Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
CAGL0L12254g8.263ON57457429530.0
TDEL0F039008.263ON55950019830.0
NCAS0B050208.263ON56849419820.0
KNAG0G020408.263ON59149719800.0
YLR089C (ALT1)8.263ON59257919720.0
Skud_12.1578.263ON59257619660.0
Smik_12.1488.263ON59257919500.0
NDAI0B019908.263ON58850919340.0
Suva_10.1738.263ON59250719260.0
ZYRO0C01628g8.263ON53450919050.0
KLLA0F19162g8.263ON52848418870.0
SAKL0H17006g8.263ON53149918620.0
KAFR0B027308.263ON53949218370.0
Kpol_392.58.263ON51250018080.0
TPHA0J007508.263ON52249217640.0
KLTH0G13662g8.263ON51948217580.0
Kwal_56.237918.263ON51847817400.0
YDR111C (ALT2)8.263ON50749417140.0
NCAS0B038408.263ON49749716950.0
Smik_4.3578.263ON50749216910.0
Suva_2.2718.263ON50749416870.0
KAFR0B055308.263ON51448816850.0
Skud_4.3728.263ON50749116780.0
KNAG0M012108.263ON52149516720.0
AGR085W8.263ON52148616590.0
Kpol_543.398.263ON49249516480.0
TBLA0E044408.263ON56248716370.0
KAFR0B05520singletonON51049216160.0
NDAI0J013608.263ON50148816040.0
TPHA0A018008.263ON49849115820.0
TBLA0F030608.263ON50049915730.0
Ecym_43078.263ON53448615680.0
TBLA0G01630singletonON50049715210.0
Kwal_34.160181.472ON3791801286e-07
Kpol_1039.222.252ON3861901081e-04
SAKL0H21824gna 1ON4991861054e-04
SAKL0F02156g3.511ON4983311054e-04
Ecym_62921.321ON4303231045e-04
KLLA0A04906gna 1ON4801221046e-04
Ecym_32902.252ON3861271036e-04
CAGL0J05126g1.321ON4333781036e-04
Kpol_1035.231.321ON4443291036e-04
KLLA0F10021g3.511ON4973261036e-04
ADL249W2.252ON3872501000.001
TPHA0O014501.321ON4433601000.001
NDAI0B045502.102ON5651611000.001
KLLA0F03509g2.252ON387169990.002
SAKL0D11528g1.472ON383153990.002
NCAS0A092001.321ON445327990.002
KLTH0E07678gna 1ON492195990.002
NDAI0G057601.321ON448329990.002
TPHA0D033703.511ON497122990.002
KAFR0A017101.321ON435241970.004
KLTH0G09614g2.252ON389237970.004
Kwal_47.17462na 1ON492122970.004
AGR167Wna 1ON512133970.004
KAFR0D014203.511ON492141960.005
NCAS0E006703.511ON497167960.005
YGL202W (ARO8)3.511ON500123950.006
Smik_7.693.511ON500123950.006
SAKL0E08492g2.252ON384125930.009
KNAG0B006603.511ON496122930.011
Kpol_278.23.511ON498122930.012
Kwal_23.48882.252ON389123920.013
KLTH0G19646g1.472ON379152910.015
Kwal_47.189823.511ON496124920.016
KLTH0G02002g3.511ON496124920.016
Smik_10.1801.321ON44450900.024
TDEL0D019001.321ON443376900.026
Kpol_1032.398.204ON453362890.029
TDEL0F009002.102ON493146890.029
TBLA0B009902.102ON54644900.029
Skud_10.1561.321ON46050890.032
AFR548C3.511ON497125890.033
KNAG0E018502.252ON384122880.036
AEL170C1.321ON458235890.036
ZYRO0G20636g1.321ON453140880.039
YJL060W (BNA3)1.321ON44450880.042
KLTH0B06270g2.102ON52544880.043
Kwal_33.145822.102ON52544880.049
CAGL0G01254g3.511ON504123870.056
Skud_7.693.511ON500123860.068
SAKL0G14564g5.133ON31671850.070
Suva_6.1361.321ON44450860.073
Suva_7.613.511ON500123860.075
Kpol_1035.302.102ON50144850.088
Kwal_14.25741.321ON44348850.088
KNAG0B053201.321ON433169850.11
NDAI0B037302.252ON386125840.12
KLLA0F01617g1.321ON44452840.13
NDAI0I028303.511ON500123840.14
ZYRO0A01672g2.252ON386124830.15
KLTH0H10648g1.321ON44348830.18
Ecym_6319singletonON354285820.19
KLTH0G19624gsingletonON46832820.23
ZYRO0C06028g3.511ON496124820.23
KLTH0B00176g8.204ON44832820.25
KNAG0H037302.102ON52344810.29
Kpol_480.11.472ON38047810.31
Ecym_7228na 1ON488125790.47
SAKL0D06886g1.321ON44748790.48
TPHA0O015202.102ON50344790.57
Kwal_8.5858.204ON44632780.61
YIL116W (HIS5)2.252ON385123770.80
KNAG0G005501.472ON38785770.80
Suva_9.782.252ON386124770.80
KAFR0J015802.252ON383123770.91
NCAS0G040501.472ON38453770.92
KNAG0G016808.204ON45234761.2
TDEL0D057903.511ON49744761.3
CAGL0C01243g2.252ON383122751.3
TDEL0A016008.204ON47532761.3
Skud_9.552.252ON385123751.4
KLLA0F22000g5.139ON79330751.6
Ecym_55428.204ON446162742.0
KLLA0D11110g2.102ON53044742.2
SAKL0H18612g8.204ON44550732.7
NCAS0B064402.252ON385142732.8
Smik_9.532.252ON388125723.2
TDEL0C040902.252ON383128723.3
CAGL0G06028g2.102ON53744714.5
Smik_10.1501.274ON117369706.5
Smik_5.3198.204ON44333697.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0L12254g
         (574 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0L12254g Chr12 complement(1327111..1328835) [1725 bp, 574 aa...  1142   0.0  
TDEL0F03900 Chr6 complement(726159..727838) [1680 bp, 559 aa] {O...   768   0.0  
NCAS0B05020 Chr2 complement(931456..933162) [1707 bp, 568 aa] {O...   768   0.0  
KNAG0G02040 Chr7 complement(463058..464833) [1776 bp, 591 aa] {O...   767   0.0  
YLR089C Chr12 complement(318237..320015) [1779 bp, 592 aa] {ON} ...   764   0.0  
Skud_12.157 Chr12 complement(301427..303205) [1779 bp, 592 aa] {...   761   0.0  
Smik_12.148 Chr12 complement(298127..299905) [1779 bp, 592 aa] {...   755   0.0  
NDAI0B01990 Chr2 complement(493160..494926) [1767 bp, 588 aa] {O...   749   0.0  
Suva_10.173 Chr10 complement(323066..324844) [1779 bp, 592 aa] {...   746   0.0  
ZYRO0C01628g Chr3 (115665..117269) [1605 bp, 534 aa] {ON} simila...   738   0.0  
KLLA0F19162g Chr6 complement(1775240..1776826) [1587 bp, 528 aa]...   731   0.0  
SAKL0H17006g Chr8 (1493272..1494867) [1596 bp, 531 aa] {ON} high...   721   0.0  
KAFR0B02730 Chr2 complement(558858..560477) [1620 bp, 539 aa] {O...   712   0.0  
Kpol_392.5 s392 (6873..8411) [1539 bp, 512 aa] {ON} (6873..8411)...   701   0.0  
TPHA0J00750 Chr10 complement(176561..178129) [1569 bp, 522 aa] {...   684   0.0  
KLTH0G13662g Chr7 (1169989..1171548) [1560 bp, 519 aa] {ON} simi...   681   0.0  
Kwal_56.23791 s56 (706946..708502) [1557 bp, 518 aa] {ON} YLR089...   674   0.0  
YDR111C Chr4 complement(678241..679764) [1524 bp, 507 aa] {ON}  ...   664   0.0  
NCAS0B03840 Chr2 (683781..685274) [1494 bp, 497 aa] {ON} Anc_8.2...   657   0.0  
Smik_4.357 Chr4 complement(639561..641084) [1524 bp, 507 aa] {ON...   655   0.0  
Suva_2.271 Chr2 complement(472714..474237) [1524 bp, 507 aa] {ON...   654   0.0  
KAFR0B05530 Chr2 (1132895..1134439) [1545 bp, 514 aa] {ON}            653   0.0  
Skud_4.372 Chr4 complement(649872..651395) [1524 bp, 507 aa] {ON...   650   0.0  
KNAG0M01210 Chr13 (220612..222177) [1566 bp, 521 aa] {ON} Anc_8....   648   0.0  
AGR085W Chr7 (887023..888588) [1566 bp, 521 aa] {ON} Syntenic ho...   643   0.0  
Kpol_543.39 s543 complement(86358..87836) [1479 bp, 492 aa] {ON}...   639   0.0  
TBLA0E04440 Chr5 complement(1138820..1140508) [1689 bp, 562 aa] ...   635   0.0  
KAFR0B05520 Chr2 (1130297..1131829) [1533 bp, 510 aa] {ON} Anc_8...   627   0.0  
NDAI0J01360 Chr10 (313791..315296) [1506 bp, 501 aa] {ON} Anc_8....   622   0.0  
TPHA0A01800 Chr1 (364262..365758) [1497 bp, 498 aa] {ON} Anc_8.2...   613   0.0  
TBLA0F03060 Chr6 (743646..745148) [1503 bp, 500 aa] {ON} Anc_8.2...   610   0.0  
Ecym_4307 Chr4 (652209..653813) [1605 bp, 534 aa] {ON} similar t...   608   0.0  
TBLA0G01630 Chr7 (428016..429518) [1503 bp, 500 aa] {ON}              590   0.0  
Kwal_34.16018 s34 (159210..160349) [1140 bp, 379 aa] {ON} YJL060...    54   6e-07
Kpol_1039.22 s1039 (68736..69896) [1161 bp, 386 aa] {ON} (68736....    46   1e-04
SAKL0H21824g Chr8 (1903887..1905386) [1500 bp, 499 aa] {ON} simi...    45   4e-04
SAKL0F02156g Chr6 (185574..187070) [1497 bp, 498 aa] {ON} highly...    45   4e-04
Ecym_6292 Chr6 (547563..548855) [1293 bp, 430 aa] {ON} similar t...    45   5e-04
KLLA0A04906g Chr1 (437523..438965) [1443 bp, 480 aa] {ON} simila...    45   6e-04
Ecym_3290 Chr3 (546773..547933) [1161 bp, 386 aa] {ON} similar t...    44   6e-04
CAGL0J05126g Chr10 complement(487452..488753) [1302 bp, 433 aa] ...    44   6e-04
Kpol_1035.23 s1035 complement(56123..57457) [1335 bp, 444 aa] {O...    44   6e-04
KLLA0F10021g Chr6 (926569..928062) [1494 bp, 497 aa] {ON} simila...    44   6e-04
ADL249W Chr4 (261227..262390) [1164 bp, 387 aa] {ON} Syntenic ho...    43   0.001
TPHA0O01450 Chr15 complement(291591..292922) [1332 bp, 443 aa] {...    43   0.001
NDAI0B04550 Chr2 (1132653..1134350) [1698 bp, 565 aa] {ON} Anc_2...    43   0.001
KLLA0F03509g Chr6 (327598..328761) [1164 bp, 387 aa] {ON} simila...    43   0.002
SAKL0D11528g Chr4 complement(960867..962018) [1152 bp, 383 aa] {...    43   0.002
NCAS0A09200 Chr1 complement(1819134..1820471) [1338 bp, 445 aa] ...    43   0.002
KLTH0E07678g Chr5 (702610..704088) [1479 bp, 492 aa] {ON} simila...    43   0.002
NDAI0G05760 Chr7 (1427844..1429190) [1347 bp, 448 aa] {ON} Anc_1...    43   0.002
TPHA0D03370 Chr4 complement(704980..706473) [1494 bp, 497 aa] {O...    43   0.002
KAFR0A01710 Chr1 complement(348198..349505) [1308 bp, 435 aa] {O...    42   0.004
KLTH0G09614g Chr7 (804939..806108) [1170 bp, 389 aa] {ON} simila...    42   0.004
Kwal_47.17462 s47 (413555..415033) [1479 bp, 492 aa] {ON} YGL202...    42   0.004
AGR167W Chr7 (1059790..1061328) [1539 bp, 512 aa] {ON} Non-synte...    42   0.004
KAFR0D01420 Chr4 (284515..285993) [1479 bp, 492 aa] {ON} Anc_3.5...    42   0.005
NCAS0E00670 Chr5 (117006..118499) [1494 bp, 497 aa] {ON} Anc_3.511     42   0.005
YGL202W Chr7 (116059..117561) [1503 bp, 500 aa] {ON}  ARO8Aromat...    41   0.006
Smik_7.69 Chr7 (111132..112634) [1503 bp, 500 aa] {ON} YGL202W (...    41   0.006
SAKL0E08492g Chr5 complement(692049..693203) [1155 bp, 384 aa] {...    40   0.009
KNAG0B00660 Chr2 (115417..116907) [1491 bp, 496 aa] {ON} Anc_3.5...    40   0.011
Kpol_278.2 s278 (2488..3984) [1497 bp, 498 aa] {ON} (2488..3984)...    40   0.012
Kwal_23.4888 s23 (907745..908914) [1170 bp, 389 aa] {ON} YIL116W...    40   0.013
KLTH0G19646g Chr7 complement(1699421..1700560) [1140 bp, 379 aa]...    40   0.015
Kwal_47.18982 s47 complement(1051414..1052904) [1491 bp, 496 aa]...    40   0.016
KLTH0G02002g Chr7 (155219..156709) [1491 bp, 496 aa] {ON} highly...    40   0.016
Smik_10.180 Chr10 (315030..316364) [1335 bp, 444 aa] {ON} YJL060...    39   0.024
TDEL0D01900 Chr4 (369434..370765) [1332 bp, 443 aa] {ON} Anc_1.3...    39   0.026
Kpol_1032.39 s1032 complement(90576..91937) [1362 bp, 453 aa] {O...    39   0.029
TDEL0F00900 Chr6 complement(153488..154969) [1482 bp, 493 aa] {O...    39   0.029
TBLA0B00990 Chr2 complement(221196..222836) [1641 bp, 546 aa] {O...    39   0.029
Skud_10.156 Chr10 complement(294149..295531) [1383 bp, 460 aa] {...    39   0.032
AFR548C Chr6 complement(1422283..1423776) [1494 bp, 497 aa] {ON}...    39   0.033
KNAG0E01850 Chr5 (381827..382981) [1155 bp, 384 aa] {ON} Anc_2.2...    39   0.036
AEL170C Chr5 complement(318032..319408) [1377 bp, 458 aa] {ON} S...    39   0.036
ZYRO0G20636g Chr7 complement(1700506..1701867) [1362 bp, 453 aa]...    39   0.039
YJL060W Chr10 (323386..324720) [1335 bp, 444 aa] {ON}  BNA3Kynur...    39   0.042
KLTH0B06270g Chr2 (508642..510219) [1578 bp, 525 aa] {ON} simila...    39   0.043
Kwal_33.14582 s33 complement(728649..730226) [1578 bp, 525 aa] {...    39   0.049
CAGL0G01254g Chr7 (119281..120795) [1515 bp, 504 aa] {ON} highly...    38   0.056
Skud_7.69 Chr7 (120729..122231) [1503 bp, 500 aa] {ON} YGL202W (...    38   0.068
SAKL0G14564g Chr7 complement(1256845..1257795) [951 bp, 316 aa] ...    37   0.070
Suva_6.136 Chr6 complement(227366..228700) [1335 bp, 444 aa] {ON...    38   0.073
Suva_7.61 Chr7 (112022..113524) [1503 bp, 500 aa] {ON} YGL202W (...    38   0.075
Kpol_1035.30 s1035 (69909..71414) [1506 bp, 501 aa] {ON} (69909....    37   0.088
Kwal_14.2574 s14 complement(818144..819475) [1332 bp, 443 aa] {O...    37   0.088
KNAG0B05320 Chr2 (1028845..1030146) [1302 bp, 433 aa] {ON} Anc_1...    37   0.11 
NDAI0B03730 Chr2 complement(935131..936291) [1161 bp, 386 aa] {O...    37   0.12 
KLLA0F01617g Chr6 complement(154025..155359) [1335 bp, 444 aa] {...    37   0.13 
NDAI0I02830 Chr9 complement(669885..671387) [1503 bp, 500 aa] {O...    37   0.14 
ZYRO0A01672g Chr1 (136284..137444) [1161 bp, 386 aa] {ON} highly...    37   0.15 
KLTH0H10648g Chr8 complement(919601..920932) [1332 bp, 443 aa] {...    37   0.18 
Ecym_6319 Chr6 complement(607599..608663) [1065 bp, 354 aa] {ON}...    36   0.19 
KLTH0G19624g Chr7 complement(1697587..1698993) [1407 bp, 468 aa]...    36   0.23 
ZYRO0C06028g Chr3 (457564..459054) [1491 bp, 496 aa] {ON} highly...    36   0.23 
KLTH0B00176g Chr2 (10791..12137) [1347 bp, 448 aa] {ON} similar ...    36   0.25 
KNAG0H03730 Chr8 (690872..692443) [1572 bp, 523 aa] {ON} Anc_2.1...    36   0.29 
Kpol_480.1 s480 (215..1357) [1143 bp, 380 aa] {ON} (215..1357) [...    36   0.31 
Ecym_7228 Chr7 (473169..474635) [1467 bp, 488 aa] {ON} similar t...    35   0.47 
SAKL0D06886g Chr4 complement(571478..572821) [1344 bp, 447 aa] {...    35   0.48 
TPHA0O01520 Chr15 (304547..306058) [1512 bp, 503 aa] {ON} Anc_2....    35   0.57 
Kwal_8.585 s8 (15757..17097) [1341 bp, 446 aa] {ON} YER152C - Hy...    35   0.61 
YIL116W Chr9 (142928..144085) [1158 bp, 385 aa] {ON}  HIS5Histid...    34   0.80 
KNAG0G00550 Chr7 (96823..97986) [1164 bp, 387 aa] {ON} Anc_1.472       34   0.80 
Suva_9.78 Chr9 (137747..138907) [1161 bp, 386 aa] {ON} YIL116W (...    34   0.80 
KAFR0J01580 Chr10 complement(287313..288464) [1152 bp, 383 aa] {...    34   0.91 
NCAS0G04050 Chr7 complement(753216..754370) [1155 bp, 384 aa] {O...    34   0.92 
KNAG0G01680 Chr7 complement(369892..371250) [1359 bp, 452 aa] {O...    34   1.2  
TDEL0D05790 Chr4 complement(1045218..1046711) [1494 bp, 497 aa] ...    34   1.3  
CAGL0C01243g Chr3 (128629..129780) [1152 bp, 383 aa] {ON} highly...    33   1.3  
TDEL0A01600 Chr1 (289263..290690) [1428 bp, 475 aa] {ON} Anc_8.2...    34   1.3  
Skud_9.55 Chr9 (119747..120904) [1158 bp, 385 aa] {ON} YIL116W (...    33   1.4  
KLLA0F22000g Chr6 complement(2044973..2047354) [2382 bp, 793 aa]...    33   1.6  
Ecym_5542 Chr5 (1099530..1100870) [1341 bp, 446 aa] {ON} similar...    33   2.0  
KLLA0D11110g Chr4 (948248..949840) [1593 bp, 530 aa] {ON} simila...    33   2.2  
SAKL0H18612g Chr8 (1655787..1657124) [1338 bp, 445 aa] {ON} high...    33   2.7  
NCAS0B06440 Chr2 complement(1218759..1219916) [1158 bp, 385 aa] ...    33   2.8  
Smik_9.53 Chr9 (120672..121838) [1167 bp, 388 aa] {ON} YIL116W (...    32   3.2  
TDEL0C04090 Chr3 complement(722310..723461) [1152 bp, 383 aa] {O...    32   3.3  
CAGL0G06028g Chr7 complement(579261..580874) [1614 bp, 537 aa] {...    32   4.5  
Smik_10.150 Chr10 (249211..252732) [3522 bp, 1173 aa] {ON} YJL09...    32   6.5  
Smik_5.319 Chr5 complement(477840..479171) [1332 bp, 443 aa] {ON...    31   7.4  

>CAGL0L12254g Chr12 complement(1327111..1328835) [1725 bp, 574 aa]
           {ON} similar to uniprot|P52893 Saccharomyces cerevisiae
           YLR089c
          Length = 574

 Score = 1142 bits (2953), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 551/574 (95%), Positives = 551/574 (95%)

Query: 1   MLRSTTSKSLSKMPHAIPPQCRRSHSSSIFQTKKRLAHLESDRPYLTHLPRSMNSSPNLR 60
           MLRSTTSKSLSKMPHAIPPQCRRSHSSSIFQTKKRLAHLESDRPYLTHLPRSMNSSPNLR
Sbjct: 1   MLRSTTSKSLSKMPHAIPPQCRRSHSSSIFQTKKRLAHLESDRPYLTHLPRSMNSSPNLR 60

Query: 61  FHXXXXXXXXXXXFLNTEIHHHSHNNLPFLPAEQATLKDVNECVLNAKYAVRGAIPMRAE 120
           FH           FLNTEIHHHSHNNLPFLPAEQATLKDVNECVLNAKYAVRGAIPMRAE
Sbjct: 61  FHSSASSSSLRSSFLNTEIHHHSHNNLPFLPAEQATLKDVNECVLNAKYAVRGAIPMRAE 120

Query: 121 ELKTQLMENPHSLPFNDIINANIGNPQQLKQKPLSFYRQVLSLLQYPELIPTLENNPQTM 180
           ELKTQLMENPHSLPFNDIINANIGNPQQLKQKPLSFYRQVLSLLQYPELIPTLENNPQTM
Sbjct: 121 ELKTQLMENPHSLPFNDIINANIGNPQQLKQKPLSFYRQVLSLLQYPELIPTLENNPQTM 180

Query: 181 IKQDAIDRAKRLLDDIGGSVGAYSSSQGVLGIRKTVADFITNRDDGIIAYPEDIFLTAGA 240
           IKQDAIDRAKRLLDDIGGSVGAYSSSQGVLGIRKTVADFITNRDDGIIAYPEDIFLTAGA
Sbjct: 181 IKQDAIDRAKRLLDDIGGSVGAYSSSQGVLGIRKTVADFITNRDDGIIAYPEDIFLTAGA 240

Query: 241 SSAVDYLLSIFCRGEETGVLIPIPQYPLYTATLALQNSHALPYYLNEETGWSTDPXXXXX 300
           SSAVDYLLSIFCRGEETGVLIPIPQYPLYTATLALQNSHALPYYLNEETGWSTDP     
Sbjct: 241 SSAVDYLLSIFCRGEETGVLIPIPQYPLYTATLALQNSHALPYYLNEETGWSTDPEELES 300

Query: 301 XXXXXXXNNIKPSVLVVINPGNPTGAVLSEEAIEQIFTLAAKYGIIVIADEVYQENVFED 360
                  NNIKPSVLVVINPGNPTGAVLSEEAIEQIFTLAAKYGIIVIADEVYQENVFED
Sbjct: 301 IILDSIENNIKPSVLVVINPGNPTGAVLSEEAIEQIFTLAAKYGIIVIADEVYQENVFED 360

Query: 361 VKFHSMKKVLRQLQMKQPGLYDNVQLASLHSTSKGVSGECGQRGGYMELVGFTHDIRQVV 420
           VKFHSMKKVLRQLQMKQPGLYDNVQLASLHSTSKGVSGECGQRGGYMELVGFTHDIRQVV
Sbjct: 361 VKFHSMKKVLRQLQMKQPGLYDNVQLASLHSTSKGVSGECGQRGGYMELVGFTHDIRQVV 420

Query: 421 LKLASISLCPVVTGQALVDLMVCPPQKGEESYEQDQEERRNIHKELHKRATLLHDAFVKL 480
           LKLASISLCPVVTGQALVDLMVCPPQKGEESYEQDQEERRNIHKELHKRATLLHDAFVKL
Sbjct: 421 LKLASISLCPVVTGQALVDLMVCPPQKGEESYEQDQEERRNIHKELHKRATLLHDAFVKL 480

Query: 481 DGISCQKPQGAMYLFPKLELPYKAIQEALHQDMSPDEFYCKSLLEKTGICTVPGSGFGQE 540
           DGISCQKPQGAMYLFPKLELPYKAIQEALHQDMSPDEFYCKSLLEKTGICTVPGSGFGQE
Sbjct: 481 DGISCQKPQGAMYLFPKLELPYKAIQEALHQDMSPDEFYCKSLLEKTGICTVPGSGFGQE 540

Query: 541 PGTYHLRTTFLAPGTKWIEDWVDFHQEFYNKFKN 574
           PGTYHLRTTFLAPGTKWIEDWVDFHQEFYNKFKN
Sbjct: 541 PGTYHLRTTFLAPGTKWIEDWVDFHQEFYNKFKN 574

>TDEL0F03900 Chr6 complement(726159..727838) [1680 bp, 559 aa] {ON}
           Anc_8.263 YDR111C
          Length = 559

 Score =  768 bits (1983), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 364/500 (72%), Positives = 421/500 (84%), Gaps = 4/500 (0%)

Query: 79  IHH--HSHNNLPFLPAEQATLKDVNECVLNAKYAVRGAIPMRAEELKTQLMENPHSLPFN 136
           +HH  H   +  F PAE  T++D+NE VL AKYAVRG+IPMRAEEL+ QL  +P SLPF+
Sbjct: 60  LHHIYHKKCHQDFYPAESLTVRDLNENVLKAKYAVRGSIPMRAEELQEQLKRDPSSLPFD 119

Query: 137 DIINANIGNPQQLKQKPLSFYRQVLSLLQYPELIPTLENN--PQTMIKQDAIDRAKRLLD 194
            I+NANIGNPQQL QKPLSFYRQVLS+LQYPE++   E     + + K+DAI+RAKR+L 
Sbjct: 120 KIVNANIGNPQQLNQKPLSFYRQVLSILQYPEVLEQGEEELISKGVFKRDAIERAKRILR 179

Query: 195 DIGGSVGAYSSSQGVLGIRKTVADFITNRDDGIIAYPEDIFLTAGASSAVDYLLSIFCRG 254
           D+GGSVGAYSSSQGV GIRKTVADFIT RD G  AYPEDIFLTAGAS+AV YLLSI CRG
Sbjct: 180 DVGGSVGAYSSSQGVYGIRKTVADFITERDSGEPAYPEDIFLTAGASAAVSYLLSILCRG 239

