNEGGEDSSDDLPDVDFKEVTAAYQVL 62
          YY LL V + AS  E+K+AYRK AL++HPDK R  E  E+++       F E+ AAY+VL
Sbjct: 5  YYELLEVSEYASDLELKKAYRKKALQYHPDKNR--ENPEEAT-----AIFSEIRAAYEVL 57

Query: 63 SDASLRAEYD 72
          SD   RA YD
Sbjct: 58 SDPQERAWYD 67

>TBLA0A01100 Chr1 (250770..252074) [1305 bp, 434 aa] {ON}
          Anc_7.157 YIR004W
          Length = 434

 Score = 59.7 bits (143), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 32/74 (43%), Positives = 46/74 (62%), Gaps = 12/74 (16%)

Query: 2  DYYGLLGVGQDASQDEIKRAYRKLALRHHPDKARGNEGGEDSSDDLPDV--DFKEVTAAY 59
          +YY LLGV  +++  EIK+AYRK +++ HPDK   N          PD    F+ ++ AY
Sbjct: 6  EYYDLLGVEPNSTDIEIKKAYRKKSIKLHPDKNPNN----------PDATKKFQAISEAY 55

Query: 60 QVLSDASLRAEYDQ 73
          QVLSD +LR+ YD+
Sbjct: 56 QVLSDKNLRSNYDK 69

>NCAS0A13210 Chr1 (2599196..2600440) [1245 bp, 414 aa] {ON}
          Anc_7.157
          Length = 414

 Score = 59.7 bits (143), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 33/79 (41%), Positives = 47/79 (59%), Gaps = 8/79 (10%)

Query: 3  YYGLLGVGQDASQDEIKRAYRKLALRHHPDKARGNEGGEDSSDDLPDVDFKEVTAAYQVL 62
          YY LLG+   A+  EIK+AYRK +++ HPDK        + +D      F+ ++ AYQVL
Sbjct: 7  YYELLGISPSATAIEIKKAYRKKSIQEHPDK--------NPNDPTATERFQAISEAYQVL 58

Query: 63 SDASLRAEYDQKLAFEAQP 81
          SD +LR +YD+    EA P
Sbjct: 59 SDDTLRLKYDKYGKKEAVP 77

>TBLA0E02490 Chr5 complement(624528..625628) [1101 bp, 366 aa]
          {ON} Anc_7.217 YER048C
          Length = 366

 Score = 59.3 bits (142), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 36/75 (48%), Positives = 43/75 (57%), Gaps = 12/75 (16%)

Query: 1  MDYYGLLGVGQDASQDEIKRAYRKLALRHHPDKARGNEGGEDSSDDLPDVD--FKEVTAA 58
          ++YY +LGV   AS  EIK+AYRK A+  HPDK           DD PD    F+ V  A
Sbjct: 5  LEYYDVLGVSPKASAIEIKKAYRKRAMETHPDK---------HPDD-PDAQAKFQRVGEA 54

Query: 59 YQVLSDASLRAEYDQ 73
          YQVLSD  LR  YD+
Sbjct: 55 YQVLSDEELRKRYDE 69

>NDAI0G04250 Chr7 (1021818..1022909) [1092 bp, 363 aa] {ON}
          Anc_1.398
          Length = 363

 Score = 59.3 bits (142), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 30/70 (42%), Positives = 43/70 (61%), Gaps = 11/70 (15%)

Query: 4  YGLLGVGQDASQDEIKRAYRKLALRHHPDKARGNEGGEDSSDDLPDVDFKEVTAAYQVLS 63
          Y LLGV   A++ EIK+ YRK AL++HPDK  G+              FK+++ AY++LS
Sbjct: 8  YDLLGVTPSANEQEIKKGYRKAALKYHPDKPTGD-----------TEKFKQISEAYEILS 56

Query: 64 DASLRAEYDQ 73
          D++ R  YDQ
Sbjct: 57 DSNKREIYDQ 66

>YER048C Chr5 complement(246982..248157) [1176 bp, 391 aa] {ON}
          CAJ1Nuclear type II J heat shock protein of the E. coli
          dnaJ family, contains a leucine zipper-like motif,
          binds to non-native substrates for presentation to
          Ssa3p, may function during protein translocation,
          assembly and disassembly
          Length = 391

 Score = 59.3 bits (142), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 34/74 (45%), Positives = 45/74 (60%), Gaps = 12/74 (16%)

Query: 2  DYYGLLGVGQDASQDEIKRAYRKLALRHHPDKARGNEGGEDSSDDLPDVD--FKEVTAAY 59
          +YY +LG+  +A+  EIK+AYR+ A+  HPDK           DD PD    F+ V  AY
Sbjct: 6  EYYDILGIKPEATPTEIKKAYRRKAMETHPDK---------HPDD-PDAQAKFQAVGEAY 55

Query: 60 QVLSDASLRAEYDQ 73
          QVLSD  LR++YDQ
Sbjct: 56 QVLSDPGLRSKYDQ 69

>Smik_9.203 Chr9 (339194..340492) [1299 bp, 432 aa] {ON} YIR004W
          (REAL)
          Length = 432

 Score = 59.3 bits (142), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 34/80 (42%), Positives = 47/80 (58%), Gaps = 8/80 (10%)

Query: 2  DYYGLLGVGQDASQDEIKRAYRKLALRHHPDKARGNEGGEDSSDDLPDVDFKEVTAAYQV 61
          +YY LLGV   A+  EIK+AYRK +++ HPDK        + +D      F+ ++ AYQV
Sbjct: 6  EYYDLLGVSTTATAIEIKKAYRKKSIQEHPDK--------NPNDPKATERFQAISEAYQV 57

Query: 62 LSDASLRAEYDQKLAFEAQP 81
          L D  LRA+YD+    EA P
Sbjct: 58 LGDDELRAKYDKYGRKEAIP 77

>KAFR0B04780 Chr2 (994492..995763) [1272 bp, 423 aa] {ON} 
          Length = 423

 Score = 59.3 bits (142), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 33/79 (41%), Positives = 48/79 (60%), Gaps = 8/79 (10%)

Query: 3  YYGLLGVGQDASQDEIKRAYRKLALRHHPDKARGNEGGEDSSDDLPDVDFKEVTAAYQVL 62
          YY LLG+  +A+  EIK+AYRK +++ HPDK   + G  +         F+ ++ AYQVL
Sbjct: 7  YYDLLGITPNATSIEIKKAYRKKSVQEHPDKNPNDPGATER--------FQAISEAYQVL 58

Query: 63 SDASLRAEYDQKLAFEAQP 81
          S+  LRA+YD+    EA P
Sbjct: 59 SNDELRAKYDRLGKQEAVP 77

>ADR015W Chr4 (732199..733509) [1311 bp, 436 aa] {ON} Syntenic
          homolog of Saccharomyces cerevisiae YIR004W (DJP1)
          Length = 436

 Score = 59.3 bits (142), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 35/79 (44%), Positives = 46/79 (58%), Gaps = 8/79 (10%)

Query: 3  YYGLLGVGQDASQDEIKRAYRKLALRHHPDKARGNEGGEDSSDDLPDVDFKEVTAAYQVL 62
          YY LLGV  DA   EIK+AYRK +++ HPDK        + +D      F+ ++ AYQVL
Sbjct: 7  YYDLLGVSPDAKAIEIKKAYRKKSVQEHPDK--------NPNDPKATERFQAISEAYQVL 58

Query: 63 SDASLRAEYDQKLAFEAQP 81
          S   LRA+YD+    EA P
Sbjct: 59 SSDELRAKYDKFGKEEAVP 77

>ZYRO0E04598g Chr5 complement(346758..347831) [1074 bp, 357 aa]
          {ON} some similarities with uniprot|P25294
          Saccharomyces cerevisiae YNL007C SIS1 HSP40 family
          chaperone sit4 suppressor dnaJ homolog
          Length = 357

 Score = 58.9 bits (141), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 29/70 (41%), Positives = 43/70 (61%), Gaps = 11/70 (15%)

Query: 4  YGLLGVGQDASQDEIKRAYRKLALRHHPDKARGNEGGEDSSDDLPDVDFKEVTAAYQVLS 63
          Y +LGV   A++ E+K+ Y+K AL++HPDK  G+              FKE++ AY++LS
Sbjct: 8  YDMLGVSPSANEQELKKGYKKAALKYHPDKPAGD-----------TEKFKEISEAYEILS 56

Query: 64 DASLRAEYDQ 73
          D+S R  YDQ
Sbjct: 57 DSSKREIYDQ 66

 Score = 43.5 bits (101), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 36/137 (26%), Positives = 61/137 (44%), Gaps = 12/137 (8%)

Query: 235 ENKVVTINIKKGTLDGDKIVLKGEADEDLESTEVGDLVIKIQEVKEPQYDIVRNGYDLII 294
           E   + I +K G   G KI  K E D + ++     L   +QE   P Y   R+G +LI 
Sbjct: 218 EKTQIDIQLKPGWKAGTKITYKNEGDYNPQTGGRKTLQFVLQEKSHPLYK--RDGDNLIY 275

Query: 295 KKQIDLADAICGFDEKPLMETYDGRVLKWSSKRGKVIRPNDIVRIQNEGWPRREDANDNN 354
              +   +++ GF +   ++T DGR L  S  + + ++P ++     +G P  +      
Sbjct: 276 SLPLSFKESLLGFSK--TIQTIDGRTLPIS--KIQPVQPTEVSSYPGQGMPVSKRPG--- 328

Query: 355 TLLKNGDLYVIVDIVFP 371
              + GDL V   I +P
Sbjct: 329 ---QRGDLVVKYKIDYP 342

>NCAS0E02930 Chr5 (572593..573756) [1164 bp, 387 aa] {ON}
          Anc_7.217
          Length = 387

 Score = 58.9 bits (141), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 35/79 (44%), Positives = 44/79 (55%), Gaps = 8/79 (10%)

Query: 3  YYGLLGVGQDASQDEIKRAYRKLALRHHPDKARGNEGGEDSSDDLPDVDFKEVTAAYQVL 62
          YY +LGV   A+  EIK+AYR+ A++ HPDK           D      F+EV  AYQVL
Sbjct: 7  YYDVLGVQPTATPAEIKKAYRRRAMQTHPDK--------HPDDPEAQAKFQEVGEAYQVL 58

Query: 63 SDASLRAEYDQKLAFEAQP 81
          SD  LR+ YD+    EA P
Sbjct: 59 SDPGLRSRYDEFGKDEAVP 77

>CAGL0H03707g Chr8 complement(341230..342279) [1050 bp, 349 aa]
          {ON} highly similar to uniprot|P25294 Saccharomyces
          cerevisiae YNL007c SIS1 heat shock protein
          Length = 349

 Score = 58.5 bits (140), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 29/70 (41%), Positives = 41/70 (58%), Gaps = 11/70 (15%)

Query: 4  YGLLGVGQDASQDEIKRAYRKLALRHHPDKARGNEGGEDSSDDLPDVDFKEVTAAYQVLS 63
          Y LLG+   A++ EIK+ YRK AL++HPDK  G+              FKE++ A+++LS
Sbjct: 8  YDLLGISPSANEQEIKKGYRKAALKYHPDKPTGDT-----------EKFKEISEAFEILS 56

Query: 64 DASLRAEYDQ 73
          D   R  YDQ
Sbjct: 57 DPQKREVYDQ 66

 Score = 43.1 bits (100), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 34/111 (30%), Positives = 52/111 (46%), Gaps = 6/111 (5%)

Query: 235 ENKVVTINIKKGTLDGDKIVLKGEADEDLESTEVGDLVIKIQEVKEPQYDIVRNGYDLII 294
           E   V I +K G   G KI  K   D +  +     L   IQE K P +   R+G DLI 
Sbjct: 210 EKTQVDIQLKPGWKAGTKITYKNYGDYNPATGRRKTLQFIIQEKKHPFF--TRDGNDLIY 267

Query: 295 KKQIDLADAICGFDEKPLMETYDGRVLKWSSKRGKVIRPNDIVRIQNEGWP 345
              +   +++ GF++   ++T DGR L  S  R + I+P++      +G P
Sbjct: 268 TLPLTFKESLLGFNK--TIQTIDGRTLPVS--RIQPIQPSEKSTYPGQGMP 314

>ZYRO0D16390g Chr4 complement(1366068..1367264) [1197 bp, 398 aa]
          {ON} similar to uniprot|P39101 YER048C Saccharomyces
          cerevisiae CAJ1 Nuclear type II J heat shock protein of
          the E. coli dnaJ family
          Length = 398

 Score = 58.5 bits (140), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 32/72 (44%), Positives = 42/72 (58%), Gaps = 8/72 (11%)

Query: 2  DYYGLLGVGQDASQDEIKRAYRKLALRHHPDKARGNEGGEDSSDDLPDVDFKEVTAAYQV 61
          +YY  LG+   A+  EIK+AYR+ A+  HPDK   +   E+         F+ V  AYQV
Sbjct: 6  EYYDRLGISPTATPTEIKKAYRRKAMETHPDKHPDDPEAENK--------FQAVGEAYQV 57

Query: 62 LSDASLRAEYDQ 73
          LSD SLRA YD+
Sbjct: 58 LSDESLRARYDE 69

>TPHA0C01260 Chr3 (287466..288608) [1143 bp, 380 aa] {ON}
          Anc_7.217 YER048C
          Length = 380

 Score = 58.5 bits (140), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 32/72 (44%), Positives = 43/72 (59%), Gaps = 8/72 (11%)

Query: 2  DYYGLLGVGQDASQDEIKRAYRKLALRHHPDKARGNEGGEDSSDDLPDVDFKEVTAAYQV 61
          +YY +LGV  +A+  +IK+AYRK A++ HPDK           D      F+ V  AYQV
Sbjct: 6  EYYDVLGVTPEATPTDIKKAYRKKAMQTHPDK--------HPDDPEAQSKFQAVGEAYQV 57

Query: 62 LSDASLRAEYDQ 73
          LSD  LR++YDQ
Sbjct: 58 LSDPGLRSKYDQ 69

>CAGL0L00957g Chr12 (112612..113733) [1122 bp, 373 aa] {ON}
          similar to uniprot|P39101 Saccharomyces cerevisiae
          YER048c CAJ1
          Length = 373

 Score = 58.2 bits (139), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 32/72 (44%), Positives = 41/72 (56%), Gaps = 8/72 (11%)

Query: 2  DYYGLLGVGQDASQDEIKRAYRKLALRHHPDKARGNEGGEDSSDDLPDVDFKEVTAAYQV 61
          +YY +LGV  +A+  EIK+AYR+ A+  HPDK          +D      F+ V  AYQV
Sbjct: 6  EYYDILGVKPEATSAEIKKAYRRRAMETHPDK--------HPNDPNAQAKFQAVGEAYQV 57

Query: 62 LSDASLRAEYDQ 73
          LSD  LR  YDQ
Sbjct: 58 LSDDELRKRYDQ 69

>KAFR0C03160 Chr3 complement(633466..634962) [1497 bp, 498 aa] {ON}
           Anc_8.61 YFL016C
          Length = 498

 Score = 58.5 bits (140), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 96/408 (23%), Positives = 158/408 (38%), Gaps = 76/408 (18%)

Query: 2   DYYGLLGVGQDASQDEIKRAYRKLALRHHPDKARGNEGGEDSSDDLPDVDFKEVTAAYQV 61
           D Y  LG+  +ASQ +IK+AY KLA ++HPD  +         ++  +  F ++  AY++
Sbjct: 47  DPYKTLGINSNASQSDIKKAYYKLAKKYHPDINK---------EENAEAKFHDLQNAYEI 97

Query: 62  LSDASLRAEYDQ--KLAFE--------AQPYXXXXXXXXXXXXXXXXHPG------HRSG 105
           LSD   R +YDQ    AF+        + P+                  G        + 
Sbjct: 98  LSDEQKRKQYDQFGPSAFDPNINTSGNSNPFTSDPFGFGTTNNPFSDFGGINFEDLFGNA 157

Query: 106 FDSGRGA----------RRYKSDDIEIDLKVKTSELYRGXXXXXXXXXXXX-CQRCDGTG 154
           F                R +K D I ++  +   +   G             C  C+G+G
Sbjct: 158 FKQQHSNNTSNSNRNFFREFKGDTIHLNYNLNFKDSVFGKKNVKLNFNSFDPCNTCNGSG 217

Query: 155 WKSHASIVKKKTAKFFWNVCEGCEGQGVRQRLRQLAPGFVTTELIECRQCGGKGKLRNLP 214
            K +A    K T       C+ C G G R  +R    GF    +  C  C G+G      
Sbjct: 218 LKHNA---HKST-------CQTCNGTGTRVHIRG---GF--QMMSTCNDCNGEGT----- 257

Query: 215 KSEKNK-CPDCITSGTVGMVEENKVVTINIKKGTLDGDKIVLKGEA-------DEDLEST 266
           K + N  C  C   G     + NK +T+++     DGD I +  +        D DL + 
Sbjct: 258 KIDPNDYCNHCHGDGV--EFKRNKEITVDLPNALQDGDVIRVSNKGSYPQMAMDPDLINN 315

Query: 267 E-----VGDLVIKIQEVKEPQYDIVRNGYDLIIKKQIDLADAICGFDEKPLMETYDGRVL 321
                  GD++IKI  + + ++ I R+ YD+    +I +  A  G      + + DG  +
Sbjct: 316 NNVRMTRGDILIKINVINDTKFKI-RDKYDIWYTMEIPITTAALG--GIVTIPSIDGTNV 372

Query: 322 KWSSKRGKVIRPNDIVRIQNEGWPRREDANDNNTLLKNGDLYVIVDIV 369
           +     G   + + I+ I N G PR    + +      G++ V   I+
Sbjct: 373 RLRVSPG--TQNDQIISIPNMGVPRSNIFSRSTNTTNRGNMKVQYKII 418

>Kpol_457.15 s457 (41492..42565) [1074 bp, 357 aa] {ON}
          (41492..42565) [1074 nt, 358 aa]
          Length = 357

 Score = 58.2 bits (139), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 30/70 (42%), Positives = 41/70 (58%), Gaps = 11/70 (15%)

Query: 4  YGLLGVGQDASQDEIKRAYRKLALRHHPDKARGNEGGEDSSDDLPDVDFKEVTAAYQVLS 63
          Y LL V   A++ EIK+ YRK AL++HPDK  G+              FKE++ A+++LS
Sbjct: 8  YDLLNVSPTANEQEIKKGYRKAALKYHPDKPTGD-----------TEKFKEISEAFEILS 56