Query: 255 EETGVLIPIPQYPLYTATLALQNSHALPYYLNEETGWSTDPXXXXXXXXXXXXNNIKPSV 314
           +ETGVLIPIPQYPLYTATLAL NSH LPYYL+EE+GWST+             + I+PSV
Sbjct: 240 QETGVLIPIPQYPLYTATLALNNSHVLPYYLDEESGWSTNTAEIEGVVTESIESGIRPSV 299

Query: 315 LVVINPGNPTGAVLSEEAIEQIFTLAAKYGIIVIADEVYQENVFEDVKFHSMKKVLRQLQ 374
           LVVINPGNPTG+VLS EAIE+IF +AAKYGI+VIADEVYQEN+F   +FHSMKKVLRQLQ
Sbjct: 300 LVVINPGNPTGSVLSVEAIEKIFQVAAKYGIVVIADEVYQENIFAGSEFHSMKKVLRQLQ 359

Query: 375 MKQPGLYDNVQLASLHSTSKGVSGECGQRGGYMELVGFTHDIRQVVLKLASISLCPVVTG 434
            + PG+YDNVQL SLHSTSKGVSGECGQRGGYMEL GFTH+IRQVVLKLASISLCPVVTG
Sbjct: 360 KEHPGIYDNVQLVSLHSTSKGVSGECGQRGGYMELTGFTHEIRQVVLKLASISLCPVVTG 419

Query: 435 QALVDLMVCPPQKGEESYEQDQEERRNIHKELHKRATLLHDAFVKLDGISCQKPQGAMYL 494
           QALVDLMVCPP+ G+ESYEQD++ER  IH+EL  RA LLHD F  L+GI CQKP+GAMYL
Sbjct: 420 QALVDLMVCPPKPGDESYEQDRKEREMIHEELDHRAGLLHDTFNSLEGIECQKPRGAMYL 479

Query: 495 FPKLELPYKAIQEALHQDMSPDEFYCKSLLEKTGICTVPGSGFGQEPGTYHLRTTFLAPG 554
           FP+++LPYKAIQ A H + +PDEFYC+ LLE TGICTVPGSGFGQEPGTYHLRTTFLAPG
Sbjct: 480 FPQIKLPYKAIQAAQHLEKTPDEFYCQKLLEATGICTVPGSGFGQEPGTYHLRTTFLAPG 539

Query: 555 TKWIEDWVDFHQEFYNKFKN 574
           T+WI+ W DFH++FY+++++
Sbjct: 540 TEWIKKWEDFHKKFYDQYRD 559

>NCAS0B05020 Chr2 complement(931456..933162) [1707 bp, 568 aa] {ON} 
          Length = 568

 Score =  768 bits (1982), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 366/494 (74%), Positives = 421/494 (85%), Gaps = 4/494 (0%)

Query: 83  SHNNLPFLPAEQATLKDVNECVLNAKYAVRGAIPMRAEELKTQLMENPHSLPFNDIINAN 142
           +HNN  FLPA+Q TL ++N+ VL AKYAVRGAIPMRAEELK QL E+P SLPF+ I+NAN
Sbjct: 77  NHNN--FLPADQLTLAELNDNVLKAKYAVRGAIPMRAEELKIQLQEDPSSLPFDHIVNAN 134

Query: 143 IGNPQQLKQKPLSFYRQVLSLLQYPELIPTLENN--PQTMIKQDAIDRAKRLLDDIGGSV 200
           IGNPQQL QKPLSFYRQVLSLLQYPE++   E+      + K+DA++RAK LL +IGG+V
Sbjct: 135 IGNPQQLNQKPLSFYRQVLSLLQYPEILKQDESKLVASGLFKKDALERAKTLLHEIGGTV 194

Query: 201 GAYSSSQGVLGIRKTVADFITNRDDGIIAYPEDIFLTAGASSAVDYLLSIFCRGEETGVL 260
           GAYS+SQGV GIRKTVA+FIT RD+G  AYPEDIFLTAGAS+AV YLLSI C+G ETGVL
Sbjct: 195 GAYSASQGVYGIRKTVANFITKRDNGEPAYPEDIFLTAGASAAVMYLLSILCKGPETGVL 254

Query: 261 IPIPQYPLYTATLALQNSHALPYYLNEETGWSTDPXXXXXXXXXXXXNNIKPSVLVVINP 320
           IPIPQYPLYTA+LAL NSHALPYYL+E++GWST+P              I+PSVLVVINP
Sbjct: 255 IPIPQYPLYTASLALNNSHALPYYLDEKSGWSTNPKEIEEVVLAAKDKKIRPSVLVVINP 314

Query: 321 GNPTGAVLSEEAIEQIFTLAAKYGIIVIADEVYQENVFEDVKFHSMKKVLRQLQMKQPGL 380
           GNPTGAVLSE++IE IF +AAKYGI+VIADEVYQENVF +VKFHSMKKVLR LQ K PG+
Sbjct: 315 GNPTGAVLSEKSIEHIFEIAAKYGIVVIADEVYQENVFNEVKFHSMKKVLRNLQKKHPGV 374

Query: 381 YDNVQLASLHSTSKGVSGECGQRGGYMELVGFTHDIRQVVLKLASISLCPVVTGQALVDL 440
           YD VQLASLHSTSKGVSGECGQRGGYMEL GFTH++R V+LKLASISLCPVVTGQALVDL
Sbjct: 375 YDMVQLASLHSTSKGVSGECGQRGGYMELTGFTHEVRSVILKLASISLCPVVTGQALVDL 434

Query: 441 MVCPPQKGEESYEQDQEERRNIHKELHKRATLLHDAFVKLDGISCQKPQGAMYLFPKLEL 500
           MV PP+KG+ES+EQDQ ER++I  ELH RA  L+  F  L+GI CQKPQGAMYLFP+L+L
Sbjct: 435 MVSPPKKGDESFEQDQAERKHIKSELHTRAMQLYKNFNTLEGIECQKPQGAMYLFPRLDL 494

Query: 501 PYKAIQEALHQDMSPDEFYCKSLLEKTGICTVPGSGFGQEPGTYHLRTTFLAPGTKWIED 560
           P+KA+Q+A H +MSPDEFYCKSLLE TGICTVPGSGFGQEPGTYHLRTTFLAPGT+WIE 
Sbjct: 495 PFKAVQKAQHLEMSPDEFYCKSLLEATGICTVPGSGFGQEPGTYHLRTTFLAPGTEWIEK 554

Query: 561 WVDFHQEFYNKFKN 574
           W  FHQ+FYN +++
Sbjct: 555 WKIFHQDFYNTYRD 568

>KNAG0G02040 Chr7 complement(463058..464833) [1776 bp, 591 aa] {ON}
           Anc_8.263 YDR111C
          Length = 591

 Score =  767 bits (1980), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 365/497 (73%), Positives = 423/497 (85%), Gaps = 4/497 (0%)

Query: 82  HSHNNLPFLPAEQATLKDVNECVLNAKYAVRGAIPMRAEELKTQLMENPHSLPFNDIINA 141
           HS ++  F PA Q  + D+NE VL AKYAVRG+IPMRAE+L+ QL E+P SLPF+ IINA
Sbjct: 95  HSKSHYKFTPAAQVKIADLNENVLKAKYAVRGSIPMRAEQLQHQLQEDPRSLPFDKIINA 154

Query: 142 NIGNPQQLKQKPLSFYRQVLSLLQYPELIPTLENNPQ---TMIKQDAIDRAKRLLDDIGG 198
           NIGNPQQL QKPLSFYRQVLSLLQ+PEL+ +L+ NP    ++ K DA+ RA++LL+DIGG
Sbjct: 155 NIGNPQQLNQKPLSFYRQVLSLLQFPELLNSLKENPAAATSLYKADAVRRAEKLLEDIGG 214

Query: 199 SVGAYSSSQGVLGIRKTVADFITNRDDGIIAYPEDIFLTAGASSAVDYLLSIFCRGEETG 258
           SVGAYS+SQGV+GIRKTVADFIT RD+   AYPEDIFLTAGAS+AV YLLSIFC+GE+TG
Sbjct: 215 SVGAYSTSQGVMGIRKTVADFITRRDNNEPAYPEDIFLTAGASAAVSYLLSIFCKGEKTG 274

Query: 259 VLIPIPQYPLYTATLALQNSHALPYYLNEETGWSTDPXXXXXXXXXXXXNNIKPSVLVVI 318
           VLIPIPQYPLYTATLAL NSH LPYYL+E++GWST+              NIKPSVLVVI
Sbjct: 275 VLIPIPQYPLYTATLALNNSHTLPYYLDEKSGWSTNTKEIDSVVLDAIDRNIKPSVLVVI 334

Query: 319 NPGNPTGAVLSEEAIEQIFTLAAKYGIIVIADEVYQENVF-EDVKFHSMKKVLRQLQMKQ 377
           NPGNPTGAVLSE+AI +IF +AAKYGI+VIADEVYQEN+F EDVKFHSMKKVLR+LQ + 
Sbjct: 335 NPGNPTGAVLSEKAIAEIFEIAAKYGIVVIADEVYQENIFDEDVKFHSMKKVLRKLQQEH 394

Query: 378 PGLYDNVQLASLHSTSKGVSGECGQRGGYMELVGFTHDIRQVVLKLASISLCPVVTGQAL 437
           PG +D VQLASLHSTSKGVSGECGQRGG+MEL GF+H+IRQV+LKLASISLCPVVTGQAL
Sbjct: 395 PGKFDEVQLASLHSTSKGVSGECGQRGGFMELTGFSHEIRQVILKLASISLCPVVTGQAL 454

Query: 438 VDLMVCPPQKGEESYEQDQEERRNIHKELHKRATLLHDAFVKLDGISCQKPQGAMYLFPK 497
           VDLMV PPQ+GEESYE DQ ER +IH ELHKRA  L + F +L+GI CQKPQGAMYLFP+
Sbjct: 455 VDLMVHPPQEGEESYELDQAERSHIHSELHKRANKLWETFNRLEGIQCQKPQGAMYLFPR 514

Query: 498 LELPYKAIQEALHQDMSPDEFYCKSLLEKTGICTVPGSGFGQEPGTYHLRTTFLAPGTKW 557
           L LP+KA+Q+A H +M+ DEFYCK LLE TGICTVPGSGFGQ PGTYHLRTTFLAPGT+W
Sbjct: 515 LNLPFKAVQKAQHMEMTADEFYCKELLENTGICTVPGSGFGQVPGTYHLRTTFLAPGTEW 574

Query: 558 IEDWVDFHQEFYNKFKN 574
           I+ W  FH+EFYNK+++
Sbjct: 575 IDLWEKFHKEFYNKYRD 591

>YLR089C Chr12 complement(318237..320015) [1779 bp, 592 aa] {ON}
           ALT1Alanine transaminase (glutamic pyruvic
           transaminase); involved in alanine biosynthetic and
           catabolic processes; the authentic, non-tagged protein
           is detected in highly purified mitochondria in
           high-throughput studies
          Length = 592

 Score =  764 bits (1972), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 384/579 (66%), Positives = 445/579 (76%), Gaps = 17/579 (2%)

Query: 2   LRSTTSKSLSKMPHAIPPQCRRSHSSSIFQTKKRLAHLESDRPYLTHLPRSMNSSPNLRF 61
           +R+ TS S  KMPH   P      S+S   TK  L      RP L     S   + N R 
Sbjct: 25  IRTLTS-SAEKMPHITTP-----FSTSASSTK--LKAFRKVRPVLQRHSSSWIVAQNHRR 76

Query: 62  HXXXXXXXXXXXFLNTEIHHH-SHNNLPFLPAEQATLKDVNECVLNAKYAVRGAIPMRAE 120
                        LN   HH    +N  F PAEQ TL+DVNE VL AKYAVRGAIPMRAE
Sbjct: 77  SLSGQSSLNDLRHLNRFPHHTLKTSNNEFYPAEQLTLEDVNENVLKAKYAVRGAIPMRAE 136

Query: 121 ELKTQLMENPHSLPFNDIINANIGNPQQLKQKPLSFYRQVLSLLQYPELIPTLENNPQTM 180
           ELK QL ++P SLPF+ IINANIGNPQQL+QKPL++YRQVLSLLQYPEL   L  N Q +
Sbjct: 137 ELKAQLEKDPQSLPFDRIINANIGNPQQLQQKPLTYYRQVLSLLQYPEL---LNQNEQQL 193

Query: 181 I-----KQDAIDRAKRLLDDIGGSVGAYSSSQGVLGIRKTVADFITNRDDGIIAYPEDIF 235
           +     K DAI RAK L++DIGGSVGAYSSSQGV GIRK+VA+FIT RD+G I+YPEDIF
Sbjct: 194 VDSKLFKLDAIKRAKSLMEDIGGSVGAYSSSQGVEGIRKSVAEFITKRDEGEISYPEDIF 253

Query: 236 LTAGASSAVDYLLSIFCRGEETGVLIPIPQYPLYTATLALQNSHALPYYLNEETGWSTDP 295
           LTAGAS+AV+YLLSIFCRG ETGVLIPIPQYPLYTATLAL NS ALPYYL+E +GWST+P
Sbjct: 254 LTAGASAAVNYLLSIFCRGPETGVLIPIPQYPLYTATLALNNSQALPYYLDENSGWSTNP 313

Query: 296 XXXXXXXXXXXXNNIKPSVLVVINPGNPTGAVLSEEAIEQIFTLAAKYGIIVIADEVYQE 355
                       N IKP+VLVVINPGNPTGAVLS E+I QIF +AAKYG +VIADEVYQE
Sbjct: 314 EEIETVVKEAIQNEIKPTVLVVINPGNPTGAVLSPESIAQIFEVAAKYGTVVIADEVYQE 373

Query: 356 NVFEDVKFHSMKKVLRQLQMKQPGLYDNVQLASLHSTSKGVSGECGQRGGYMELVGFTHD 415
           N+F   KFHSMKK+LR LQ + PG +DNVQLASLHSTSKGVSGECGQRGGYMEL GF+H+
Sbjct: 374 NIFPGTKFHSMKKILRHLQREHPGKFDNVQLASLHSTSKGVSGECGQRGGYMELTGFSHE 433

Query: 416 IRQVVLKLASISLCPVVTGQALVDLMVCPPQKGEESYEQDQEERRNIHKELHKRATLLHD 475
           +RQV+LKLASISLCPVVTGQALVDLMV PP +GEES+E DQ ER +IH++L  RA  L++
Sbjct: 434 MRQVILKLASISLCPVVTGQALVDLMVRPPVEGEESFESDQAERNSIHEKLITRAMTLYE 493

Query: 476 AFVKLDGISCQKPQGAMYLFPKLELPYKAIQEALHQDMSPDEFYCKSLLEKTGICTVPGS 535
            F  L+GI CQKPQGAMYLFPK++LP+KA+QEA H +++PDEFYCK LLE TGICTVPGS
Sbjct: 494 TFNSLEGIECQKPQGAMYLFPKIDLPFKAVQEARHLELTPDEFYCKKLLESTGICTVPGS 553

Query: 536 GFGQEPGTYHLRTTFLAPGTKWIEDWVDFHQEFYNKFKN 574
           GFGQEPGTYHLRTTFLAPG +WI+ W  FH+EF++++++
Sbjct: 554 GFGQEPGTYHLRTTFLAPGLEWIKKWESFHKEFFDQYRD 592

>Skud_12.157 Chr12 complement(301427..303205) [1779 bp, 592 aa] {ON}
           YLR089C (REAL)
          Length = 592

 Score =  761 bits (1966), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 378/576 (65%), Positives = 443/576 (76%), Gaps = 16/576 (2%)

Query: 5   TTSKSLSKMPHAIPPQCRRSHSSSIFQTKKRLAHLESDRPYLTHLPRSMNSSPNLRFHXX 64
           T + S+ KMP+  PP    + ++       +L      RP L     S  +  +      
Sbjct: 27  TLTTSVKKMPYINPPFITTASNT-------KLKAFRKVRPVLQRHSSSWVAGQSHSRSLS 79

Query: 65  XXXXXXXXXFLNTEIHHH-SHNNLPFLPAEQATLKDVNECVLNAKYAVRGAIPMRAEELK 123
                     LN   HH     N  F PAEQ TL+DVNE VL AKYAVRGAIPMRAEELK
Sbjct: 80  GQSSLNDLRHLNRFPHHTLKTGNDDFYPAEQLTLEDVNENVLKAKYAVRGAIPMRAEELK 139

Query: 124 TQLMENPHSLPFNDIINANIGNPQQLKQKPLSFYRQVLSLLQYPELIPTLENNPQTMI-- 181
            QL ++P SLPF+ IINANIGNPQQL+QKPL++YRQVLSLLQYPEL   L  N Q ++  
Sbjct: 140 AQLEKDPQSLPFDKIINANIGNPQQLQQKPLTYYRQVLSLLQYPEL---LNQNEQQLVDS 196

Query: 182 ---KQDAIDRAKRLLDDIGGSVGAYSSSQGVLGIRKTVADFITNRDDGIIAYPEDIFLTA 238
              K DAI RAK L++DIGGSVGAYSSSQGV GIRK+VA+FIT RDDG I+YPEDIFLTA
Sbjct: 197 KLFKLDAIKRAKSLMEDIGGSVGAYSSSQGVEGIRKSVAEFITKRDDGEISYPEDIFLTA 256

Query: 239 GASSAVDYLLSIFCRGEETGVLIPIPQYPLYTATLALQNSHALPYYLNEETGWSTDPXXX 298
           GAS+AV+YLLSIFCRG ETGVLIPIPQYPLYTATLAL NS ALPYYL+E++GWST+P   
Sbjct: 257 GASAAVNYLLSIFCRGPETGVLIPIPQYPLYTATLALNNSQALPYYLDEQSGWSTNPEEI 316

Query: 299 XXXXXXXXXNNIKPSVLVVINPGNPTGAVLSEEAIEQIFTLAAKYGIIVIADEVYQENVF 358
                    N IKP+VLVVINPGNPTGAVLS E++ QIF +AAKYG +VIADEVYQEN+F
Sbjct: 317 ETVVKEAIQNEIKPTVLVVINPGNPTGAVLSPESVSQIFEVAAKYGTVVIADEVYQENIF 376

Query: 359 EDVKFHSMKKVLRQLQMKQPGLYDNVQLASLHSTSKGVSGECGQRGGYMELVGFTHDIRQ 418
              KFHSMKK+LR LQ + PG +DNVQLASLHSTSKGVSGECGQRGGYMEL GF+H++RQ
Sbjct: 377 PGTKFHSMKKILRTLQREHPGKFDNVQLASLHSTSKGVSGECGQRGGYMELTGFSHEMRQ 436

Query: 419 VVLKLASISLCPVVTGQALVDLMVCPPQKGEESYEQDQEERRNIHKELHKRATLLHDAFV 478
           V+LKLASISLCPVVTGQALVDLMV PP +GEES+E DQ ER +IH++L  RA  L+D F 
Sbjct: 437 VILKLASISLCPVVTGQALVDLMVRPPVEGEESFELDQAERNSIHEKLITRAMTLYDTFN 496

Query: 479 KLDGISCQKPQGAMYLFPKLELPYKAIQEALHQDMSPDEFYCKSLLEKTGICTVPGSGFG 538
            L+GI CQKPQGAMYLFPK++LP+KA+QEA H +++PDEFYCKSLLE TGICTVPGSGFG
Sbjct: 497 SLEGIECQKPQGAMYLFPKIDLPFKAVQEARHLELTPDEFYCKSLLESTGICTVPGSGFG 556

Query: 539 QEPGTYHLRTTFLAPGTKWIEDWVDFHQEFYNKFKN 574
           QEPGTYHLRTTFLAPG +WI+ W  FH+EF++++++
Sbjct: 557 QEPGTYHLRTTFLAPGLEWIKKWETFHKEFFDQYRD 592

>Smik_12.148 Chr12 complement(298127..299905) [1779 bp, 592 aa] {ON}
           YLR089C (REAL)
          Length = 592

 Score =  755 bits (1950), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 376/579 (64%), Positives = 444/579 (76%), Gaps = 17/579 (2%)

Query: 2   LRSTTSKSLSKMPHAIPPQCRRSHSSSIFQTKKRLAHLESDRPYLTHLPRSMNSSPNLRF 61
           +R+ TS++  KMPH   P    + ++++   +K        RP L     S  ++ N R 
Sbjct: 25  IRTLTSRA-EKMPHISTPFTTSASNTNLKAFRK-------IRPVLQRHSSSWIAAQNHRR 76

Query: 62  HXXXXXXXXXXXFLNTEIHHH-SHNNLPFLPAEQATLKDVNECVLNAKYAVRGAIPMRAE 120
                        LN   HH    +N  F PAEQ TL DVNE VL AKYAVRGAIPMRAE
Sbjct: 77  SLSGQSSLNDLRHLNRFPHHTLKTSNNEFYPAEQLTLDDVNENVLKAKYAVRGAIPMRAE 136

Query: 121 ELKTQLMENPHSLPFNDIINANIGNPQQLKQKPLSFYRQVLSLLQYPELIPTLENNPQTM 180
           ELK QL ++P SLPFN IINANIGNPQQL+QKPL++YRQVLSLLQYPEL   L  N Q +
Sbjct: 137 ELKAQLEKDPQSLPFNKIINANIGNPQQLQQKPLTYYRQVLSLLQYPEL---LNQNEQQL 193

Query: 181 I-----KQDAIDRAKRLLDDIGGSVGAYSSSQGVLGIRKTVADFITNRDDGIIAYPEDIF 235
           +     K DAI RAK L+++IGGSVGAYSSSQGV GIR++VA+FIT RD+G I+YPEDIF
Sbjct: 194 VDSKLFKLDAIKRAKSLMEEIGGSVGAYSSSQGVEGIRRSVAEFITKRDEGEISYPEDIF 253

Query: 236 LTAGASSAVDYLLSIFCRGEETGVLIPIPQYPLYTATLALQNSHALPYYLNEETGWSTDP 295
           LTAGAS+AV+YLLSIFCRG ETGVLIPIPQYPLYTATLAL NS ALPYYL+E +GWST+P
Sbjct: 254 LTAGASAAVNYLLSIFCRGPETGVLIPIPQYPLYTATLALNNSQALPYYLDESSGWSTNP 313

Query: 296 XXXXXXXXXXXXNNIKPSVLVVINPGNPTGAVLSEEAIEQIFTLAAKYGIIVIADEVYQE 355
                       N IK +VLVVINPGNPTGAVLS E+I QIF +AAKYG +VIADEVYQE
Sbjct: 314 EEIETVVKEAIENEIKSTVLVVINPGNPTGAVLSPESIAQIFEVAAKYGTVVIADEVYQE 373

Query: 356 NVFEDVKFHSMKKVLRQLQMKQPGLYDNVQLASLHSTSKGVSGECGQRGGYMELVGFTHD 415
           N+F   KFHSMKK+LR LQ + PG +DNVQLASLHSTSKGVSGECGQRGGYMEL GF+H+
Sbjct: 374 NIFPGTKFHSMKKILRHLQREHPGKFDNVQLASLHSTSKGVSGECGQRGGYMELTGFSHE 433

Query: 416 IRQVVLKLASISLCPVVTGQALVDLMVCPPQKGEESYEQDQEERRNIHKELHKRATLLHD 475
           +RQV+LKLASISLCPVVTGQALVDLMV PP +GEES+E DQ ER +IH++L  RA  L+ 
Sbjct: 434 MRQVILKLASISLCPVVTGQALVDLMVRPPLEGEESFESDQAERNSIHEKLITRAMTLYK 493

Query: 476 AFVKLDGISCQKPQGAMYLFPKLELPYKAIQEALHQDMSPDEFYCKSLLEKTGICTVPGS 535
            F  L+GI CQKPQGAMYLFPK++LP++A+QEA H +++PDEFYCK LLE TGICTVPGS
Sbjct: 494 TFNSLEGIECQKPQGAMYLFPKIDLPFRAVQEARHLELTPDEFYCKKLLESTGICTVPGS 553

Query: 536 GFGQEPGTYHLRTTFLAPGTKWIEDWVDFHQEFYNKFKN 574
           GFGQEPGTYHLRTTFLAPG +WI+ W  FH+EF++ +++
Sbjct: 554 GFGQEPGTYHLRTTFLAPGLEWIKKWETFHKEFFDHYRD 592

>NDAI0B01990 Chr2 complement(493160..494926) [1767 bp, 588 aa] {ON}
           Anc_8.263 YDR111C
          Length = 588

 Score =  749 bits (1934), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 361/509 (70%), Positives = 416/509 (81%), Gaps = 11/509 (2%)

Query: 74  FLNTEIHHHS---HNNLPFLPAEQATLKDVNECVLNAKYAVRGAIPMRAEELKTQLMENP 130
            +   I HHS        F PAEQ TL D+NE VL AKYAVRG+IPMRAEELK QL  NP
Sbjct: 83  LMTRSISHHSLKVAKGKDFAPAEQLTLADLNENVLKAKYAVRGSIPMRAEELKVQLENNP 142

Query: 131 HSLPFNDIINANIGNPQQLKQKPLSFYRQVLSLLQYPELIPTLENNPQTMI-----KQDA 185
            +LPF+ I+NANIGNPQQLKQKPLSFYRQVLS+LQYP++   L+ N Q +I     K+DA
Sbjct: 143 STLPFSQIVNANIGNPQQLKQKPLSFYRQVLSILQYPDI---LKENEQNLIDAKVYKRDA 199

Query: 186 IDRAKRLLDDIGGSVGAYSSSQGVLGIRKTVADFITNRDDGIIAYPEDIFLTAGASSAVD 245
           IDRAK LL +IGGSVGAYS+SQGV GIRKTVA+FIT RD G  AYPEDIFLT        
Sbjct: 200 IDRAKLLLSEIGGSVGAYSASQGVYGIRKTVANFITERDGGEPAYPEDIFLTVWCFRCCC 259

Query: 246 YLLSIFCRGEETGVLIPIPQYPLYTATLALQNSHALPYYLNEETGWSTDPXXXXXXXXXX 305
           YLLSI C+G +TGVLIPIPQYPLYTATLAL NSHALPYYL+E++GWST+P          
Sbjct: 260 YLLSILCQGPKTGVLIPIPQYPLYTATLALNNSHALPYYLDEKSGWSTNPKEIEEVVQDA 319

Query: 306 XXNNIKPSVLVVINPGNPTGAVLSEEAIEQIFTLAAKYGIIVIADEVYQENVFEDVKFHS 365
               I PSVLVVINPGNPTGAVL+EE+IE IF +AAKYGI+VIADEVYQEN+ + VKF+S
Sbjct: 320 MERAINPSVLVVINPGNPTGAVLTEESIEHIFEIAAKYGIVVIADEVYQENIADGVKFYS 379

Query: 366 MKKVLRQLQMKQPGLYDNVQLASLHSTSKGVSGECGQRGGYMELVGFTHDIRQVVLKLAS 425
           MKKVLR+LQ   PG +DNVQLASLHSTSKGVSGECGQRGGYMEL+GFTH++R+V+LKLAS
Sbjct: 380 MKKVLRKLQKSHPGKFDNVQLASLHSTSKGVSGECGQRGGYMELIGFTHEVRKVILKLAS 439

Query: 426 ISLCPVVTGQALVDLMVCPPQKGEESYEQDQEERRNIHKELHKRATLLHDAFVKLDGISC 485
           ISLCPVVTGQALVDLMV PP+KG+ SYEQDQ ERR+I  EL  RA+ L++ FV L+GI C
Sbjct: 440 ISLCPVVTGQALVDLMVSPPKKGDASYEQDQAERRHIKSELSIRASQLYETFVGLEGIEC 499

Query: 486 QKPQGAMYLFPKLELPYKAIQEALHQDMSPDEFYCKSLLEKTGICTVPGSGFGQEPGTYH 545
           QKPQGAMYLFPKL+LP+KA+QEA H +M+PDEFYCKSLL+ TGICTVPGSGFGQEPGTYH
Sbjct: 500 QKPQGAMYLFPKLDLPFKAVQEAQHLEMTPDEFYCKSLLDATGICTVPGSGFGQEPGTYH 559

Query: 546 LRTTFLAPGTKWIEDWVDFHQEFYNKFKN 574
           LRTTFLAPGT+WI+ W  FH+EFY+ +++
Sbjct: 560 LRTTFLAPGTEWIKKWEAFHKEFYDNYRD 588

>Suva_10.173 Chr10 complement(323066..324844) [1779 bp, 592 aa] {ON}
           YDR111C (REAL)
          Length = 592

 Score =  746 bits (1926), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 363/507 (71%), Positives = 417/507 (82%), Gaps = 11/507 (2%)

Query: 75  LNTEIHH--HSHNNLPFLPAEQATLKDVNECVLNAKYAVRGAIPMRAEELKTQLMENPHS 132
           LN   HH   + NN  F PAEQ TL DVNE VL A+YAVRGAIPMRAEELK QL ++P S
Sbjct: 90  LNRFPHHTLKTANN-EFYPAEQLTLDDVNENVLKARYAVRGAIPMRAEELKAQLEKDPQS 148

Query: 133 LPFNDIINANIGNPQQLKQKPLSFYRQVLSLLQYPELIPTLENNPQTMI-----KQDAID 187
           LPFN IINANIGNPQQL+QKPL++YRQVLSLLQYPEL   L +N Q ++     K DAI 
Sbjct: 149 LPFNKIINANIGNPQQLQQKPLTYYRQVLSLLQYPEL---LNHNEQELVGSKLFKIDAIK 205

Query: 188 RAKRLLDDIGGSVGAYSSSQGVLGIRKTVADFITNRDDGIIAYPEDIFLTAGASSAVDYL 247
           RAK L+ DIGGSVGAYSSSQGV GIRK+VADFIT RD G  AYPEDIFLTAGAS+AV YL
Sbjct: 206 RAKSLIKDIGGSVGAYSSSQGVEGIRKSVADFITKRDGGETAYPEDIFLTAGASAAVTYL 265

Query: 248 LSIFCRGEETGVLIPIPQYPLYTATLALQNSHALPYYLNEETGWSTDPXXXXXXXXXXXX 307
           LSIFCRG ETGVLIPIPQYPLYTATLAL NS  LPYYL+E +GWST+P            
Sbjct: 266 LSIFCRGPETGVLIPIPQYPLYTATLALNNSQPLPYYLDENSGWSTNPEEIETVVKEAIQ 325

Query: 308 NNIKPSVLVVINPGNPTGAVLSEEAIEQIFTLAAKYGIIVIADEVYQENVFEDVKFHSMK 367
           N IKP+VLVVINPGNPTGAVLS E+I QIF +AAKYG +VIADEVYQEN+F   +F+SMK
Sbjct: 326 NEIKPTVLVVINPGNPTGAVLSPESIAQIFEVAAKYGTVVIADEVYQENIFPGTEFNSMK 385

Query: 368 KVLRQLQMKQPGLYDNVQLASLHSTSKGVSGECGQRGGYMELVGFTHDIRQVVLKLASIS 427
           KVLR LQ   PG +DNVQLASLHSTSKGVSGECGQRGGYMEL GF+H++RQV+LKLASIS
Sbjct: 386 KVLRHLQRDHPGKFDNVQLASLHSTSKGVSGECGQRGGYMELTGFSHEMRQVILKLASIS 445

Query: 428 LCPVVTGQALVDLMVCPPQKGEESYEQDQEERRNIHKELHKRATLLHDAFVKLDGISCQK 487
           LCPVVTGQALVDLMV PP +GEES+E DQ ER +IH++L+ RA  L++ F  L+GI CQK
Sbjct: 446 LCPVVTGQALVDLMVRPPVEGEESFESDQSERNSIHEKLNTRAMTLYETFNSLEGIECQK 505

Query: 488 PQGAMYLFPKLELPYKAIQEALHQDMSPDEFYCKSLLEKTGICTVPGSGFGQEPGTYHLR 547
           PQGAMYLFPK+++P+KAIQEA H +++PDEFYCK LLE TGICTVPGSGFGQEPGTYHLR
Sbjct: 506 PQGAMYLFPKIDVPFKAIQEAHHLELTPDEFYCKKLLESTGICTVPGSGFGQEPGTYHLR 565

Query: 548 TTFLAPGTKWIEDWVDFHQEFYNKFKN 574
           TTFLAPG +W++ W  FH+EF++++++
Sbjct: 566 TTFLAPGVEWMKKWEIFHKEFFDQYRD 592

>ZYRO0C01628g Chr3 (115665..117269) [1605 bp, 534 aa] {ON} similar
           to uniprot|P52893 Saccharomyces cerevisiae YLR089C ALT1
           putative alanine transaminase (glutamyc pyruvic
           transaminase)
          Length = 534

 Score =  738 bits (1905), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 357/509 (70%), Positives = 415/509 (81%), Gaps = 14/509 (2%)

Query: 77  TEIH-HHSHNNL-----PFLPAEQATLKDVNECVLNAKYAVRGAIPMRAEELKTQLMENP 130
           TE H HH H+ +        PAE+  L +VNE VL AKYAVRGAIPM A EL  +L ++P
Sbjct: 29  TEAHLHHIHSKVSNVLGAVYPAEKLGLSEVNENVLKAKYAVRGAIPMLAAELNAKLKKDP 88

Query: 131 HSLPFNDIINANIGNPQQLKQKPLSFYRQVLSLLQYPELIPTLENNPQTMI-----KQDA 185
           HSLPF++I++ANIGNPQ LKQKPL+FYRQVLSLLQYP L   LE N Q +I     ++DA
Sbjct: 89  HSLPFDNIVSANIGNPQHLKQKPLTFYRQVLSLLQYPGL---LEENEQVLIDSKLYQKDA 145

Query: 186 IDRAKRLLDDIGGSVGAYSSSQGVLGIRKTVADFITNRDDGIIAYPEDIFLTAGASSAVD 245
           I RA+RLL+DIG SVGAYS+SQG+ GIR+TVA FIT RD G  AY EDIFLTAGASSAV 
Sbjct: 146 IARARRLLNDIGSSVGAYSTSQGIQGIRETVAQFITERDGGEKAYAEDIFLTAGASSAVS 205

Query: 246 YLLSIFCRGEETGVLIPIPQYPLYTATLALQNSHALPYYLNEETGWSTDPXXXXXXXXXX 305
           YLLSI C+G+ETGVLIPIPQYPLYTA+LAL NSH LPYYL+E++GWST+P          
Sbjct: 206 YLLSILCKGQETGVLIPIPQYPLYTASLALNNSHPLPYYLDEKSGWSTNPTEIEDVVNNA 265

Query: 306 XXNNIKPSVLVVINPGNPTGAVLSEEAIEQIFTLAAKYGIIVIADEVYQENVFEDVKFHS 365
              NIKPSVLVVINPGNPTGAVLSEE I QIF +AAKYGI+VIADEVYQENVF+  +FHS
Sbjct: 266 IEQNIKPSVLVVINPGNPTGAVLSEEDISQIFAIAAKYGIVVIADEVYQENVFDGAEFHS 325

Query: 366 MKKVLRQLQMKQPGLYDNVQLASLHSTSKGVSGECGQRGGYMELVGFTHDIRQVVLKLAS 425
           MKK+LR+LQ   PG++DNVQLASLHSTSKGVSGECGQRGGYME+ GF +DIRQV+LKLAS
Sbjct: 326 MKKILRKLQKSNPGVFDNVQLASLHSTSKGVSGECGQRGGYMEITGFNNDIRQVILKLAS 385

Query: 426 ISLCPVVTGQALVDLMVCPPQKGEESYEQDQEERRNIHKELHKRATLLHDAFVKLDGISC 485
           ISLCPVVTGQALVDLMV PP+ G+ESYE DQ+ER++IH+ L +RA  LH  F  L+GI C
Sbjct: 386 ISLCPVVTGQALVDLMVSPPKPGDESYELDQQERKSIHEALAERAGKLHATFNSLEGIEC 445

Query: 486 QKPQGAMYLFPKLELPYKAIQEALHQDMSPDEFYCKSLLEKTGICTVPGSGFGQEPGTYH 545
           QKP+GAMYLFP+L LP+KAIQ A H+ M+PD FYCK LLE TGICTVPGSGFGQEPGTYH
Sbjct: 446 QKPEGAMYLFPRLLLPFKAIQSAEHEGMTPDAFYCKKLLEATGICTVPGSGFGQEPGTYH 505

Query: 546 LRTTFLAPGTKWIEDWVDFHQEFYNKFKN 574
           LRTTFLAPGT+WIE W +FH+ FY ++++
Sbjct: 506 LRTTFLAPGTEWIERWENFHKAFYEEYRD 534

>KLLA0F19162g Chr6 complement(1775240..1776826) [1587 bp, 528 aa]
           {ON} similar to uniprot|P52893 Saccharomyces cerevisiae
           YLR089C ALT1 putative alanine transaminase (glutamyc
           pyruvic transaminase)
          Length = 528

 Score =  731 bits (1887), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 346/484 (71%), Positives = 401/484 (82%)

Query: 91  PAEQATLKDVNECVLNAKYAVRGAIPMRAEELKTQLMENPHSLPFNDIINANIGNPQQLK 150
           PA + +L DVNE VL AKYAVRG IPMRAEEL+ QL ++P SLPF+ II+ANIGNPQQL 
Sbjct: 45  PAPKLSLDDVNENVLKAKYAVRGRIPMRAEELRDQLKKDPSSLPFSKIISANIGNPQQLD 104

Query: 151 QKPLSFYRQVLSLLQYPELIPTLENNPQTMIKQDAIDRAKRLLDDIGGSVGAYSSSQGVL 210
           QKPL+FYR+VLSLLQ+PEL+   +   QT+ K D+I RAKRLL ++GGSVGAYS SQGV 
Sbjct: 105 QKPLTFYREVLSLLQHPELLEEADEALQTLYKTDSIKRAKRLLSEVGGSVGAYSQSQGVQ 164

Query: 211 GIRKTVADFITNRDDGIIAYPEDIFLTAGASSAVDYLLSIFCRGEETGVLIPIPQYPLYT 270
           GIR+TVADFIT RDDG I+YPEDI+LTAGAS+AV Y+LSI C+G  TGVLIPIPQYPLYT
Sbjct: 165 GIRETVADFITKRDDGEISYPEDIYLTAGASAAVSYILSILCKGPNTGVLIPIPQYPLYT 224

Query: 271 ATLALQNSHALPYYLNEETGWSTDPXXXXXXXXXXXXNNIKPSVLVVINPGNPTGAVLSE 330
           A+LAL NS  LPYYL EE  WSTDP              IKP+ LVVINPGNPTGA+LSE
Sbjct: 225 ASLALNNSRPLPYYLREEQNWSTDPEEIEQVVLDAIQKGIKPTCLVVINPGNPTGAILSE 284

Query: 331 EAIEQIFTLAAKYGIIVIADEVYQENVFEDVKFHSMKKVLRQLQMKQPGLYDNVQLASLH 390
           ++I++IF +AAKYGI+VIADEVYQENVF+  KF+SMKKVLR LQ    G YDN+QLASLH
Sbjct: 285 QSIQKIFEVAAKYGIVVIADEVYQENVFKGSKFYSMKKVLRNLQKTYHGQYDNIQLASLH 344

Query: 391 STSKGVSGECGQRGGYMELVGFTHDIRQVVLKLASISLCPVVTGQALVDLMVCPPQKGEE 450
           STSKGVSGECGQRGGYMELVGF HDIRQV LKLASISLCPVVTGQALVDLMV PPQ G+E
Sbjct: 345 STSKGVSGECGQRGGYMELVGFNHDIRQVFLKLASISLCPVVTGQALVDLMVSPPQPGDE 404

Query: 451 SYEQDQEERRNIHKELHKRATLLHDAFVKLDGISCQKPQGAMYLFPKLELPYKAIQEALH 510
           SYEQDQ+ER +IH  L +RA+ L + F +L+GI C+KPQGAMYL+PKL+LPYK IQEA H
Sbjct: 405 SYEQDQQEREDIHDALDERASKLFETFSRLEGIECRKPQGAMYLYPKLDLPYKVIQEAQH 464

Query: 511 QDMSPDEFYCKSLLEKTGICTVPGSGFGQEPGTYHLRTTFLAPGTKWIEDWVDFHQEFYN 570
            +M PDEFYCK+LLE TGICTVPGSGFGQ PGTYHLRTTFL PGT+W+E W  FH+ F++
Sbjct: 465 LEMEPDEFYCKALLENTGICTVPGSGFGQVPGTYHLRTTFLPPGTEWVETWEKFHKAFFD 524

Query: 571 KFKN 574
           K+++
Sbjct: 525 KYRD 528

>SAKL0H17006g Chr8 (1493272..1494867) [1596 bp, 531 aa] {ON} highly
           similar to gnl|GLV|KLLA0F19162g Kluyveromyces lactis
           KLLA0F19162g and similar to YLR089C uniprot|P52893
           Saccharomyces cerevisiae YLR089C ALT1 putative alanine
           transaminase (glutamyc pyruvic transaminase)
          Length = 531

 Score =  721 bits (1862), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 344/499 (68%), Positives = 406/499 (81%), Gaps = 3/499 (0%)

Query: 79  IHHHSHNNLP--FLPAEQATLKDVNECVLNAKYAVRGAIPMRAEELKTQLMENPHSLPFN 136
           +   S N +P  F PA++ +L+D+NE VL AKYAVRG IP +AEELK QL  +P SLPF+
Sbjct: 33  LRSFSSNFVPYKFQPADKLSLEDLNENVLRAKYAVRGKIPQKAEELKNQLARDPKSLPFD 92

Query: 137 DIINANIGNPQQLKQKPLSFYRQVLSLLQYPELIPTLENNPQTMI-KQDAIDRAKRLLDD 195
            IINANIGNPQQL QKPL+FYRQVLSLLQ P+++  +     + I K DAIDRA RLL +
Sbjct: 93  RIINANIGNPQQLDQKPLTFYRQVLSLLQNPDMLEEIPREQLSQIYKPDAIDRAARLLSN 152

Query: 196 IGGSVGAYSSSQGVLGIRKTVADFITNRDDGIIAYPEDIFLTAGASSAVDYLLSIFCRGE 255
           IGGSVGAYS SQGV G RKTVADFIT RD G  AY EDIFLTAGAS+AV Y+LSI CRG 
Sbjct: 153 IGGSVGAYSHSQGVYGFRKTVADFITKRDGGEEAYAEDIFLTAGASAAVSYILSILCRGP 212

Query: 256 ETGVLIPIPQYPLYTATLALQNSHALPYYLNEETGWSTDPXXXXXXXXXXXXNNIKPSVL 315
           +TGVLIPIPQYPLYTA+LAL NSHALPYYL+EE+ WST+P              ++P  L
Sbjct: 213 QTGVLIPIPQYPLYTASLALNNSHALPYYLDEESNWSTNPEEIEKVVTNSIAKGVEPKCL 272

Query: 316 VVINPGNPTGAVLSEEAIEQIFTLAAKYGIIVIADEVYQENVFEDVKFHSMKKVLRQLQM 375
           VVINPGNPTGA+LS E+IE+IF +AAKYGI+VIADEVYQENVF   +FHSM+KVL+ LQ 
Sbjct: 273 VVINPGNPTGAILSPESIEKIFEVAAKYGIVVIADEVYQENVFNGAEFHSMRKVLKDLQR 332

Query: 376 KQPGLYDNVQLASLHSTSKGVSGECGQRGGYMELVGFTHDIRQVVLKLASISLCPVVTGQ 435
           K  G +DN+QLASLHSTSKGVSGECGQRGGYMEL+GF+HD+RQV LKLASISLCPVVTGQ
Sbjct: 333 KHHGKFDNIQLASLHSTSKGVSGECGQRGGYMELLGFSHDVRQVFLKLASISLCPVVTGQ 392

Query: 436 ALVDLMVCPPQKGEESYEQDQEERRNIHKELHKRATLLHDAFVKLDGISCQKPQGAMYLF 495
           ALVDLMVCPP+ G+ SYEQDQ+ER  IH  L  RA++L++ F +L+GI CQKPQGAMYLF
Sbjct: 393 ALVDLMVCPPKPGDASYEQDQKERSEIHDALDARASMLYETFNRLEGIECQKPQGAMYLF 452

Query: 496 PKLELPYKAIQEALHQDMSPDEFYCKSLLEKTGICTVPGSGFGQEPGTYHLRTTFLAPGT 555
           P+L+L YKA+Q+A H  +SPDEFYC+ LLE TGICTVPGSGFGQ PGTYHLRTTFLAPGT
Sbjct: 453 PRLDLSYKAVQKAEHLSLSPDEFYCQELLEATGICTVPGSGFGQVPGTYHLRTTFLAPGT 512

Query: 556 KWIEDWVDFHQEFYNKFKN 574
            WI+ W +FH++FYN++++
Sbjct: 513 DWIKAWEEFHKKFYNEYRD 531

>KAFR0B02730 Chr2 complement(558858..560477) [1620 bp, 539 aa] {ON}
           Anc_8.263 YDR111C
          Length = 539

 Score =  712 bits (1837), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 351/492 (71%), Positives = 404/492 (82%), Gaps = 2/492 (0%)

Query: 85  NNLPFLPAEQATLKDVNECVLNAKYAVRGAIPMRAEELKTQLMENPHSLPFNDIINANIG 144
           +NL F PA Q T+ D+NE VL AKYAVRG IP RAEELK QL E P+SLPF+ IINANIG
Sbjct: 48  HNLNFKPAGQLTIGDLNENVLKAKYAVRGKIPTRAEELKRQLAEKPNSLPFDKIINANIG 107

Query: 145 NPQQLKQKPLSFYRQVLSLLQYPELIPTLENNPQT--MIKQDAIDRAKRLLDDIGGSVGA 202
           NPQQL+Q+PLSFYRQVLSLLQYP L+  +E  P +  + K+DAI RAK++L DIGGSVGA
Sbjct: 108 NPQQLQQQPLSFYRQVLSLLQYPTLLHAIETKPGSSAVYKKDAILRAKKILKDIGGSVGA 167

Query: 203 YSSSQGVLGIRKTVADFITNRDDGIIAYPEDIFLTAGASSAVDYLLSIFCRGEETGVLIP 262
           YS SQGV GIR+TVA+FIT RD G  AYPEDIFLTAGAS+AV+YLLSI C+GE+TGVLIP
Sbjct: 168 YSESQGVYGIRRTVANFITERDGGEPAYPEDIFLTAGASAAVNYLLSILCKGEKTGVLIP 227

Query: 263 IPQYPLYTATLALQNSHALPYYLNEETGWSTDPXXXXXXXXXXXXNNIKPSVLVVINPGN 322
           IPQYPLYTATLAL NSHALPY+L+E  GWS +P            +NIKP VLVVINPGN
Sbjct: 228 IPQYPLYTATLALNNSHALPYFLDEMNGWSINPIEIENVIKKAVQDNIKPDVLVVINPGN 287

Query: 323 PTGAVLSEEAIEQIFTLAAKYGIIVIADEVYQENVFEDVKFHSMKKVLRQLQMKQPGLYD 382
           PTGAVLS+EAI  I  +AAKYGI+VIADEVYQEN+F+ +KFHS+K VLR+LQ + PG +D
Sbjct: 288 PTGAVLSKEAIVSILEIAAKYGIVVIADEVYQENIFDGMKFHSVKGVLRRLQREIPGKFD 347

Query: 383 NVQLASLHSTSKGVSGECGQRGGYMELVGFTHDIRQVVLKLASISLCPVVTGQALVDLMV 442
           NVQLASLHSTSKGVSGECGQRGGYME++GFTH++RQV+LKLASISLCPVVTGQALVDLMV
Sbjct: 348 NVQLASLHSTSKGVSGECGQRGGYMEIIGFTHEVRQVILKLASISLCPVVTGQALVDLMV 407

Query: 443 CPPQKGEESYEQDQEERRNIHKELHKRATLLHDAFVKLDGISCQKPQGAMYLFPKLELPY 502
            PP++GEES+  DQ +R+ IH +L +RA LL   F  LDGI CQKP GAMYLFPKL LPY
Sbjct: 408 SPPKRGEESFALDQAQRKTIHSQLSQRAELLWKTFNSLDGIECQKPNGAMYLFPKLNLPY 467

Query: 503 KAIQEALHQDMSPDEFYCKSLLEKTGICTVPGSGFGQEPGTYHLRTTFLAPGTKWIEDWV 562
           +AIQEA   ++SPDEFYCK LLE TGICTVPGSGFGQ  GTYHLRTTFLAPG +WI+ W 
Sbjct: 468 RAIQEAQRLELSPDEFYCKELLEHTGICTVPGSGFGQVAGTYHLRTTFLAPGIEWIDSWK 527

Query: 563 DFHQEFYNKFKN 574
            FH EF  K+ +
Sbjct: 528 QFHIEFMEKYNS 539

>Kpol_392.5 s392 (6873..8411) [1539 bp, 512 aa] {ON} (6873..8411)
           [1539 nt, 513 aa]
          Length = 512

 Score =  701 bits (1808), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 336/500 (67%), Positives = 405/500 (81%), Gaps = 9/500 (1%)

Query: 75  LNTEIHHHSHNNLPFLPAEQATLKDVNECVLNAKYAVRGAIPMRAEELKTQLMENPHSLP 134
           L+T ++ H HN     PA++  + D+N+ VL AKYAVRG+IP+RAEELK  L E    LP
Sbjct: 22  LSTTLYEHKHN---VYPAQKLRMDDLNKNVLKAKYAVRGSIPLRAEELKLYL-EAGQKLP 77

Query: 135 FNDIINANIGNPQQLKQKPLSFYRQVLSLLQYPELIPTLENNPQTMIKQDAIDRAKRLLD 194
           F+ +INANIGNPQQLKQKPL+FYRQVLS+LQYPEL+ +  N    + K+DAI+RA++LL 
Sbjct: 78  FDTVINANIGNPQQLKQKPLTFYRQVLSILQYPELLESGSN----IFKKDAIERARKLLK 133

Query: 195 DIGGSVGAYSSSQGVLGIRKTVADFITNRDDGIIAYPEDIFLTAGASSAVDYLLSIFCRG 254
           +IG SVG+YSSSQG+  IRKTVA+FIT RDDG I+ P DIFLTAGASSAVDYLLSI C+ 
Sbjct: 134 EIG-SVGSYSSSQGIPAIRKTVANFITKRDDGEISTPNDIFLTAGASSAVDYLLSILCKN 192

Query: 255 EETGVLIPIPQYPLYTATLALQNSHALPYYLNEETGWSTDPXXXXXXXXXXXXNNIKPSV 314
           E++GVLIPIPQYPLYTATLAL N+HALPYYL+E  GWSTD               IKP+ 
Sbjct: 193 EKSGVLIPIPQYPLYTATLALNNAHALPYYLDESKGWSTDINEIEEVINDSLDKGIKPTA 252

Query: 315 LVVINPGNPTGAVLSEEAIEQIFTLAAKYGIIVIADEVYQENVFEDVKFHSMKKVLRQLQ 374
           LV+INPGNPTG++LS E++E+I  +AA +GI++IADEVYQENVF + KFHSMKKVLR LQ
Sbjct: 253 LVIINPGNPTGSILSVESMEKIIEVAATHGIVIIADEVYQENVFNNAKFHSMKKVLRNLQ 312

Query: 375 MKQPGLYDNVQLASLHSTSKGVSGECGQRGGYMELVGFTHDIRQVVLKLASISLCPVVTG 434
              PG YD VQLASLHSTSKGVSGECGQRGGYMEL GF  +I+QV+LKL SISLCPVVTG
Sbjct: 313 KAFPGEYDTVQLASLHSTSKGVSGECGQRGGYMELTGFNPEIKQVILKLCSISLCPVVTG 372

Query: 435 QALVDLMVCPPQKGEESYEQDQEERRNIHKELHKRATLLHDAFVKLDGISCQKPQGAMYL 494
           QALVDLMV PPQKG+ESYEQDQ ER  I  +L  RA LL +AF  ++G+SCQKP+GAMYL
Sbjct: 373 QALVDLMVSPPQKGDESYEQDQLERSTILNDLSNRAILLWEAFNSMEGVSCQKPEGAMYL 432

Query: 495 FPKLELPYKAIQEALHQDMSPDEFYCKSLLEKTGICTVPGSGFGQEPGTYHLRTTFLAPG 554
           FPK++LP+K +Q++   D++PDEFYCK+LLE TGICTVPGSGFGQ+PGTYHLRTTFLAPG
Sbjct: 433 FPKIDLPFKVLQKSQELDITPDEFYCKALLEATGICTVPGSGFGQQPGTYHLRTTFLAPG 492

Query: 555 TKWIEDWVDFHQEFYNKFKN 574
           T+WI+ W  FH EFY+K+++
Sbjct: 493 TEWIDRWNKFHAEFYDKYRD 512

>TPHA0J00750 Chr10 complement(176561..178129) [1569 bp, 522 aa] {ON}
           Anc_8.263 YDR111C
          Length = 522

 Score =  684 bits (1764), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 336/492 (68%), Positives = 402/492 (81%), Gaps = 3/492 (0%)

Query: 84  HNNLPFLPAEQATLKDVNECVLNAKYAVRGAIPMRAEELKTQLMENPHSLPFNDIINANI 143
           H N  F PA++ T+ D+NE VL AKYAVRG IP RAE LK QL++NP SLPF  +INANI
Sbjct: 33  HKN--FKPADKLTINDLNENVLKAKYAVRGKIPARAEVLKQQLIDNPSSLPFKKVINANI 90