Query: 64 DASLRAEYDQ 73
          DA  R  YDQ
Sbjct: 57 DAEKREVYDQ 66

>Suva_9.213 Chr9 (350204..351499) [1296 bp, 431 aa] {ON} YIR004W
          (REAL)
          Length = 431

 Score = 58.2 bits (139), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 34/80 (42%), Positives = 46/80 (57%), Gaps = 8/80 (10%)

Query: 2  DYYGLLGVGQDASQDEIKRAYRKLALRHHPDKARGNEGGEDSSDDLPDVDFKEVTAAYQV 61
          +YY LLGV   AS  EIK+AYRK +++ HPDK        + +D      F+ ++ AYQV
Sbjct: 6  EYYDLLGVSTTASAIEIKKAYRKKSIQEHPDK--------NPNDPKATERFQAISEAYQV 57

Query: 62 LSDASLRAEYDQKLAFEAQP 81
          L D  LR +YD+    EA P
Sbjct: 58 LGDNELRVKYDKYGRKEAIP 77

>Smik_5.173 Chr5 complement(251699..252874) [1176 bp, 391 aa] {ON}
          YER048C (REAL)
          Length = 391

 Score = 58.2 bits (139), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 32/74 (43%), Positives = 44/74 (59%), Gaps = 12/74 (16%)

Query: 2  DYYGLLGVGQDASQDEIKRAYRKLALRHHPDKARGNEGGEDSSDDLPDVD--FKEVTAAY 59
          +YY +LG+  +A+  EIK+AYR+ A+  HPDK            D PD    F+ V  AY
Sbjct: 6  EYYDILGIKPEATSTEIKKAYRRKAMETHPDK----------HPDDPDAQAKFQAVGEAY 55

Query: 60 QVLSDASLRAEYDQ 73
          QVLSD  LR++YD+
Sbjct: 56 QVLSDPGLRSKYDE 69

>Suva_5.150 Chr5 complement(223538..224713) [1176 bp, 391 aa] {ON}
          YER048C (REAL)
          Length = 391

 Score = 58.2 bits (139), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 33/74 (44%), Positives = 45/74 (60%), Gaps = 12/74 (16%)

Query: 2  DYYGLLGVGQDASQDEIKRAYRKLALRHHPDKARGNEGGEDSSDDLPDVD--FKEVTAAY 59
          +YY +LG+  +A+  EIK+AYR+ A+  HPDK           DD PD    F+ V  AY
Sbjct: 6  EYYDILGIKPEATATEIKKAYRRKAMETHPDK---------HPDD-PDAQAKFQAVGEAY 55

Query: 60 QVLSDASLRAEYDQ 73
          QVLSD  LR++YD+
Sbjct: 56 QVLSDQGLRSKYDE 69

>Ecym_4469 Chr4 complement(953409..954710) [1302 bp, 433 aa] {ON}
          similar to Ashbya gossypii ADR015W
          Length = 433

 Score = 58.2 bits (139), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 34/79 (43%), Positives = 46/79 (58%), Gaps = 8/79 (10%)

Query: 3  YYGLLGVGQDASQDEIKRAYRKLALRHHPDKARGNEGGEDSSDDLPDVDFKEVTAAYQVL 62
          YY LLGV  DA Q +IK+AYRK +++ HPDK        + +D      F+ ++ AYQVL
Sbjct: 7  YYDLLGVSPDAKQIDIKKAYRKKSVQEHPDK--------NPNDPKATERFQAISEAYQVL 58

Query: 63 SDASLRAEYDQKLAFEAQP 81
              LRA+YD+    EA P
Sbjct: 59 GSDELRAKYDKFGKDEAVP 77

>KAFR0H03150 Chr8 (601486..602565) [1080 bp, 359 aa] {ON}
          Anc_1.398 YNL007C
          Length = 359

 Score = 57.8 bits (138), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 30/70 (42%), Positives = 41/70 (58%), Gaps = 11/70 (15%)

Query: 4  YGLLGVGQDASQDEIKRAYRKLALRHHPDKARGNEGGEDSSDDLPDVDFKEVTAAYQVLS 63
          Y LLGV   A+  EIK+ YRK AL++HPDK  G+              FKE++ A+++LS
Sbjct: 8  YDLLGVSPSANDQEIKKGYRKAALKYHPDKPTGD-----------TEKFKEISEAFEILS 56

Query: 64 DASLRAEYDQ 73
          D + R  YDQ
Sbjct: 57 DKNKREVYDQ 66

>Kwal_47.18133 s47 complement(703122..704303) [1182 bp, 393 aa]
          {ON} YER048C (CAJ1) - homologous to E. coli DnaJ
          [contig 197] FULL
          Length = 393

 Score = 57.8 bits (138), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 32/72 (44%), Positives = 41/72 (56%), Gaps = 8/72 (11%)

Query: 2  DYYGLLGVGQDASQDEIKRAYRKLALRHHPDKARGNEGGEDSSDDLPDVDFKEVTAAYQV 61
          +YY LLG+  DAS  +IK+AYRK A+  HPDK           D      F+ +  AYQV
Sbjct: 6  EYYDLLGLQPDASATDIKKAYRKKAMLTHPDK--------HPDDPEAQAKFQAIGEAYQV 57

Query: 62 LSDASLRAEYDQ 73
          LSD  LR+ YD+
Sbjct: 58 LSDPDLRSRYDE 69

>ZYRO0G03850g Chr7 complement(307633..308889) [1257 bp, 418 aa]
          {ON} similar to gnl|GLV|CAGL0J01936g Candida glabrata
          CAGL0J01936g and some similarites with uniprot|P40564
          YIR004W Saccharomyces cerevisiae DJP1 Cytosolic
          J-domain- containing protein, required for peroxisomal
          protein import
          Length = 418

 Score = 57.8 bits (138), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 31/72 (43%), Positives = 43/72 (59%), Gaps = 8/72 (11%)

Query: 2  DYYGLLGVGQDASQDEIKRAYRKLALRHHPDKARGNEGGEDSSDDLPDVDFKEVTAAYQV 61
          +YY LLGV   A+  EIK+AYRK ++  HPDK R +    +         F+ ++ AYQV
Sbjct: 6  EYYDLLGVEVTATDVEIKKAYRKKSILEHPDKNRDDPAATER--------FQSISEAYQV 57

Query: 62 LSDASLRAEYDQ 73
          LS+  LRA YD+
Sbjct: 58 LSNKDLRANYDK 69

>KLLA0D04818g Chr4 complement(411615..412679) [1065 bp, 354 aa]
          {ON} similar to gnl|GLV|CAGL0H03707g Candida glabrata
          CAGL0H03707g and some similarites with YNL007C
          uniprot|P25294 Saccharomyces cerevisiae YNL007C SIS1
          HSP40 family chaperone sit4 suppressor dnaJ homolog
          Length = 354

 Score = 57.4 bits (137), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 29/69 (42%), Positives = 40/69 (57%), Gaps = 11/69 (15%)

Query: 4  YGLLGVGQDASQDEIKRAYRKLALRHHPDKARGNEGGEDSSDDLPDVDFKEVTAAYQVLS 63
          Y LLG+   A + EIK+ YRK AL++HPDK  G+              FKE++ A+++LS
Sbjct: 8  YDLLGISPSAGEAEIKKGYRKAALKYHPDKPTGD-----------TEKFKEISEAFEILS 56

Query: 64 DASLRAEYD 72
          DA  R  YD
Sbjct: 57 DAQKREVYD 65

 Score = 43.1 bits (100), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 41/151 (27%), Positives = 63/151 (41%), Gaps = 20/151 (13%)

Query: 225 ITSGTVGMVEENKVVTINIKKGTLDGDKIVLKGEADEDLESTEVGDLVIKIQEVKEPQYD 284
           IT    G V E   + I +K G   G KI  KGE D +  +     L   +QE  +P   
Sbjct: 205 ITRKGAGGVSEKNQIDIQLKPGWKAGTKITFKGEGDYNPRTGGRQTLQFVLQE--KPHEF 262

Query: 285 IVRNGYDLIIKKQIDLADAICGFDEKPLMETYDGRVLKWSSKRGKVIRPNDIVRIQNEGW 344
             R   DLI    +   +++ GF ++  ++T DG+ +  +  R + I+P        +G 
Sbjct: 263 FTRQDNDLIYTLPLSFKESLLGFSKQ--VQTIDGKTIPIT--RTQPIQPTQTSTYPGQGM 318

Query: 345 PRREDANDNNTLLKN----GDLYVIVDIVFP 371
                     TL KN    GDL +   I +P
Sbjct: 319 ----------TLSKNPSQRGDLIIKFKIDYP 339

>SAKL0F08052g Chr6 complement(616679..617860) [1182 bp, 393 aa]
          {ON} highly similar to uniprot|P39101 YER048C
          Saccharomyces cerevisiae CAJ1 Nuclear type II J heat
          shock protein of the E. coli dnaJ family
          Length = 393

 Score = 57.8 bits (138), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 33/74 (44%), Positives = 42/74 (56%), Gaps = 12/74 (16%)

Query: 2  DYYGLLGVGQDASQDEIKRAYRKLALRHHPDKARGNEGGEDSSDDLPDVD--FKEVTAAY 59
          +YY  LG+  DA+  EIK+AYRK A+  HPDK   +          PD    F+ V  AY
Sbjct: 6  EYYDALGISPDATPTEIKKAYRKKAMLTHPDKHPND----------PDAQAKFQAVGQAY 55

Query: 60 QVLSDASLRAEYDQ 73
          QVLSD  LR+ YD+
Sbjct: 56 QVLSDPGLRSRYDE 69

>Skud_14.320 Chr14 complement(585268..586374) [1107 bp, 368 aa]
          {ON} YNL007C (REAL)
          Length = 368

 Score = 57.4 bits (137), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 29/70 (41%), Positives = 42/70 (60%), Gaps = 11/70 (15%)

Query: 4  YGLLGVGQDASQDEIKRAYRKLALRHHPDKARGNEGGEDSSDDLPDVDFKEVTAAYQVLS 63
          Y LLGV   A++ E+K+ YRK AL++HPDK  G+              FKE++ A+++L+
Sbjct: 8  YDLLGVSPTANEQELKKGYRKAALKYHPDKPTGD-----------TEKFKEISEAFEILN 56

Query: 64 DASLRAEYDQ 73
          DA  R  YDQ
Sbjct: 57 DAQKREIYDQ 66

>CAGL0J02750g Chr10 complement(273009..274157) [1149 bp, 382 aa]
          {ON} highly similar to uniprot|P39101 Saccharomyces
          cerevisiae YER048c CAJ1
          Length = 382

 Score = 57.4 bits (137), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 29/72 (40%), Positives = 43/72 (59%), Gaps = 8/72 (11%)

Query: 2  DYYGLLGVGQDASQDEIKRAYRKLALRHHPDKARGNEGGEDSSDDLPDVDFKEVTAAYQV 61
          ++Y +LG+  +A+  EIK+AYRK+A+  HPDK           D      F+ V  AYQV
Sbjct: 6  EFYDVLGISPEATPSEIKKAYRKMAMLTHPDK--------HPDDPEAQAKFQAVGEAYQV 57

Query: 62 LSDASLRAEYDQ 73
          L+D +LR +YD+
Sbjct: 58 LNDPALRKQYDE 69

>Ecym_5626 Chr5 (1262223..1262954) [732 bp, 243 aa] {ON} similar
          to Ashbya gossypii AFL190C
          Length = 243

 Score = 56.2 bits (134), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 29/71 (40%), Positives = 43/71 (60%), Gaps = 9/71 (12%)

Query: 3  YYGLLGVGQDASQDEIKRAYRKLALRHHPDKARGNEGGEDSSDDLPDVDFKEVTAAYQVL 62
          +Y LL + ++AS  ++K+AYRKLA++ HPDK R     E          FK++  A++VL
Sbjct: 25 FYELLQIDKEASDSDVKKAYRKLAIKLHPDKNRHPRAAE---------AFKKINRAFEVL 75

Query: 63 SDASLRAEYDQ 73
          SD + R  YDQ
Sbjct: 76 SDENKRKVYDQ 86

>KLTH0F13398g Chr6 (1101625..1102884) [1260 bp, 419 aa] {ON}
          similar to uniprot|P40564 YIR004W Saccharomyces
          cerevisiae DJP1 Cytosolic J-domain-containing protein,
          required for peroxisomal protein import
          Length = 419

 Score = 57.4 bits (137), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 34/79 (43%), Positives = 46/79 (58%), Gaps = 8/79 (10%)

Query: 3  YYGLLGVGQDASQDEIKRAYRKLALRHHPDKARGNEGGEDSSDDLPDVDFKEVTAAYQVL 62
          YY LLGV  DA   +IK+AYRK +++ HPDK        + +D      F+ ++ AYQVL
Sbjct: 7  YYDLLGVSPDAKSIDIKKAYRKKSVQEHPDK--------NPNDPTATERFQAISQAYQVL 58

Query: 63 SDASLRAEYDQKLAFEAQP 81
          S   LRA+YD+    EA P
Sbjct: 59 SKDDLRAKYDKFGKEEAVP 77

>ABL194C Chr2 complement(42210..43868) [1659 bp, 552 aa] {ON}
          Syntenic homolog of Saccharomyces cerevisiae YNL227C
          Length = 552

 Score = 57.4 bits (137), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 33/70 (47%), Positives = 44/70 (62%), Gaps = 7/70 (10%)

Query: 3  YYGLLGVGQDASQDEIKRAYRKLALRHHPDKARGNEGGEDSSDDLPDVDFKEVTAAYQVL 62
          YY LLGV   AS  ++K+AYR+ AL++HPDK   N G    + ++    F  + AAY+VL
Sbjct: 5  YYELLGVDSGASDTDLKKAYRRKALQYHPDK---NIGNVQQATEI----FASIRAAYEVL 57

Query: 63 SDASLRAEYD 72
          SDA  RA YD
Sbjct: 58 SDAQERAWYD 67

>NCAS0G03610 Chr7 (674056..675039) [984 bp, 327 aa] {ON} Anc_1.398
          Length = 327

 Score = 56.6 bits (135), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 28/70 (40%), Positives = 42/70 (60%), Gaps = 11/70 (15%)

Query: 4  YGLLGVGQDASQDEIKRAYRKLALRHHPDKARGNEGGEDSSDDLPDVDFKEVTAAYQVLS 63
          Y LLGV   A++ E+K+ YRK AL++HPDK  G+              FKE++ A+++L+
Sbjct: 8  YDLLGVSPTANEQELKKGYRKAALKYHPDKPTGD-----------TEKFKEISEAFEILN 56

Query: 64 DASLRAEYDQ 73
          D + R  YDQ
Sbjct: 57 DPNTREVYDQ 66

>KAFR0L00740 Chr12 complement(141062..142156) [1095 bp, 364 aa]
          {ON} Anc_7.217 YER048C
          Length = 364

 Score = 57.0 bits (136), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 34/74 (45%), Positives = 42/74 (56%), Gaps = 12/74 (16%)

Query: 2  DYYGLLGVGQDASQDEIKRAYRKLALRHHPDKARGNEGGEDSSDDLPDVD--FKEVTAAY 59
          +YY +LG+   A+  EIK+AYRK A+  HPDK           DD PD    F+ V  AY
Sbjct: 6  EYYDILGIQPSATSTEIKKAYRKKAMETHPDK---------HPDD-PDAQSKFQSVGEAY 55

Query: 60 QVLSDASLRAEYDQ 73
          QVLSD  LR  YD+
Sbjct: 56 QVLSDDDLRKRYDE 69

>NCAS0C03950 Chr3 complement(798535..800094) [1560 bp, 519 aa] {ON}
           Anc_8.61
          Length = 519

 Score = 57.4 bits (137), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 100/445 (22%), Positives = 170/445 (38%), Gaps = 95/445 (21%)

Query: 2   DYYGLLGVGQDASQDEIKRAYRKLALRHHPDKARGNEGGEDSSDDLPDVDFKEVTAAYQV 61
           D Y +LG+ + A+  EIK+AY KLA ++HPD  +         +   +  F ++  AY++
Sbjct: 51  DPYKVLGINKSATSSEIKKAYYKLAKKYHPDINK---------EPTAEKKFHDLQNAYEI 101

Query: 62  LSDASLRAEYDQ--KLAFEA----------QPYXXXXXXXXXXXXXXXXHPG-------- 101
           LSD + +++YD     AF             P+                  G        
Sbjct: 102 LSDETKKSQYDTFGSAAFNQDGSGGASSANNPFAGGFSSSGGPGGNPFTDFGINFEDLFG 161

Query: 102 -------------HRSGFDSGRGARR------YKSDDIEIDLKVKTSELYRGXXXXXXXX 142
                         RSG     GARR      +K D +EI  ++   +   G        
Sbjct: 162 AAFGGGAGTGPGGARSG-----GARRSNMYREFKGDPLEITHRIPFKDAVFGLANVSLKY 216

Query: 143 XXX-XCQRCDGTGWKSHASIVKKKTAKFFWNVCEGCEGQGVRQRLRQLAPGFVTTELIEC 201
                C  C G+G K  A            + C  C G G +  +R    GF       C
Sbjct: 217 NVMDPCHTCHGSGIKQGAQ----------KHQCPSCHGSGQKVHIRS---GFQMVST--C 261

Query: 202 RQCGGKGKLRNLPKSEKNKCPDCITSGTVGMVEENKVVTINIKKGTLDGDKIVLKGEA-- 259
            +C G+G + N      + C  C   G       +  + +N+  G  DGD I + G+   
Sbjct: 262 NECHGEGTILN----ASDYCGTC--HGDAVEFTRDHSINVNLPNGLQDGDVIRIPGQGNY 315

Query: 260 -----DEDLEST---EVGDLVIKIQEVKEPQYDIVRNGYDLIIKKQIDLADAICGFDEKP 311
                D +L+++     GD++++I+  K+ ++ I ++ YD+   K I +  A  G     
Sbjct: 316 PQMALDPELKNSVKLTRGDVLVRIRVDKDNRFSI-KDKYDIWFTKDIPITTAALG--GIV 372

Query: 312 LMETYDGRVLKWSSKRGKVIRPNDIVRIQNEGWPRREDANDNNTLLKNGDLYVIVDIVFP 371
            + T DG  L+   + G   + + ++ I N G PR     +N      G++ V   IV  
Sbjct: 373 TIPTVDGTTLRLKVQAG--TQHDQVISIPNLGVPRSSINKEN-----RGNMKVQYRIVIR 425