Query: 144 GNPQQLKQKPLSFYRQVLSLLQYPELI-PTLENNPQTMIKQDAIDRAKRLLDDIGGSVGA 202
           GNPQQL QKPL+FYRQVLSLLQYP ++  T   N +T+ KQDAI+RAKR+L+DIG SVG+
Sbjct: 91  GNPQQLNQKPLTFYRQVLSLLQYPMVLDETFSGNTKTLYKQDAIERAKRILNDIGSSVGS 150

Query: 203 YSSSQGVLGIRKTVADFITNRDDGIIAYPEDIFLTAGASSAVDYLLSIFCRGEETGVLIP 262
           YSSSQGV G+RKTVA++I+ RD G  AY EDIFLTAGASSAV YLL+I C+G+E+GVLIP
Sbjct: 151 YSSSQGVFGLRKTVAEYISRRDGGEKAYAEDIFLTAGASSAVSYLLNILCKGKESGVLIP 210

Query: 263 IPQYPLYTATLALQNSHALPYYLNEETGWSTDPXXXXXXXXXXXXNNIKPSVLVVINPGN 322
           IPQYPLYTATLAL N++ALPYYL E +GWST+               I P VLVVINPGN
Sbjct: 211 IPQYPLYTATLALNNTNALPYYLEENSGWSTNMEEIENVVHNAIREKIIPRVLVVINPGN 270

Query: 323 PTGAVLSEEAIEQIFTLAAKYGIIVIADEVYQENVFEDVKFHSMKKVLRQLQMKQPGLYD 382
           PTGA+LS E+IE+IF +AA +GI+VIADEVYQEN+F   +FHSMKKVLR LQ + PG Y+
Sbjct: 271 PTGAILSVESIEKIFDVAAHHGIVVIADEVYQENIFPGNEFHSMKKVLRDLQRRVPGKYE 330

Query: 383 NVQLASLHSTSKGVSGECGQRGGYMELVGFTHDIRQVVLKLASISLCPVVTGQALVDLMV 442
           NVQLASLHSTSKGVSGECGQRGGYMEL GF+ +I+  +LKL SISLCPVVTGQALVDLM 
Sbjct: 331 NVQLASLHSTSKGVSGECGQRGGYMELTGFSTEIKHEILKLCSISLCPVVTGQALVDLMT 390

Query: 443 CPPQKGEESYEQDQEERRNIHKELHKRATLLHDAFVKLDGISCQKPQGAMYLFPKLELPY 502
           CPP+KGE SYEQDQ ER  IH EL++RAT L  AF +++G+SCQKPQG+MYLFPK+++P+
Sbjct: 391 CPPKKGEASYEQDQMERSTIHSELYERATYLWKAFNEMEGVSCQKPQGSMYLFPKIDIPH 450

Query: 503 KAIQEALHQDMSPDEFYCKSLLEKTGICTVPGSGFGQEPGTYHLRTTFLAPGTKWIEDWV 562
           KA+++A   D++PDE YC  LLE TGICTVPGSGFGQ+PGT+HLRTTFLAPGT WI+ W 
Sbjct: 451 KALEKAQELDITPDELYCAELLEATGICTVPGSGFGQKPGTFHLRTTFLAPGTSWIDQWR 510

Query: 563 DFHQEFYNKFKN 574
           +FHQ F NK+++
Sbjct: 511 EFHQIFCNKYRD 522

>KLTH0G13662g Chr7 (1169989..1171548) [1560 bp, 519 aa] {ON} similar
           to uniprot|P52893 Saccharomyces cerevisiae YLR089C ALT1
           putative alanine transaminase (glutamyc pyruvic
           transaminase)
          Length = 519

 Score =  681 bits (1758), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 325/482 (67%), Positives = 388/482 (80%), Gaps = 2/482 (0%)

Query: 94  QATLKDVNECVLNAKYAVRGAIPMRAEELKTQLMENPHSLPFNDIINANIGNPQQLKQKP 153
           + TL+DVN+CVLNAKYAVRG IP+RAEEL+ +L+E P SLPFN IINANIGNPQQL QKP
Sbjct: 39  KKTLRDVNQCVLNAKYAVRGPIPLRAEELRHKLVEEPGSLPFNKIINANIGNPQQLDQKP 98

Query: 154 LSFYRQVLSLLQYPELIPTLENNP-QTMIKQDAIDRAKRLLDDIGGSVGAYSSSQGVLGI 212
           L+FYRQVLSLLQ P LI +L       + K DA++RAK++L  +GGSVGAYS+SQGV G 
Sbjct: 99  LTFYRQVLSLLQNPALIESLPTGELHKLFKPDAVERAKKMLKQVGGSVGAYSASQGVAGF 158

Query: 213 RKTVADFITNRDDGIIAYPEDIFLTAGASSAVDYLLSIFCRGEETGVLIPIPQYPLYTAT 272
           R++VA+FI  RD G  A   DIFLTAGASSAV  +LS+FC G E G LIPIPQYPLYTAT
Sbjct: 159 RQSVAEFIEERD-GEPASANDIFLTAGASSAVSAILSMFCTGSENGALIPIPQYPLYTAT 217

Query: 273 LALQNSHALPYYLNEETGWSTDPXXXXXXXXXXXXNNIKPSVLVVINPGNPTGAVLSEEA 332
           LAL ++HALPYYL+E +GWS D               ++P+ LVVINPGNPTGA+LS EA
Sbjct: 218 LALNDAHALPYYLDEASGWSMDTEQVEQVVKDAIRKGVRPTCLVVINPGNPTGAILSPEA 277

Query: 333 IEQIFTLAAKYGIIVIADEVYQENVFEDVKFHSMKKVLRQLQMKQPGLYDNVQLASLHST 392
           IE+I T+AAKY ++VIADEVYQEN F+D  F SMKKVLR LQ  +PG YDNVQLASLHST
Sbjct: 278 IEKILTVAAKYSLVVIADEVYQENGFDDADFVSMKKVLRVLQKTEPGKYDNVQLASLHST 337

Query: 393 SKGVSGECGQRGGYMELVGFTHDIRQVVLKLASISLCPVVTGQALVDLMVCPPQKGEESY 452
           SKGVSGECGQRGGYMELVGF+ +++QV LKLASISLCPVVTGQALVDLMV PP+KG+ SY
Sbjct: 338 SKGVSGECGQRGGYMELVGFSEEVKQVFLKLASISLCPVVTGQALVDLMVRPPKKGDASY 397

Query: 453 EQDQEERRNIHKELHKRATLLHDAFVKLDGISCQKPQGAMYLFPKLELPYKAIQEALHQD 512
           E D++ER  IH  LH+++TLL++ F  L+G+SCQKPQGAMYLFPKL+L  KAI++A    
Sbjct: 398 ELDRQERNAIHNSLHQKSTLLYETFQSLEGVSCQKPQGAMYLFPKLDLSRKAIRKAESLG 457

Query: 513 MSPDEFYCKSLLEKTGICTVPGSGFGQEPGTYHLRTTFLAPGTKWIEDWVDFHQEFYNKF 572
           M+PDE+YCK LLE TGICTVPGSGF Q PGTYHLRTTFLAPGT+W++ W  FHQ+F ++ 
Sbjct: 458 MAPDEYYCKELLEATGICTVPGSGFRQVPGTYHLRTTFLAPGTEWVDSWKKFHQKFVDEH 517

Query: 573 KN 574
           ++
Sbjct: 518 RD 519

>Kwal_56.23791 s56 (706946..708502) [1557 bp, 518 aa] {ON} YLR089C -
           Hypothetical ORF [contig 173] FULL
          Length = 518

 Score =  674 bits (1740), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 320/478 (66%), Positives = 383/478 (80%), Gaps = 2/478 (0%)

Query: 92  AEQATLKDVNECVLNAKYAVRGAIPMRAEELKTQLMENPHSLPFNDIINANIGNPQQLKQ 151
             + TL+D+NECVLNAKYAVRG IP+RAEELK +L+E P SLPF+ IINANIGNPQQL Q
Sbjct: 36  GSKKTLQDINECVLNAKYAVRGLIPLRAEELKQKLLEEPGSLPFDKIINANIGNPQQLDQ 95

Query: 152 KPLSFYRQVLSLLQYPELIPTLENNP-QTMIKQDAIDRAKRLLDDIGGSVGAYSSSQGVL 210
           KPL+FYRQVL+LLQ P+LI  L +       K DA++RAK++L  +GGSVGAYS+SQGV 
Sbjct: 96  KPLTFYRQVLALLQNPDLISDLSSGELHKFFKPDAVERAKKMLKQVGGSVGAYSNSQGVA 155

Query: 211 GIRKTVADFITNRDDGIIAYPEDIFLTAGASSAVDYLLSIFCRGEETGVLIPIPQYPLYT 270
           G R++VA+FI  RD G  A  +DIFLT GAS AV Y+LS+FC G E G LIPIPQYPLYT
Sbjct: 156 GFRESVAEFIEERD-GEPASAQDIFLTTGASGAVSYILSLFCNGPENGALIPIPQYPLYT 214

Query: 271 ATLALQNSHALPYYLNEETGWSTDPXXXXXXXXXXXXNNIKPSVLVVINPGNPTGAVLSE 330
           A+LAL NSHALPYYL+EE+GWS D               I+P+ LVVINPGNPTGA+L+ 
Sbjct: 215 ASLALNNSHALPYYLDEESGWSMDTEQIEKVVQDSIKKGIRPTCLVVINPGNPTGALLNT 274

Query: 331 EAIEQIFTLAAKYGIIVIADEVYQENVFEDVKFHSMKKVLRQLQMKQPGLYDNVQLASLH 390
           + IE +  +AAKY +++IADEVYQEN F D +F SMKKVLR LQ  +PG YDNVQLASLH
Sbjct: 275 DTIENVIKVAAKYSMVIIADEVYQENGFNDAEFVSMKKVLRVLQKTEPGKYDNVQLASLH 334

Query: 391 STSKGVSGECGQRGGYMELVGFTHDIRQVVLKLASISLCPVVTGQALVDLMVCPPQKGEE 450
           STSKGVSGECGQRGGYMELVGF+ +++QV LKLASISLCPVVTGQAL+DLMV PP+KG+ 
Sbjct: 335 STSKGVSGECGQRGGYMELVGFSEEVKQVFLKLASISLCPVVTGQALIDLMVRPPKKGDA 394

Query: 451 SYEQDQEERRNIHKELHKRATLLHDAFVKLDGISCQKPQGAMYLFPKLELPYKAIQEALH 510
           SYEQD++ER +IH  LHKR+ LL+ AF  ++G+SCQ+PQGAMYLFPKLEL  KAI +A  
Sbjct: 395 SYEQDRQERCDIHDALHKRSGLLYQAFQSMEGVSCQEPQGAMYLFPKLELSNKAIHKAES 454

Query: 511 QDMSPDEFYCKSLLEKTGICTVPGSGFGQEPGTYHLRTTFLAPGTKWIEDWVDFHQEF 568
             ++PDE+YCK LLE TGICTVPGSGFGQ PGT+HLRTTFLAPGT+WI+ W  FH++F
Sbjct: 455 AGLAPDEYYCKELLEATGICTVPGSGFGQVPGTFHLRTTFLAPGTEWIDSWKKFHEKF 512

>YDR111C Chr4 complement(678241..679764) [1524 bp, 507 aa] {ON}
           ALT2Putative alanine transaminase (glutamic pyruvic
           transaminase)
          Length = 507

 Score =  664 bits (1714), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 316/494 (63%), Positives = 386/494 (78%), Gaps = 2/494 (0%)

Query: 83  SHNNLPFLPAEQATLKDVNECVLNAKYAVRGAIPMRAEELKTQLMENPHSLPFNDIINAN 142
           +  +L F PA + T KD+N  V  A+YAVRGAIP RA+ELK +L +NP  LPF+DIINAN
Sbjct: 14  TAKDLDFKPAGKITKKDLNTGVTKAEYAVRGAIPTRADELKEELKKNPEVLPFDDIINAN 73

Query: 143 IGNPQQLKQKPLSFYRQVLSLLQYPELIPTLENNPQTM--IKQDAIDRAKRLLDDIGGSV 200
           IGNPQQL QKPL+F RQVL++L+YPE++    N   ++    +DA++RA+RLL+DIGGS+
Sbjct: 74  IGNPQQLDQKPLTFTRQVLAILEYPEILRVGHNELASLNLFSRDALERAERLLNDIGGSI 133

Query: 201 GAYSSSQGVLGIRKTVADFITNRDDGIIAYPEDIFLTAGASSAVDYLLSIFCRGEETGVL 260
           GAYS SQGV GIR+TVADFIT RD G  A PEDI+LT GASSA   LLS+ C+  +TG+L
Sbjct: 134 GAYSHSQGVPGIRQTVADFITRRDGGEPATPEDIYLTTGASSAATSLLSLLCKDSQTGLL 193

Query: 261 IPIPQYPLYTATLALQNSHALPYYLNEETGWSTDPXXXXXXXXXXXXNNIKPSVLVVINP 320
           IPIPQYPLYTA+ +L N+  LPYYL+EE+ WST+               I+PSVL+VINP
Sbjct: 194 IPIPQYPLYTASASLFNAQVLPYYLDEESNWSTNSDEIEKVVQDALKKQIRPSVLIVINP 253

Query: 321 GNPTGAVLSEEAIEQIFTLAAKYGIIVIADEVYQENVFEDVKFHSMKKVLRQLQMKQPGL 380
           GNPTGAVLSEE I +I  +AAKYGI +I+DEVYQEN+F DVKFHSMKKVLR+LQ   PG 
Sbjct: 254 GNPTGAVLSEETIARICLIAAKYGITIISDEVYQENIFNDVKFHSMKKVLRKLQHLYPGK 313

Query: 381 YDNVQLASLHSTSKGVSGECGQRGGYMELVGFTHDIRQVVLKLASISLCPVVTGQALVDL 440
           +DNVQLASLHS SKG   ECGQRGGYME++GF+ +IR  + KL SIS+C VVTGQA+VDL
Sbjct: 314 FDNVQLASLHSISKGFMDECGQRGGYMEIIGFSQEIRDALFKLMSISICSVVTGQAVVDL 373

Query: 441 MVCPPQKGEESYEQDQEERRNIHKELHKRATLLHDAFVKLDGISCQKPQGAMYLFPKLEL 500
           MV PPQ G+ESYEQD +ER  I  E+  RA LL++ F +L+GI CQKPQGAMYLFP+L L
Sbjct: 374 MVKPPQPGDESYEQDHDERLKIFHEMRTRANLLYETFKELEGIECQKPQGAMYLFPRLVL 433

Query: 501 PYKAIQEALHQDMSPDEFYCKSLLEKTGICTVPGSGFGQEPGTYHLRTTFLAPGTKWIED 560
           P KA+ E+    + PDEFYC SLLE TGICTVPGSGFGQ PGTYH+RTTFLAPGTKWI+D
Sbjct: 434 PKKALCESERLGIEPDEFYCTSLLESTGICTVPGSGFGQRPGTYHVRTTFLAPGTKWIQD 493

Query: 561 WVDFHQEFYNKFKN 574
           W +FHQ+F++K++N
Sbjct: 494 WKEFHQDFFSKYRN 507

>NCAS0B03840 Chr2 (683781..685274) [1494 bp, 497 aa] {ON} Anc_8.263
           YDR111C
          Length = 497

 Score =  657 bits (1695), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 313/497 (62%), Positives = 390/497 (78%), Gaps = 9/497 (1%)

Query: 83  SHNNLPFLPAEQATLKDVNECVLNAKYAVRGAIPMRAEELKTQLMENPHSLPFNDIINAN 142
           S  N  F PA + +LKD+NE V++AK+A+RG+I ++AE+L+ QL +NPH LPF++I  AN
Sbjct: 5   SLENNDFQPAPKLSLKDINENVVDAKFAIRGSISIKAEDLQVQLNKNPHCLPFDEITVAN 64

Query: 143 IGNPQQLKQKPLSFYRQVLSLLQYPELIPTLENNPQTMIKQ-----DAIDRAKRLLDDIG 197
           IGNPQ+L QKPL+F RQV+S+LQYPEL+    NN   + K+     D+ DRA+RLL DIG
Sbjct: 65  IGNPQELNQKPLTFARQVVSILQYPELL----NNRDVLTKEKIFNSDSFDRAERLLRDIG 120

Query: 198 GSVGAYSSSQGVLGIRKTVADFITNRDDGIIAYPEDIFLTAGASSAVDYLLSIFCRGEET 257
           GSVGAYS+SQGV GIRKT A++IT RD G  +YPEDIFLT GA+SA  YLLS+ CRG +T
Sbjct: 121 GSVGAYSASQGVYGIRKTAAEYITKRDGGEPSYPEDIFLTTGATSAASYLLSVLCRGPQT 180

Query: 258 GVLIPIPQYPLYTATLALQNSHALPYYLNEETGWSTDPXXXXXXXXXXXXNNIKPSVLVV 317
           GVLIPIPQYPLYTATLAL  S  +PYYL+EE+ WST+               IKPSV+VV
Sbjct: 181 GVLIPIPQYPLYTATLALNKSTMIPYYLDEESAWSTNTTEIEKLVLDSIKKGIKPSVIVV 240

Query: 318 INPGNPTGAVLSEEAIEQIFTLAAKYGIIVIADEVYQENVFEDVKFHSMKKVLRQLQMKQ 377
           INPGNPTGAVLSE AI +IF +AAKYGI+V+ADEVYQEN+F+ V+FHS KKVLR LQ + 
Sbjct: 241 INPGNPTGAVLSELAIAKIFQIAAKYGIVVLADEVYQENIFDGVQFHSTKKVLRGLQKQY 300

Query: 378 PGLYDNVQLASLHSTSKGVSGECGQRGGYMELVGFTHDIRQVVLKLASISLCPVVTGQAL 437
           PG +DN+QLAS+HSTSKGV GECGQRGGYMELVGFT ++RQ++LKLA +++C VVTGQA+
Sbjct: 301 PGKFDNIQLASMHSTSKGVFGECGQRGGYMELVGFTDEVRQLLLKLACLAVCSVVTGQAM 360

Query: 438 VDLMVCPPQKGEESYEQDQEERRNIHKELHKRATLLHDAFVKLDGISCQKPQGAMYLFPK 497
           VDLM+ PP+KG+ SYE D++ER+ I   +++RA  L+  F KLDGI CQKPQGAMYL+P 
Sbjct: 361 VDLMLLPPKKGDASYELDKKERQEIFDAMYERARKLYAMFDKLDGIECQKPQGAMYLYPS 420

Query: 498 LELPYKAIQEALHQDMSPDEFYCKSLLEKTGICTVPGSGFGQEPGTYHLRTTFLAPGTKW 557
           L L  KAI +A   +++PDEFYC  LL+ TGICTVPGSGFGQ+ GTYHLRTTFLAPG +W
Sbjct: 421 LILSKKAIAKAESLNLTPDEFYCHELLDATGICTVPGSGFGQKKGTYHLRTTFLAPGIEW 480

Query: 558 IEDWVDFHQEFYNKFKN 574
           I  W  FH+ FY K+++
Sbjct: 481 INKWEKFHKHFYEKYQD 497

>Smik_4.357 Chr4 complement(639561..641084) [1524 bp, 507 aa] {ON}
           YDR111C (REAL)
          Length = 507

 Score =  655 bits (1691), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 314/492 (63%), Positives = 383/492 (77%), Gaps = 2/492 (0%)

Query: 85  NNLPFLPAEQATLKDVNECVLNAKYAVRGAIPMRAEELKTQLMENPHSLPFNDIINANIG 144
            +L F PA + T KD+N  V  A+YAVRGAIP RA+ELK +L   P  LPF+DIINANIG
Sbjct: 16  KDLNFKPAAKITKKDLNAGVTKAEYAVRGAIPTRADELKEELKRKPGVLPFDDIINANIG 75

Query: 145 NPQQLKQKPLSFYRQVLSLLQYPELIPTLENNPQTM--IKQDAIDRAKRLLDDIGGSVGA 202
           NPQQL QKPL+F RQVLS+L+YPE++    +   ++   ++DA+ RA+ LL+DIGGS+GA
Sbjct: 76  NPQQLDQKPLTFTRQVLSILEYPEILRVGPDKLASLNLFRKDALGRAEHLLEDIGGSIGA 135

Query: 203 YSSSQGVLGIRKTVADFITNRDDGIIAYPEDIFLTAGASSAVDYLLSIFCRGEETGVLIP 262
           YS SQGV GIR++VA+FIT RDDG  A PE+I+LT GASSA   LLS+ C+  +TG+LIP
Sbjct: 136 YSHSQGVPGIRQSVAEFITKRDDGEPAAPENIYLTTGASSAATSLLSLLCKDVQTGLLIP 195

Query: 263 IPQYPLYTATLALQNSHALPYYLNEETGWSTDPXXXXXXXXXXXXNNIKPSVLVVINPGN 322
           IPQYPLYTA+ +L N+  LPYYL+E + WST                IKPSVL+VINPGN
Sbjct: 196 IPQYPLYTASASLFNAQVLPYYLDEGSNWSTKSDEIEKVVKDALEKGIKPSVLIVINPGN 255

Query: 323 PTGAVLSEEAIEQIFTLAAKYGIIVIADEVYQENVFEDVKFHSMKKVLRQLQMKQPGLYD 382
           PTGAVLSE+ I +I  +AAKYGI +I+DEVYQENVF  VKFHSMKKVLR+LQ   PG +D
Sbjct: 256 PTGAVLSEDTIAKICLIAAKYGIAIISDEVYQENVFNGVKFHSMKKVLRKLQRLYPGKFD 315

Query: 383 NVQLASLHSTSKGVSGECGQRGGYMELVGFTHDIRQVVLKLASISLCPVVTGQALVDLMV 442
           NVQLASLHS SKG  GECGQRGGYME+VGF+ DIR  + KL SIS+C VVTGQA+VDLMV
Sbjct: 316 NVQLASLHSISKGFMGECGQRGGYMEVVGFSKDIRDALFKLMSISICSVVTGQAVVDLMV 375

Query: 443 CPPQKGEESYEQDQEERRNIHKELHKRATLLHDAFVKLDGISCQKPQGAMYLFPKLELPY 502
            PPQ G+ESY+QD  ER  I  E++ RATLLH+ F +L+GI CQKPQGAMYLFP+L LP 
Sbjct: 376 KPPQPGDESYDQDHSERMKIFHEMYTRATLLHETFNELEGIECQKPQGAMYLFPRLVLPE 435

Query: 503 KAIQEALHQDMSPDEFYCKSLLEKTGICTVPGSGFGQEPGTYHLRTTFLAPGTKWIEDWV 562
           KA++E+    + PDEFYC SLLE TGICTVPGSGFGQ+PGTYH+RTTFLAPGT+WI+DW 
Sbjct: 436 KALRESERLGIEPDEFYCTSLLESTGICTVPGSGFGQQPGTYHVRTTFLAPGTQWIQDWK 495

Query: 563 DFHQEFYNKFKN 574
            FHQ+F+NK+++
Sbjct: 496 HFHQDFFNKYRD 507

>Suva_2.271 Chr2 complement(472714..474237) [1524 bp, 507 aa] {ON}
           YDR111C (REAL)
          Length = 507

 Score =  654 bits (1687), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 311/494 (62%), Positives = 382/494 (77%), Gaps = 2/494 (0%)

Query: 83  SHNNLPFLPAEQATLKDVNECVLNAKYAVRGAIPMRAEELKTQLMENPHSLPFNDIINAN 142
           +  +L F PA + T KD+N  V  A+YAVRGAIP RAEELK +L  + +SLPFN IINAN
Sbjct: 14  TTKDLDFKPAAKLTKKDLNASVTKAEYAVRGAIPTRAEELKEELKRSSNSLPFNSIINAN 73

Query: 143 IGNPQQLKQKPLSFYRQVLSLLQYPELIPTLENNPQTM--IKQDAIDRAKRLLDDIGGSV 200
           IGNPQQL QKPL+F RQVLS+L+YPE++    +   ++    +DA+ RA+RLLDDIGGSV
Sbjct: 74  IGNPQQLDQKPLTFTRQVLSILEYPEILRVDHDKLASLNLFAKDALKRAQRLLDDIGGSV 133

Query: 201 GAYSSSQGVLGIRKTVADFITNRDDGIIAYPEDIFLTAGASSAVDYLLSIFCRGEETGVL 260
           GAYS SQGV GIR+TVADFIT RD G  A PEDI+LT GASSA   LLS+ C+  +TG+L
Sbjct: 134 GAYSHSQGVPGIRQTVADFITERDGGEPAGPEDIYLTTGASSAATSLLSLLCKDSQTGLL 193

Query: 261 IPIPQYPLYTATLALQNSHALPYYLNEETGWSTDPXXXXXXXXXXXXNNIKPSVLVVINP 320
           +PIPQYPLYTA+ +L N+  LPYYL+EE  WST+               I+PSVLVVINP
Sbjct: 194 LPIPQYPLYTASASLYNAQVLPYYLDEEADWSTESDEIERVVLDALKKGIRPSVLVVINP 253

Query: 321 GNPTGAVLSEEAIEQIFTLAAKYGIIVIADEVYQENVFEDVKFHSMKKVLRQLQMKQPGL 380
           GNPTGAVL+E  I +I  +AAKYGI +I+DEVYQEN+F DVKFHSMKK+LR+LQ   PG 
Sbjct: 254 GNPTGAVLTENTIAKICLIAAKYGITIISDEVYQENIFGDVKFHSMKKILRKLQNLHPGK 313

Query: 381 YDNVQLASLHSTSKGVSGECGQRGGYMELVGFTHDIRQVVLKLASISLCPVVTGQALVDL 440
           +DNVQLASLHS SKG  GECGQRGGYME+VGF+ DIR  + KL SIS+C V TGQA++DL
Sbjct: 314 FDNVQLASLHSISKGFMGECGQRGGYMEIVGFSQDIRDALFKLMSISICSVATGQAIIDL 373

Query: 441 MVCPPQKGEESYEQDQEERRNIHKELHKRATLLHDAFVKLDGISCQKPQGAMYLFPKLEL 500
           MV PPQ G+ESY+QD++ER  I+ E+  RA LL++ F +L+GI CQKPQGAMYLFPKL L
Sbjct: 374 MVKPPQPGDESYDQDRKERLKIYNEMLTRANLLYETFNELEGIKCQKPQGAMYLFPKLFL 433