Query: 372 PDNWTMEVNDYRAVRNIIPSTINKR 396
                 E   + A+ ++   T+ +R
Sbjct: 426 KPQSQAEKCLWEALADVTNDTMARR 450

>SAKL0F04444g Chr6 complement(357126..358415) [1290 bp, 429 aa]
          {ON} similar to uniprot|P40564 YIR004W Saccharomyces
          cerevisiae DJP1 Cytosolic J-domain-containing protein,
          required for peroxisomal protein import
          Length = 429

 Score = 57.0 bits (136), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 33/79 (41%), Positives = 46/79 (58%), Gaps = 8/79 (10%)

Query: 3  YYGLLGVGQDASQDEIKRAYRKLALRHHPDKARGNEGGEDSSDDLPDVDFKEVTAAYQVL 62
          YY LLGV  +A   EIK+AYRK +++ HPDK        + +D      F+ ++ AYQVL
Sbjct: 7  YYDLLGVSPNARPIEIKKAYRKKSVQEHPDK--------NPNDPSATERFQSISQAYQVL 58

Query: 63 SDASLRAEYDQKLAFEAQP 81
          S+  LR +YD+    EA P
Sbjct: 59 SNEELRTKYDKFGKEEAVP 77

>Suva_14.116 Chr14 complement(214797..216599) [1803 bp, 600 aa]
          {ON} YNL227C (REAL)
          Length = 600

 Score = 57.0 bits (136), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 34/70 (48%), Positives = 45/70 (64%), Gaps = 7/70 (10%)

Query: 3  YYGLLGVGQDASQDEIKRAYRKLALRHHPDKARGNEGGEDSSDDLPDVDFKEVTAAYQVL 62
          YY LLGV   AS  E+K+AYRK AL++HPDK   N   E++++      F  + AAY+VL
Sbjct: 5  YYELLGVESHASDLELKKAYRKKALQYHPDKNPDN--VEEATE-----KFAIIRAAYEVL 57

Query: 63 SDASLRAEYD 72
          SD+  RA YD
Sbjct: 58 SDSQERAWYD 67

>CAGL0C04565g Chr3 (435373..435900) [528 bp, 175 aa] {ON} similar
          to uniprot|P47138 Saccharomyces cerevisiae YJR097w
          Length = 175

 Score = 54.3 bits (129), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 32/76 (42%), Positives = 46/76 (60%), Gaps = 3/76 (3%)

Query: 1  MDYYGLLGVGQDASQDEIKRAYRKLALRHHPDKARGNEGGEDSSDDL-PDVDFKEVTAAY 59
          + +Y +LGV  DAS DEIK  YRK+ L  HPDK++      DS+  +   V   ++  AY
Sbjct: 9  ISHYEVLGVPVDASTDEIKLTYRKMLLTLHPDKSKTVPI--DSTIKIRSGVSINQIQEAY 66

Query: 60 QVLSDASLRAEYDQKL 75
          +VLS+  LRA Y++ L
Sbjct: 67 RVLSNDQLRAAYNRAL 82

>TPHA0A02810 Chr1 complement(606816..608294) [1479 bp, 492 aa]
          {ON} Anc_1.185 YJL162C
          Length = 492

 Score = 56.6 bits (135), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 29/70 (41%), Positives = 41/70 (58%), Gaps = 9/70 (12%)

Query: 3  YYGLLGVGQDASQDEIKRAYRKLALRHHPDKARGNEGGEDSSDDLPDVDFKEVTAAYQVL 62
          +Y +LG+   AS ++IK++Y+KLA   HPDK++ NE  E          FK V  AY +L
Sbjct: 8  HYSVLGLTPTASLNDIKKSYKKLARELHPDKSKSNESSE---------LFKIVVDAYSIL 58

Query: 63 SDASLRAEYD 72
          SD   R EY+
Sbjct: 59 SDVKEREEYN 68

>Smik_14.321 Chr14 complement(576829..577929) [1101 bp, 366 aa]
          {ON} YNL007C (REAL)
          Length = 366

 Score = 56.2 bits (134), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 28/70 (40%), Positives = 42/70 (60%), Gaps = 11/70 (15%)

Query: 4  YGLLGVGQDASQDEIKRAYRKLALRHHPDKARGNEGGEDSSDDLPDVDFKEVTAAYQVLS 63
          Y LLGV   A++ E+K+ YRK AL++HPDK  G+              FKE++ A+++L+
Sbjct: 8  YDLLGVSPTANEQELKKGYRKAALKYHPDKPTGD-----------TEKFKEISEAFEILN 56

Query: 64 DASLRAEYDQ 73
          D+  R  YDQ
Sbjct: 57 DSQKREIYDQ 66

>Kpol_499.30 s499 (76723..77949) [1227 bp, 408 aa] {ON}
          (76723..77949) [1227 nt, 409 aa]
          Length = 408

 Score = 56.2 bits (134), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 30/72 (41%), Positives = 44/72 (61%), Gaps = 8/72 (11%)

Query: 2  DYYGLLGVGQDASQDEIKRAYRKLALRHHPDKARGNEGGEDSSDDLPDVDFKEVTAAYQV 61
          +YY LL +   A+  EIK+AYRK +++ HPDK        + +D      F+ ++ AYQV
Sbjct: 6  EYYDLLDIDITATAIEIKKAYRKKSIKEHPDK--------NPNDPTATERFQAISEAYQV 57

Query: 62 LSDASLRAEYDQ 73
          LSD +LRA YD+
Sbjct: 58 LSDKNLRANYDK 69

>Ecym_1450 Chr1 (930504..931982) [1479 bp, 492 aa] {ON} similar to
           Ashbya gossypii AFR507W
          Length = 492

 Score = 56.6 bits (135), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 64/245 (26%), Positives = 104/245 (42%), Gaps = 37/245 (15%)

Query: 113 RRYKSDDIEIDLKVKTSELYRGXXXXXXXXXXX-XCQRCDGTGWKSHASIVKKKTAKFFW 171
           R YK D I +   V   +   G             C  C G+G KS A    K+++    
Sbjct: 184 REYKGDSIHVPFNVSFKDAVFGLKGIKLKYSAYDQCGTCAGSGLKSGA----KRSS---- 235

Query: 172 NVCEGCEGQGVRQRLRQLAPGFVTTELIECRQCGGKGKLRNLPKSEKNKCPDCITSGTVG 231
             C  C G G +  +R    GF       C QC G+G   ++ +S++  C  C   G V 
Sbjct: 236 --CSICHGTGTQMHVR---AGFQMAST--CTQCNGEGS--SIRRSDQ--CSSCRGEGVV- 283

Query: 232 MVEENKVVTINIKKGTLDGD--KIVLKG-----EADEDLEST---EVGDLVIKIQEVKEP 281
                K + +++  G  DGD  K+  +G     + D ++  T     GDL+I+I+  ++P
Sbjct: 284 -FNRQKEIDVDLPHGLQDGDVVKVPSQGSFPHVQVDPEMSHTIRTRRGDLLIQIRVERDP 342

Query: 282 QYDIVRNGYDLIIKKQIDLADAICGFDEKPLMETYDGRVLKWSSKRGKVIRPNDIVRIQN 341
           ++ I RN YD+   + I +  A  G      + T DG  L+     G   +   +V + N
Sbjct: 343 RFQI-RNNYDIWYTQDIPITTAALGGVVN--IPTVDGEQLRLKIAPG--TQHEQVVSVPN 397

Query: 342 EGWPR 346
           +G P+
Sbjct: 398 KGVPK 402

 Score = 40.8 bits (94), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 33/72 (45%), Positives = 45/72 (62%), Gaps = 9/72 (12%)

Query: 2   DYYGLLGVGQDASQDEIKRAYRKLALRHHPDKARGNEGGEDSSDDLPDVDFKEVTAAYQV 61
           D Y  LGV +DAS  +IK+AY KLA ++HPD  + +EG E    DL +        AY++
Sbjct: 51  DPYETLGVSRDASTSQIKKAYYKLAKKYHPDINK-DEGAEKKFHDLQN--------AYEI 101

Query: 62  LSDASLRAEYDQ 73
           LSD S R++YDQ
Sbjct: 102 LSDESKRSQYDQ 113

>NDAI0F03800 Chr6 (902416..904332) [1917 bp, 638 aa] {ON} Anc_2.15
          Length = 638

 Score = 56.6 bits (135), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 34/70 (48%), Positives = 43/70 (61%), Gaps = 7/70 (10%)

Query: 3  YYGLLGVGQDASQDEIKRAYRKLALRHHPDKARGNEGGEDSSDDLPDVDFKEVTAAYQVL 62
          YY LLGV   AS  E+K+AYRK AL+ HPDK        D+ D+  + +F  + AAY+VL
Sbjct: 5  YYELLGVEVTASDAELKKAYRKKALQFHPDK------NPDNVDEATE-NFATIRAAYEVL 57

Query: 63 SDASLRAEYD 72
          SD   RA YD
Sbjct: 58 SDPQERAWYD 67

>YNL007C Chr14 complement(618507..619565) [1059 bp, 352 aa] {ON}
          SIS1Type II HSP40 co-chaperone that interacts with the
          HSP70 protein Ssa1p; not functionally redundant with
          Ydj1p due to due to substrate specificity; shares
          similarity with bacterial DnaJ proteins
          Length = 352

 Score = 55.8 bits (133), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 28/70 (40%), Positives = 41/70 (58%), Gaps = 11/70 (15%)

Query: 4  YGLLGVGQDASQDEIKRAYRKLALRHHPDKARGNEGGEDSSDDLPDVDFKEVTAAYQVLS 63
          Y LLGV   A++ E+K+ YRK AL++HPDK  G+              FKE++ A+++L+
Sbjct: 8  YDLLGVSPSANEQELKKGYRKAALKYHPDKPTGD-----------TEKFKEISEAFEILN 56

Query: 64 DASLRAEYDQ 73
          D   R  YDQ
Sbjct: 57 DPQKREIYDQ 66

>ZYRO0F03652g Chr6 complement(306692..308080) [1389 bp, 462 aa] {ON}
           similar to uniprot|Q752R6 Ashbya gossypii AFR507W
           AFR507Wp and some similarites with YFL016C
           uniprot|P35191 Saccharomyces cerevisiae YFL016C MDJ1
           Protein involved in folding of mitochondrially
           synthesized proteins in the mitochondrial matrix
           localizes to the mitochondrial inner membrane member of
           the DnaJ family of molecular chaperones
          Length = 462

 Score = 56.2 bits (134), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 59/247 (23%), Positives = 107/247 (43%), Gaps = 41/247 (16%)

Query: 113 RRYKSDDIEIDLKVKTSE-LYRGXXXXXXXXXXXXCQRCDGTGWKSHASIVKKKTAKFFW 171
           R Y+ D IE+  ++   + ++              C  CDG+G K+ A            
Sbjct: 161 REYRGDPIEVSYRMPFKDAVFGAKDVNLKFRALDPCHTCDGSGMKTGAKP---------- 210

Query: 172 NVCEGCEGQGVRQRLRQLAPGFVTTELIECRQCGGKGKLRNLPKSEKNKCPDCITSGTVG 231
             C  C G G    +R    GF       C+QCGG+G         ++ C  C   G   
Sbjct: 211 QSCPSCHGTGTTVHVRA---GFQMA--TTCQQCGGEGTT----TKREDLCGSCHGDG--- 258

Query: 232 MVE--ENKVVTINIKKGTLDGDKIVLKGEAD-------EDLEST---EVGDLVIKIQEVK 279
            VE  ++K V +++ +G  DGD + + G+          +++S+     GD++++I+  K
Sbjct: 259 -VEWTKDKSVRVDLPQGLQDGDVVRVPGQGSYPNMAVPPEMKSSIRLRRGDVLVRIRVDK 317

Query: 280 EPQYDIVRNGYDLIIKKQIDLADAICGFDEKPLMETYDGRVLKWSSKRGKVIRPNDIVRI 339
           +P++ I R+ +D+   + I +  A  G   +  + T DG  ++   + G   + + I+ I
Sbjct: 318 DPRFSI-RDKWDIWFIQDIPITTAALGGTVQ--VPTVDGSHVRLRVQPG--TQHDQIISI 372

Query: 340 QNEGWPR 346
            N G PR
Sbjct: 373 PNMGVPR 379

 Score = 38.5 bits (88), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 29/71 (40%), Positives = 42/71 (59%), Gaps = 9/71 (12%)

Query: 2  DYYGLLGVGQDASQDEIKRAYRKLALRHHPDKARGNEGGEDSSDDLPDVDFKEVTAAYQV 61
          D Y  LGVG+ AS  EIK+AY KLA ++HPD  +    G+          F ++  AY++
Sbjct: 33 DPYDTLGVGKSASPSEIKKAYYKLAKKYHPDINKEQGAGD---------KFHDLQNAYEI 83

Query: 62 LSDASLRAEYD 72
          LSDA  +++YD
Sbjct: 84 LSDADKKSQYD 94

>KAFR0C02450 Chr3 (477069..478190) [1122 bp, 373 aa] {ON}
          Anc_7.217 YER048C
          Length = 373

 Score = 55.8 bits (133), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 35/77 (45%), Positives = 42/77 (54%), Gaps = 9/77 (11%)

Query: 3  YYGLLGVGQDASQDEIKRAYRKLALRHHPDKARGNEGGEDSSDDLPDVDFKEVTAAYQVL 62
          YY LLGV  DA+  EIK+AYRK AL   P+K   N G  +         F+ +  AYQVL
Sbjct: 7  YYELLGVEPDATSSEIKKAYRKKALSMLPEKHPSNIGANEK--------FQAIAEAYQVL 58

Query: 63 SDASLRAEYDQKLAFEA 79
              LR +YD KL  EA
Sbjct: 59 HSKELREKYD-KLGKEA 74

>Kpol_1064.40 s1064 (74841..76004) [1164 bp, 387 aa] {ON}
          (74841..76004) [1164 nt, 388 aa]
          Length = 387

 Score = 55.8 bits (133), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 31/72 (43%), Positives = 44/72 (61%), Gaps = 8/72 (11%)

Query: 2  DYYGLLGVGQDASQDEIKRAYRKLALRHHPDKARGNEGGEDSSDDLPDVDFKEVTAAYQV 61
          DYY +LG+ ++ ++ EIK AYR+L+ + HPDK   N   ED+ +      F E+  AY+V
Sbjct: 23 DYYKILGLSKNCNEKEIKSAYRQLSKKFHPDK---NPNDEDAHN-----KFIEIGEAYEV 74

Query: 62 LSDASLRAEYDQ 73
          LSD   R  YDQ
Sbjct: 75 LSDPEKRRMYDQ 86

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 60/259 (23%), Positives = 107/259 (41%), Gaps = 30/259 (11%)

Query: 114 RYKSDDIEIDLKVKTSELYRGXXXXXXXXXXXXCQRCDGTGWKSHASIVKKKTAKFFWNV 173
           + +   I++   +   + Y G            C  C G+G  S    VKK         
Sbjct: 146 KQRGQSIKVRHALTLKDYYNGGSISFSLLLNDNCDHCHGSG--SEDGKVKK--------- 194

Query: 174 CEGCEGQGVRQRLRQLAPGFVTTELIE-CRQCGGKGKLRNLPKSEKNKCPDCITSGTVGM 232
           C  C G+GV  ++ ++  G VT ++ + C +C G G++       +NKC  C  SG   +
Sbjct: 195 CPDCGGRGVVIQVIRM--GIVTQQVQQRCNRCAGSGEII------QNKCKVC--SGA-KV 243

Query: 233 VEENKVVTINIKKGTLDGDKIVLKGEADEDLESTEVGDLVIKIQEVKEPQYDIVRNGYDL 292
            ++ K ++++   G       V +GEA++     E GDL+++  EV E      R G DL
Sbjct: 244 QKKEKDISVSFDSGIERNHISVQQGEAEKG-PGIEPGDLIVEFFEVPEANMGYRRRGKDL 302

Query: 293 IIKKQIDLADAICGFDEKPLMETYDGRVLKWSSKRGKVIRPNDIVRIQNEGWPRREDAND 352
              + + L +AI G   + +      + L+       ++   ++ +I   G P       
Sbjct: 303 FRTEVLTLQEAINGDWSRDIQFLDPTKKLQLKRSPMDIVMNGEVEKIPGFGMPILGSKG- 361

Query: 353 NNTLLKNGDLYVIVDIVFP 371
                K GDLY+   ++ P
Sbjct: 362 -----KFGDLYIDYVVIKP 375

>Kpol_1070.22 s1070 (52022..53164) [1143 bp, 380 aa] {ON}
          (52022..53164) [1143 nt, 381 aa]
          Length = 380

 Score = 55.8 bits (133), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 31/71 (43%), Positives = 40/71 (56%), Gaps = 8/71 (11%)

Query: 3  YYGLLGVGQDASQDEIKRAYRKLALRHHPDKARGNEGGEDSSDDLPDVDFKEVTAAYQVL 62
          YY +LGV  +A+  EIK+AYR+ A+  HPDK           D      F+ V  AYQVL
Sbjct: 7  YYDILGVKPEATPAEIKKAYRRRAMETHPDK--------HPDDPEAQSKFQAVGEAYQVL 58

Query: 63 SDASLRAEYDQ 73
          SD  LR+ YD+
Sbjct: 59 SDPGLRSRYDE 69

>Kpol_2000.32 s2000 complement(60585..61088) [504 bp, 167 aa] {ON}
          complement(60585..61088) [504 nt, 168 aa]
          Length = 167

 Score = 53.5 bits (127), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 29/73 (39%), Positives = 45/73 (61%), Gaps = 6/73 (8%)

Query: 3  YYGLLGVGQDASQDEIKRAYRKLALRHHPDKARGNEGGEDSSDDLPDVDFKEVTAAYQVL 62
          +Y +LGV  D+S +++K+AY++  L  HPDK     G E  ++ +P  D   +  AY+VL
Sbjct: 10 HYMVLGVDLDSSLEDVKKAYKERLLTSHPDKT----GIE--ANIMPSTDINRIKEAYKVL 63

Query: 63 SDASLRAEYDQKL 75
          S+  LRAEY+  L
Sbjct: 64 SNPVLRAEYNNML 76

>TDEL0B05960 Chr2 complement(1053955..1055064) [1110 bp, 369 aa]
          {ON} Anc_1.398 YNL007C
          Length = 369

 Score = 55.8 bits (133), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 28/70 (40%), Positives = 42/70 (60%), Gaps = 11/70 (15%)

Query: 4  YGLLGVGQDASQDEIKRAYRKLALRHHPDKARGNEGGEDSSDDLPDVDFKEVTAAYQVLS 63
          Y LLGV   A++ E+K+ YRK AL++HPDK  G+              FKE++ A+++L+
Sbjct: 8  YDLLGVSPTANEQELKKGYRKAALKYHPDKPTGD-----------TEKFKEISEAFEILN 56

Query: 64 DASLRAEYDQ 73
          D+  R  YDQ
Sbjct: 57 DSQKREIYDQ 66

 Score = 47.4 bits (111), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 45/165 (27%), Positives = 72/165 (43%), Gaps = 17/165 (10%)

Query: 212 NLPKSEKNKCPDCITSGTVGM-----VEENKVVTINIKKGTLDGDKIVLKGEADEDLEST 266
           NLP S ++ C     S  +G        E   + I +K+G   G KI  K E D +  + 
Sbjct: 202 NLPVSLEDLCAGKKKSFKIGRKGPNGTSEKTQIDIQLKQGWKAGTKITYKNEGDYNPRTG 261

Query: 267 EVGDLVIKIQEVKEPQYDIVRNGYDLIIKKQIDLADAICGFDEKPLMETYDGRVLKWSSK 326
               L   +QE   P +   R+G +LI    +   +++ GF +   ++T DGR L  S  
Sbjct: 262 GRKTLQFVLQEKAHPLFK--RDGDNLIYTLPLSFKESLLGFSK--TIQTIDGRTLPIS-- 315

Query: 327 RGKVIRPNDIVRIQNEGWPRREDANDNNTLLKNGDLYVIVDIVFP 371
           R + I+P++  R   +G P  +         + GDL V   I +P
Sbjct: 316 RVQPIQPSESSRYPGQGMPITKKPG------QRGDLIVKYKIDYP 354

>KNAG0C02450 Chr3 complement(477576..479210) [1635 bp, 544 aa]
          {ON} Anc_1.185 YJL162C
          Length = 544

 Score = 56.2 bits (134), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 30/73 (41%), Positives = 47/73 (64%), Gaps = 9/73 (12%)

Query: 3  YYGLLGVGQDASQDEIKRAYRKLALRHHPDKARGNEGGEDSSDDLPDVDFKEVTAAYQVL 62
          +Y LLGV  DA+ +EI ++YRKLA++ HPDK++      D  ++L    FK V  A+ VL
Sbjct: 10 HYSLLGVHFDATNEEISKSYRKLAMKLHPDKSKS-----DKCEEL----FKLVVHAHSVL 60

Query: 63 SDASLRAEYDQKL 75
          ++   RA+Y++ L
Sbjct: 61 TNGEERAKYNKVL 73

>KNAG0L01330 Chr12 complement(239806..240996) [1191 bp, 396 aa]
          {ON} Anc_7.217 YER048C
          Length = 396

 Score = 55.8 bits (133), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 30/72 (41%), Positives = 41/72 (56%), Gaps = 8/72 (11%)

Query: 2  DYYGLLGVGQDASQDEIKRAYRKLALRHHPDKARGNEGGEDSSDDLPDVDFKEVTAAYQV 61
          +YY +LG+   A+  EIK+AYR+ A+  HPDK           D      F++V  AYQV
Sbjct: 6  EYYDVLGIPPTATATEIKKAYRRKAMETHPDK--------HPDDPTASERFQQVGEAYQV 57

Query: 62 LSDASLRAEYDQ 73
          LSD  LR +YD+
Sbjct: 58 LSDPDLRKQYDE 69

>AAL008W Chr1 (327127..328176) [1050 bp, 349 aa] {ON} Syntenic
          homolog of Saccharomyces cerevisiae YNL007C (SIS1)
          Length = 349

 Score = 55.5 bits (132), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 29/69 (42%), Positives = 40/69 (57%), Gaps = 11/69 (15%)

Query: 4  YGLLGVGQDASQDEIKRAYRKLALRHHPDKARGNEGGEDSSDDLPDVDFKEVTAAYQVLS 63
          Y LLGV   AS  E+K+ YRK AL++HPDK  G+              FKE++ A+++LS
Sbjct: 8  YDLLGVSPSASDAELKKGYRKAALKYHPDKPTGD-----------TEKFKEISEAFEILS 56

Query: 64 DASLRAEYD 72
          D + R  YD
Sbjct: 57 DPNKREVYD 65

 Score = 44.3 bits (103), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 36/140 (25%), Positives = 65/140 (46%), Gaps = 7/140 (5%)

Query: 218 KNKCPDCITSGTVGMVEENKVVTINIKKGTLDGDKIVLKGEADEDLESTEVGDLVIKIQE 277
           K K       G  G + E K + I ++ G   G KI  K E D +  +     +   IQE
Sbjct: 194 KRKSFKITRKGQTG-IPEKKQIDIQLRPGWKAGTKITYKNEGDYNPSTGGRQTIQFIIQE 252

Query: 278 VKEPQYDIVRNGYDLIIKKQIDLADAICGFDEKPLMETYDGRVLKWSSKRGKVIRPNDIV 337
             +P     R+G DLI    +   +++ GFD+   + T DGR +  S  + + ++P++ +
Sbjct: 253 --KPHEFFKRDGNDLIYTLPLTFKESLLGFDK--TVRTIDGRQI--SIHKTQPVQPSEEM 306

Query: 338 RIQNEGWPRREDANDNNTLL 357
           R   +G P  ++ ++   L+
Sbjct: 307 RYPGQGMPLSKNPSERGDLI 326

>KNAG0G01130 Chr7 (244979..246481) [1503 bp, 500 aa] {ON} Anc_8.61
          YFL016C
          Length = 500

 Score = 56.2 bits (134), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 32/72 (44%), Positives = 44/72 (61%), Gaps = 9/72 (12%)

Query: 2  DYYGLLGVGQDASQDEIKRAYRKLALRHHPDKARGNEGGEDSSDDLPDVDFKEVTAAYQV 61
          D YG+LGV   ASQ EIK+AY KLA ++HPD  +  E G +         F ++  AY++
Sbjct: 35 DPYGVLGVKSSASQGEIKKAYYKLAKQYHPDINK--EAGAEKK-------FHDLQNAYEI 85

Query: 62 LSDASLRAEYDQ 73
          LSD S R ++DQ
Sbjct: 86 LSDESKRKQFDQ 97

 Score = 55.1 bits (131), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 67/300 (22%), Positives = 117/300 (39%), Gaps = 43/300 (14%)

Query: 108 SGRGARRYKSDDIEIDLKVKTSELYRGXXXXXXXXXXX-XCQRCDGTGWKSHASIVKKKT 166
           S  G R+YK D + +   +   +   G             C  C G+G K  AS      
Sbjct: 174 SSSGYRQYKGDSVHVSYNMSFKDAVFGKSGVKLKFNVFDPCDTCSGSGIKKGAS------ 227

Query: 167 AKFFWNVCEGCEGQGVRQRLRQLAPGFVTTELIECRQCGGKGKLRNLPKSEKNKCPDCIT 226
                + C GC+G G +  +R    GF    +  C +C G+G   N      + C  C  
Sbjct: 228 ----RHQCPGCQGSGTKIHVRG---GF--QMMSTCNECQGEGTTVN----SSDLCGACHG 274

Query: 227 SGTVGMVEENKVVTINIKKGTLDGDKIVLKGEA-------DEDLEST---EVGDLVIKIQ 276
            G        K +T+++  G  DGD I + G+        D  L  +     GD+++ ++
Sbjct: 275 EGV--HFHRGKEITVDLPHGLQDGDVIRIPGQGSYPEVALDPSLAGSVKLTRGDVLVNVR 332

Query: 277 EVKEPQYDIVRNGYDLIIKKQIDLADAICGFDEKPLMETYDGRVLKWSSKRGKVIRPNDI 336
             ++P + I R+  D+    +I +  A  G   +  + T DG  ++     G   +  D+
Sbjct: 333 VEEDPTFTI-RDKSDIWYTMEIPITTAALGGTVQ--VPTVDGSHIRLKVAPG--TQSGDV 387

Query: 337 VRIQNEGWPRREDANDNNTLLKNGDLYVIVDIVFPPDNWTMEVNDYRAVRNIIPSTINKR 396
           + + N G PR      +N     G + V   IV    +  +E   + A+ ++   T  +R
Sbjct: 388 ITVPNMGVPR------SNLTRSRGAMKVQYRIVIKKPSSEVEKCLWEALADVKNDTTARR 441

>Skud_14.110 Chr14 complement(209411..211201) [1791 bp, 596 aa]
          {ON} YNL227C (REAL)
          Length = 596

 Score = 55.8 bits (133), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 34/70 (48%), Positives = 44/70 (62%), Gaps = 7/70 (10%)

Query: 3  YYGLLGVGQDASQDEIKRAYRKLALRHHPDKARGNEGGEDSSDDLPDVDFKEVTAAYQVL 62
          YY LLGV   AS  E+K+AYRK AL++HPDK   N   E+++       F  + AAY+VL
Sbjct: 5  YYELLGVESHASDLELKKAYRKKALQYHPDKNPDN--VEEATQ-----KFAIIRAAYEVL 57

Query: 63 SDASLRAEYD 72
          SD+  RA YD
Sbjct: 58 SDSQERAWYD 67

>Ecym_1110 Chr1 (231686..232156) [471 bp, 156 aa] {ON} similar to
          Ashbya gossypii AFR639W
          Length = 156

 Score = 52.8 bits (125), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 32/84 (38%), Positives = 49/84 (58%), Gaps = 11/84 (13%)

Query: 1  MDYYGLLGVGQDASQDEIKRAYRKLALRHHPDKARGNEGGEDSSDDLPDVDFKEVTAAYQ 60
          + +Y +LG+  DA  D IK+AYR+  L  HPDK +        S++   VD  ++  AY+
Sbjct: 3  VSHYSVLGIDSDADSDTIKKAYRRRLLETHPDKKQ-------ISNESLSVD--QLQKAYR 53

Query: 61 VLSDASLRAEYDQKLA--FEAQPY 82
          VL D  LRA+YD +L+  F+ Q +
Sbjct: 54 VLIDKELRAKYDSELSEGFKKQGF 77

>NDAI0D00500 Chr4 complement(103935..104507) [573 bp, 190 aa] {ON}
          Anc_1.113
          Length = 190

 Score = 53.5 bits (127), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 26/76 (34%), Positives = 46/76 (60%), Gaps = 1/76 (1%)

Query: 1  MDYYGLLGVGQDASQDEIKRAYRKLALRHHPDKARGN-EGGEDSSDDLPDVDFKEVTAAY 59
          + +Y +L +  DA+  EIK+AY++  L  HPDK+         +++DL  V   ++  AY
Sbjct: 8  ITHYEVLNINSDATLQEIKKAYKQKLLNIHPDKSSTQILPISITTNDLTSVSINQIQQAY 67

Query: 60 QVLSDASLRAEYDQKL 75
          ++LS+ S R +YD++L
Sbjct: 68 KILSNESTREQYDEEL 83

>CAGL0J07370g Chr10 (713487..715358) [1872 bp, 623 aa] {ON}
          similar to uniprot|P53863 Saccharomyces cerevisiae
          YNL227c
          Length = 623

 Score = 55.8 bits (133), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 32/70 (45%), Positives = 44/70 (62%), Gaps = 7/70 (10%)

Query: 3  YYGLLGVGQDASQDEIKRAYRKLALRHHPDKARGNEGGEDSSDDLPDVDFKEVTAAYQVL 62
          YY LL V  DAS  ++K+AYR+ AL++HPDK        D+ ++   + F E+ AAY+VL
Sbjct: 5  YYDLLEVRSDASDLDLKKAYRRKALQYHPDK------NPDNVEEATTI-FAEIRAAYEVL 57

Query: 63 SDASLRAEYD 72
          SD   RA YD
Sbjct: 58 SDPQERAWYD 67

>Suva_14.341 Chr14 complement(598475..599554) [1080 bp, 359 aa]
          {ON} YNL007C (REAL)
          Length = 359

 Score = 55.1 bits (131), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 27/70 (38%), Positives = 41/70 (58%), Gaps = 11/70 (15%)

Query: 4  YGLLGVGQDASQDEIKRAYRKLALRHHPDKARGNEGGEDSSDDLPDVDFKEVTAAYQVLS 63
          Y +LGV   A++ E+K+ YRK AL++HPDK  G+              FKE++ A+++L+
Sbjct: 8  YDMLGVSPTANEQELKKGYRKAALKYHPDKPTGD-----------TEKFKEISEAFEILN 56

Query: 64 DASLRAEYDQ 73
          D   R  YDQ
Sbjct: 57 DPQKREIYDQ 66

>YNL227C Chr14 complement(220659..222431) [1773 bp, 590 aa] {ON}
          JJJ1Co-chaperone that stimulates the ATPase activity of
          Ssa1p, required for a late step of ribosome biogenesis;
          associated with the cytosolic large ribosomal subunit;
          contains a J-domain; mutation causes defects in
          fluid-phase endocytosis
          Length = 590

 Score = 55.5 bits (132), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 34/70 (48%), Positives = 43/70 (61%), Gaps = 7/70 (10%)

Query: 3  YYGLLGVGQDASQDEIKRAYRKLALRHHPDKARGNEGGEDSSDDLPDVDFKEVTAAYQVL 62
          YY LLGV   AS  E+K+AYRK AL++HPDK   N   E+++       F  + AAY+VL
Sbjct: 5  YYELLGVETHASDLELKKAYRKKALQYHPDKNPDN--VEEATQ-----KFAVIRAAYEVL 57

Query: 63 SDASLRAEYD 72
          SD   RA YD
Sbjct: 58 SDPQERAWYD 67

>ZYRO0F15400g Chr6 (1261048..1262625) [1578 bp, 525 aa] {ON}
          similar to uniprot|P53863 Saccharomyces cerevisiae
          YNL227C JJJ1 Protein that may function as a cochaperone
          as suggested by the presence of a DnaJ-like domain
          Length = 525

 Score = 55.5 bits (132), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 31/70 (44%), Positives = 45/70 (64%), Gaps = 7/70 (10%)

Query: 3  YYGLLGVGQDASQDEIKRAYRKLALRHHPDKARGNEGGEDSSDDLPDVDFKEVTAAYQVL 62
          YY LLGV   A   E+K+A+R+ AL++HPDK R N   E++++      F ++ AAY+VL
Sbjct: 5  YYELLGVSSTADDLELKKAFRRKALQYHPDKNRDN--VEEATE-----TFAQIRAAYEVL 57

Query: 63 SDASLRAEYD 72
          +D   RA YD
Sbjct: 58 NDPQERAWYD 67

>SAKL0E06050g Chr5 (491382..492080) [699 bp, 232 aa] {ON} some
          similarities with uniprot|P48353 Saccharomyces
          cerevisiae YMR161W
          Length = 232

 Score = 53.9 bits (128), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 31/72 (43%), Positives = 41/72 (56%), Gaps = 9/72 (12%)

Query: 2  DYYGLLGVGQDASQDEIKRAYRKLALRHHPDKARGNEGGEDSSDDLPDVDFKEVTAAYQV 61
          ++Y LL V + AS +EIK+AYRKLA+R HPDK       E          FK +  A++V
Sbjct: 24 EFYELLQVEKGASDNEIKKAYRKLAIRLHPDKNTHPRASE---------AFKRINRAFEV 74

Query: 62 LSDASLRAEYDQ 73
          LSD   R  +DQ
Sbjct: 75 LSDVGKRRMFDQ 86

>Smik_14.106 Chr14 complement(199985..201766) [1782 bp, 593 aa]
          {ON} YNL227C (REAL)
          Length = 593

 Score = 55.5 bits (132), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 35/72 (48%), Positives = 41/72 (56%), Gaps = 11/72 (15%)

Query: 3  YYGLLGVGQDASQDEIKRAYRKLALRHHPDKARGN--EGGEDSSDDLPDVDFKEVTAAYQ 60
          YY LLGV   AS  E+K+AYRK AL++HPDK   N  E  E          F  + AAY+
Sbjct: 5  YYELLGVESHASDLELKKAYRKKALQYHPDKNPDNVQEATE---------KFAIIRAAYE 55

Query: 61 VLSDASLRAEYD 72
          VLSD   RA YD
Sbjct: 56 VLSDPQERAWYD 67

>Kwal_55.20965 s55 (627332..628597) [1266 bp, 421 aa] {ON} YIR004W
          (DJP1) - involved in peroxisome biogenesis [contig 135]
          FULL
          Length = 421

 Score = 55.1 bits (131), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 33/79 (41%), Positives = 45/79 (56%), Gaps = 8/79 (10%)

Query: 3  YYGLLGVGQDASQDEIKRAYRKLALRHHPDKARGNEGGEDSSDDLPDVDFKEVTAAYQVL 62
          YY LLGV   A   +IK+AYRK +++ HPDK        + +D      F+ ++ AYQVL
Sbjct: 8  YYDLLGVDPSAKAIDIKKAYRKKSVQEHPDK--------NPNDPTATERFQAISQAYQVL 59

Query: 63 SDASLRAEYDQKLAFEAQP 81
          S   LRA+YD+    EA P
Sbjct: 60 SKEDLRAKYDKYGKEEAIP 78

>KNAG0B01890 Chr2 (358819..359931) [1113 bp, 370 aa] {ON} Anc_1.92
           YGL128C
          Length = 370

 Score = 54.7 bits (130), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 31/79 (39%), Positives = 48/79 (60%), Gaps = 8/79 (10%)

Query: 1   MDYYGLLGVGQ----DASQDEIKRAYRKLALRHHPDKARGNEGGEDSSDDLPDVDFKEVT 56
           +D Y +LG+      + + +E+KR Y+KL L++HPDK     G ED+S       F  + 
Sbjct: 81  VDLYDVLGLDSAKLDEITVEEVKRCYKKLVLQYHPDK--NVSGAEDAS--FVASRFHSLR 136

Query: 57  AAYQVLSDASLRAEYDQKL 75
           +A+Q+L D+SLR +YDQ L
Sbjct: 137 SAFQILCDSSLRTQYDQWL 155

>NCAS0G01360 Chr7 complement(242638..244488) [1851 bp, 616 aa]
          {ON} Anc_2.15
          Length = 616

 Score = 55.1 bits (131), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 32/70 (45%), Positives = 43/70 (61%), Gaps = 7/70 (10%)

Query: 3  YYGLLGVGQDASQDEIKRAYRKLALRHHPDKARGNEGGEDSSDDLPDVDFKEVTAAYQVL 62
          YY LLGV   A+  E+K+AYRK AL+ HPDK        D+ D+  ++ F  + +AY+VL
Sbjct: 5  YYELLGVDVTATDLELKKAYRKKALQFHPDK------NPDNVDEATEI-FATIRSAYEVL 57