Query: 501 PYKAIQEALHQDMSPDEFYCKSLLEKTGICTVPGSGFGQEPGTYHLRTTFLAPGTKWIED 560
           P KA++E+   ++ PD  YC SLLE TGICTVPGSGFGQ+ GTYH+RTTFL PGT+WI+D
Sbjct: 434 PEKALRESERLNIEPDVLYCTSLLESTGICTVPGSGFGQKSGTYHVRTTFLPPGTQWIQD 493

Query: 561 WVDFHQEFYNKFKN 574
           W  FHQ+F+NK+++
Sbjct: 494 WRQFHQDFFNKYRD 507

>KAFR0B05530 Chr2 (1132895..1134439) [1545 bp, 514 aa] {ON} 
          Length = 514

 Score =  653 bits (1685), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 318/488 (65%), Positives = 386/488 (79%), Gaps = 4/488 (0%)

Query: 89  FLPAEQATLKDVNECVLNAKYAVRGAIPMRAEELKTQLMEN--PHSLPFNDIINANIGNP 146
           F PA++ TL D+N+ VL ++YAVRG+IP RAEEL+ +L+ N    SL F +I++ANIGNP
Sbjct: 28  FKPAKKITLDDLNQNVLKSEYAVRGSIPRRAEELEFELLNNDSSDSLAFENIVHANIGNP 87

Query: 147 QQLKQKPLSFYRQVLSLLQYPELIPTLENNPQTMI-KQDAIDRAKRLLDDIGGSVGAYSS 205
           QQL QKPL+F RQV+S+LQYPEL+        T I K DA++RA+ LL  IGGSVGAYSS
Sbjct: 88  QQLDQKPLTFSRQVISILQYPELLNQRNILVSTGIFKSDAMERAETLLCHIGGSVGAYSS 147

Query: 206 SQGVLGIRKTVADFITNRDDGIIAYPEDIFLTAGASSAVDYLLSIFCRGEETGVLIPIPQ 265
           SQGV GIR+TVA++IT RD+G  A P+DIFLT GAS A  YLLS+ C+ + TGVLIPIPQ
Sbjct: 148 SQGVYGIRETVANYITARDNGETASPDDIFLTEGASKAASYLLSLLCKDKNTGVLIPIPQ 207

Query: 266 YPLYTATLALQNSHALPYYLNEETGWSTDPXXXXXXXXXXXXNNIKPSVLVVINPGNPTG 325
           YPLYTAT+ L ++  LPYYLNEE+GWST+             +N+KPSV+VVINPGNPTG
Sbjct: 208 YPLYTATITLCDAKMLPYYLNEESGWSTNTNEIEKVVLDAIADNVKPSVMVVINPGNPTG 267

Query: 326 AVLSEEAIEQIFTLAAKYGIIVIADEVYQENVFEDVKFHSMKKVLRQLQMKQPGLYDNVQ 385
           +VLS++ I  I  + AKYGI++IADEVYQEN+F D +FHSMKKVLR LQ + PG YD VQ
Sbjct: 268 SVLSKDDIIHIINIGAKYGIVLIADEVYQENIF-DGEFHSMKKVLRSLQKQYPGKYDAVQ 326

Query: 386 LASLHSTSKGVSGECGQRGGYMELVGFTHDIRQVVLKLASISLCPVVTGQALVDLMVCPP 445
           LASLHSTSKGVSGECGQRGGYMELVGF  +IRQ +LKLASISLC V+TGQALVDLMV PP
Sbjct: 327 LASLHSTSKGVSGECGQRGGYMELVGFKDEIRQAILKLASISLCSVITGQALVDLMVNPP 386

Query: 446 QKGEESYEQDQEERRNIHKELHKRATLLHDAFVKLDGISCQKPQGAMYLFPKLELPYKAI 505
           +KG+ESYE D  ER+NIH+ L +RA  L++ F +L G+ CQKPQGAMYLFPKL  P   I
Sbjct: 387 KKGDESYELDNFERKNIHETLKERAEKLYNLFCQLKGVECQKPQGAMYLFPKLHFPQTLI 446

Query: 506 QEALHQDMSPDEFYCKSLLEKTGICTVPGSGFGQEPGTYHLRTTFLAPGTKWIEDWVDFH 565
            EA++Q+MSPDEFYC +LLE TGICTVPGSGFGQ+ GTYHLRTTFLAPG +W E W  FH
Sbjct: 447 TEAINQNMSPDEFYCHALLEATGICTVPGSGFGQKEGTYHLRTTFLAPGNQWTEKWKLFH 506

Query: 566 QEFYNKFK 573
           +EF++K++
Sbjct: 507 EEFFSKYQ 514

>Skud_4.372 Chr4 complement(649872..651395) [1524 bp, 507 aa] {ON}
           YDR111C (REAL)
          Length = 507

 Score =  650 bits (1678), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 314/491 (63%), Positives = 378/491 (76%), Gaps = 2/491 (0%)

Query: 86  NLPFLPAEQATLKDVNECVLNAKYAVRGAIPMRAEELKTQLMENPHSLPFNDIINANIGN 145
           +L F PA + T KD+N  V  A+YAVRG+IP RA+ELK +L +NP  LPF+DIINANIGN
Sbjct: 17  DLDFKPAAKITKKDLNGSVTKAEYAVRGSIPTRADELKEELKKNPGLLPFDDIINANIGN 76

Query: 146 PQQLKQKPLSFYRQVLSLLQYPELIPTLENNPQTM--IKQDAIDRAKRLLDDIGGSVGAY 203
           PQQL QKPL+F RQVLS+L+YPE++        ++    +DA+ RA+ LL DIGGSVGAY
Sbjct: 77  PQQLDQKPLTFTRQVLSILEYPEILQVDHEKLASLNLFSKDALKRAECLLKDIGGSVGAY 136

Query: 204 SSSQGVLGIRKTVADFITNRDDGIIAYPEDIFLTAGASSAVDYLLSIFCRGEETGVLIPI 263
           S SQGV GIR+TVADFIT RD G  A PEDI+LT GASSA   LLS+ C+   TG+LIPI
Sbjct: 137 SHSQGVPGIRQTVADFITARDGGEPATPEDIYLTTGASSAATSLLSLLCKDTRTGLLIPI 196

Query: 264 PQYPLYTATLALQNSHALPYYLNEETGWSTDPXXXXXXXXXXXXNNIKPSVLVVINPGNP 323
           PQYPLYTA+ +L N+  LPYYL+EE  WST+               I+PSVL+VINPGNP
Sbjct: 197 PQYPLYTASASLFNAQVLPYYLDEECNWSTESDEIEKVVQDALEKGIRPSVLIVINPGNP 256

Query: 324 TGAVLSEEAIEQIFTLAAKYGIIVIADEVYQENVFEDVKFHSMKKVLRQLQMKQPGLYDN 383
           TGAVL+EE I +I  +AAKYGI VI+DEVYQENVF D KFHSMKKVLR+LQ   PG +DN
Sbjct: 257 TGAVLTEETIARICLIAAKYGIAVISDEVYQENVFNDFKFHSMKKVLRKLQHCYPGKFDN 316

Query: 384 VQLASLHSTSKGVSGECGQRGGYMELVGFTHDIRQVVLKLASISLCPVVTGQALVDLMVC 443
           VQLASLHS SKG  GECGQRGGYME+VGF+ DIR  + KL SIS+C VVTGQA+VDLMV 
Sbjct: 317 VQLASLHSISKGFMGECGQRGGYMEIVGFSQDIRDALFKLMSISICSVVTGQAIVDLMVN 376

Query: 444 PPQKGEESYEQDQEERRNIHKELHKRATLLHDAFVKLDGISCQKPQGAMYLFPKLELPYK 503
           PPQ G+ESYEQD++ER  I  E+  RA LL++ F  L+GI CQ PQGAMYLFP+L LP K
Sbjct: 377 PPQPGDESYEQDRQERSKIFNEMRTRANLLYETFNGLEGIECQNPQGAMYLFPRLILPDK 436

Query: 504 AIQEALHQDMSPDEFYCKSLLEKTGICTVPGSGFGQEPGTYHLRTTFLAPGTKWIEDWVD 563
           A +E+    + PDEFYC SLLE TGICTVPGSGFGQ+PGTYH+RTTFLAPGT+WI++W +
Sbjct: 437 AFRESERLGVEPDEFYCASLLESTGICTVPGSGFGQKPGTYHVRTTFLAPGTQWIQNWKN 496

Query: 564 FHQEFYNKFKN 574
           FHQ F+N++++
Sbjct: 497 FHQSFFNEYRD 507

>KNAG0M01210 Chr13 (220612..222177) [1566 bp, 521 aa] {ON} Anc_8.263
           YDR111C
          Length = 521

 Score =  648 bits (1672), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 312/495 (63%), Positives = 380/495 (76%), Gaps = 8/495 (1%)

Query: 85  NNLPFLPAEQATLKDVNECVLNAKYAVRGAIPMRAEELKTQLMENPHSLPFNDIINANIG 144
           + L F PA +    D+N+ +++A+YAVRGAIPM+AEEL+ QL + P  LPFN I  ANIG
Sbjct: 30  SGLAFEPARKLGADDLNKNIIDAEYAVRGAIPMKAEELEIQLSQQPDLLPFNAITVANIG 89

Query: 145 NPQQLKQKPLSFYRQVLSLLQYPELIPTLENNPQTMI----KQDAIDRAKRLLDDIGGSV 200
           NPQQL QKPL+F RQV+S+LQYP   P L+   Q +     K+DA  RA  LL+ IGGSV
Sbjct: 90  NPQQLDQKPLTFSRQVVSILQYP---PLLDYEEQLVTSGAYKRDAFKRAAVLLEQIGGSV 146

Query: 201 GAYSSSQGVLGIRKTVADFITNRDDGIIAYPEDIFLTAGASSAVDYLLSIFCRGEETGVL 260
           GAYS +QGV GIR++VADFIT RD+G  A P+DIFLT GAS A  YLLSI CR   TG++
Sbjct: 147 GAYSLAQGVYGIRESVADFITRRDEGETASPDDIFLTDGASKAATYLLSILCRDSSTGIM 206

Query: 261 IPIPQYPLYTATLALQNSHALPYYLNEETGWSTDPXXXXXXXXXXXXNNIKPSVLVVINP 320
           IPIPQYPLYTA++ + NS  LPYYL+EE+GWST                + P V+VVINP
Sbjct: 207 IPIPQYPLYTASITMYNSVMLPYYLDEESGWSTKAEEIEQQVIDSIKRGVTPRVIVVINP 266

Query: 321 GNPTGAVLSEEAIEQIFTLAAKYGIIVIADEVYQENVFEDVKFHSMKKVLRQLQMKQP-G 379
           GNPTGAVLS + I QI T+AAKYGI+V+ADEVYQ N+++ VKFHSMKKVLR LQ   P G
Sbjct: 267 GNPTGAVLSFDTIAQILTIAAKYGIVVLADEVYQNNIYKGVKFHSMKKVLRSLQRDHPNG 326

Query: 380 LYDNVQLASLHSTSKGVSGECGQRGGYMELVGFTHDIRQVVLKLASISLCPVVTGQALVD 439
            YDNVQLAS+HSTSKGVSGECGQRGGYMELVGF++++RQV+LKLASIS+C VVTGQALVD
Sbjct: 327 EYDNVQLASMHSTSKGVSGECGQRGGYMELVGFSNEVRQVILKLASISICSVVTGQALVD 386

Query: 440 LMVCPPQKGEESYEQDQEERRNIHKELHKRATLLHDAFVKLDGISCQKPQGAMYLFPKLE 499
           LM+ PP++G++SYE D  ER+ IH  +  R  LL+D F KL+GI CQ+PQGAMYLFPKL 
Sbjct: 387 LMLNPPREGDDSYELDVRERKEIHNNMKTRGYLLYDTFQKLEGIECQEPQGAMYLFPKLL 446

Query: 500 LPYKAIQEALHQDMSPDEFYCKSLLEKTGICTVPGSGFGQEPGTYHLRTTFLAPGTKWIE 559
           L  KAI+EA    + PDEFYC  LL+ TGICTVPGSGFGQ+ GTYH+RTTFLAPGT+WI+
Sbjct: 447 LSKKAIEEAKSLGLQPDEFYCHRLLDTTGICTVPGSGFGQKEGTYHVRTTFLAPGTQWIK 506

Query: 560 DWVDFHQEFYNKFKN 574
           DW  FH+ FY+K+++
Sbjct: 507 DWETFHKAFYDKYRD 521

>AGR085W Chr7 (887023..888588) [1566 bp, 521 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YLR089C (ALT1) and
           YDR111C (ALT2)
          Length = 521

 Score =  643 bits (1659), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 316/486 (65%), Positives = 377/486 (77%), Gaps = 1/486 (0%)

Query: 89  FLPAEQATLKDVNECVLNAKYAVRGAIPMRAEELKTQLMENPHSLPFNDIINANIGNPQQ 148
           F+PAE  TL DVNE V+ AKYAVRG IP RAEEL+ +L E+P SLPF+ II ANIGNPQQ
Sbjct: 37  FVPAEPMTLADVNENVVKAKYAVRGKIPTRAEELERRLEEHPGSLPFSKIIQANIGNPQQ 96

Query: 149 LKQKPLSFYRQVLSLLQYPELIPTLENNPQTMIKQDAIDRAKRLLDDIGGSVGAYSSSQG 208
           L QKPL+FYRQV+SL+Q P+L+       Q   K D + RA+R+L D GGSVGAYS+SQG
Sbjct: 97  LGQKPLTFYRQVISLMQNPQLLEMPAEWLQQAFKADVVVRARRMLQDAGGSVGAYSASQG 156

Query: 209 VLGIRKTVADFITNRDDGIIAYPEDIFLTAGASSAVDYLLSIFCRGEETGVLIPIPQYPL 268
           V G R+TVA FI  RD GI A P++++LTAGASSAV  LLS FC+G ETGVLIPIPQYPL
Sbjct: 157 VKGYRRTVAQFIERRD-GIPANPDNVYLTAGASSAVSCLLSTFCKGPETGVLIPIPQYPL 215

Query: 269 YTATLALQNSHALPYYLNEETGWSTDPXXXXXXXXXXXXNNIKPSVLVVINPGNPTGAVL 328
           YTAT+   N+ ALPYYLNE  GWST+P             NI P  LVVINPGNPTG+VL
Sbjct: 216 YTATITQNNAVALPYYLNEADGWSTNPDEMERVILDSKKRNIAPKCLVVINPGNPTGSVL 275

Query: 329 SEEAIEQIFTLAAKYGIIVIADEVYQENVFEDVKFHSMKKVLRQLQMKQPGLYDNVQLAS 388
           S + +E I TLAAKYGI+VIADEVYQ+NVF D KFHSM+KVL+ LQ+++P LY NVQLAS
Sbjct: 276 SVKDMEAILTLAAKYGIVVIADEVYQDNVFGDAKFHSMRKVLKNLQLREPTLYKNVQLAS 335

Query: 389 LHSTSKGVSGECGQRGGYMELVGFTHDIRQVVLKLASISLCPVVTGQALVDLMVCPPQKG 448
           LHS SKG+SGECGQRGGYMEL+GF  ++R+V +KLASISLCPVVTGQALVDLMV PP +G
Sbjct: 336 LHSISKGLSGECGQRGGYMELIGFREELRKVFVKLASISLCPVVTGQALVDLMVGPPSQG 395

Query: 449 EESYEQDQEERRNIHKELHKRATLLHDAFVKLDGISCQKPQGAMYLFPKLELPYKAIQEA 508
           + SYEQ  +E R+I+ EL +R+ LL   F  L+GI C  PQGA+YLFPKL LP KAI+ A
Sbjct: 396 DPSYEQYTQETRSIYHELEERSQLLWKTFCSLEGIECNMPQGALYLFPKLHLPQKAIEAA 455

Query: 509 LHQDMSPDEFYCKSLLEKTGICTVPGSGFGQEPGTYHLRTTFLAPGTKWIEDWVDFHQEF 568
               +  DE YC  LL++TGICTVPG+GFGQ PGTYH+RTTFL PGTKWIE W DFH++F
Sbjct: 456 QKLGIPADELYCSELLDETGICTVPGTGFGQIPGTYHVRTTFLPPGTKWIESWKDFHKKF 515

Query: 569 YNKFKN 574
           Y+K+++
Sbjct: 516 YDKYRD 521

>Kpol_543.39 s543 complement(86358..87836) [1479 bp, 492 aa] {ON}
           complement(86358..87836) [1479 nt, 493 aa]
          Length = 492

 Score =  639 bits (1648), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 305/495 (61%), Positives = 378/495 (76%), Gaps = 13/495 (2%)

Query: 87  LPFLPAEQATLKDVNECVLNAKYAVRGAIPMRAEELKTQLMENPHSLPFNDIINANIGNP 146
           + F+PAE+ ++ D+N+  ++A YAVRG+IPMRAE+L  Q++ +P SLPF+ II ANIGNP
Sbjct: 1   MSFVPAEKLSVNDLNQHAVHADYAVRGSIPMRAEQLHAQIINDPGSLPFDKIITANIGNP 60

Query: 147 QQLKQKPLSFYRQVLSLLQYPELIPTLENNPQTMIK--------QDAIDRAKRLLDDIGG 198
           QQ+ QKPL+F RQVLS+L+YP ++    N+P+ + K        +D I+RA+++LD IGG
Sbjct: 61  QQVGQKPLTFIRQVLSILEYPNIL----NDPELLEKLVQLGVYQRDVIERARKMLDSIGG 116

Query: 199 SVGAYSSSQGVLGIRKTVADFITNRDD-GIIAYPEDIFLTAGASSAVDYLLSIFCRGEET 257
           SVGAYS+SQGVLG R+TVADFI  RD    +A P DIFLT GASSAV YLLSI C G E 
Sbjct: 117 SVGAYSASQGVLGFRQTVADFINKRDGCKQLASPNDIFLTGGASSAVHYLLSILCSGPEF 176

Query: 258 GVLIPIPQYPLYTATLALQNSHALPYYLNEETGWSTDPXXXXXXXXXXXXNNIKPSVLVV 317
           GVLIPIPQYPLYTATL L NS A+PYYL E T WST+             N +KP  +V+
Sbjct: 177 GVLIPIPQYPLYTATLTLSNSTAIPYYLKEHTSWSTNTKEIEINIKESMANGVKPVAIVI 236

Query: 318 INPGNPTGAVLSEEAIEQIFTLAAKYGIIVIADEVYQENVFEDVKFHSMKKVLRQLQMKQ 377
           INPGNPTGA+LSE  +  I  ++AKYGI +IADEVYQEN+F   +FHSM+KVL  LQ + 
Sbjct: 237 INPGNPTGAILSESDLADIIRISAKYGIAIIADEVYQENIFPGFEFHSMRKVLLNLQSEF 296

Query: 378 PGLYDNVQLASLHSTSKGVSGECGQRGGYMELVGFTHDIRQVVLKLASISLCPVVTGQAL 437
           PG YDNVQLASLHSTSKG  GECGQRGGYMEL+GF  ++  +VLKLASIS+C VVTGQAL
Sbjct: 297 PGTYDNVQLASLHSTSKGFIGECGQRGGYMELIGFKDEVIAIVLKLASISICSVVTGQAL 356

Query: 438 VDLMVCPPQKGEESYEQDQEERRNIHKELHKRATLLHDAFVKLDGISCQKPQGAMYLFPK 497
           +DL+ CPPQ G+ SY+ DQEER  I ++L  RA  L+  F  L+G+ CQ+PQGAMYLFPK
Sbjct: 357 MDLVTCPPQPGDASYKLDQEERNKIKQDLMFRADRLYGLFTSLEGVECQRPQGAMYLFPK 416

Query: 498 LELPYKAIQEALHQDMSPDEFYCKSLLEKTGICTVPGSGFGQEPGTYHLRTTFLAPGTKW 557
           L LP KAI++AL  ++ PDE+YC+ LL+ TGICTVPGSGFGQ+PGTYHLRTTFL PGT+W
Sbjct: 417 LILPDKAIEKALQLEIPPDEYYCRELLDATGICTVPGSGFGQDPGTYHLRTTFLVPGTEW 476

Query: 558 IEDWVDFHQEFYNKF 572
           IE W +FHQ+FY +F
Sbjct: 477 IERWREFHQQFYERF 491

>TBLA0E04440 Chr5 complement(1138820..1140508) [1689 bp, 562 aa]
           {ON} Anc_8.263 YDR111C
          Length = 562

 Score =  635 bits (1637), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 301/487 (61%), Positives = 382/487 (78%), Gaps = 10/487 (2%)

Query: 92  AEQATLKDVNECVLNAKYAVRGAIPMRAEELKTQLMENPHSLPFNDIINANIGNPQQLKQ 151
           AE+   +D+N  V+ AKYAVRGAIP  A++LK QL+++P +LPF  +IN+NIGNPQQL Q
Sbjct: 81  AERLEPEDLNPNVVKAKYAVRGAIPSYADKLKIQLLKHPGTLPFESVINSNIGNPQQLGQ 140

Query: 152 KPLSFYRQVLSLLQYPELIPTLENNPQTMIKQ-----DAIDRAKRLLDDIGGSVGAYSSS 206
           KPLSF RQVLS+L+YP L+    ++ +T++       D+I+RAK LL DIG S+GAYS+S
Sbjct: 141 KPLSFGRQVLSILEYPALL----DHERTLVDSMGYAPDSIERAKTLLTDIG-SIGAYSNS 195

Query: 207 QGVLGIRKTVADFITNRDDGIIAYPEDIFLTAGASSAVDYLLSIFCRGEETGVLIPIPQY 266
           QGV GIR+TVADFITNRDDG +AYP+DIFLTAGASSAV  +LSI C+G++TGVLIPIPQY
Sbjct: 196 QGVHGIRQTVADFITNRDDGEVAYPDDIFLTAGASSAVSTILSILCKGQQTGVLIPIPQY 255

Query: 267 PLYTATLALQNSHALPYYLNEETGWSTDPXXXXXXXXXXXXNNIKPSVLVVINPGNPTGA 326
           PLYTATL L ++ ALPYYL+E  GWSTD               IKP+ LVVINPGNPTG+
Sbjct: 256 PLYTATLTLNDATALPYYLDESNGWSTDINEISKVAQDSLEAGIKPTCLVVINPGNPTGS 315

Query: 327 VLSEEAIEQIFTLAAKYGIIVIADEVYQENVFEDVKFHSMKKVLRQLQMKQPGLYDNVQL 386
           VL+ EAI+ +F +AAKYG++VIADEVYQ+N+F   +FHSMKK+LR LQ + P  YDN+QL
Sbjct: 316 VLTVEAIKNVFDVAAKYGLVVIADEVYQDNIFPGSEFHSMKKILRILQKEVPNKYDNIQL 375

Query: 387 ASLHSTSKGVSGECGQRGGYMELVGFTHDIRQVVLKLASISLCPVVTGQALVDLMVCPPQ 446
           ASLHS SKG+ GECG RGGY E +GFT +++QV+ KL+SISLC  V GQALVDLM CPP+
Sbjct: 376 ASLHSCSKGLLGECGHRGGYCEFIGFTPEVKQVITKLSSISLCSSVIGQALVDLMCCPPK 435

Query: 447 KGEESYEQDQEERRNIHKELHKRATLLHDAFVKLDGISCQKPQGAMYLFPKLELPYKAIQ 506
           KGE SYE DQ ER+ I     KR+  L++ F  L+G++CQKPQGAMY+FP ++LP+ AI+
Sbjct: 436 KGEPSYELDQHERQTIRTNHKKRSNKLYEMFNSLEGVTCQKPQGAMYMFPNIQLPFNAIK 495

Query: 507 EALHQDMSPDEFYCKSLLEKTGICTVPGSGFGQEPGTYHLRTTFLAPGTKWIEDWVDFHQ 566
            A + D++PDEFYC+ LL+ TGICTVPGSGFGQ+PGTYH+RTTFLAPG +W++ W  FH 
Sbjct: 496 MAQNLDITPDEFYCRELLKATGICTVPGSGFGQQPGTYHVRTTFLAPGVEWMKRWEKFHI 555

Query: 567 EFYNKFK 573
           EF+ K++
Sbjct: 556 EFFEKYR 562

>KAFR0B05520 Chr2 (1130297..1131829) [1533 bp, 510 aa] {ON}
           Anc_8.263 YDR111C
          Length = 510

 Score =  627 bits (1616), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 304/492 (61%), Positives = 376/492 (76%), Gaps = 4/492 (0%)

Query: 85  NNLPFLPAEQATLKDVNECVLNAKYAVRGAIPMRAEELKTQLMEN--PHSLPFNDIINAN 142
           N   F PA + ++ D+N+ ++NA+YAVRG+I MRAEEL+ +L     PHS PF  II AN
Sbjct: 20  NTHDFEPAPKISVADLNQKIINAEYAVRGSIAMRAEELEFELYHKTQPHSFPFERIIYAN 79

Query: 143 IGNPQQLKQKPLSFYRQVLSLLQYPELIPTLENN-PQTMIKQDAIDRAKRLLDDIGGSVG 201
           IGNPQQL QKPL+F RQV+S+L+YP L+   +    Q + K+DA++RA+ L   IG SVG
Sbjct: 80  IGNPQQLDQKPLTFSRQVMSILEYPGLLKFKDVLLSQGIYKKDALERAELLQSQIGASVG 139

Query: 202 AYSSSQGVLGIRKTVADFITNRDDGIIAYPEDIFLTAGASSAVDYLLSIFCRGEETGVLI 261
           AYS +QGV GIR+T A FI+ RD+   A  +DIFLT GAS AV YL+   C+ E TG+LI
Sbjct: 140 AYSLAQGVYGIRETTARFISKRDNCEAASADDIFLTDGASKAVTYLMMALCQNEHTGILI 199

Query: 262 PIPQYPLYTATLALQNSHALPYYLNEETGWSTDPXXXXXXXXXXXXNNIKPSVLVVINPG 321
           PIPQYPLYTA++ + N+  LPYYL+EE+GWST              N IKPS +VVINPG
Sbjct: 200 PIPQYPLYTASICIHNAKMLPYYLDEESGWSTKVEEIENSVINAIENGIKPSAMVVINPG 259

Query: 322 NPTGAVLSEEAIEQIFTLAAKYGIIVIADEVYQENVFEDVKFHSMKKVLRQLQMKQPGLY 381
           NPTGAVLS + I++I T+AAKYGI++IADEVYQ+N+F + +FHSMKK+LRQLQ K PG Y
Sbjct: 260 NPTGAVLSVDVIQRIITVAAKYGIVLIADEVYQDNIF-NGEFHSMKKILRQLQKKYPGKY 318