Query: 63 SDASLRAEYD 72
          SD   RA YD
Sbjct: 58 SDPQERAWYD 67

>KNAG0H01680 Chr8 complement(300014..301105) [1092 bp, 363 aa]
          {ON} Anc_1.398 YNL007C
          Length = 363

 Score = 54.3 bits (129), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 28/70 (40%), Positives = 41/70 (58%), Gaps = 11/70 (15%)

Query: 4  YGLLGVGQDASQDEIKRAYRKLALRHHPDKARGNEGGEDSSDDLPDVDFKEVTAAYQVLS 63
          Y LLGV   A++ E+K+ YRK AL++HPDK  G+              FKE++ A+++L+
Sbjct: 8  YDLLGVSPTANEQELKKGYRKSALKYHPDKPTGD-----------TEKFKEISEAFEILN 56

Query: 64 DASLRAEYDQ 73
          D   R  YDQ
Sbjct: 57 DKQKREIYDQ 66

 Score = 47.8 bits (112), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 39/141 (27%), Positives = 60/141 (42%), Gaps = 12/141 (8%)

Query: 231 GMVEENKVVTINIKKGTLDGDKIVLKGEADEDLESTEVGDLVIKIQEVKEPQYDIVRNGY 290
           G  +E   + I +K G   G K+  K   D +  +     L   IQE   P Y   RNG 
Sbjct: 220 GGAQEKVQIDIQLKAGWKAGTKVTYKNHGDYNPRTGGRKTLQFVIQEKTHPLYK--RNGD 277

Query: 291 DLIIKKQIDLADAICGFDEKPLMETYDGRVLKWSSKRGKVIRPNDIVRIQNEGWPRREDA 350
           DL     +   +++ GF +   ++T DGR L  S  R   ++P +  R   +G P  +  
Sbjct: 278 DLEYTLPLTFKESLLGFSK--TIQTIDGRTLPLS--RSSPVQPTETSRYPGQGMPMPKMP 333

Query: 351 NDNNTLLKNGDLYVIVDIVFP 371
           +      + GDL V   I +P
Sbjct: 334 S------QRGDLVVRFKIDYP 348

>YJR097W Chr10 (612413..612931) [519 bp, 172 aa] {ON}  JJJ3Protein
          of unknown function, contains a CSL Zn finger and a
          DnaJ-domain; involved in diphthamide biosynthesis;
          ortholog human Dph4
          Length = 172

 Score = 52.4 bits (124), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 27/73 (36%), Positives = 42/73 (57%), Gaps = 5/73 (6%)

Query: 1  MDYYGLLGVGQDASQDEIKRAYRKLALRHHPDKARGNEGGEDSSDDLPDVDFKEVTAAYQ 60
          + +Y +L +  DA+QDEIK+AYR   L  HPDK       +   D + +V   ++  AY+
Sbjct: 7  LTHYEILRIPSDATQDEIKKAYRNRLLNTHPDKL-----SKSIHDTVSNVTINKIQDAYK 61

Query: 61 VLSDASLRAEYDQ 73
          +LS+   R EYD+
Sbjct: 62 ILSNIKTRREYDR 74

>ADR124C Chr4 complement(926129..927964) [1836 bp, 611 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YJL073W
           (JEM1)
          Length = 611

 Score = 55.1 bits (131), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 30/71 (42%), Positives = 43/71 (60%), Gaps = 3/71 (4%)

Query: 2   DYYGLLGVGQDASQDEIKRAYRKLALRHHPDKARGNEGGEDSSDDLPDVDFKEVTAAYQV 61
           +YY +LG+G DA+  +I+RAY  L  ++HPDK +GN    D+     +     +  AY+V
Sbjct: 509 NYYKILGIGNDANAKDIRRAYLHLTKKYHPDK-QGNMS--DAERAKVEEKMSSINEAYEV 565

Query: 62  LSDASLRAEYD 72
           LSD S R EYD
Sbjct: 566 LSDESKRKEYD 576

>Kwal_23.4420 s23 complement(711673..713451) [1779 bp, 592 aa]
          {ON} YNL227C - Hypothetical ORF [contig 1] FULL
          Length = 592

 Score = 54.7 bits (130), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 33/70 (47%), Positives = 43/70 (61%), Gaps = 7/70 (10%)

Query: 3  YYGLLGVGQDASQDEIKRAYRKLALRHHPDKARGNEGGEDSSDDLPDVDFKEVTAAYQVL 62
          YY LLGV   AS  ++K+AYRK AL +HPDK R N   E+++       F  + AAY+VL
Sbjct: 5  YYELLGVETTASDADLKKAYRKKALVYHPDKNRDN--VEEAT-----AIFATIRAAYEVL 57

Query: 63 SDASLRAEYD 72
          +D   RA YD
Sbjct: 58 ADPQERAWYD 67

>TBLA0J00970 Chr10 (219487..221247) [1761 bp, 586 aa] {ON}
          Anc_1.185 YJL162C
          Length = 586

 Score = 54.7 bits (130), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 29/73 (39%), Positives = 44/73 (60%), Gaps = 9/73 (12%)

Query: 3  YYGLLGVGQDASQDEIKRAYRKLALRHHPDKARGNEGGEDSSDDLPDVDFKEVTAAYQVL 62
          YY +LG+   AS  EI+++Y KLA   HPDK++ N     +S++L    FK V+ A+ +L
Sbjct: 15 YYSVLGLTSKASVSEIRKSYMKLAKSLHPDKSKSN-----ASEEL----FKIVSNAHSIL 65

Query: 63 SDASLRAEYDQKL 75
           D  L+ +YD  L
Sbjct: 66 IDPELKLDYDNTL 78

>YJL073W Chr10 (303181..305118) [1938 bp, 645 aa] {ON}
           JEM1DnaJ-like chaperone required for nuclear membrane
           fusion during mating, localizes to the ER membrane;
           exhibits genetic interactions with KAR2
          Length = 645

 Score = 54.7 bits (130), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 28/71 (39%), Positives = 40/71 (56%), Gaps = 3/71 (4%)

Query: 2   DYYGLLGVGQDASQDEIKRAYRKLALRHHPDKARGNEGGEDSSDDLPDVDFKEVTAAYQV 61
           DYY +LGV   AS  EI++AY  L  ++HPDK + N    D  + + +    ++  AY+ 
Sbjct: 538 DYYKILGVSPSASSKEIRKAYLNLTKKYHPDKIKANHN--DKQESIHET-MSQINEAYET 594

Query: 62  LSDASLRAEYD 72
           LSD   R EYD
Sbjct: 595 LSDDDKRKEYD 605

>Suva_12.185 Chr12 (290829..291335) [507 bp, 168 aa] {ON} YJR097W
          (REAL)
          Length = 168

 Score = 52.0 bits (123), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 27/75 (36%), Positives = 42/75 (56%), Gaps = 5/75 (6%)

Query: 1  MDYYGLLGVGQDASQDEIKRAYRKLALRHHPDKARGNEGGEDSSDDLPDVDFKEVTAAYQ 60
          + +Y +L +  DA+Q+EIK+AYR   L  HPDK   N     +S     V   ++  AY+
Sbjct: 7  LTHYEILRIPSDATQEEIKKAYRDRLLNTHPDKLTKNTNNRVNS-----VTINKIQDAYK 61

Query: 61 VLSDASLRAEYDQKL 75
          +LS+   R EYD+ +
Sbjct: 62 ILSNNQKRGEYDKTI 76

>Kwal_0.207 s0 complement(103950..105011) [1062 bp, 353 aa] {ON}
          YNL007C (SIS1) - sit4 suppressor, dnaJ homolog [contig
          82] FULL
          Length = 353

 Score = 53.9 bits (128), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 27/69 (39%), Positives = 39/69 (56%), Gaps = 11/69 (15%)

Query: 4  YGLLGVGQDASQDEIKRAYRKLALRHHPDKARGNEGGEDSSDDLPDVDFKEVTAAYQVLS 63
          Y LLGV   A + E+K+ YRK AL++HPDK  G+              FKE++ A+++L+
Sbjct: 8  YDLLGVSPSAQETELKKGYRKAALKYHPDKPSGDA-----------EKFKEISEAFEILN 56

Query: 64 DASLRAEYD 72
          D   R  YD
Sbjct: 57 DPQKREVYD 65

 Score = 48.1 bits (113), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 42/147 (28%), Positives = 66/147 (44%), Gaps = 12/147 (8%)

Query: 225 ITSGTVGMVEENKVVTINIKKGTLDGDKIVLKGEADEDLESTEVGDLVIKIQEVKEPQYD 284
           IT    G   E + V I +K G   G KI  K E D +  +     L   +QE  +P  +
Sbjct: 204 ITRKGPGGASEKQQVDIQLKPGWKAGTKITYKNEGDYNPRTGRRQTLQFILQE--KPHSN 261

Query: 285 IVRNGYDLIIKKQIDLADAICGFDEKPLMETYDGRVLKWSSKRGKVIRPNDIVRIQNEGW 344
             R+G DLI    +   +++ GF +   ++T DGR L  S  R + ++P+D      +G 
Sbjct: 262 YTRDGNDLIYSLPLTFKESLLGFSK--TIQTIDGRTLPIS--RVQPVQPSDSSTYPGQGM 317

Query: 345 PRREDANDNNTLLKNGDLYVIVDIVFP 371
           P  +      T  + G+L V   I +P
Sbjct: 318 PIAK------TPSQRGNLIVKYKIDYP 338

>KLTH0H12100g Chr8 complement(1032695..1033747) [1053 bp, 350 aa]
          {ON} some similarities with uniprot|P25294
          Saccharomyces cerevisiae YNL007C SIS1 HSP40 family
          chaperone sit4 suppressor dnaJ homolog
          Length = 350

 Score = 53.9 bits (128), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 27/69 (39%), Positives = 39/69 (56%), Gaps = 11/69 (15%)

Query: 4  YGLLGVGQDASQDEIKRAYRKLALRHHPDKARGNEGGEDSSDDLPDVDFKEVTAAYQVLS 63
          Y LLGV   A + E+K+ YRK AL++HPDK  G+              FKE++ A+++L+
Sbjct: 8  YDLLGVSPSAQETELKKGYRKAALKYHPDKPTGDA-----------EKFKEISEAFEILN 56

Query: 64 DASLRAEYD 72
          D   R  YD
Sbjct: 57 DPQKREIYD 65

 Score = 50.1 bits (118), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 40/147 (27%), Positives = 69/147 (46%), Gaps = 12/147 (8%)

Query: 225 ITSGTVGMVEENKVVTINIKKGTLDGDKIVLKGEADEDLESTEVGDLVIKIQEVKEPQYD 284
           IT    G   E + V I ++ G   G KI  K E D +  +     +   IQE  +P  +
Sbjct: 201 ITRKGPGGAPEKQQVDIQLRPGWKAGTKITYKNEGDYNPRTGRRQTMQFIIQE--KPHEN 258

Query: 285 IVRNGYDLIIKKQIDLADAICGFDEKPLMETYDGRVLKWSSKRGKVIRPNDIVRIQNEGW 344
             R+G DLI    +   +++ GF++   ++T DGR L  S  R + ++P+D+     +G 
Sbjct: 259 YTRDGNDLIYTLPLTFKESLLGFNK--TIQTIDGRTLPIS--RVQPVQPSDVSTYPGQGM 314

Query: 345 PRREDANDNNTLLKNGDLYVIVDIVFP 371
           P  ++ +      + G+L V   I +P
Sbjct: 315 PVAKNPS------QRGNLIVKYKIDYP 335

>KLTH0F04906g Chr6 complement(434195..435967) [1773 bp, 590 aa]
          {ON} weakly similar to uniprot|P46997 Saccharomyces
          cerevisiae YJL162C JJJ2 Protein that may function as a
          cochaperone as suggested by the presence of a DnaJ-like
          domain
          Length = 590

 Score = 54.3 bits (129), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 28/73 (38%), Positives = 41/73 (56%), Gaps = 9/73 (12%)

Query: 3  YYGLLGVGQDASQDEIKRAYRKLALRHHPDKARGNEGGEDSSDDLPDVDFKEVTAAYQVL 62
          +Y +LG+  DAS+ +IK+AYR++A+  HPDK +     E          FK V+ A  VL
Sbjct: 13 HYSVLGLKSDASESQIKKAYRRIAMAIHPDKNKSASAAE---------MFKLVSHAQSVL 63

Query: 63 SDASLRAEYDQKL 75
           D  LR  Y++ L
Sbjct: 64 IDKELRRTYNRSL 76

>Smik_10.168 Chr10 (294947..296896) [1950 bp, 649 aa] {ON} YJL073W
           (REAL)
          Length = 649

 Score = 54.3 bits (129), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 27/71 (38%), Positives = 41/71 (57%), Gaps = 3/71 (4%)

Query: 2   DYYGLLGVGQDASQDEIKRAYRKLALRHHPDKARGNEGGEDSSDDLPDVDFKEVTAAYQV 61
           DYY +LGV  +A+  EI++AY  L  ++HPDK + N    D  + + +    ++  AY+ 
Sbjct: 542 DYYKILGVSPNANSKEIRKAYLNLTKKYHPDKIKANHN--DKKESIHET-MSQINEAYET 598

Query: 62  LSDASLRAEYD 72
           LSD   R EYD
Sbjct: 599 LSDEDKRKEYD 609

>TDEL0C05880 Chr3 complement(1059324..1059803) [480 bp, 159 aa]
          {ON} Anc_1.113 YJR097W
          Length = 159

 Score = 51.2 bits (121), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 30/73 (41%), Positives = 43/73 (58%), Gaps = 9/73 (12%)

Query: 3  YYGLLGVGQDASQDEIKRAYRKLALRHHPDKARGNEGGEDSSDDLPDVDFKEVTAAYQVL 62
          +Y  LG+  D S +EIK+AY++  L  HPDK     G E SS     V+  ++  AY+VL
Sbjct: 5  HYETLGLNSDCSLEEIKKAYKEKLLSSHPDKI----GDESSS-----VEVNKIQEAYKVL 55

Query: 63 SDASLRAEYDQKL 75
           D +LR +YD+ L
Sbjct: 56 CDVNLREKYDESL 68

>KAFR0A07950 Chr1 (1592293..1593948) [1656 bp, 551 aa] {ON}
          Anc_2.15 YNL227C
          Length = 551

 Score = 53.9 bits (128), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 33/72 (45%), Positives = 40/72 (55%), Gaps = 11/72 (15%)

Query: 3  YYGLLGVGQDASQDEIKRAYRKLALRHHPDK--ARGNEGGEDSSDDLPDVDFKEVTAAYQ 60
          YY LLGV   AS  E+K+AYRK AL++HPDK   +  E  E          F  +  AY+
Sbjct: 5  YYELLGVDSHASDLELKKAYRKKALQYHPDKNPTKVEEATE---------IFATIRTAYE 55

Query: 61 VLSDASLRAEYD 72
          VLSD   RA YD
Sbjct: 56 VLSDPQERAWYD 67

>TDEL0A06430 Chr1 complement(1125394..1127394) [2001 bp, 666 aa]
           {ON} Anc_8.698 YOR254C
          Length = 666

 Score = 53.9 bits (128), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 27/71 (38%), Positives = 43/71 (60%), Gaps = 2/71 (2%)

Query: 1   MDYYGLLGVGQDASQDEIKRAYRKLALRHHPDKARGNEGGEDSSDDLPDVDFKEVTAAYQ 60
            D Y LLGV   A+  +IK AYRKL+++ HPDK   + GGE+ +    +  + +++ AY+
Sbjct: 122 FDPYALLGVSPSATDRDIKSAYRKLSVKFHPDKLSKDLGGEERARI--EEMYVQISKAYE 179

Query: 61  VLSDASLRAEY 71
            L+D   +A Y
Sbjct: 180 ALTDEITKANY 190

>KLTH0F09944g Chr6 complement(863160..863861) [702 bp, 233 aa]
          {ON} some similarities with uniprot|P48353
          Saccharomyces cerevisiae YMR161W
          Length = 233

 Score = 52.0 bits (123), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 28/71 (39%), Positives = 42/71 (59%), Gaps = 9/71 (12%)

Query: 3  YYGLLGVGQDASQDEIKRAYRKLALRHHPDKARGNEGGEDSSDDLPDVDFKEVTAAYQVL 62
          +Y +L + ++AS +EIK+AYRKLA++ HPDK +     E          FK +  A++VL
Sbjct: 23 FYEVLQIEREASDNEIKKAYRKLAIKLHPDKNKHPRASE---------AFKRINRAFEVL 73

Query: 63 SDASLRAEYDQ 73
          SD   R  +DQ
Sbjct: 74 SDEQKRRIFDQ 84

>Skud_10.319 Chr10 (569772..570278) [507 bp, 168 aa] {ON} YJR097W
          (REAL)
          Length = 168

 Score = 50.8 bits (120), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 30/78 (38%), Positives = 44/78 (56%), Gaps = 6/78 (7%)

Query: 1  MDYYGLLGVGQDASQDEIKRAYRKLALRHHPDKARGNEGGEDSSDDLPDVDFKEVTAAYQ 60
          + +Y +L +  DA+Q+EIK+AYR   L  HPDK       + +S+ +  V    +  AY+
Sbjct: 7  LTHYEILRIPSDATQEEIKKAYRDRLLNTHPDKL-----AKKTSNKVNSVTIDTIQDAYK 61

Query: 61 VLSDASLRAEYDQKLAFE 78
          VLS+   R EYD KL  E
Sbjct: 62 VLSNIKTRGEYD-KLILE 78

>KNAG0F00860 Chr6 complement(155142..157022) [1881 bp, 626 aa]
          {ON} Anc_2.15 YNL227C
          Length = 626

 Score = 53.5 bits (127), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 31/70 (44%), Positives = 43/70 (61%), Gaps = 7/70 (10%)

Query: 3  YYGLLGVGQDASQDEIKRAYRKLALRHHPDKARGNEGGEDSSDDLPDVDFKEVTAAYQVL 62
          YY LLGV  +A+  E+K+AYR+ AL+ HPDK        D+ ++   + F  V AAY+VL
Sbjct: 5  YYELLGVETNATDVELKKAYRRKALQFHPDK------NPDNVEETTAI-FASVRAAYEVL 57

Query: 63 SDASLRAEYD 72
          +D   RA YD
Sbjct: 58 ADPQERAWYD 67

>Kpol_529.21 s529 (62384..64252) [1869 bp, 622 aa] {ON}
          (62384..64252) [1869 nt, 623 aa]
          Length = 622

 Score = 53.5 bits (127), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 31/70 (44%), Positives = 43/70 (61%), Gaps = 7/70 (10%)