Query: 382 DNVQLASLHSTSKGVSGECGQRGGYMELVGFTHDIRQVVLKLASISLCPVVTGQALVDLM 441
           DNVQLASLHSTSKGVSGECGQRGGYME+VGF+ ++R ++LKLASI++C VVTGQALVDLM
Sbjct: 319 DNVQLASLHSTSKGVSGECGQRGGYMEIVGFSDEVRHLLLKLASINICSVVTGQALVDLM 378

Query: 442 VCPPQKGEESYEQDQEERRNIHKELHKRATLLHDAFVKLDGISCQKPQGAMYLFPKLELP 501
           V PP  G+ESYE+DQEER  IH  L KRA  L+D F  L+GI CQKPQGAMYLFP+L LP
Sbjct: 379 VDPPHVGDESYEKDQEERNEIHSTLKKRADKLYDTFSNLEGIECQKPQGAMYLFPRLILP 438

Query: 502 YKAIQEALHQDMSPDEFYCKSLLEKTGICTVPGSGFGQEPGTYHLRTTFLAPGTKWIEDW 561
            +AI+EA    M  DEFYC  LLE TGICTVPGSGFGQ  GTYH+RTTFL+PGT+WI+DW
Sbjct: 439 DRAIEEAKKLQMEADEFYCHKLLENTGICTVPGSGFGQREGTYHVRTTFLSPGTEWIDDW 498

Query: 562 VDFHQEFYNKFK 573
             FH++F  +++
Sbjct: 499 KKFHEKFMKEYQ 510

>NDAI0J01360 Chr10 (313791..315296) [1506 bp, 501 aa] {ON} Anc_8.263
          Length = 501

 Score =  622 bits (1604), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 294/488 (60%), Positives = 374/488 (76%), Gaps = 4/488 (0%)

Query: 89  FLPAEQATLKDVNECVLNAKYAVRGAIPMRAEELKTQLMENPHSLPFNDIINANIGNPQQ 148
           F PA + ++KD+N  V+ A++AVRG IPM+A+EL+TQL +NPHSLPFN+I  ANIGNPQ+
Sbjct: 13  FEPAPKLSIKDLNPNVIKAEFAVRGTIPMKAQELQTQLNKNPHSLPFNEITVANIGNPQE 72

Query: 149 LKQKPLSFYRQVLSLLQYPELIP---TLENNPQTMIKQDAIDRAKRLLDDIGGSVGAYSS 205
           L QKPL+F RQV+S+LQYPEL+     L +    +   D+ DRA++LL++IGGSVGAYS+
Sbjct: 73  LHQKPLTFARQVVSILQYPELLNRRNELTSTTPPIYNNDSFDRAEKLLNEIGGSVGAYSA 132

Query: 206 SQGVLGIRKTVADFITNRDDGIIAYPEDIFLTAGASSAVDYLLSIFCRGEETGVLIPIPQ 265
           SQGV GIRKT+A++IT RD G  A P DIF+T GA++A  YLLSI   G +TGVL+PIPQ
Sbjct: 133 SQGVYGIRKTIANYITQRDLGESASPNDIFMTTGATAASSYLLSILSNGPQTGVLLPIPQ 192

Query: 266 YPLYTATLALQNSHALPYYLNEETGWSTDPXXXXXX-XXXXXXNNIKPSVLVVINPGNPT 324
           YPLYTA LAL N+  LPYYL EE+GWS D                I+P V+V+INPGNPT
Sbjct: 193 YPLYTALLALHNATMLPYYLEEESGWSIDTNEIEKTIKKNAMTKGIQPKVMVIINPGNPT 252

Query: 325 GAVLSEEAIEQIFTLAAKYGIIVIADEVYQENVFEDVKFHSMKKVLRQLQMKQPGLYDNV 384
           G++LSE+++ +IF +AAKYGI++IADEVYQEN+F   KFHS KKVLR LQ + P  Y+NV
Sbjct: 253 GSILSEDSLIKIFNIAAKYGIVIIADEVYQENLFNGNKFHSCKKVLRSLQKQFPTQYNNV 312

Query: 385 QLASLHSTSKGVSGECGQRGGYMELVGFTHDIRQVVLKLASISLCPVVTGQALVDLMVCP 444
           QLASLHSTSKG+ GECGQRGGYME++GF +D+R ++LKLA I +CPVVTGQA++DLM+ P
Sbjct: 313 QLASLHSTSKGLFGECGQRGGYMEIIGFNNDVRNLILKLACIDVCPVVTGQAMMDLMILP 372

Query: 445 PQKGEESYEQDQEERRNIHKELHKRATLLHDAFVKLDGISCQKPQGAMYLFPKLELPYKA 504
           P++G++SY+ D  ER+ IH ++  RA  L+D F  ++GI CQKPQGAMYLFP+L L  K 
Sbjct: 373 PKQGDQSYQLDCIERQQIHNDMLNRAKKLYDMFSHMEGIQCQKPQGAMYLFPRLLLSTKV 432

Query: 505 IQEALHQDMSPDEFYCKSLLEKTGICTVPGSGFGQEPGTYHLRTTFLAPGTKWIEDWVDF 564
           I EA   +M PDEFYC  LL +TGICTVPGSGFGQ+P TYHLRTTFLAPG +WI  W  F
Sbjct: 433 IDEAKKFEMEPDEFYCHELLNETGICTVPGSGFGQKPNTYHLRTTFLAPGDQWINKWEKF 492

Query: 565 HQEFYNKF 572
           H+ F  ++
Sbjct: 493 HKAFLKRY 500

>TPHA0A01800 Chr1 (364262..365758) [1497 bp, 498 aa] {ON} Anc_8.263
           YDR111C
          Length = 498

 Score =  613 bits (1582), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 294/491 (59%), Positives = 364/491 (74%), Gaps = 6/491 (1%)

Query: 89  FLPAEQATLKDVNECVLNAKYAVRGAIPMRAEELKTQLMENPHSLPFNDIINANIGNPQQ 148
           F P  + TLKD+N  ++  +YAVRG IP RAEELK QL ++P SLPFN IINANIGNPQQ
Sbjct: 9   FTPVAKVTLKDLNSKIIKTQYAVRGPIPARAEELKLQLEKDPKSLPFNKIINANIGNPQQ 68

Query: 149 LKQKPLSFYRQVLSLLQYPELIPTLENNPQTMI-----KQDAIDRAKRLLDDIGGSVGAY 203
           L QKPLSF R+VLS+LQYP+++   E+  QT+I     ++D + RA++LL +IGGSVGAY
Sbjct: 69  LGQKPLSFIRKVLSILQYPDILED-ESKLQTLIELRVYQKDVVRRARKLLGEIGGSVGAY 127

Query: 204 SSSQGVLGIRKTVADFITNRDDGIIAYPEDIFLTAGASSAVDYLLSIFCRGEETGVLIPI 263
           S SQGV GI++TVAD+IT RD G +AYPEDIFLT GASSAV ++L +FC G  TGVLIPI
Sbjct: 128 SLSQGVPGIQQTVADYITKRDSGEVAYPEDIFLTTGASSAVSFILPMFCNGPTTGVLIPI 187

Query: 264 PQYPLYTATLALQNSHALPYYLNEETGWSTDPXXXXXXXXXXXXNNIKPSVLVVINPGNP 323
           PQYPLYTAT+ L  + A+ YYLNEE  WS +             + IKP+ +V+INPGNP
Sbjct: 188 PQYPLYTATITLVGATAISYYLNEEDNWSVNTVEMENTIQESIKSGIKPTTIVIINPGNP 247

Query: 324 TGAVLSEEAIEQIFTLAAKYGIIVIADEVYQENVFEDVKFHSMKKVLRQLQMKQPGLYDN 383
           TG++L+E+ I  I  ++AKYG+++IADEVYQENVF   +FHS+KKVLR+LQ K  G Y+ 
Sbjct: 248 TGSILTEKDIANIIRISAKYGLLIIADEVYQENVFSGNEFHSVKKVLRKLQRKYLGFYET 307

Query: 384 VQLASLHSTSKGVSGECGQRGGYMELVGFTHDIRQVVLKLASISLCPVVTGQALVDLMVC 443
           VQLASLHSTSKG+ GECGQRGGYMEL+G T D+R  V+KL SIS+C VVTGQAL+D++V 
Sbjct: 308 VQLASLHSTSKGLIGECGQRGGYMELIGLTDDVRLEVVKLMSISICSVVTGQALIDMVVS 367

Query: 444 PPQKGEESYEQDQEERRNIHKELHKRATLLHDAFVKLDGISCQKPQGAMYLFPKLELPYK 503
           PP+ G+ESYE DQ ER NI  +L  R+  LH  F+ L+G+ C +PQGAMYLFPK   P K
Sbjct: 368 PPRPGDESYEMDQLERNNIKNDLISRSQKLHQLFISLEGVECLRPQGAMYLFPKFIFPQK 427

Query: 504 AIQEALHQDMSPDEFYCKSLLEKTGICTVPGSGFGQEPGTYHLRTTFLAPGTKWIEDWVD 563
            I  A       D  YCK LLE TGICTVPGSGFGQ+P TYHLRTTFL PG  WI+ W  
Sbjct: 428 FIDIAQKLHTEADTLYCKELLEHTGICTVPGSGFGQKPNTYHLRTTFLVPGDSWIDLWRK 487

Query: 564 FHQEFYNKFKN 574
           FH EF  ++++
Sbjct: 488 FHTEFCERYRS 498

>TBLA0F03060 Chr6 (743646..745148) [1503 bp, 500 aa] {ON} Anc_8.263
           YDR111C
          Length = 500

 Score =  610 bits (1573), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 301/499 (60%), Positives = 368/499 (73%), Gaps = 8/499 (1%)

Query: 83  SHNNLPFLPAEQATLKDVNECVLNAKYAVRGAIPMRAEELKTQLMENPHSLPFNDIINAN 142
           + N   FLPA + +L D+NE +L A+YA+RG IP RAEEL  QL+EN  SLPF  I+ AN
Sbjct: 2   TMNQKTFLPAPKFSLNDINESILKAEYAIRGTIPNRAEELDIQLLENSKSLPFAKIVYAN 61

Query: 143 IGNPQQLKQKPLSFYRQVLSLLQYPELIPTLENN-PQTMIKQDAIDRAKRLLDDIGGSVG 201
           IGNPQQL Q+PL+F RQV+SL+Q+P+L+ + +    Q +  +D+I+RA +LL+ IGGSVG
Sbjct: 62  IGNPQQLDQQPLTFQRQVMSLVQFPDLLKSKDILLAQKIYSKDSIERATKLLNSIGGSVG 121

Query: 202 AYSSSQGVLGIRKTVADFITNRD-------DGIIAYPEDIFLTAGASSAVDYLLSIFCRG 254
           AYSSSQGVL IRK VA FI  RD       D I     ++FLTAGAS+AVD++L +F + 
Sbjct: 122 AYSSSQGVLDIRKNVARFILKRDLHHDPTQDLIDETASNVFLTAGASTAVDHILPLFAKD 181

Query: 255 EETGVLIPIPQYPLYTATLALQNSHALPYYLNEETGWSTDPXXXXXXXXXXXXNNIKPSV 314
           E  GVL+PIPQYPLYTA + LQ S  LPYYLNE   WSTDP             NIKP+ 
Sbjct: 182 ESCGVLLPIPQYPLYTAAVTLQKSKLLPYYLNESNNWSTDPKQIEQIVIDAIKQNIKPTT 241

Query: 315 LVVINPGNPTGAVLSEEAIEQIFTLAAKYGIIVIADEVYQENVFEDVKFHSMKKVLRQLQ 374
           LVVINPGNPTGA+L++++I  I  +AA+YGI++IADEVYQENV+E  +FHS KKVL +L+
Sbjct: 242 LVVINPGNPTGAILTKDSIIDIIDIAAEYGIVIIADEVYQENVYEAFEFHSFKKVLSELR 301

Query: 375 MKQPGLYDNVQLASLHSTSKGVSGECGQRGGYMELVGFTHDIRQVVLKLASISLCPVVTG 434
              P  YDNVQLASLHS SKGV+GECGQRGGYME+ GF++D+++V+LK+ASIS+C VVTG
Sbjct: 302 KNYPSKYDNVQLASLHSISKGVNGECGQRGGYMEITGFSNDVKKVLLKVASISICSVVTG 361

Query: 435 QALVDLMVCPPQKGEESYEQDQEERRNIHKELHKRATLLHDAFVKLDGISCQKPQGAMYL 494
           Q LVDLMV PPQ G+ESYE DQ ER  IH  L  ++  L+D F +L GISCQKPQGAMYL
Sbjct: 362 QILVDLMVNPPQPGDESYELDQLERSVIHSNLILKSNTLYDVFTRLPGISCQKPQGAMYL 421

Query: 495 FPKLELPYKAIQEALHQDMSPDEFYCKSLLEKTGICTVPGSGFGQEPGTYHLRTTFLAPG 554
           FP+L L   AI  A   ++ PDEFYC  LLE TGICTVPGSGFGQ PGTYHLRTTFL PG
Sbjct: 422 FPRLHLSENAINAATELNLKPDEFYCLKLLENTGICTVPGSGFGQYPGTYHLRTTFLPPG 481

Query: 555 TKWIEDWVDFHQEFYNKFK 573
            +WI  W  FH EF  K+K
Sbjct: 482 IEWINSWEKFHLEFMEKYK 500

>Ecym_4307 Chr4 (652209..653813) [1605 bp, 534 aa] {ON} similar to
           Ashbya gossypii AGR085W
          Length = 534

 Score =  608 bits (1568), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 294/486 (60%), Positives = 362/486 (74%), Gaps = 1/486 (0%)

Query: 89  FLPAEQATLKDVNECVLNAKYAVRGAIPMRAEELKTQLMENPHSLPFNDIINANIGNPQQ 148
           F P +   L+D+N  VL AKYAVRG IP RA EL+ QL  +P SLPF  II ANIGNPQQ
Sbjct: 50  FEPGDPLKLEDLNSNVLEAKYAVRGKIPARAMELERQLSRDPDSLPFKKIIYANIGNPQQ 109

Query: 149 LKQKPLSFYRQVLSLLQYPELIPTLENNPQTMIKQDAIDRAKRLLDDIGGSVGAYSSSQG 208
           L QKPLSF R+VLSLL+ P L+         + K DA+ RAKR++ D+  S+GAYS SQG
Sbjct: 110 LGQKPLSFSREVLSLLESPNLLQMPMEVLNLIYKPDAVRRAKRMMRDLQTSIGAYSHSQG 169

Query: 209 VLGIRKTVADFITNRDDGIIAYPEDIFLTAGASSAVDYLLSIFCRGEETGVLIPIPQYPL 268
           VLG RKTVA+++++RD G  A  EDIFLT GAS+    ++ + C+G+E+GVLIPIPQYPL
Sbjct: 170 VLGFRKTVAEYLSSRD-GEPASAEDIFLTTGASNGASLMIELLCKGQESGVLIPIPQYPL 228

Query: 269 YTATLALQNSHALPYYLNEETGWSTDPXXXXXXXXXXXXNNIKPSVLVVINPGNPTGAVL 328
           YTAT+ L N+ ALPYYL+EE+GWS +               +KP+ LVVINPGNPTGA+L
Sbjct: 229 YTATITLNNTVALPYYLDEESGWSLNIDDLERIIIESIEKGVKPACLVVINPGNPTGAIL 288

Query: 329 SEEAIEQIFTLAAKYGIIVIADEVYQENVFEDVKFHSMKKVLRQLQMKQPGLYDNVQLAS 388
             E++E+IF +AAKY I+VIADEVYQENVFE +KF+SMKKVLR LQ +   L+ NVQL S
Sbjct: 289 PVESMERIFVIAAKYSIVVIADEVYQENVFEGLKFYSMKKVLRSLQRRYKELFSNVQLVS 348

Query: 389 LHSTSKGVSGECGQRGGYMELVGFTHDIRQVVLKLASISLCPVVTGQALVDLMVCPPQKG 448
           LHSTSKG+SGECGQRGGYMELVGF+ DIR+V+LK+ASI LC  V GQALVDLM+  P+ G
Sbjct: 349 LHSTSKGLSGECGQRGGYMELVGFSDDIREVILKMASIQLCSPVGGQALVDLMLSRPKPG 408

Query: 449 EESYEQDQEERRNIHKELHKRATLLHDAFVKLDGISCQKPQGAMYLFPKLELPYKAIQEA 508
           +ESYE+D  ER +I   L +R+  L + F  L+G+ C+KPQG+MYLFP+L LP KAI+ A
Sbjct: 409 DESYERDLSERSSIRNALQERSKSLWETFNNLEGVECRKPQGSMYLFPRLVLPQKAIKAA 468

Query: 509 LHQDMSPDEFYCKSLLEKTGICTVPGSGFGQEPGTYHLRTTFLAPGTKWIEDWVDFHQEF 568
              DM PDEFYC  LL  TGICTVPGSGFGQ P T HLRTTFL PGT+WIE W  FH+ F
Sbjct: 469 ESLDMQPDEFYCTELLNSTGICTVPGSGFGQAPDTCHLRTTFLCPGTEWIESWELFHKSF 528

Query: 569 YNKFKN 574
           Y+K+++
Sbjct: 529 YDKYRD 534

>TBLA0G01630 Chr7 (428016..429518) [1503 bp, 500 aa] {ON} 
          Length = 500

 Score =  590 bits (1521), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 285/497 (57%), Positives = 361/497 (72%), Gaps = 18/497 (3%)

Query: 91  PAEQATLKDVNECVLNAKYAVRGAIPMRAEELKTQLMENPHSLPFNDIINANIGNPQQLK 150
           PA + +L D+++ +L+ +YA+RG IP RA+EL+ QL  +P+ LPF  II ANIGNPQQL+
Sbjct: 8   PAPKFSLNDISQSILDTEYAIRGTIPTRADELQEQLNISPNQLPFKKIIYANIGNPQQLE 67

Query: 151 QKPLSFYRQVLSLLQYPELIPTLENNPQTMIKQ-----DAIDRAKRLLDDIGGSVGAYSS 205
           Q+PL+F RQVLSL++YP L+    N+   +++      DAI RA+ +L+ IGGSVGAYSS
Sbjct: 68  QEPLTFQRQVLSLVEYPNLV----NSKNILVENKIYAPDAIKRAETILNSIGGSVGAYSS 123

Query: 206 SQGVLGIRKTVADFITNRDDG---------IIAYPEDIFLTAGASSAVDYLLSIFCRGEE 256
           SQG+L IRK VA  I  RD+          I     +IFLT GA++AV Y+L +F + E 
Sbjct: 124 SQGILSIRKNVAKCILQRDNDELCCNDEELINETASNIFLTDGATTAVSYILPLFAKDEN 183

Query: 257 TGVLIPIPQYPLYTATLALQNSHALPYYLNEETGWSTDPXXXXXXXXXXXXNNIKPSVLV 316
            GVL+PIPQYPLYTA + LQNS  LPYYLNE+  WSTDP             NIKP+ LV
Sbjct: 184 CGVLLPIPQYPLYTAAVTLQNSKLLPYYLNEDENWSTDPEEIETIIKDAISRNIKPTTLV 243

Query: 317 VINPGNPTGAVLSEEAIEQIFTLAAKYGIIVIADEVYQENVFEDVKFHSMKKVLRQLQMK 376
           +INPGNPTGA+LS E+I QI  +AAKYGI++IADEVYQ N+++D KFHS KK+L  L+++
Sbjct: 244 IINPGNPTGAILSVESITQIINIAAKYGIVIIADEVYQNNIYQDFKFHSFKKILNSLKLQ 303

Query: 377 QPGLYDNVQLASLHSTSKGVSGECGQRGGYMELVGFTHDIRQVVLKLASISLCPVVTGQA 436
            P  YDNVQLASLHS SKGV+GECGQRGGY EL+GF+ +I++++LKLASI +C VVTGQ 
Sbjct: 304 YPKKYDNVQLASLHSISKGVNGECGQRGGYFELLGFSDEIKKIILKLASIDICSVVTGQI 363

Query: 437 LVDLMVCPPQKGEESYEQDQEERRNIHKELHKRATLLHDAFVKLDGISCQKPQGAMYLFP 496
           LVDLM  PP+KG+ SY+ DQ ER NI   L  ++  L+D F +L GISCQKPQGAMYLFP
Sbjct: 364 LVDLMSKPPEKGDYSYKLDQRERNNIQSNLILKSNTLYDLFSRLPGISCQKPQGAMYLFP 423

Query: 497 KLELPYKAIQEALHQDMSPDEFYCKSLLEKTGICTVPGSGFGQEPGTYHLRTTFLAPGTK 556
           +L L    I EA   ++ PDEFYC  LLE TGICTVPGSGFGQ+ GTYH+RTTFL  G +
Sbjct: 424 RLHLTSNMINEAKLNNLEPDEFYCLKLLENTGICTVPGSGFGQKEGTYHVRTTFLPSGIE 483

Query: 557 WIEDWVDFHQEFYNKFK 573
           WI+ W  FH EF N++K
Sbjct: 484 WIKLWEKFHLEFMNQYK 500

>Kwal_34.16018 s34 (159210..160349) [1140 bp, 379 aa] {ON} YJL060W
           (BNA3) - YJL060W [contig 272] FULL
          Length = 379

 Score = 53.9 bits (128), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 47/180 (26%), Positives = 80/180 (44%), Gaps = 19/180 (10%)

Query: 203 YSSSQGVLGIRKTVADFITNRDDGIIAYPEDIFLTAGASSAVDYLLSIFCRGEETGVLIP 262
           Y + QG   +RK +A+  +N D  +    E++ LT GA +A ++L      G+    +  
Sbjct: 55  YGAIQGSHALRKLIAEMYSNED--VTLSEENVILTNGAIAA-NFLTHYTLAGKGDHFICI 111

Query: 263 IPQYPLYTATLALQNSHALPYYLNEETGWSTDPXXXXXXXXXXXXNNIKPSV--LVVINP 320
            P Y   ++   +  +     +L +ET +  +               IKP+   +V+  P
Sbjct: 112 SPTYQQLSSIPQMFGAEVELLHLRKETNYQPNIVELERM--------IKPNTKCIVLNTP 163

Query: 321 GNPTGAVLSEEAIEQIFTLAAKYGIIVIADEVYQENVFEDVKFHSMKKVLRQLQMKQPGL 380
            NP  +V+  E + +I  LA K+GI+V  DEVY         FHS +K     Q+   G+
Sbjct: 164 NNPLSSVIPTETLREIAELADKHGIVVFCDEVYSP------LFHSCEKPKSLCQLSANGI 217

>Kpol_1039.22 s1039 (68736..69896) [1161 bp, 386 aa] {ON}
           (68736..69896) [1161 nt, 387 aa]
          Length = 386

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 47/190 (24%), Positives = 83/190 (43%), Gaps = 19/190 (10%)

Query: 214 KTVADFITNRDD---GIIAYPED-IFLTAGASSAVDYLLSIFCRGEETGVLIPIPQYPLY 269
           KT+     NR D   GI    ED + L  G+   +D L+   CR E   +L   P Y +Y
Sbjct: 63  KTLLAGFRNRLDKTPGIEPLTEDNLCLGVGSDECIDSLIRACCRPEVDKILTLPPTYSMY 122

Query: 270 TATLALQNSHALPY-YLNEETGWSTDPXXXXXXXXXXXXNNIKPSVLVVINPGNPTGAVL 328
           +    + +   +    + E+  +  +             N+ K  +L + +PGNPTG ++
Sbjct: 123 SVCANINDVEIVECPLITEDNSFQMN----VPEVLSTLKNDPKIKLLFITSPGNPTGKLV 178

Query: 329 SEEAIEQIFTLAAKYGIIVIADEVYQENVFEDVKFHSMKKVLRQLQMKQPGLYDNVQLAS 388
           +++ IE  F L      +V+ DE Y +    +   +SM K++ +        Y N+ +  
Sbjct: 179 NKKDIE--FILENWTNGLVVVDEAYIDFADAEGTTYSMAKLVTK--------YPNLTVLQ 228

Query: 389 LHSTSKGVSG 398
             S S G++G
Sbjct: 229 TLSKSFGLAG 238

>SAKL0H21824g Chr8 (1903887..1905386) [1500 bp, 499 aa] {ON} similar
           to uniprot|P53090 Saccharomyces cerevisiae YGL202W ARO8
           Aromatic aminotransferase expression is regulated by
           general control of amino acid biosynthesis
          Length = 499

 Score = 45.1 bits (105), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 48/186 (25%), Positives = 75/186 (40%), Gaps = 18/186 (9%)

Query: 172 TLENNPQTMIKQDAIDRAKRLLDDIGGSVGAYSSSQGVLGIRKTVADFITNRDDGIIAYP 231
           T+  NP+ ++ +D I  A+ L          Y +S+G    +K +  F+        + P
Sbjct: 82  TIMKNPEDLLFRDDIPLARAL---------QYGNSRG----QKELVSFLKEHTSIFHSIP 128

Query: 232 ---EDIFLTAGASSAVDYLLSIFCRGEETGVLIPIPQYPLYTATLALQNSHALPYYLNEE 288
               DI  T G++ A D  L IFC   +T VL+    Y         Q  + +P  ++ +
Sbjct: 129 YNDWDIITTTGSTQAWDASLRIFCNKGDT-VLLEEFTYSSSVEAADAQGLNCIPVPMDNQ 187

Query: 289 TGWSTDPXXXXXXXXXXXXNNIKPSVLVVINPG-NPTGAVLSEEAIEQIFTLAAKYGIIV 347
                                  P +L  I  G NPTG  LSE     I+ LA KY I++
Sbjct: 188 GIIPEKLEEMLSNWTDRYPGIPMPKLLYTIPTGQNPTGCTLSECRKPCIYRLAQKYDILI 247

Query: 348 IADEVY 353
           + D+ Y
Sbjct: 248 VEDDPY 253

>SAKL0F02156g Chr6 (185574..187070) [1497 bp, 498 aa] {ON} highly
           similar to uniprot|P53090 Saccharomyces cerevisiae
           YGL202W ARO8 Aromatic aminotransferase expression is
           regulated by general control of amino acid biosynthesis
          Length = 498

 Score = 45.1 bits (105), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 80/331 (24%), Positives = 134/331 (40%), Gaps = 49/331 (14%)

Query: 233 DIFLTAGASSAVDYLLSIFCRGEETGVLIPIPQYPLYTATLALQNSHALPYYLNEETGWS 292
           D+  TAG ++A +  L +FC   +T +L     +         Q  +  P  L+E   + 
Sbjct: 135 DVLATAGNTNAWESTLRVFCNRGDT-ILAEAYSFSSSLYAAEAQGVNVFPVPLDE---FG 190