Query: 3  YYGLLGVGQDASQDEIKRAYRKLALRHHPDKARGNEGGEDSSDDLPDVDFKEVTAAYQVL 62
          YY LLGV   A+  E+K+AYRK AL+ HPDK        D+ ++  ++ F  + +AY+VL
Sbjct: 5  YYELLGVDITATDIELKKAYRKKALQFHPDK------NPDNVEEATEI-FATIRSAYEVL 57

Query: 63 SDASLRAEYD 72
          SD   RA YD
Sbjct: 58 SDPQERAWYD 67

>AEL112C Chr5 complement(412116..413723) [1608 bp, 535 aa] {ON}
          Syntenic homolog of Saccharomyces cerevisiae YJL162C
          (JJJ2)
          Length = 535

 Score = 53.1 bits (126), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 29/73 (39%), Positives = 41/73 (56%), Gaps = 9/73 (12%)

Query: 3  YYGLLGVGQDASQDEIKRAYRKLALRHHPDKARGNEGGEDSSDDLPDVDFKEVTAAYQVL 62
          YY LLG+   AS+  I++AY +LA   HPDK++  E  E          FK V  A+ VL
Sbjct: 13 YYSLLGLPFGASELHIRKAYMRLARELHPDKSKSKEAAE---------LFKVVAHAHSVL 63

Query: 63 SDASLRAEYDQKL 75
          +D   R +YD++L
Sbjct: 64 TDKEKRLKYDRQL 76

>SAKL0D08778g Chr4 (729953..730999) [1047 bp, 348 aa] {ON} similar
          to uniprot|P25294 Saccharomyces cerevisiae YNL007C SIS1
          HSP40 family chaperone sit4 suppressor dnaJ homolog
          Length = 348

 Score = 52.8 bits (125), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 27/69 (39%), Positives = 39/69 (56%), Gaps = 11/69 (15%)

Query: 4  YGLLGVGQDASQDEIKRAYRKLALRHHPDKARGNEGGEDSSDDLPDVDFKEVTAAYQVLS 63
          Y LLGV   A + E+K+ YRK AL++HPDK  G+              FKE++ A+++L+
Sbjct: 8  YDLLGVSPSADEGELKKGYRKAALKYHPDKPTGD-----------TEKFKEISEAFEILN 56

Query: 64 DASLRAEYD 72
          D   R  YD
Sbjct: 57 DPQKREIYD 65

 Score = 50.8 bits (120), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 41/147 (27%), Positives = 67/147 (45%), Gaps = 12/147 (8%)

Query: 225 ITSGTVGMVEENKVVTINIKKGTLDGDKIVLKGEADEDLESTEVGDLVIKIQEVKEPQYD 284
           IT    G V E K + I +K G   G KI  K E D + ++     +   IQE   P + 
Sbjct: 199 ITRKGPGSVPEKKQIDIQMKPGWKAGTKITFKNEGDYNQQTGGRQTMQFVIQEKLHPHFK 258

Query: 285 IVRNGYDLIIKKQIDLADAICGFDEKPLMETYDGRVLKWSSKRGKVIRPNDIVRIQNEGW 344
             R+G +LI    +   +++ GF +   ++T DGR L  S  R + I+P++      +G 
Sbjct: 259 --RDGNNLIYTLPLSFKESLLGFSK--TIQTIDGRTLPIS--RVQPIQPSETSTYPGQGM 312

Query: 345 PRREDANDNNTLLKNGDLYVIVDIVFP 371
           P  +      T  + GDL +   + +P
Sbjct: 313 PLPK------TPAQRGDLIIKYKVDYP 333

>Kwal_33.13860 s33 complement(427243..428979) [1737 bp, 578 aa]
          {ON} YJL162C - Hypothetical ORF [contig 108] FULL
          Length = 578

 Score = 53.1 bits (126), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 28/73 (38%), Positives = 41/73 (56%), Gaps = 9/73 (12%)

Query: 3  YYGLLGVGQDASQDEIKRAYRKLALRHHPDKARGNEGGEDSSDDLPDVDFKEVTAAYQVL 62
          +Y +LG+  DA++ +IK+AYRK+A+  HPDK +     E          FK V+ A  VL
Sbjct: 13 HYSMLGLTSDATEAQIKKAYRKIAMAIHPDKNKSVSAAE---------LFKLVSHAQSVL 63

Query: 63 SDASLRAEYDQKL 75
           D   R  Y++KL
Sbjct: 64 IDKEQRQSYNRKL 76

>NDAI0B00200 Chr2 (25694..27478) [1785 bp, 594 aa] {ON} Anc_1.185
          Length = 594

 Score = 53.1 bits (126), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 26/73 (35%), Positives = 43/73 (58%), Gaps = 9/73 (12%)

Query: 3  YYGLLGVGQDASQDEIKRAYRKLALRHHPDKARGNEGGEDSSDDLPDVDFKEVTAAYQVL 62
          YY +LG+   A+ +EI+++Y K A + HPDK++ +   E          FK V  A+ +L
Sbjct: 19 YYSILGLHPQATDNEIRKSYMKFARKLHPDKSKSDTCAE---------LFKLVVHAHSIL 69

Query: 63 SDASLRAEYDQKL 75
          +D  L+ EYD++L
Sbjct: 70 TDKELKLEYDREL 82

>NCAS0C04890 Chr3 (997613..998716) [1104 bp, 367 aa] {ON}
          Anc_1.398
          Length = 367

 Score = 52.8 bits (125), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 27/70 (38%), Positives = 40/70 (57%), Gaps = 11/70 (15%)

Query: 4  YGLLGVGQDASQDEIKRAYRKLALRHHPDKARGNEGGEDSSDDLPDVDFKEVTAAYQVLS 63
          Y LL V   A++ E+K+ YRK AL++HPDK  G+              FKE++ A+++L+
Sbjct: 8  YDLLNVQPTANEQELKKGYRKAALKYHPDKPTGD-----------TEKFKEISEAFEILN 56

Query: 64 DASLRAEYDQ 73
          D   R  YDQ
Sbjct: 57 DPQKREIYDQ 66

>TDEL0C00870 Chr3 complement(140420..141832) [1413 bp, 470 aa] {ON}
           Anc_8.61 YFL016C
          Length = 470

 Score = 52.8 bits (125), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 54/245 (22%), Positives = 103/245 (42%), Gaps = 37/245 (15%)

Query: 113 RRYKSDDIEIDLKVKTSE-LYRGXXXXXXXXXXXXCQRCDGTGWKSHASIVKKKTAKFFW 171
           R YK D +E+  ++K  + ++              C  C G+G K +A            
Sbjct: 167 REYKGDSVEVIHRMKFKDAVFGAKNANLQFSVLDPCGVCHGSGLKKNAQ----------S 216

Query: 172 NVCEGCEGQGVRQRLRQLAPGFVTTELIECRQCGGKGKLRNLPKSEKNKCPDCITSGTVG 231
           + C  C G G    +R    GF       C QCGG+G         ++ C  C   G   
Sbjct: 217 STCPSCHGTGTTVHVRG---GFQMAST--CNQCGGEGTTVR----PEDVCSKCHGEGV-- 265

Query: 232 MVEENKVVTINIKKGTLDGDKIVLKGEA-------DEDLEST---EVGDLVIKIQEVKEP 281
            +   + +++++ +G  DGD + + G+        D  ++++     GD++++I+  K+ 
Sbjct: 266 ELNSQRSISVDLPQGLQDGDVVRVPGQGSYPHLAVDPKMKNSVKLHRGDVLVRIRVDKDS 325

Query: 282 QYDIVRNGYDLIIKKQIDLADAICGFDEKPLMETYDGRVLKWSSKRGKVIRPNDIVRIQN 341
           ++ I RN  D+   K+I +  A  G   +  + T D   ++   + G   + + ++ I N
Sbjct: 326 RFSI-RNKTDIWFTKEIPITTAALG--GQVTIPTVDDTQIRLKVQPG--TQHDQVISIPN 380

Query: 342 EGWPR 346
            G PR
Sbjct: 381 MGVPR 385

 Score = 37.0 bits (84), Expect = 0.089,   Method: Compositional matrix adjust.
 Identities = 28/72 (38%), Positives = 42/72 (58%), Gaps = 9/72 (12%)

Query: 2  DYYGLLGVGQDASQDEIKRAYRKLALRHHPDKARGNEGGEDSSDDLPDVDFKEVTAAYQV 61
          D Y  LGVG++AS  EIK+AY KLA + HPD  +         +   +  F ++  AY++
Sbjct: 36 DPYETLGVGKNASSSEIKKAYYKLAKKFHPDINK---------EPNAEAKFHDLQNAYEI 86

Query: 62 LSDASLRAEYDQ 73
          LSD + + +YDQ
Sbjct: 87 LSDDTKKQQYDQ 98

>AFL190C Chr6 complement(84145..84852) [708 bp, 235 aa] {ON}
          Syntenic homolog of Saccharomyces cerevisiae YMR161W
          (HLJ1)
          Length = 235

 Score = 51.6 bits (122), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 31/71 (43%), Positives = 41/71 (57%), Gaps = 9/71 (12%)

Query: 3  YYGLLGVGQDASQDEIKRAYRKLALRHHPDKARGNEGGEDSSDDLPDVDFKEVTAAYQVL 62
          +Y LL V + AS  +IK+AYRK+A++ HPDK R     E          FK+V  A++VL
Sbjct: 25 FYELLQVDEKASDGDIKKAYRKMAIKLHPDKNRHPRAAE---------AFKKVNRAFEVL 75

Query: 63 SDASLRAEYDQ 73
          SD   R  YDQ
Sbjct: 76 SDEKKRRVYDQ 86

>SAKL0E14234g Chr5 (1172804..1174840) [2037 bp, 678 aa] {ON}
          similar to uniprot|P53863 Saccharomyces cerevisiae
          YNL227C JJJ1 Protein that may function as a cochaperone
          as suggested by the presence of a DnaJ-like domain
          Length = 678

 Score = 53.1 bits (126), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 32/70 (45%), Positives = 39/70 (55%), Gaps = 7/70 (10%)

Query: 3  YYGLLGVGQDASQDEIKRAYRKLALRHHPDKARGNEGGEDSSDDLPDVDFKEVTAAYQVL 62
          YY LLGV   AS  E+K+AYRK AL++HPDK   N      +       F  +  AY+VL
Sbjct: 5  YYELLGVESIASDLELKKAYRKKALKYHPDKNPNNVEEATQA-------FATIRLAYEVL 57

Query: 63 SDASLRAEYD 72
          SD   RA YD
Sbjct: 58 SDPQERAWYD 67

>Kpol_1072.4 s1072 (8361..10346) [1986 bp, 661 aa] {ON}
           (8361..10346) [1986 nt, 662 aa]
          Length = 661

 Score = 52.8 bits (125), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 28/71 (39%), Positives = 43/71 (60%), Gaps = 2/71 (2%)

Query: 1   MDYYGLLGVGQDASQDEIKRAYRKLALRHHPDKARGNEGGEDSSDDLPDVDFKEVTAAYQ 60
            D Y LLGV   AS  EIK AYRKL+L+ HPDK    +  E+  + L ++ + +++ AY+
Sbjct: 119 FDPYDLLGVSVTASDKEIKSAYRKLSLKFHPDKV-AKDITEEEKNSLEEM-YVQISKAYE 176

Query: 61  VLSDASLRAEY 71
            L+D  ++  Y
Sbjct: 177 ALTDELVKQNY 187

>TBLA0A05740 Chr1 (1424068..1424580) [513 bp, 170 aa] {ON}
          Anc_1.113 YJR097W
          Length = 170

 Score = 50.1 bits (118), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 24/82 (29%), Positives = 47/82 (57%), Gaps = 7/82 (8%)

Query: 1  MDYYGLLGVGQDASQDEIKRAYRKLALRHHPDKARGNEGGEDSS-------DDLPDVDFK 53
          + +Y +LG+  DA++ +IKRAY++  L  HPDK + N   + ++       ++   +   
Sbjct: 4  LSHYEILGIDSDATESDIKRAYKEKLLAIHPDKIKNNAKAKANTNENITGNENKSPISVN 63

Query: 54 EVTAAYQVLSDASLRAEYDQKL 75
           +  AY++L D+  R +YD++L
Sbjct: 64 HIQDAYKILVDSKSRQQYDKEL 85

>Suva_6.148 Chr6 complement(246008..247936) [1929 bp, 642 aa] {ON}
           YJL073W (REAL)
          Length = 642

 Score = 52.4 bits (124), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 27/71 (38%), Positives = 40/71 (56%), Gaps = 3/71 (4%)

Query: 2   DYYGLLGVGQDASQDEIKRAYRKLALRHHPDKARGNEGGEDSSDDLPDVDFKEVTAAYQV 61
           DYY +LGV   A+  EI++AY  L  ++HPDK + N    D  + + +    ++  AY+ 
Sbjct: 535 DYYKVLGVAPGATSKEIRKAYLNLTKKYHPDKIKANHN--DKEETIHET-MSQINEAYET 591

Query: 62  LSDASLRAEYD 72
           LSD   R EYD
Sbjct: 592 LSDDDKRKEYD 602

>KAFR0A01620 Chr1 (331073..333070) [1998 bp, 665 aa] {ON} Anc_1.297
           YJL073W
          Length = 665

 Score = 52.8 bits (125), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 26/72 (36%), Positives = 45/72 (62%), Gaps = 5/72 (6%)

Query: 2   DYYGLLGVGQDASQDEIKRAYRKLALRHHPDKARGNEGGEDSSDDLPDVD-FKEVTAAYQ 60
           DYY +LG+ ++A+  +I++AY +L  R+HPDK    +G    S+   + +   E+  AY+
Sbjct: 559 DYYKILGISKEATSKDIRKAYLQLTKRYHPDK----QGHLSESEQKKNHEKMSEINEAYE 614

Query: 61  VLSDASLRAEYD 72
            LSD + ++EYD
Sbjct: 615 TLSDEAKKSEYD 626

>Skud_10.169 Chr10 complement(313783..315717) [1935 bp, 644 aa] {ON}
           YJL073W (REAL)
          Length = 644

 Score = 52.4 bits (124), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 27/71 (38%), Positives = 40/71 (56%), Gaps = 3/71 (4%)

Query: 2   DYYGLLGVGQDASQDEIKRAYRKLALRHHPDKARGNEGGEDSSDDLPDVDFKEVTAAYQV 61
           DYY  LGV   A+  EI++AY  L  ++HPDK + N    D  + + +    ++  AY+ 
Sbjct: 538 DYYKTLGVTPSATSKEIRKAYLNLTKKYHPDKIKANHN--DKKESIHET-MSQINEAYEA 594

Query: 62  LSDASLRAEYD 72
           LSD + R EYD
Sbjct: 595 LSDDNKRKEYD 605

>KLTH0F03124g Chr6 (271947..272435) [489 bp, 162 aa] {ON} similar
          to uniprot|P47138 Saccharomyces cerevisiae YJR097W JJJ3
          Protein required along with Dph1p Dph2p Kti11p and
          Dph5p for synthesis of diphthamide which is a modified
          histidine residue of translation elongation factor 2
          (Eft1p or Eft2p) contains a DnaJ-like domain
          Length = 162

 Score = 49.7 bits (117), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 29/74 (39%), Positives = 42/74 (56%), Gaps = 8/74 (10%)

Query: 3  YYGLLGVGQDASQDEIKRAYRKLALRHHPDKARGNEGGEDSSDDLPDVDFKEVTAAYQVL 62
          YY +LGV   ++  EIK+AY++  L  HPDK R  E          +V  +E+  AYQVL
Sbjct: 7  YYEILGVDTKSTVAEIKKAYKEKLLCTHPDKNRTVEA--------QNVSIEEIKEAYQVL 58

Query: 63 SDASLRAEYDQKLA 76
           + S +  YD++LA
Sbjct: 59 VNPSGKENYDKELA 72

>YMR161W Chr13 (577718..578392) [675 bp, 224 aa] {ON}
          HLJ1Co-chaperone for Hsp40p, anchored in the ER
          membrane; with its homolog Ydj1p promotes ER-associated
          protein degradation (ERAD) of integral membrane
          substrates; similar to E. coli DnaJ
          Length = 224

 Score = 50.4 bits (119), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 28/72 (38%), Positives = 43/72 (59%), Gaps = 9/72 (12%)

Query: 2  DYYGLLGVGQDASQDEIKRAYRKLALRHHPDKARGNEGGEDSSDDLPDVDFKEVTAAYQV 61
          ++Y +L V + A+  EIK+AYRKLA++ HPDK    + GE          FK +  A++V
Sbjct: 21 EFYEILKVDRKATDSEIKKAYRKLAIKLHPDKNSHPKAGE---------AFKVINRAFEV 71

Query: 62 LSDASLRAEYDQ 73
          LS+   R+ YD+
Sbjct: 72 LSNEEKRSIYDR 83

>KLTH0B08338g Chr2 (676591..678363) [1773 bp, 590 aa] {ON} similar
          to uniprot|P53863 Saccharomyces cerevisiae YNL227C JJJ1
          Protein that may function as a cochaperone as suggested
          by the presence of a DnaJ-like domain
          Length = 590

 Score = 52.0 bits (123), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 30/70 (42%), Positives = 43/70 (61%), Gaps = 7/70 (10%)

Query: 3  YYGLLGVGQDASQDEIKRAYRKLALRHHPDKARGNEGGEDSSDDLPDVDFKEVTAAYQVL 62
          YY LLGV   AS  ++K+AYR+ AL++HPDK        D+ ++   V F  + +AY+VL
Sbjct: 5  YYELLGVETTASDSDLKKAYRRKALQYHPDK------NPDNVEEATTV-FATIRSAYEVL 57

Query: 63 SDASLRAEYD 72
          +D   RA YD
Sbjct: 58 ADPQERAWYD 67

>Ecym_1292 Chr1 complement(593715..594758) [1044 bp, 347 aa] {ON}
          similar to Ashbya gossypii AAL008W
          Length = 347

 Score = 51.2 bits (121), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 29/76 (38%), Positives = 43/76 (56%), Gaps = 12/76 (15%)

Query: 4  YGLLGVGQDASQDEIKRAYRKLALRHHPDKARGNEGGEDSSDDLPDVDFKEVTAAYQVLS 63
          Y LLGV  + +  E+K+ YRK AL++HPDK  G+              FKE++ A+++L+
Sbjct: 8  YDLLGVSPNCNDAELKKGYRKAALKYHPDKPTGD-----------TEKFKEISEAFEILN 56

Query: 64 DASLRAEYDQKLAFEA 79
          D + R  YD K   EA
Sbjct: 57 DPNKREVYD-KYGLEA 71

 Score = 40.0 bits (92), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 36/140 (25%), Positives = 64/140 (45%), Gaps = 14/140 (10%)

Query: 233 VEENKVVTINIKKGTLDGDKIVLKGEADEDLESTEVGDLVIKIQEVKEPQYDIV-RNGYD 291
           + E K + I ++ G   G KI  K E D +  +     L   IQE     +D + R+G D
Sbjct: 206 IPEKKQIDIQLRPGWKAGTKITYKNEGDYNPSTGGRQTLQFIIQEK---MHDFLKRDGND 262

Query: 292 LIIKKQIDLADAICGFDEKPLMETYDGRVLKWSSKRGKVIRPNDIVRIQNEGWPRREDAN 351
           L     +   +++ GF +   + T DGR +  S  + + ++P++  R   +G P  ++ +
Sbjct: 263 LTYTLPLSFKESLLGFSK--TVHTIDGRQIFIS--KTQPVQPSEESRYPGQGMPLSKNPS 318

Query: 352 DNNTLLKNGDLYVIVDIVFP 371
           +       GDL V   I +P
Sbjct: 319 E------RGDLIVKYKIDYP 332

>KNAG0J01840 Chr10 complement(334573..336525) [1953 bp, 650 aa] {ON}
           Anc_8.698 YOR254C
          Length = 650

 Score = 51.6 bits (122), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 27/71 (38%), Positives = 42/71 (59%), Gaps = 2/71 (2%)

Query: 1   MDYYGLLGVGQDASQDEIKRAYRKLALRHHPDKARGNEGGEDSSDDLPDVDFKEVTAAYQ 60
            D Y LLG+   AS  +IK AYRKL+L+ HPDK    +G  ++  +  +  + ++T AY+
Sbjct: 120 FDPYELLGISSSASDKDIKSAYRKLSLKFHPDKL--PKGLSEADREGLEAQYVQITKAYE 177

Query: 61  VLSDASLRAEY 71
            L+D  +R  Y
Sbjct: 178 SLTDELIRFNY 188

>SAKL0C03476g Chr3 (329030..329527) [498 bp, 165 aa] {ON} similar
          to uniprot|P47138 Saccharomyces cerevisiae YJR097W JJJ3
          Protein required along with Dph1p Dph2p Kti11p and
          Dph5p for synthesis of diphthamide which is a modified
          histidine residue of translation elongation factor 2
          (Eft1p or Eft2p) contains a DnaJ-like domain
          Length = 165

 Score = 48.9 bits (115), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 28/74 (37%), Positives = 41/74 (55%), Gaps = 3/74 (4%)

Query: 3  YYGLLGVGQDASQDEIKRAYRKLALRHHPDKARGNEGGEDSSDDLPDVDFKEVTAAYQVL 62
          +Y +L V   AS  +IKRAYR+  L  HPDK  G +     S        +++  AY+VL
Sbjct: 5  HYEVLAVEAGASLSQIKRAYRERLLDTHPDKKNGQQA---RSQAHTQASIEQIQQAYRVL 61

Query: 63 SDASLRAEYDQKLA 76
          +D + R +YD +LA
Sbjct: 62 ADPTRREQYDAELA 75

>TDEL0E00500 Chr5 complement(112459..114204) [1746 bp, 581 aa]
          {ON} Anc_2.15 YNL227C
          Length = 581

 Score = 51.2 bits (121), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 31/70 (44%), Positives = 43/70 (61%), Gaps = 7/70 (10%)

Query: 3  YYGLLGVGQDASQDEIKRAYRKLALRHHPDKARGNEGGEDSSDDLPDVDFKEVTAAYQVL 62
          YY LL V   A  +E+K+AYR+ AL++HPDK    E  E++++      F  + AAY+VL
Sbjct: 5  YYELLDVQPFADDNELKKAYRRKALQYHPDK--NPENVEEATE-----IFASIRAAYEVL 57

Query: 63 SDASLRAEYD 72
          SD   RA YD
Sbjct: 58 SDPQERAWYD 67

>Suva_8.303 Chr8 complement(544176..546170) [1995 bp, 664 aa] {ON}
           YOR254C (REAL)
          Length = 664

 Score = 50.8 bits (120), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 28/72 (38%), Positives = 43/72 (59%), Gaps = 4/72 (5%)

Query: 1   MDYYGLLGVGQDASQDEIKRAYRKLALRHHPDK-ARGNEGGEDSSDDLPDVDFKEVTAAY 59
            D Y +LG+   AS  +IK AYRKL+++ HPDK A+G    E    D+ +  + ++T AY
Sbjct: 124 FDPYEILGISSSASDRDIKSAYRKLSVKFHPDKLAKGLTTDE---KDVMEETYVQITKAY 180

Query: 60  QVLSDASLRAEY 71
           + L+D  +R  Y
Sbjct: 181 ESLTDELVRQNY 192

>Kwal_23.3578 s23 complement(349005..349259) [255 bp, 85 aa] {OFF}
          YMR161W (HLJ1) - similar to E. coli DnaJ [contig 253]
          PARTIAL
          Length = 85

 Score = 46.6 bits (109), Expect = 4e-06,   Method: Composition-based stats.
 Identities = 27/66 (40%), Positives = 37/66 (56%), Gaps = 9/66 (13%)

Query: 3  YYGLLGVGQDASQDEIKRAYRKLALRHHPDKARGNEGGEDSSDDLPDVDFKEVTAAYQVL 62
          +Y +L V + AS  EIK+AYRKLA++ HPDK +     E          FK +  A++VL
Sbjct: 23 FYEVLRVEKQASDLEIKKAYRKLAIKLHPDKNKHPRASE---------AFKRINRAFEVL 73

Query: 63 SDASLR 68
          SD   R
Sbjct: 74 SDEQKR 79

>NCAS0I02830 Chr9 (526309..527784) [1476 bp, 491 aa] {ON}
          Anc_1.185 YJL162C
          Length = 491

 Score = 50.8 bits (120), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 27/75 (36%), Positives = 44/75 (58%), Gaps = 9/75 (12%)

Query: 3  YYGLLGVGQDASQDEIKRAYRKLALRHHPDKARGNEGGEDSSDDLPDVDFKEVTAAYQVL 62
          YY +LG+   A+ +EI+++Y KLA + HPDK++      DS  +L    FK V  A+ +L
Sbjct: 8  YYSILGLTPKATDNEIRKSYMKLARQLHPDKSKS-----DSCAEL----FKLVVHAHSIL 58

Query: 63 SDASLRAEYDQKLAF 77
          +D   + +YD +L  
Sbjct: 59 TDEETKRKYDTQLVM 73

>Smik_15.437 Chr15 complement(754736..756727) [1992 bp, 663 aa] {ON}
           YOR254C (REAL)
          Length = 663

 Score = 50.8 bits (120), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 28/72 (38%), Positives = 43/72 (59%), Gaps = 4/72 (5%)

Query: 1   MDYYGLLGVGQDASQDEIKRAYRKLALRHHPDK-ARGNEGGEDSSDDLPDVDFKEVTAAY 59
            D Y +LG+   AS  +IK AYRKL+++ HPDK A+G    E S   + +  + ++T AY
Sbjct: 124 FDPYEILGISTSASDRDIKSAYRKLSVKFHPDKVAKGLTSDEKS---VMEETYVQITKAY 180

Query: 60  QVLSDASLRAEY 71
           + L+D  +R  Y
Sbjct: 181 ESLTDELVRQNY 192

>NDAI0H03180 Chr8 (757990..758679) [690 bp, 229 aa] {ON} Anc_2.350
          Length = 229

 Score = 49.3 bits (116), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 28/71 (39%), Positives = 42/71 (59%), Gaps = 9/71 (12%)

Query: 3  YYGLLGVGQDASQDEIKRAYRKLALRHHPDKARGNEGGEDSSDDLPDVDFKEVTAAYQVL 62
          +Y +L V + ++++EIK+AYRKLA+R HPDK    +  E          FK +  A++VL
Sbjct: 22 FYEILKVERTSTENEIKKAYRKLAIRLHPDKNPHPKASE---------AFKIINRAFEVL 72

Query: 63 SDASLRAEYDQ 73
          SD   R  +DQ
Sbjct: 73 SDNEKRRIFDQ 83

>ZYRO0F15972g Chr6 complement(1311698..1312186) [489 bp, 162 aa]
          {ON} similar to uniprot|P47138 Saccharomyces cerevisiae
          YJR097W JJJ3 Protein required along with Dph1p Dph2p
          Kti11p and Dph5p for synthesis of diphthamide which is
          a modified histidine residue of translation elongation
          factor 2 (Eft1p or Eft2p) contains a DnaJ-like domain
          Length = 162

 Score = 48.1 bits (113), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 30/75 (40%), Positives = 40/75 (53%), Gaps = 6/75 (8%)

Query: 1  MDYYGLLGVGQDASQDEIKRAYRKLALRHHPDKARGNEGGEDSSDDLPDVDFKEVTAAYQ 60
          + +Y +L V  DAS  EIK+AYR   L  HPDK        D +    +V    +  AY+
Sbjct: 2  LTHYEVLRVKFDASLIEIKQAYRDRLLNAHPDK------NNDENKPALNVSVNAIQEAYR 55

Query: 61 VLSDASLRAEYDQKL 75
          VLSD  LR EYD ++
Sbjct: 56 VLSDEKLRREYDHEV 70

>TBLA0B03730 Chr2 (860167..862248) [2082 bp, 693 aa] {ON} Anc_8.698
           YOR254C
          Length = 693

 Score = 50.4 bits (119), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 25/71 (35%), Positives = 43/71 (60%), Gaps = 2/71 (2%)

Query: 1   MDYYGLLGVGQDASQDEIKRAYRKLALRHHPDKARGNEGGEDSSDDLPDVDFKEVTAAYQ 60
            D Y LLG+   AS+ +IK AYRKL+++ HPDK    +  E     + ++ + ++T AY+
Sbjct: 128 FDPYELLGISTSASERDIKSAYRKLSVKFHPDKL-SKDLSEKERTTMEEM-YVQITKAYE 185

Query: 61  VLSDASLRAEY 71
            L+D ++R  +
Sbjct: 186 ALTDEAMRENF 196

>Smik_13.361 Chr13 (561431..562105) [675 bp, 224 aa] {ON} YMR161W
          (REAL)
          Length = 224

 Score = 48.9 bits (115), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 27/72 (37%), Positives = 43/72 (59%), Gaps = 9/72 (12%)

Query: 2  DYYGLLGVGQDASQDEIKRAYRKLALRHHPDKARGNEGGEDSSDDLPDVDFKEVTAAYQV 61
          ++Y +L V + A+  +IK+AYRKLA++ HPDK    + GE          FK +  A++V
Sbjct: 21 EFYEILKVDRKATDSDIKKAYRKLAIKLHPDKNSHPKAGE---------AFKVINRAFEV 71

Query: 62 LSDASLRAEYDQ 73
          LS+   R+ YD+
Sbjct: 72 LSNEEKRSIYDR 83

>AFR639W Chr6 (1604427..1604897) [471 bp, 156 aa] {ON}
          Non-syntenic homolog of Saccharomyces cerevisiae
          YJR097W (JJJ3)
          Length = 156

 Score = 47.8 bits (112), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 27/76 (35%), Positives = 41/76 (53%), Gaps = 10/76 (13%)

Query: 3  YYGLLGVGQDASQDEIKRAYRKLALRHHPDKARGNEGGEDSSDDLPDVDFKEVTAAYQVL 62
          +Y +LG+  DA   E+++AYR+  L  HPDK  G + G              +  AY+VL
Sbjct: 5  HYDILGIAVDAEPLEVRQAYRQRLLEAHPDKQGGVDKGA----------VTRIQQAYRVL 54

Query: 63 SDASLRAEYDQKLAFE 78
          SD + R+ YD +LA +
Sbjct: 55 SDPTQRSAYDGELAVQ 70

>SAKL0B01276g Chr2 (119226..120104) [879 bp, 292 aa] {ON}
          conserved hypothetical protein
          Length = 292

 Score = 49.3 bits (116), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 27/79 (34%), Positives = 44/79 (55%), Gaps = 7/79 (8%)

Query: 1  MDYYGLLGVGQDASQDEIKRAYRKLALRHHPDKARGNEGGEDSSDDLPDVDFKEVTAAYQ 60
          +D Y  L +  DA   ++K++YR+L LR+HPDK   +   E++ D      F +V  +Y+
Sbjct: 11 IDPYATLELSNDAEDSQVKKSYRRLMLRYHPDKLSNDLAKEEAQD-----RFHKVQLSYE 65

Query: 61 VLSDASLRAEYDQKLAFEA 79
          VL+    R  YD+  + EA
Sbjct: 66 VLT--KFREIYDKSGSIEA 82

>YOR254C Chr15 complement(805032..807023) [1992 bp, 663 aa] {ON}
           SEC63Essential subunit of Sec63 complex (Sec63p, Sec62p,
           Sec66p and Sec72p); with Sec61 complex, Kar2p/BiP and
           Lhs1p forms a channel competent for SRP-dependent and
           post-translational SRP-independent protein targeting and
           import into the ER
          Length = 663

 Score = 50.1 bits (118), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 28/72 (38%), Positives = 43/72 (59%), Gaps = 4/72 (5%)

Query: 1   MDYYGLLGVGQDASQDEIKRAYRKLALRHHPDK-ARGNEGGEDSSDDLPDVDFKEVTAAY 59
            D Y +LG+   AS  +IK AYRKL+++ HPDK A+G    E S   + +  + ++T AY
Sbjct: 124 FDPYEILGISTSASDRDIKSAYRKLSVKFHPDKLAKGLTPDEKS---VMEETYVQITKAY 180

Query: 60  QVLSDASLRAEY 71
           + L+D  +R  Y
Sbjct: 181 ESLTDELVRQNY 192

>TDEL0C03680 Chr3 (646797..648467) [1671 bp, 556 aa] {ON}
          Anc_1.185 YJL162C
          Length = 556

 Score = 50.1 bits (118), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 25/73 (34%), Positives = 40/73 (54%), Gaps = 9/73 (12%)

Query: 3  YYGLLGVGQDASQDEIKRAYRKLALRHHPDKARGNEGGEDSSDDLPDVDFKEVTAAYQVL 62
          YY  LG+  +A++ EI ++Y  LA + HPDK++     E          FK ++ A+ VL
Sbjct: 14 YYSTLGLSSNANEAEIHKSYMMLARQLHPDKSKSEASAE---------QFKLISHAHSVL 64

Query: 63 SDASLRAEYDQKL 75
           D + R +YD+ L
Sbjct: 65 MDEAKRLKYDESL 77

>Ecym_6318 Chr6 complement(605055..606929) [1875 bp, 624 aa] {ON}
           similar to Ashbya gossypii ADR124C
          Length = 624

 Score = 49.7 bits (117), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 30/73 (41%), Positives = 43/73 (58%), Gaps = 7/73 (9%)

Query: 2   DYYGLLGVGQDASQDEIKRAYRKLALRHHPDKARGNEGGEDSSDDLPDVDFK--EVTAAY 59
           DYY  LGV ++A+  +I+RAY +L  ++HPDK      G+ S ++   VD K   +  AY
Sbjct: 504 DYYKELGVSKNANNKDIRRAYLQLTKKYHPDKQ-----GQLSQEERLKVDEKMSAINEAY 558

Query: 60  QVLSDASLRAEYD 72
           + L D S R EYD
Sbjct: 559 ETLRDDSKRKEYD 571

>KNAG0D01360 Chr4 complement(229325..229882) [558 bp, 185 aa] {ON}
          Anc_1.113 YJR097W
          Length = 185

 Score = 47.8 bits (112), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 28/73 (38%), Positives = 39/73 (53%), Gaps = 1/73 (1%)

Query: 3  YYGLLGVGQDASQDEIKRAYRKLALRHHPDKARGNEGGEDSSDDLPDVDFKEVTAAYQVL 62
          +Y +L V       E+K  Y++L L  HPDK    +  E    D   V    +  AY+VL
Sbjct: 7  HYEVLKVNSAVQLPELKLRYKELLLNTHPDKLGSAQDSESVWRD-RKVTINHIQEAYKVL 65

Query: 63 SDASLRAEYDQKL 75
          SDA+L+AEYD+ L
Sbjct: 66 SDATLKAEYDKSL 78

>ZYRO0D10934g Chr4 complement(921917..923908) [1992 bp, 663 aa] {ON}
           similar to uniprot|P14906 Saccharomyces cerevisiae
           YOR254C SEC63 Essential subunit of Sec63 complex (Sec63p
           Sec62p Sec66p and Sec72p) with Sec61 complex Kar2p/BiP
           and Lhs1p forms a channel competent for SRP-dependent
           and post- translational SRP-independent protein
           targeting and import into the ER
          Length = 663

 Score = 49.7 bits (117), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 25/71 (35%), Positives = 45/71 (63%), Gaps = 2/71 (2%)

Query: 1   MDYYGLLGVGQDASQDEIKRAYRKLALRHHPDKARGNEGGEDSSDDLPDVDFKEVTAAYQ 60
            D Y +LGV   A+  EIK AYRKL+++ HPDK  G++   ++   + ++ + ++T AY+
Sbjct: 121 FDPYEILGVSASAADREIKSAYRKLSVKFHPDKL-GHDLAPEARTKMEEM-YVQITKAYE 178

Query: 61  VLSDASLRAEY 71
            L+D +++  Y
Sbjct: 179 SLTDENVKENY 189

>ZYRO0A07502g Chr1 complement(614282..614998) [717 bp, 238 aa]
          {ON} similar to uniprot|P48353 Saccharomyces cerevisiae
          YMR161W
          Length = 238

 Score = 48.5 bits (114), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 28/74 (37%), Positives = 43/74 (58%), Gaps = 15/74 (20%)

Query: 3  YYGLLGVGQDASQDEIKRAYRKLALRHHPDK---ARGNEGGEDSSDDLPDVDFKEVTAAY 59
          +Y +L V + A+ +EIK++YRKLA+R HPDK    R +E             FK +  A+
Sbjct: 23 FYEILKVERTANDNEIKKSYRKLAIRLHPDKNPHPRASEA------------FKLINRAF 70

Query: 60 QVLSDASLRAEYDQ 73
          +VL D+  R+ YD+
Sbjct: 71 EVLGDSEKRSLYDR 84

>Kpol_2001.27 s2001 (79675..81237) [1563 bp, 520 aa] {ON}
          (79675..81237) [1563 nt, 521 aa]
          Length = 520