Query: 293 TDPXXXXXXXXXXXXNNIKPSVLVVINPG-NPTGAVLSEEAIEQIFTLAAKYGIIVIADE 351
             P               KP +L  I  G NPTG+ LS++   +I+ +A K+  I+I DE
Sbjct: 191 IIPEKLESIMDNWNPETPKPKLLYTIPTGQNPTGSSLSDDRKAKIYRIAQKHNFIIIEDE 250

Query: 352 VY----------QENVFEDVKFHSMKKVLRQLQMKQPGLYDNVQLASLHSTSKGVSGECG 401
            Y            +  E   + S  + ++ L      L  + ++  L S SK ++   G
Sbjct: 251 PYYFLQMEPYVKDASAREKKTYSSHDEFIQSLAKSFISLDTDGRVVRLDSFSKVLA--PG 308

Query: 402 QRGGYMELVGFTHDIRQVVLKLASISL-CPVVTGQALVDLMVCPPQKGEESYEQDQEERR 460
            R G+  +VG +  I +  L+L  +++  P    Q+LV   +   + G++ Y       R
Sbjct: 309 TRLGW--IVG-SKKILEPYLRLHEMTIQAPSGFTQSLVAGTLN--RWGQDGYVDWLIGLR 363

Query: 461 NIHKELHKRATLLHDAFVKLDGISCQKPQGAMYLFPKLELPYKA------IQEALHQDMS 514
             H+  HKR        V +D +    P+G+   F K+  P         I  + H + S
Sbjct: 364 --HEYTHKRD-------VAIDALYKYLPKGS---FIKINPPIAGMFFTINIDSSAHPEFS 411

Query: 515 PD-----EFYCKSLLEKT---GICTVPGSGF 537
                  E   K++ EK    G+  VPG  F
Sbjct: 412 TTYQSNPELVEKAIYEKVVSQGVLVVPGIWF 442

>Ecym_6292 Chr6 (547563..548855) [1293 bp, 430 aa] {ON} similar to
           Ashbya gossypii AEL170C
          Length = 430

 Score = 44.7 bits (104), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 70/323 (21%), Positives = 128/323 (39%), Gaps = 48/323 (14%)

Query: 232 EDIFLTAGASSAV-DYLLSIFCRGEETGVLIPIPQYPLYTATLA--------LQNSHALP 282
           E+I +T GA  A+ + L+++   G+E  V+ P     ++   +A        L N +   
Sbjct: 99  ENILVTTGAIQALLESLMALIKPGDEVIVIEPFFDPYIHLIKIAGGVVKYVPLTNPNQGK 158

Query: 283 YYLNEETGWSTDPXXXXXXXXXXXXNNIKPSVLVVINPGNPTGAVLSEEAIEQIFTLAAK 342
             + E   W  D                K  ++++ NP NP G V + + + ++ TL   
Sbjct: 159 KRILEANDWILDRETLRAAFTD------KTKLMIINNPNNPLGKVFNRDELLEMATLCVN 212

Query: 343 YGIIVIADEVYQENVFEDVKFHSMKKVLRQLQMKQPGLYDNVQLASLHSTSKGVSGECGQ 402
            G  +IADEVY+   F       +  +   +  K           ++ S  K +    G 
Sbjct: 213 NGAYIIADEVYEFLQFTPNPLSRISNLSEAIAQKT---------ITIGSAGK-IFRVTGW 262

Query: 403 RGGYM-----ELVGFTHDIRQVVLKLASISLCPVVTGQALVDLMVCPPQKGEESYEQDQE 457
           R G+M     ELV     +  V +   S S+  V +G  +   + C              
Sbjct: 263 RVGWMISKNRELVEKVTAV-HVRMGFCSPSISQVASGLGIQRALECG------------- 308

Query: 458 ERRNIHKELHKRATLLHDAFVKLDGISCQKPQGAMYL---FPKLELPYKAIQEALHQDMS 514
              ++  E  ++ ++++ A   L G+S  KPQGA ++   F K+++P         ++ +
Sbjct: 309 YFLSMPNEFDRKFSIIYKALDYL-GVSYTKPQGAHFIITDFSKVKIPEDYQFPEYLKNRA 367

Query: 515 PDEFYCKSLLEKTGICTVPGSGF 537
            D F    L ++  I  +P S F
Sbjct: 368 RDFFISYWLTQEFCILLLPCSEF 390

>KLLA0A04906g Chr1 (437523..438965) [1443 bp, 480 aa] {ON} similar
           to uniprot|P53090 Saccharomyces cerevisiae YGL202W ARO8
           Aromatic aminotransferase expression is regulated by
           general control of amino acid biosynthesis
          Length = 480

 Score = 44.7 bits (104), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 35/122 (28%), Positives = 53/122 (43%), Gaps = 3/122 (2%)

Query: 233 DIFLTAGASSAVDYLLSIFCRGEETGVLIPIPQYPLYTATLALQNSHALPYYLNEETGWS 292
           D+  TAG++ A D  L +FC   ET VL+    Y         Q  + +   ++++ G  
Sbjct: 128 DLITTAGSTQAWDACLRLFCNRGET-VLMEEYTYSSSLEAAVAQGLNCVAMKMDKD-GIK 185

Query: 293 TDPXXXXXXXXXXXXNNIKPSVLVVI-NPGNPTGAVLSEEAIEQIFTLAAKYGIIVIADE 351
            D                 P +L  I N  NPTG  L EE   ++  LA++Y  I+I D+
Sbjct: 186 VDKLSEMLRDWDVAVQGPFPKLLYTIPNGHNPTGCTLHEERKPELVRLASQYDFIIIEDD 245

Query: 352 VY 353
            Y
Sbjct: 246 PY 247

>Ecym_3290 Chr3 (546773..547933) [1161 bp, 386 aa] {ON} similar to
           Ashbya gossypii ADL249W
          Length = 386

 Score = 44.3 bits (103), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 34/127 (26%), Positives = 58/127 (45%), Gaps = 8/127 (6%)

Query: 228 IAYPEDIFLTAGASSAVDYLLSIFCRGEETGVLIPIPQYPLYTATLALQNSHALPY-YLN 286
           I+Y ++I L  G+   VD L+   C  +   VL+  P Y +Y+    + ++  +    + 
Sbjct: 85  ISY-KNICLGVGSDEGVDSLIRATCVPKTDKVLVLPPTYSMYSVFAMINDTEVVECPLIT 143

Query: 287 EETGWSTDPXXXXXXXXXXXXNNIKPSVLVVINPGNPTGAVLSEEAIEQIFTLAAKYGII 346
           E+  +  D             N+    +L +  PGNPTGA +S + IE +       GI+
Sbjct: 144 EDNSFDMD----LDNVLETLSNDDSIKLLFITTPGNPTGASISTQKIEMLLN-NWSAGIV 198

Query: 347 VIADEVY 353
           V+ DE Y
Sbjct: 199 VV-DEAY 204

>CAGL0J05126g Chr10 complement(487452..488753) [1302 bp, 433 aa]
           {ON} highly similar to uniprot|P47039 Saccharomyces
           cerevisiae YJL060w
          Length = 433

 Score = 44.3 bits (103), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 83/378 (21%), Positives = 146/378 (38%), Gaps = 64/378 (16%)

Query: 183 QDAIDRAKRLLDDIGGSVGAYSSSQGVLGIRKTV--------ADFITNRDDGIIAYPEDI 234
           Q AI+ AK  LD     V  YS ++G   + K++         DFI N         +++
Sbjct: 59  QFAINAAKSALD--VPLVNQYSPTRGRPSLIKSLVELYKPVFGDFIDN---------QNV 107

Query: 235 FLTAGASSAV-DYLLSIFCRGEETGVLIP-----IPQYPLYTATLALQNSHALPYYLNEE 288
            +T GA+  +   L+ I   G+E  V  P     IP   L    +     H         
Sbjct: 108 LVTTGANEGILSCLMGILNAGDEVIVFEPFFDQYIPNIELCGGVVRYVPIHPPKEMKTRN 167

Query: 289 TGWSTDPXXXXXXXXXXXXNNIKPSVLVVINPGNPTGAVLSEEAIEQIFTLAAKYGIIVI 348
           T  + D             NN K   +++  P NP G V +E+ + ++  L  ++  +VI
Sbjct: 168 T--TGDEWQIDWDALEKTFNN-KTKAVIINTPHNPIGKVFTEQELTKLAQLCVEHNTVVI 224

Query: 349 ADEVYQENVFEDVKFHSMKKVLRQLQMKQPGLYDNVQLASLHSTSKGVSGECGQRGGYME 408
           +DEVY+   F +  F  +  +             N  +A+L  T  G +G+     G+  
Sbjct: 225 SDEVYEHLYFTE-SFPRIANI-------------NEDIANLTLTV-GSAGKSFAATGWR- 268

Query: 409 LVGFTHDIRQVVLKLASISLCPVVTGQALVDLMVCPPQKGEESYEQDQEERRNI------ 462
            +G+       +L   S         +A   +    P   +E+     E    I      
Sbjct: 269 -IGWIISKNDQLLNYVS---------KAHTRICFASPSPLQEACAGSIEHALKIDYFPKM 318

Query: 463 HKELHKRATLLHDAFVKLDGISCQKPQGAMYL---FPKLELPYKAIQEALHQDMSPDEFY 519
            +E  K+  +L  AF KL G++  +P+G  ++   F K+++P   +      + + D   
Sbjct: 319 REEYRKKFEILTTAFDKL-GLNYTQPEGTYFILVDFSKVKIPEDYVYPEELLEKAKDFRI 377

Query: 520 CKSLLEKTGICTVPGSGF 537
              L+ + GI  +P + F
Sbjct: 378 SYWLINEIGIVAIPPTEF 395

>Kpol_1035.23 s1035 complement(56123..57457) [1335 bp, 444 aa] {ON}
           complement(56123..57457) [1335 nt, 445 aa]
          Length = 444

 Score = 44.3 bits (103), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 73/329 (22%), Positives = 130/329 (39%), Gaps = 59/329 (17%)

Query: 231 PEDIFLTAGASSAV-DYLLSIFCRGEETGVLIP-----IPQYPLYTATLA---LQNSHAL 281
           PE++ +T GA+  +   L+ I   G+E  V  P     IP   L    +    +     L
Sbjct: 115 PENVLVTTGANEGILSCLMGIINPGDEVIVFEPFFDQYIPNIELCGGKVVYVPINPPKEL 174

Query: 282 PYYLNEETGWSTDPXXXXXXXXXXXXNNIKPSVLVVI--NPGNPTGAVLSEEAIEQIFTL 339
              + + T W+ D               I P    VI   P NP G V + E + ++  +
Sbjct: 175 DNRVTKGTEWTVD--------FDEFTRAITPKTKAVIINTPHNPIGKVFTREELTKLGNI 226

Query: 340 AAKYGIIVIADEVYQENVFEDV--KFHSMKKVLRQLQMKQPGLYDNVQLASLHSTSKGVS 397
             +  +I+IADEVY+   F D   +  ++ + + QL +            S+ S  K  +
Sbjct: 227 CVENNVIIIADEVYEHLYFVDEFPRIATLSEEIGQLTL------------SVGSAGKSFA 274

Query: 398 GECGQRGGYMELVGFTHDIRQVVLKLASISLCPVVTGQALVDLMVCPPQKGEESYEQDQE 457
              G R G+  +V    D+ Q   K A   +C               P +   SY  D  
Sbjct: 275 A-TGWRIGW--VVSQNPDLLQYASK-AHTRIC----------FASPSPIQEACSYSIDHA 320

Query: 458 ER----RNIHKELHKRATLLHDAFVKLDGISCQKPQGAMYL---FPKLELP--YKAIQEA 508
            +     N+ +E  K+  +    F +L G+    P+G+ ++   F K+++P  Y+  +E 
Sbjct: 321 LKIDYFENMRQEYVKKFKIFTSVFDEL-GLPYTIPEGSYFVLADFSKVKIPDSYQFPEEI 379

Query: 509 LHQDMSPDEFYCKSLLEKTGICTVPGSGF 537
           + +    D      L+ + G+  +P + F
Sbjct: 380 MSK--GKDFRISNWLINELGVVAIPPTEF 406

>KLLA0F10021g Chr6 (926569..928062) [1494 bp, 497 aa] {ON} similar
           to uniprot|P53090 Saccharomyces cerevisiae YGL202W ARO8
           Aromatic aminotransferase expression is regulated by
           general control of amino acid biosynthesis
          Length = 497

 Score = 44.3 bits (103), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 77/326 (23%), Positives = 134/326 (41%), Gaps = 39/326 (11%)

Query: 233 DIFLTAGASSAVDYLLSIFCRGEETGVLIPIPQYPLYTATLAL--QNSHALPYYLNEETG 290
           D+  T G + A + +L IFC   +T   I   Q+   ++  A   Q  +  P  L+E   
Sbjct: 134 DVLATIGNTGAWESVLRIFCNRGDT---ILAEQFAFSSSISAAEAQGVNVFPIPLDEH-- 188

Query: 291 WSTDPXXXXXXXXXXXXNNIKPSVLVVINPG-NPTGAVLSEEAIEQIFTLAAKYGIIVIA 349
               P               KP +L  +  G NPTG+ LS +  E+I+ +A K+  I+I 
Sbjct: 189 -GIIPSKLETILDNWTEGAAKPKLLYTVPTGQNPTGSSLSFDRKEEIYRIAQKHDFIIIE 247

Query: 350 DEVY---QENVFED------VK-FHSMKKVLRQLQMKQPGLYDNVQLASLHSTSKGVSGE 399
           DE Y   Q   +E       VK +   K+ ++ L+     +    ++  L S SK ++  
Sbjct: 248 DEPYYFLQMEKYEKDPANRVVKSYADHKEFIQNLEKSFVSIDTEGRVLRLDSLSKVLA-- 305

Query: 400 CGQRGGYMELVGFTHDIRQVVLKLASISL-CPVVTGQALVDLMVCPPQKGEESYEQDQEE 458
            G R G+  +VG   DI   +L L  +++  P    Q+++   +   + G+E Y    + 
Sbjct: 306 PGTRFGW--IVG-AKDILARILSLQEMTIQAPAGFTQSIIAGTMN--RWGQEGY---LDW 357

Query: 459 RRNIHKELHKRATLLHDAFVK----LDGISCQKPQGAMYLFPKLEL---PYKAIQEALHQ 511
              +  E  K+     DA  K    +D I    P   M+    ++    P  A +     
Sbjct: 358 LIGLRHEYTKKRDCCIDALYKYLPQVDYIKINPPIAGMFFTVNIDASKHPEFATKYGSDP 417

Query: 512 DMSPDEFYCKSLLEKTGICTVPGSGF 537
           +      + +S+   +G+  VPG+ F
Sbjct: 418 EKVEKAIFDRSI--ASGVLVVPGNWF 441

>ADL249W Chr4 (261227..262390) [1164 bp, 387 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YIL116W (HIS5)
          Length = 387

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 64/250 (25%), Positives = 101/250 (40%), Gaps = 38/250 (15%)

Query: 232 EDIFLTAGASSAVDYLLSIFCRGEETGVLIPIPQYPLYTATLALQNSHALPYYLNEETGW 291
           ++I L  G+  ++D ++   C   E  V++  P Y +Y     + +   +   L      
Sbjct: 88  KNICLGVGSDESIDAIIRATCSPREQKVMLLPPTYGMYKVCADINDVGYVEVPL-----I 142

Query: 292 STDPXXXXXXXXXXXXNNIKPSVLVVI--NPGNPTGAVLSEEAIEQIFTLAAKYGIIVIA 349
           S+D              N+  S+ VV   +PGNPTGA +    +E++  L      IV+ 
Sbjct: 143 SSDNSFQIDEDRILEQLNLDKSIKVVFITSPGNPTGACIEVGRVEKL--LRNWTAGIVVV 200

Query: 350 DEVYQENVFEDVKFHSMKKVLRQLQMKQPGLYDNVQLASLHSTSKGVSGECGQRGGYMEL 409
           DE Y       + F + K  L  L  K P       L  L + SK  SG  G R      
Sbjct: 201 DEAY-------IDFSADKPSLSPLVNKHP------NLVVLQTLSKA-SGLAGIR------ 240

Query: 410 VGFTHDIRQVVLKLASISLCPVVTGQ--ALVDLMVCPPQK---GEESYEQDQEERRNIHK 464
           +GFT    Q+   L ++   P    Q  A++ +    P+     ++  +Q   E+R I K
Sbjct: 241 LGFTFASTQIATALNAMK-APYNISQITAIIGIEALQPEALKLMQKHIDQINTEKRRIIK 299

Query: 465 ELHKRATLLH 474
            L   ATL H
Sbjct: 300 AL---ATLNH 306

>TPHA0O01450 Chr15 complement(291591..292922) [1332 bp, 443 aa] {ON}
           Anc_1.321 YJL060W
          Length = 443

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 71/360 (19%), Positives = 141/360 (39%), Gaps = 60/360 (16%)

Query: 200 VGAYSSSQGVLGIRKTVADFITNRDDGIIAYPEDIFLTAGASSAV-DYLLSIFCRGEETG 258
           V  YS ++G   + K++ D  +     +   PE++ +T GA+  +   L+ I  + +E  
Sbjct: 84  VNQYSPTRGRPTLIKSLTDLYSPLYK-LTLKPENVLVTTGANEGILACLMGILNQNDEVI 142

Query: 259 VLIP-----IPQYPLYTATLA---LQNSHALPYYLNEETGWSTDPXXXXXXXXXXXXNNI 310
           V  P     IP   L    +    +     L   + + T W+ D                
Sbjct: 143 VFEPFFDQYIPNIELCGGKVVYVPINPPKDLDKRVTKGTEWTLDFEQFENVITN------ 196

Query: 311 KPSVLVVINPGNPTGAVLSEEAIEQIFTLAAKYGIIVIADEVYQENVFED--VKFHSMKK 368
           K   +++  P NP G V + E +++I  +  K+ +I+I+DEVY    F D   +  ++  
Sbjct: 197 KTKAIIINTPHNPIGKVFTREELKRIGDICVKHNVIIISDEVYDNLYFVDEFTRIATLSP 256

Query: 369 VLRQLQMKQPGLYDNVQLASLHSTSKGVSGECGQRGGYMELVGFTHDIRQVVLKLASISL 428
            + QL +                 S G +G+     G+   +G+   +   +L  AS   
Sbjct: 257 EIGQLTL-----------------SVGSAGKTFAATGWR--IGWVVSLNPELLNFAS--- 294

Query: 429 CPVVTGQALVDLMVCPPQKGEESYEQD------QEERRNIHKELHKRATLLHDAFVKLDG 482
                 +A   +    P   +E+  +            N+  E  K+  +    F +L G
Sbjct: 295 ------KAHTRICFASPSPIQEACAESINIALRNGYFENMRNEYVKKYKIFTSVFDEL-G 347

Query: 483 ISCQKPQGAMYL---FPKLELP--YKAIQEALHQDMSPDEFYCKSLLEKTGICTVPGSGF 537
           +   + +G  +L   F ++++P  YK  +E +++    D      L+ + G+  +P + F
Sbjct: 348 LPYTEAEGTYFLLVDFSRVKIPEDYKFPEEIINK--GKDFRISNWLINELGVVAIPPTEF 405

>NDAI0B04550 Chr2 (1132653..1134350) [1698 bp, 565 aa] {ON}
           Anc_2.102
          Length = 565

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 41/161 (25%), Positives = 71/161 (44%), Gaps = 12/161 (7%)

Query: 203 YSSSQGVLGIRKTVADFITNRDDGIIAYPE---DIFLTAGASSAVDYLLSIFCRGEETGV 259
           YS +QG+  +   +  FIT + +    Y E   DI L  G+S ++  +    C    T +
Sbjct: 137 YSETQGMKPLLDFIKTFIT-KLNNTPPYNETLYDIMLANGSSDSMFKVFETLCDESTTVL 195

Query: 260 LIPIPQYPLYTATLALQNSHALPYYLN---EETGWSTDPXXXXXXXXXXXXNN---IKPS 313
           +      P+ +  +A   +  +P  LN   E+ G   +             N     KP 
Sbjct: 196 MEEFTFVPVISNVMA-TGAKCIPLKLNLNYEDQGIDIEYLENLLDNWGGKSNTKHLSKPK 254

Query: 314 VLVVINPG-NPTGAVLSEEAIEQIFTLAAKYGIIVIADEVY 353
           +L  I+ G NP G  LS E   +I+T+A ++ +I++ D+ Y
Sbjct: 255 ILYTISTGQNPIGVTLSMEKRRKIYTIAQRHDLIILEDDPY 295

>KLLA0F03509g Chr6 (327598..328761) [1164 bp, 387 aa] {ON} similar
           to uniprot|P07172 Saccharomyces cerevisiae YIL116W HIS5
           Histidinol-phosphate aminotransferase catalyzes the
           seventh step in histidine biosynthesis responsive to
           general control of amino acid biosynthesis mutations
           cause histidine auxotrophy and sensitivity to Cu Co and
           Ni salts
          Length = 387

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 42/169 (24%), Positives = 74/169 (43%), Gaps = 17/169 (10%)

Query: 232 EDIFLTAGASSAVDYLLSIFCRGEETGVLIPIPQYPLYTATLALQNSH--ALPYYLNEET 289
           +++ L  G+  ++D L+   C   +  +LI    Y +YT    + +     +P  L+EE 
Sbjct: 88  DNLCLGVGSDESIDALIRACCVPAKEKILIAPATYGMYTICSQVNDVEYVTVPLLLSEED 147

Query: 290 GWSTDPXXXXXXXXXXXXNNIKPSVLVVINPGNPTGAVLSEEAIEQIFTLAAKYGIIVIA 349
            +  D             N+    ++ + +PGNPTG  +    IE+I +   + G++V+ 
Sbjct: 148 KFQID----EEKILETLQNDPSIKLVFITSPGNPTGTFIDVNRIEKILS-QWQTGLVVV- 201

Query: 350 DEVYQENVFEDVKFHSMKKVLRQLQMKQPGLYDNVQLASLHSTSKGVSG 398
           DE Y      D    S K  L  L  K    Y+N+ +    S S G++G
Sbjct: 202 DEAYI-----DFVEGSDKGSLAPLATK----YENIAVLQTLSKSFGLAG 241

>SAKL0D11528g Chr4 complement(960867..962018) [1152 bp, 383 aa] {ON}
           weakly similar to uniprot|P47039 Saccharomyces
           cerevisiae YJL060W BNA3 Arylformamidase, involved in
           biosynthesis of nicotinic acid from tryptophan via
           kynurenine pathway; potential Cdc28p substrate
          Length = 383

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 40/153 (26%), Positives = 68/153 (44%), Gaps = 9/153 (5%)

Query: 202 AYSSSQGVLGIRKTVADFITNRDDGIIAYPEDIFLTAGASSAVDYLLSIFCRGEETGVLI 261
            Y + +G   +R  VA   ++++  +    +++ +T GA  A ++L+S    G    V+ 
Sbjct: 54  TYGAIKGSDELRSLVASLYSDKE--VKLDKDNVLITNGAIGA-NFLVSYTLAGPGDHVIC 110

Query: 262 PIPQYPLYTATLALQNSHALPYYLNEETGWSTDPXXXXXXXXXXXXNNIKPSVLVVINPG 321
             P Y   ++   +  +      LN E  +  D              N K   +V+ NP 
Sbjct: 111 VDPTYQQLSSVPKMFGAEVELLELNRENDFIPD----IGKLKSMIKGNTK--CIVLNNPN 164

Query: 322 NPTGAVLSEEAIEQIFTLAAKYGIIVIADEVYQ 354
           NP G+V+    +E+I  LA K  I VI DEVY+
Sbjct: 165 NPLGSVIPTATLEEIAALARKNEIRVICDEVYR 197

>NCAS0A09200 Chr1 complement(1819134..1820471) [1338 bp, 445 aa]
           {ON} Anc_1.321 YJL060W
          Length = 445

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 67/327 (20%), Positives = 136/327 (41%), Gaps = 57/327 (17%)

Query: 232 EDIFLTAGASSAV-DYLLSIFCRGEETGVLIPIPQYPLYTATLALQNSHALPYYLN---- 286
           E++ +T GA+  +   L+ +   G+E  V++  P +  Y + + L     +   +N    
Sbjct: 117 ENVTITTGANEGILSCLMGLLNAGDE--VIVFEPFFDQYISNIELMGGKIVYVPINPPKE 174

Query: 287 ------EETGWSTDPXXXXXXXXXXXXNNIKPSVLVVINPGNPTGAVLSEEAIEQIFTLA 340
                 E T W+ D                K   +++  P NP G V + E + QI  + 
Sbjct: 175 LDQRVTEGTEWTVDMEQFKNAITS------KTKAVIINTPHNPIGKVFTREELLQIGNIC 228

Query: 341 AKYGIIVIADEVYQENVFED--VKFHSMKKVLRQLQMKQPGLYDNVQLASLHSTSKGVSG 398
            +  +I+I+DEVY+   F D   +  ++   + QL +            ++ S  K  + 
Sbjct: 229 VEKNVIIISDEVYEHLYFTDEFTRIATLSPEIGQLTL------------TVGSAGKTFAA 276

Query: 399 ECGQRGGYMELVGFTHDIRQVVLKLASISLC---PVVTGQALVDLMVCPPQKGEESYEQD 455
             G R G++  +    ++ Q V K A   +C   P    +A  + +        ++ E +
Sbjct: 277 -TGWRIGWV--ISLNSELLQYVSK-AHTRICFASPSPLQEACANSI-------NDALESN 325

Query: 456 QEERRNIHKELHKRATLLHDAFVKLDGISCQKPQGAMYL---FPKLELP--YKAIQEALH 510
             E+  + +E  ++  +    F +L G+   KP+G  ++   F K+++P  Y   +E L+
Sbjct: 326 YFEK--MRQEYIQKFKIFTSVFEEL-GLPYTKPEGTYFVLADFSKVKIPEDYPYPKEILN 382

Query: 511 QDMSPDEFYCKSLLEKTGICTVPGSGF 537
           +    D      L+ + G+  +P + F
Sbjct: 383 K--GKDFRISHWLINELGVVAIPPTEF 407

>KLTH0E07678g Chr5 (702610..704088) [1479 bp, 492 aa] {ON} similar
           to uniprot|P53090 Saccharomyces cerevisiae YGL202W ARO8
           Aromatic aminotransferase expression is regulated by
           general control of amino acid biosynthesis
          Length = 492

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 53/195 (27%), Positives = 74/195 (37%), Gaps = 18/195 (9%)

Query: 233 DIFLTAGASSAVDYLLSIFCRGEETGVLIPIPQYPLYTATLALQNSHALPYYLNEETGWS 292
           DI  T G++   D  L IFC   +T VL+    Y         Q  + +P  L+ E    
Sbjct: 132 DIITTTGSTQGWDASLRIFCNKGDT-VLLEDYTYSSSVEAADAQGLNCVPMPLDGEGIVP 190