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 25/70 (35%), Positives = 41/70 (58%), Gaps = 9/70 (12%)

Query: 3  YYGLLGVGQDASQDEIKRAYRKLALRHHPDKARGNEGGEDSSDDLPDVDFKEVTAAYQVL 62
          YY +LG+   A++ +I ++Y +LA + HPDK++ N+  E          FK V  A+ +L
Sbjct: 8  YYSVLGLPTTANKKDIHKSYLRLARKLHPDKSKSNDFEE---------LFKVVVQAHSIL 58

Query: 63 SDASLRAEYD 72
          +D S + EYD
Sbjct: 59 TDISSKQEYD 68

>Ecym_8093 Chr8 (198912..200543) [1632 bp, 543 aa] {ON} similar to
          Ashbya gossypii AEL112C
          Length = 543

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 24/73 (32%), Positives = 40/73 (54%), Gaps = 9/73 (12%)

Query: 3  YYGLLGVGQDASQDEIKRAYRKLALRHHPDKARGNEGGEDSSDDLPDVDFKEVTAAYQVL 62
          YY +LG+  D ++  I+++Y +LA   HPDK++  E  E          FK V  A+ +L
Sbjct: 13 YYSVLGLPFDTTEMHIRKSYMRLARELHPDKSKSKEAAE---------LFKIVAHAHSIL 63

Query: 63 SDASLRAEYDQKL 75
          +D   + +YD+ L
Sbjct: 64 TDKEKKLKYDKTL 76

>TPHA0B04190 Chr2 complement(984952..985458) [507 bp, 168 aa] {ON}
          Anc_1.113 YJR097W
          Length = 168

 Score = 47.4 bits (111), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 25/77 (32%), Positives = 42/77 (54%), Gaps = 6/77 (7%)

Query: 1  MDYYGLLGVGQDASQDEIKRAYRKLALRHHPDKARGNEGGEDSSDDLPDVDFKEVTAAYQ 60
          + +Y +LGV  D++  +IKRAY++  L  HPDK +G     ++          ++  AY 
Sbjct: 8  VSHYEVLGVTTDSTLMDIKRAYKEKLLNVHPDKNKGQAPKSNT------YSVNQIQEAYG 61

Query: 61 VLSDASLRAEYDQKLAF 77
          VL++ +LR +YD  L  
Sbjct: 62 VLAEQTLRTQYDASLEL 78

>CAGL0H04499g Chr8 complement(427509..428207) [699 bp, 232 aa]
          {ON} similar to uniprot|P48353 Saccharomyces cerevisiae
          YMR161w HLJ1
          Length = 232

 Score = 48.1 bits (113), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 28/71 (39%), Positives = 41/71 (57%), Gaps = 9/71 (12%)

Query: 3  YYGLLGVGQDASQDEIKRAYRKLALRHHPDKARGNEGGEDSSDDLPDVDFKEVTAAYQVL 62
          +Y +L V + +S  +IK+AYRKLA++ HPDK    +  E          FK +  A++VL
Sbjct: 22 FYDILNVERSSSDVDIKKAYRKLAIKLHPDKNPYPKAHE---------AFKLINRAFEVL 72

Query: 63 SDASLRAEYDQ 73
          SD+  R  YDQ
Sbjct: 73 SDSQKRQIYDQ 83

>NCAS0D00960 Chr4 complement(187021..187695) [675 bp, 224 aa] {ON}
          Anc_2.350
          Length = 224

 Score = 48.1 bits (113), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 28/71 (39%), Positives = 41/71 (57%), Gaps = 9/71 (12%)

Query: 3  YYGLLGVGQDASQDEIKRAYRKLALRHHPDKARGNEGGEDSSDDLPDVDFKEVTAAYQVL 62
          +Y +L V + A+ +EIK+AYRKLA++ HPDK    +  E          FK +  A++VL
Sbjct: 23 FYEILKVEKTANDNEIKKAYRKLAVKLHPDKNPHPKASE---------AFKIINRAFEVL 73

Query: 63 SDASLRAEYDQ 73
          SD   R  YD+
Sbjct: 74 SDVEKRQLYDR 84

>TBLA0C02720 Chr3 complement(651693..653840) [2148 bp, 715 aa] {ON}
           Anc_1.297 YJL073W
          Length = 715

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 26/71 (36%), Positives = 43/71 (60%), Gaps = 3/71 (4%)

Query: 2   DYYGLLGVGQDASQDEIKRAYRKLALRHHPDKARGNEGGEDSSDDLPDVDFKEVTAAYQV 61
           DYY +LGV +++   EI+++Y  L  ++HPDK +G    E+   +   ++  ++  AY+ 
Sbjct: 604 DYYKILGVKKNSQLKEIRKSYLSLTKKYHPDK-QGQLSEEEQERNHKKME--QINEAYEC 660

Query: 62  LSDASLRAEYD 72
           LSD S R EYD
Sbjct: 661 LSDESKRKEYD 671

>KAFR0H02310 Chr8 (441168..443135) [1968 bp, 655 aa] {ON} Anc_8.698
           YOR254C
          Length = 655

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 26/71 (36%), Positives = 40/71 (56%), Gaps = 2/71 (2%)

Query: 1   MDYYGLLGVGQDASQDEIKRAYRKLALRHHPDKARGNEGGEDSSDDLPDVDFKEVTAAYQ 60
            D Y +LG+   AS+ EIK AYRKL+++ HPDK    E  E     + +  + ++T AY+
Sbjct: 118 FDPYDILGISSSASEREIKSAYRKLSVKFHPDKL-AKELTEQERTTMEEA-YVQITKAYE 175

Query: 61  VLSDASLRAEY 71
            L+D   R  +
Sbjct: 176 ALTDELTRQNF 186

>Skud_13.323 Chr13 (550675..551349) [675 bp, 224 aa] {ON} YMR161W
          (REAL)
          Length = 224

 Score = 47.8 bits (112), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 27/72 (37%), Positives = 41/72 (56%), Gaps = 9/72 (12%)

Query: 2  DYYGLLGVGQDASQDEIKRAYRKLALRHHPDKARGNEGGEDSSDDLPDVDFKEVTAAYQV 61
          ++Y +L V + A+  EIK+AYRKLA++ HPDK       E          FK +  A++V
Sbjct: 21 EFYEILRVDKKATDGEIKKAYRKLAIKLHPDKNSHPRASE---------AFKVINRAFEV 71

Query: 62 LSDASLRAEYDQ 73
          LS+   R+ YD+
Sbjct: 72 LSNEEKRSIYDR 83

>TBLA0B03490 Chr2 complement(814731..815885) [1155 bp, 384 aa]
          {ON} Anc_8.730 YMR214W
          Length = 384

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 27/73 (36%), Positives = 43/73 (58%), Gaps = 9/73 (12%)

Query: 2  DYYGLLGVGQDAS-QDEIKRAYRKLALRHHPDKARGNEGGEDSSDDLPDVDFKEVTAAYQ 60
          DYY +LG+ ++   + EIK AYRKL+ ++HPDK + ++  +         +F +V  AY 
Sbjct: 24 DYYKILGINKNYKYEKEIKSAYRKLSKKYHPDKNKNDKDAQQ--------NFIKVGEAYD 75

Query: 61 VLSDASLRAEYDQ 73
          VL D   + +YDQ
Sbjct: 76 VLGDPDKKRQYDQ 88

 Score = 44.3 bits (103), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 54/253 (21%), Positives = 104/253 (41%), Gaps = 30/253 (11%)

Query: 120 IEIDLKVKTSELYRGXXXXXXXXXXXXCQRCDGTGWKSHASIVKKKTAKFFWNVCEGCEG 179
           ++++ ++   + Y+G            C  C GTG +   +            VC  C+G
Sbjct: 151 LKVEQQLSLKQYYQGFDFQFALNLHDDCDHCHGTGSEDGKT-----------KVCPDCKG 199

Query: 180 QGVRQRLRQLAPGFVTTELIE-CRQCGGKGKLRNLPKSEKNKCPDCITSGTVGMVEENKV 238
            G+  ++ ++  G +T ++ + C +C G+G L       KN C  C  +     +++ KV
Sbjct: 200 SGIIIQIIRM--GMMTQQIQQPCGRCRGQGHLI------KNFCKVCNGAKVQQKLKDFKV 251

Query: 239 VTINIKKGTLDGDKIVLKGEADEDLESTEVGDLVIKIQEVKEPQYDIVRNGYDLIIKKQI 298
               +  G+      V  G+A+++  + E GD++I+  E+        R G +L   + I
Sbjct: 252 Y---VPPGSPRNHVEVKAGQAEKN-PNYEPGDVIIEFNELPLDNLGYRRRGNNLFRTEYI 307

Query: 299 DLADAICGFDEKPLMETYDGRVLKWSSKRGKVIRPNDIVRIQNEGWPRREDANDNNTLLK 358
            L +A+ G  E+ L      + +         I   +I  ++  G P     N      K
Sbjct: 308 SLNEALYGNWERTLDFLDPKKRINLKRSPNVTIYDGEIEILKGFGMPIPNKKN------K 361

Query: 359 NGDLYVIVDIVFP 371
            GDLY+   ++ P
Sbjct: 362 FGDLYIDYKVIIP 374

>TPHA0C04590 Chr3 (991298..991999) [702 bp, 233 aa] {ON} Anc_2.350
          YMR161W
          Length = 233

 Score = 47.8 bits (112), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 27/71 (38%), Positives = 41/71 (57%), Gaps = 9/71 (12%)

Query: 3  YYGLLGVGQDASQDEIKRAYRKLALRHHPDKARGNEGGEDSSDDLPDVDFKEVTAAYQVL 62
          +Y +L V + A   EIK++YRKLA++ HPDK    + GE          FK +  A++VL
Sbjct: 25 FYDILNVQKSADSVEIKKSYRKLAIKLHPDKNPHPKAGE---------AFKVINRAFEVL 75

Query: 63 SDASLRAEYDQ 73
          SD   R+ +D+
Sbjct: 76 SDDEKRSVFDR 86

>KLLA0B07271g Chr2 complement(633724..635685) [1962 bp, 653 aa]
          {ON} some similarities with uniprot|P46997
          Saccharomyces cerevisiae YJL162C JJJ2 Protein that may
          function as a cochaperone as suggested by the presence
          of a DnaJ-like domain
          Length = 653

 Score = 49.3 bits (116), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 26/72 (36%), Positives = 41/72 (56%), Gaps = 9/72 (12%)

Query: 4  YGLLGVGQDASQDEIKRAYRKLALRHHPDKARGNEGGEDSSDDLPDVDFKEVTAAYQVLS 63
          Y +L +   A++ +I++AY KLA   HPDK++  E GE          FK+V  A+ +L+
Sbjct: 16 YSVLNLKYGATEVQIRKAYMKLARELHPDKSKSEEAGE---------LFKKVAHAHFILT 66

Query: 64 DASLRAEYDQKL 75
          D   + +YD KL
Sbjct: 67 DKKEKMKYDSKL 78

>SAKL0C05456g Chr3 complement(519700..521451) [1752 bp, 583 aa]
          {ON} similar to uniprot|Q757X4 Ashbya gossypii AEL112C
          AEL112Cp and some similarites with YJL162C
          uniprot|P46997 Saccharomyces cerevisiae YJL162C JJJ2
          Protein that may function as a cochaperone as suggested
          by the presence of a DnaJ-like domain
          Length = 583

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 26/73 (35%), Positives = 40/73 (54%), Gaps = 9/73 (12%)

Query: 3  YYGLLGVGQDASQDEIKRAYRKLALRHHPDKARGNEGGEDSSDDLPDVDFKEVTAAYQVL 62
          YY +LG+  DA+  +I+++Y KLA   HPDK++     E          FK V  A+ +L
Sbjct: 13 YYSVLGLPFDATDAQIRKSYMKLARELHPDKSKSEVAAE---------LFKVVAHAHSIL 63

Query: 63 SDASLRAEYDQKL 75
          +D   R +YD+ L
Sbjct: 64 TDREKRLKYDRSL 76

>TPHA0O01940 Chr15 (386610..388406) [1797 bp, 598 aa] {ON}
          Anc_2.15 YNL227C
          Length = 598

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 28/70 (40%), Positives = 39/70 (55%), Gaps = 7/70 (10%)

Query: 3  YYGLLGVGQDASQDEIKRAYRKLALRHHPDKARGNEGGEDSSDDLPDVDFKEVTAAYQVL 62
          YY LL V   AS  ++K+AYR+ AL++HPDK   N        +  D+ F  +  AY++L
Sbjct: 5  YYELLDVEMTASDADLKKAYRRKALQYHPDKNINN------IKEATDI-FANIRTAYEIL 57

Query: 63 SDASLRAEYD 72
          SD   R  YD
Sbjct: 58 SDPQERVWYD 67

>Skud_10.52 Chr10 complement(88516..90195) [1680 bp, 559 aa] {ON}
          YJL162C (REAL)
          Length = 559

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 26/73 (35%), Positives = 40/73 (54%), Gaps = 9/73 (12%)

Query: 3  YYGLLGVGQDASQDEIKRAYRKLALRHHPDKARGNEGGEDSSDDLPDVDFKEVTAAYQVL 62
          YY +LG+  +A+  E+ ++Y KLA   HPDK +      D  +DL    FK V  A+ +L
Sbjct: 14 YYSILGLTSNATSSEVHKSYLKLARLLHPDKTKS-----DKCEDL----FKAVVHAHSIL 64

Query: 63 SDASLRAEYDQKL 75
          +D   +  YD+ L
Sbjct: 65 TDKDQKLRYDRDL 77

>Skud_15.420 Chr15 complement(743976..745973) [1998 bp, 665 aa] {ON}
           YOR254C (REAL)
          Length = 665

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 28/72 (38%), Positives = 43/72 (59%), Gaps = 4/72 (5%)

Query: 1   MDYYGLLGVGQDASQDEIKRAYRKLALRHHPDK-ARGNEGGEDSSDDLPDVDFKEVTAAY 59
            D Y +LGV   AS  +IK AYRKL+++ HPDK A+G    E    ++ +  + ++T AY
Sbjct: 124 FDPYEILGVSTSASDRDIKSAYRKLSVKFHPDKLAKGLTPDE---KNVVEEAYVQITKAY 180

Query: 60  QVLSDASLRAEY 71
           + L+D  +R  Y
Sbjct: 181 ESLTDELVRQNY 192

>SAKL0D06226g Chr4 (510407..512254) [1848 bp, 615 aa] {ON} weakly
           similar to uniprot|P40358 Saccharomyces cerevisiae
           YJL073W JEM1 DnaJ-like chaperone required for nuclear
           membrane fusion during mating localizes to the ER
           membrane exhibits genetic interactions with KAR2
          Length = 615

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 25/71 (35%), Positives = 42/71 (59%), Gaps = 3/71 (4%)

Query: 2   DYYGLLGVGQDASQDEIKRAYRKLALRHHPDKARGNEGGEDSSDDLPDVDFKEVTAAYQV 61
           DYY +L V ++A+  +I++AY +L  ++HPDK +     E  ++   +     +  AY++
Sbjct: 507 DYYKILEVPKNANTKDIRKAYLQLTKKYHPDKQQQLSENEQVAN---EEKMSAINEAYEI 563

Query: 62  LSDASLRAEYD 72
           LSD S R EYD
Sbjct: 564 LSDESKRKEYD 574

>SAKL0H00858g Chr8 complement(101231..102529) [1299 bp, 432 aa] {ON}
           highly similar to uniprot|P32527 Saccharomyces
           cerevisiae YGR285C ZUO1 Cytosolic ribosome-associated
           chaperone contains a DnaJ domain together with Ssz1p
           acts as a chaperone for nascent polypeptide chains
          Length = 432

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 27/74 (36%), Positives = 43/74 (58%), Gaps = 9/74 (12%)

Query: 2   DYYGLLGVGQ---DASQDEIKRAYRKLALRHHPDKARGNEGGEDSSDDLPDVDFKEVTAA 58
           D Y  +G+ +    A+  +I +A+RK  L+HHPDK   + G E+      D  FK +  A
Sbjct: 97  DLYAAMGISKLRYKATDAQIIKAHRKQVLKHHPDKKSASGGLEE------DGFFKIIQKA 150

Query: 59  YQVLSDASLRAEYD 72
           Y+ L+D++ RA+YD
Sbjct: 151 YETLTDSNKRAQYD 164

>YJL162C Chr10 complement(113878..115629) [1752 bp, 583 aa] {ON}
          JJJ2Protein of unknown function, contains a J-domain,
          which is a region with homology to the E. coli DnaJ
          protein
          Length = 583

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 26/73 (35%), Positives = 41/73 (56%), Gaps = 9/73 (12%)

Query: 3  YYGLLGVGQDASQDEIKRAYRKLALRHHPDKARGNEGGEDSSDDLPDVDFKEVTAAYQVL 62
          YY +LG+  +A+  E+ ++Y KLA   HPDK +      D S++L    FK V  A+ +L
Sbjct: 14 YYSILGLTSNATSSEVHKSYLKLARLLHPDKTKS-----DKSEEL----FKAVVHAHSIL 64

Query: 63 SDASLRAEYDQKL 75
          +D   +  YD+ L
Sbjct: 65 TDEDQKLRYDRDL 77

>AFR659W Chr6 (1640624..1641445) [822 bp, 273 aa] {ON}
          Non-syntenic homolog of Saccharomyces cerevisiae
          YGL128C (CWC23)
          Length = 273

 Score = 48.1 bits (113), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 28/82 (34%), Positives = 44/82 (53%), Gaps = 15/82 (18%)

Query: 2  DYYGLLGVGQDASQD-------EIKRAYRKLALRHHPDKARGNEGGEDSSDDLPDVDFKE 54
          D Y LL V   + ++       +++  +R+LALR+HPDK R +    D         F  
Sbjct: 15 DLYALLEVSISSPEELEAVDAAQLRAQFRRLALRYHPDKRRDDTQQNDK--------FVS 66

Query: 55 VTAAYQVLSDASLRAEYDQKLA 76
          V  AY +LS++SLRA Y++ L+
Sbjct: 67 VQKAYDILSNSSLRATYNRWLS 88

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.315    0.135    0.405 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 49,499,461
Number of extensions: 2223138
Number of successful extensions: 6067
Number of sequences better than 10.0: 366
Number of HSP's gapped: 5652
Number of HSP's successfully gapped: 448
Length of query: 452
Length of database: 53,481,399
Length adjustment: 113
Effective length of query: 339
Effective length of database: 40,524,141
Effective search space: 13737683799
Effective search space used: 13737683799
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 67 (30.4 bits)