Query: 293 TDPXXXXXXXXXXXXNNIKPSVLVVINPG-NPTGAVLSEEAIEQIFTLAAKYGIIVIADE 351
           +                  P +L  I  G NPTG  LS+     I+ LA +Y II+I D+
Sbjct: 191 SKLEEMLANWSSLYGEMPMPKLLYTIPTGQNPTGCTLSDNRKPHIYRLAQQYDIIIIEDD 250

Query: 352 VY-----QENVFEDVKFH-------SMKKVLRQLQMKQPGLYDNVQLASLHSTSKGVSGE 399
            Y        V ED +         S    +  L      L  + ++  L S SK  +  
Sbjct: 251 PYYFLQMDPYVSEDARLETAEASTMSQATFMNSLNRSFLELDTDGRVVRLESVSKTFAPG 310

Query: 400 CGQRGGYMELVGFTH 414
           C  R G+  LVG  H
Sbjct: 311 C--RMGW--LVGSKH 321

>NDAI0G05760 Chr7 (1427844..1429190) [1347 bp, 448 aa] {ON}
           Anc_1.321
          Length = 448

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 72/329 (21%), Positives = 138/329 (41%), Gaps = 61/329 (18%)

Query: 232 EDIFLTAGASSAV-DYLLSIFCRGEETGVLIPIPQYPLYTATLALQNSHALPYYLN---- 286
           E+I +T GA+  +   L+ +   G+E  V++  P +  Y + + L     +   +N    
Sbjct: 120 ENITITTGANEGILSCLMGLLNAGDE--VIVFEPFFDQYISNIELMGGKVVYVPINPPKD 177

Query: 287 ------EETGWSTDPXXXXXXXXXXXXNNIKPSVLVVI--NPGNPTGAVLSEEAIEQIFT 338
                 E T W+ D             N I P    VI  +P NP G V ++E + ++  
Sbjct: 178 LDQRITEGTEWTID--------FEQFRNAITPKTKAVIVNSPHNPIGKVFTKEELTKLGE 229

Query: 339 LAAKYGIIVIADEVYQENVFED--VKFHSMKKVLRQLQMKQPGLYDNVQLASLHSTSKGV 396
           +  +  +I+I+DEVY+   F D   +  ++   + QL +            ++ S  K  
Sbjct: 230 ICVENNVIIISDEVYEFLYFNDSFTRIATLSPEIGQLTL------------TVGSAGKTF 277

Query: 397 SGECGQRGGYMELVGFTHDIRQVVLKLASISLC---PVVTGQALVDLMVCPPQKGEESYE 453
           +   G R G++  +    ++ Q V K A   +C   P    +A  + +        ++ E
Sbjct: 278 AA-TGWRIGWV--ISQNPELLQYVSK-AHTRICFASPSPLQEACANSI-------NDALE 326

Query: 454 QDQEERRNIHKELHKRATLLHDAFVKLDGISCQKPQGAMYL---FPKLELP--YKAIQEA 508
               E+  + KE  ++  + +  F +L G+   KP+G  ++   F K+++P  Y   +E 
Sbjct: 327 SGYFEK--MRKEYVQKFKIFNAVFEEL-GLPYTKPEGTYFVLADFSKVKIPEDYPWPEEI 383

Query: 509 LHQDMSPDEFYCKSLLEKTGICTVPGSGF 537
           L  D   D      L+ + G+  +P + F
Sbjct: 384 L--DKGKDFRISHWLINELGVVAIPPTEF 410

>TPHA0D03370 Chr4 complement(704980..706473) [1494 bp, 497 aa] {ON}
           Anc_3.511 YGL202W
          Length = 497

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 34/122 (27%), Positives = 52/122 (42%), Gaps = 5/122 (4%)

Query: 233 DIFLTAGASSAVDYLLSIFCRGEETGVLIPIPQYPLYTATLALQNSHALPYYLNEETGWS 292
           D  LT G ++  +  L IFC   +  +L     +    A+   Q     P  ++ +    
Sbjct: 132 DSILTTGNTNGWESTLRIFCNKGDV-ILAEAHSFSSSLASAEAQGVITFPVPIDSD---G 187

Query: 293 TDPXXXXXXXXXXXXNNIKPSVLVVINPG-NPTGAVLSEEAIEQIFTLAAKYGIIVIADE 351
             P             + KP +L  I  G NPTG+ LS+E  E I+ +A K+  I+I DE
Sbjct: 188 IIPEKLESILDNWTPGSPKPKLLYTIPTGQNPTGSSLSDERKEAIYKIACKHDFIIIEDE 247

Query: 352 VY 353
            Y
Sbjct: 248 PY 249

>KAFR0A01710 Chr1 complement(348198..349505) [1308 bp, 435 aa] {ON}
           Anc_1.321 YJL060W
          Length = 435

 Score = 42.0 bits (97), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 47/241 (19%), Positives = 102/241 (42%), Gaps = 42/241 (17%)

Query: 309 NIKPSVLVVINPGNPTGAVLSEEAIEQIFTLAAKYGIIVIADEVYQENVFED--VKFHSM 366
           N K   +++  P NP G V +E  + ++  +  K  +++I+DEVY+   F+D   +  ++
Sbjct: 187 NSKTKAIIINTPHNPIGKVFTEPELRRLGDICVKNNVVIISDEVYEHLYFKDSFTRIATL 246

Query: 367 KKVLRQLQMKQPGLYDNVQLASLHSTSKGVSGECGQRGGYMELVGFTHDIRQVVLKLASI 426
              + QL +                 + G +G+     G+   +G+   + Q +L  A+ 
Sbjct: 247 SPEIGQLTL-----------------TVGSAGKSFAATGWR--IGWALSLNQELLSYAA- 286

Query: 427 SLCPVVTGQALVDLMVCPPQKGEESYEQ--DQEERRNIHKELHKRATLLHDAFVKL---D 481
                   +A   +    P   +E+     +  E+    KE   +    ++ F  +    
Sbjct: 287 --------KAHTRICFASPSPLQEAVANAFNDAEKVEYFKETRLQYIRKYEIFTNVLNEL 338

Query: 482 GISCQKPQGAMYL---FPKLELP--YKAIQEALHQDMSPDEFYCKSLLEKTGICTVPGSG 536
           G+   +P+G  ++   F K+++P  YK  +E L++  + D      L+ + G+  +P + 
Sbjct: 339 GLPYTEPEGTYFILVNFSKVKIPPDYKYPEELLNK--AKDFRISYWLMNELGVVAIPPTE 396

Query: 537 F 537
           F
Sbjct: 397 F 397

>KLTH0G09614g Chr7 (804939..806108) [1170 bp, 389 aa] {ON} similar
           to uniprot|P07172 Saccharomyces cerevisiae YIL116W HIS5
           Histidinol-phosphate aminotransferase catalyzes the
           seventh step in histidine biosynthesis responsive to
           general control of amino acid biosynthesis mutations
           cause histidine auxotrophy and sensitivity to Cu Co and
           Ni salts
          Length = 389

 Score = 42.0 bits (97), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 61/237 (25%), Positives = 101/237 (42%), Gaps = 25/237 (10%)

Query: 232 EDIFLTAGASSAVDYLLSIFCRGEETGVLIPIPQYPLYTATLALQNSHALPYYLNEETGW 291
           +++ L  G+  ++D L+   C   +  +LI  P Y +Y+    + +   +   L  E   
Sbjct: 88  DNLCLGVGSDESIDALIRACCVPGKDKILIMTPTYGMYSICADINDVEIIKVPLIVEDN- 146

Query: 292 STDPXXXXXXXXXXXXNNIKPSVLVVINPGNPTGAVLSEEAIEQIFTLAAKYGIIVIADE 351
           S               +NIK  +  V +PGNPTGA++   +IE+I +   + GI+ I DE
Sbjct: 147 SFQMNTDKVIETLQGDSNIK--IAFVTSPGNPTGALIDIASIEKILS-QWQSGIVAI-DE 202

Query: 352 VYQENVFEDVKFHSMKKVLRQLQMKQPGLYDNVQLASLHSTSKGVSGECGQRGGYMELVG 411
            Y       + F S       L  K P       LA L + SK   G  G R G    V 
Sbjct: 203 AY-------IDFCSTGGSAAPLVNKYP------NLAVLQTLSKSF-GLAGVRLG----VT 244

Query: 412 FT-HDIRQVVLKL-ASISLCPVVTGQALVDLMVCPPQKGEESYEQDQEERRNIHKEL 466
           FT  D+ +V+  + A  ++  + +   L  L     Q  +++ ++  EER  + K L
Sbjct: 245 FTSKDLSRVLNAMKAPYNISSMASNLVLKALSSESVQTMKDNVQEIVEERERVLKAL 301

>Kwal_47.17462 s47 (413555..415033) [1479 bp, 492 aa] {ON} YGL202W
           (ARO8) - aromatic amino acid aminotransferase [contig
           207] FULL
          Length = 492

 Score = 42.0 bits (97), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 37/122 (30%), Positives = 50/122 (40%), Gaps = 2/122 (1%)

Query: 233 DIFLTAGASSAVDYLLSIFCRGEETGVLIPIPQYPLYTATLALQNSHALPYYLNEETGWS 292
           DI  T G++   D  L IFC   +T VL+    Y         Q  + +P  L+ E    
Sbjct: 132 DIITTTGSTQGWDASLRIFCNKGDT-VLLEEYTYSSSVEAADAQGLNCIPMPLDGEGIIP 190

Query: 293 TDPXXXXXXXXXXXXNNIKPSVLVVINPG-NPTGAVLSEEAIEQIFTLAAKYGIIVIADE 351
                          +   P +L  I  G NPTG  LS+     I+ LA KY +I+I DE
Sbjct: 191 EKLEEMLINWSDLYPDIPMPKLLYTIPTGQNPTGCTLSDSRKPYIYHLAQKYDMIIIEDE 250

Query: 352 VY 353
            Y
Sbjct: 251 PY 252

>AGR167W Chr7 (1059790..1061328) [1539 bp, 512 aa] {ON} Non-syntenic
           homolog of Saccharomyces cerevisiae YGL202W (ARO8)
          Length = 512

 Score = 42.0 bits (97), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 34/133 (25%), Positives = 57/133 (42%), Gaps = 24/133 (18%)

Query: 233 DIFLTAGASSAVDYLLSIFCRGEETGVLIPIPQYP----------LYTATLALQNSHALP 282
           D+ +TAG++ A D  + +FC  E   V++    Y           LY   + + +   +P
Sbjct: 127 DVLVTAGSTQAWDATMRLFC-NEGDSVVMEAFTYSSSVEAAEAQGLYCVGMEVDSEGIVP 185

Query: 283 YYLNEETG-WSTDPXXXXXXXXXXXXNNIKPSVLVVINPG-NPTGAVLSEEAIEQIFTLA 340
             L E    W T               + +P VL  I  G NP G+ L +    QI+ LA
Sbjct: 186 ERLAELLAEWDTQ-----------HAGHARPRVLYTIPTGQNPMGSTLVDARKAQIYRLA 234

Query: 341 AKYGIIVIADEVY 353
            +Y ++++ D+ Y
Sbjct: 235 QQYDMLIVEDDPY 247

>KAFR0D01420 Chr4 (284515..285993) [1479 bp, 492 aa] {ON} Anc_3.511
           YGL202W
          Length = 492

 Score = 41.6 bits (96), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 37/141 (26%), Positives = 63/141 (44%), Gaps = 6/141 (4%)

Query: 233 DIFLTAGASSAVDYLLSIFCRGEETGVLIPIPQYPLYTATLALQNSHALPYYLNEETGWS 292
           ++ +TAG +SA +  L IFC   +T +L     +    +    Q     P  ++++    
Sbjct: 132 ELLVTAGNTSAWESTLRIFCNRGDT-ILAEAHSFSSSLSAAQAQGIITFPVPIDDK---G 187

Query: 293 TDPXXXXXXXXXXXXNNIKPSVLVVINPG-NPTGAVLSEEAIEQIFTLAAKYGIIVIADE 351
             P               KP +L  I  G NPTG+ L  E   Q++ +A K+  +++ DE
Sbjct: 188 IIPEKLAAIMDNWNPETPKPKLLYTIPTGQNPTGSSLDAERKSQVYKIAQKHDFLIVEDE 247

Query: 352 VYQENVFED-VKFHSMKKVLR 371
            Y     ED VK  S++K ++
Sbjct: 248 PYYFLQMEDYVKDPSLRKEVK 268

>NCAS0E00670 Chr5 (117006..118499) [1494 bp, 497 aa] {ON} Anc_3.511
          Length = 497

 Score = 41.6 bits (96), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 46/167 (27%), Positives = 67/167 (40%), Gaps = 20/167 (11%)

Query: 233 DIFLTAGASSAVDYLLSIFC-RGEETGVLIPIPQYPLYTATLALQNSHALPYYLNEETGW 291
           D+  TAG ++A +  L +FC RG+   +L     +    A    Q     P  ++++   
Sbjct: 133 DVVATAGNTNAWESTLRVFCNRGDV--ILAEAHSFSSCLAAAQAQGITTFPVPIDDK--- 187

Query: 292 STDPXXXXXXXXXXXXNNIKPSVLVVINPG-NPTGAVLSEEAIEQIFTLAAKYGIIVIAD 350
              P               KP +L  I  G NPTG  L++E   +IF +A K+  ++I D
Sbjct: 188 GIIPAKLEAILDNWTPGAPKPKLLYTIPTGQNPTGTSLADERKPEIFRIAQKHDFLIIED 247

Query: 351 EVYQENVFEDVKFHSMKKVLRQLQMK-----QPGLYDNVQLASLHST 392
             Y         F  M K  R LQ +     QP       LASL  T
Sbjct: 248 APYY--------FLQMDKYERDLQKRAVTRAQPRESHKDFLASLDKT 286

>YGL202W Chr7 (116059..117561) [1503 bp, 500 aa] {ON}  ARO8Aromatic
           aminotransferase I, expression is regulated by general
           control of amino acid biosynthesis
          Length = 500

 Score = 41.2 bits (95), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 32/123 (26%), Positives = 54/123 (43%), Gaps = 7/123 (5%)

Query: 233 DIFLTAGASSAVDYLLSIFC-RGEETGVLIPIPQYPLYTATLALQNSHALPYYLNEETGW 291
           D+  TAG ++A +  L +FC RG+   +L+    +    A+   Q     P  ++ +   
Sbjct: 134 DVLATAGNTNAWESTLRVFCNRGDV--ILVEAHSFSSSLASAEAQGVITFPVPIDAD--- 188

Query: 292 STDPXXXXXXXXXXXXNNIKPSVLVVINPG-NPTGAVLSEEAIEQIFTLAAKYGIIVIAD 350
              P               KP +L  I  G NPTG  +++   E I+ +A KY  +++ D
Sbjct: 189 GIIPEKLAKVMENWTPGAPKPKLLYTIPTGQNPTGTSIADHRKEAIYKIAQKYDFLIVED 248

Query: 351 EVY 353
           E Y
Sbjct: 249 EPY 251

>Smik_7.69 Chr7 (111132..112634) [1503 bp, 500 aa] {ON} YGL202W
           (REAL)
          Length = 500

 Score = 41.2 bits (95), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 33/123 (26%), Positives = 54/123 (43%), Gaps = 7/123 (5%)

Query: 233 DIFLTAGASSAVDYLLSIFC-RGEETGVLIPIPQYPLYTATLALQNSHALPYYLNEETGW 291
           D+F TAG ++A +  L +FC RG+   +L     +    A+   Q     P  ++ +   
Sbjct: 134 DVFATAGNTNAWESTLRLFCNRGDV--ILAEAHSFSSSLASAEAQGVITFPVPIDAD--- 188

Query: 292 STDPXXXXXXXXXXXXNNIKPSVLVVINPG-NPTGAVLSEEAIEQIFTLAAKYGIIVIAD 350
              P            N  KP +L  I  G NPTG  ++    E I+ +A K+  +++ D
Sbjct: 189 GIIPEKLAKIMDNWTPNAPKPKLLYTIPTGQNPTGTSIANHRKEAIYKIAQKHDFLIVED 248

Query: 351 EVY 353
           E Y
Sbjct: 249 EPY 251

>SAKL0E08492g Chr5 complement(692049..693203) [1155 bp, 384 aa] {ON}
           similar to uniprot|P07172 Saccharomyces cerevisiae
           YIL116W HIS5 Histidinol-phosphate aminotransferase
           catalyzes the seventh step in histidine biosynthesis
           responsive to general control of amino acid biosynthesis
           mutations cause histidine auxotrophy and sensitivity to
           Cu Co and Ni salts
          Length = 384

 Score = 40.4 bits (93), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 29/125 (23%), Positives = 56/125 (44%), Gaps = 11/125 (8%)

Query: 232 EDIFLTAGASSAVDYLLSIFCRGEETGVLIPIPQYPLYTATLALQNSHALPYYL-NEETG 290
           E+I L  G+  ++D L+ + C   +  ++I  P Y +Y+    + +   +   L  E+  
Sbjct: 88  ENICLGVGSDESIDALIRVCCVPSKDKIMIMPPTYGMYSICADINDVGCVKVPLVAEDNS 147

Query: 291 WSTDPXXXXXXXXXXXXNNIKPSV--LVVINPGNPTGAVLSEEAIEQIFTLAAKYGIIVI 348
           +  D                 P++  + + +PGNPT A++    IE++  L    G +V+
Sbjct: 148 FQMDTSKVLETLAQ------DPTIKLIFITSPGNPTAALIDTAEIEKV--LNNWTGGLVV 199

Query: 349 ADEVY 353
            DE Y
Sbjct: 200 VDEAY 204

>KNAG0B00660 Chr2 (115417..116907) [1491 bp, 496 aa] {ON} Anc_3.511
           YGL202W
          Length = 496

 Score = 40.4 bits (93), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 33/122 (27%), Positives = 52/122 (42%), Gaps = 5/122 (4%)

Query: 233 DIFLTAGASSAVDYLLSIFCRGEETGVLIPIPQYPLYTATLALQNSHALPYYLNEETGWS 292
           D+  T G ++A +  L +FC   +  +L     +    A    Q     P  ++E     
Sbjct: 132 DVVATTGNTNAWESTLRVFCDKGDV-ILAEAHSFSSCLAAAQAQGIITFPIPIDEH---G 187

Query: 293 TDPXXXXXXXXXXXXNNIKPSVLVVINPG-NPTGAVLSEEAIEQIFTLAAKYGIIVIADE 351
             P               KP +L  I  G NPTG+ LS++  E+I+ +A K+  I+I DE
Sbjct: 188 IIPEKLEQILDNWTEGAPKPKLLYTIPTGQNPTGSSLSDDRKEKIYKVAQKHDFIIIEDE 247

Query: 352 VY 353
            Y
Sbjct: 248 PY 249

>Kpol_278.2 s278 (2488..3984) [1497 bp, 498 aa] {ON} (2488..3984)
           [1497 nt, 499 aa]
          Length = 498

 Score = 40.4 bits (93), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 32/122 (26%), Positives = 51/122 (41%), Gaps = 5/122 (4%)

Query: 233 DIFLTAGASSAVDYLLSIFCRGEETGVLIPIPQYPLYTATLALQNSHALPYYLNEETGWS 292
           DI LT G ++  +  L +FC   +  +L     +    A+   Q     P  ++E     
Sbjct: 132 DIILTTGNTNGWESTLRVFCNKGDV-ILAEAHSFSSSLASAEAQGITTFPIPIDEH---G 187

Query: 293 TDPXXXXXXXXXXXXNNIKPSVLVVINPG-NPTGAVLSEEAIEQIFTLAAKYGIIVIADE 351
             P               KP +L  I  G NPTG  L++E   +I+ +A K+  ++I DE
Sbjct: 188 IIPEKLEEILDNWTPGAPKPKLLYTIPTGQNPTGTSLADERKVEIYRIACKHDFLIIEDE 247

Query: 352 VY 353
            Y
Sbjct: 248 PY 249

>Kwal_23.4888 s23 (907745..908914) [1170 bp, 389 aa] {ON} YIL116W
           (HIS5) - histidinol-phosphate aminotransferase [contig
           5] FULL
          Length = 389

 Score = 40.0 bits (92), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 30/123 (24%), Positives = 57/123 (46%), Gaps = 7/123 (5%)

Query: 232 EDIFLTAGASSAVDYLLSIFCRGEETGVLIPIPQYPLYTATLALQNSHALPYYLN-EETG 290
           E++ L  G+   +D L+   C   +  +LI  P Y +Y+    + +   +   L  E+  
Sbjct: 88  ENLCLGVGSDECIDALIRACCVPGKDKILIMPPTYGMYSICTDINDVEYVKVPLVVEDNS 147

Query: 291 WSTDPXXXXXXXXXXXXNNIKPSVLVVINPGNPTGAVLSEEAIEQIFTLAAKYGIIVIAD 350
           +  D             N+    ++ + +PGNPTGA++  E IE++ +   + G +V+ D
Sbjct: 148 FQMD----TEKVIETLQNDPSIKLVFITSPGNPTGALIKPENIEKLLS-QWQSGFVVV-D 201

Query: 351 EVY 353
           E Y
Sbjct: 202 EAY 204

>KLTH0G19646g Chr7 complement(1699421..1700560) [1140 bp, 379 aa]
           {ON} conserved hypothetical protein
          Length = 379

 Score = 39.7 bits (91), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 35/152 (23%), Positives = 64/152 (42%), Gaps = 9/152 (5%)

Query: 202 AYSSSQGVLGIRKTVADFITNRDDGIIAYPEDIFLTAGASSAVDYLLSIFCRGEETGVLI 261
            Y S  G   +R  VA    +  D I    +++ +T GA  A ++L+     G    ++ 
Sbjct: 54  TYGSIWGTPVLRDLVAKI--HSSDEIQLTADNVLITNGAIGA-NFLVHYTAAGPGDHIIC 110

Query: 262 PIPQYPLYTATLALQNSHALPYYLNEETGWSTDPXXXXXXXXXXXXNNIKPSVLVVINPG 321
             P Y   ++  ++  +     +L  E G++ +                    +V+ NP 
Sbjct: 111 VDPTYQQLSSVPSMFGADVELLHLEAEDGYTPNIQKLKSKVRA------NTKYIVLNNPN 164

Query: 322 NPTGAVLSEEAIEQIFTLAAKYGIIVIADEVY 353
           NP G+V+S E + +I   A +  I ++ DEVY
Sbjct: 165 NPLGSVISTEKMTEIIDYAERNEIFIVCDEVY 196

>Kwal_47.18982 s47 complement(1051414..1052904) [1491 bp, 496 aa]
           {ON} YGL202W (ARO8) - 1:1 [contig 188] FULL
          Length = 496

 Score = 40.0 bits (92), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 33/124 (26%), Positives = 56/124 (45%), Gaps = 9/124 (7%)

Query: 233 DIFLTAGASSAVDYLLSIFCRGEETGVLIPIPQYPLYTATLAL--QNSHALPYYLNEETG 290
           ++  T G + + +  L IFC   +T   I   QY   ++  A   Q  +  P  L+ +  
Sbjct: 135 NVLATTGNTGSWESTLRIFCNRGDT---ILAEQYTFSSSVYAAEAQGINVFPVPLDAD-- 189

Query: 291 WSTDPXXXXXXXXXXXXNNIKPSVLVVINPG-NPTGAVLSEEAIEQIFTLAAKYGIIVIA 349
               P            +  KP +L  I  G NPTG+ LS++   +I+ +A K+ +++I 
Sbjct: 190 -GLIPERLEAILDNWNPDTAKPKLLYTIPTGQNPTGSSLSDDRKVEIYRIAKKHDLLIIE 248

Query: 350 DEVY 353
           DE Y
Sbjct: 249 DEPY 252

>KLTH0G02002g Chr7 (155219..156709) [1491 bp, 496 aa] {ON} highly
           similar to uniprot|P53090 Saccharomyces cerevisiae
           YGL202W ARO8 Aromatic aminotransferase expression is
           regulated by general control of amino acid biosynthesis
          Length = 496

 Score = 40.0 bits (92), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 34/124 (27%), Positives = 55/124 (44%), Gaps = 9/124 (7%)

Query: 233 DIFLTAGASSAVDYLLSIFCRGEETGVLIPIPQYPLYTATLAL--QNSHALPYYLNEETG 290
           D+  T G + + +  L IFC   +T   I   +Y   ++  A   Q  +  P  L+ +  
Sbjct: 135 DVLATIGNTGSWESTLRIFCNRGDT---ILAEKYTFSSSVYAAEAQGVNVFPVPLDAD-- 189

Query: 291 WSTDPXXXXXXXXXXXXNNIKPSVLVVINPG-NPTGAVLSEEAIEQIFTLAAKYGIIVIA 349
               P               KP +L  I  G NPTG+ LS++  ++I+ +A K+  I+I 
Sbjct: 190 -GLIPERLEAILDNWNPETPKPKLLYTIPTGQNPTGSSLSDDRKKEIYRIAQKHDFIIIE 248

Query: 350 DEVY 353
           DE Y
Sbjct: 249 DEPY 252

>Smik_10.180 Chr10 (315030..316364) [1335 bp, 444 aa] {ON} YJL060W
           (REAL)
          Length = 444

 Score = 39.3 bits (90), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 16/50 (32%), Positives = 28/50 (56%)

Query: 311 KPSVLVVINPGNPTGAVLSEEAIEQIFTLAAKYGIIVIADEVYQENVFED 360
           K   +++  P NP G V + E +  +  +  K+ +I+I+DEVY+   F D
Sbjct: 198 KTKAVIINTPHNPIGKVFTREELTTLGNICVKHNVIIISDEVYEHLYFTD 247

>TDEL0D01900 Chr4 (369434..370765) [1332 bp, 443 aa] {ON} Anc_1.321
           YJL060W
          Length = 443

 Score = 39.3 bits (90), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 77/376 (20%), Positives = 157/376 (41%), Gaps = 64/376 (17%)

Query: 185 AIDRAKRLLDDIGGSVGAYSSSQGVLGIRKTVADFITNRDDGIIAYPEDIFLTAGASSAV 244
           AI  AK+ +D     V  YS ++G + + +++    +   +  +   E++ +T GA+  +
Sbjct: 71  AITEAKKAVDI--PLVNQYSPTRGRVSLLESLIKLYSPLYNAELK-AENVTVTTGANEGI 127

Query: 245 -DYLLSIFCRGEETGVLIPIPQYPLYTATLALQNSHALPYYLN----------EETGWST 293
              L+ I   G+E  V++  P +  Y   + L     +   +N          + T W+ 
Sbjct: 128 LSCLMGILNPGDE--VIVFEPFFDQYIPNIELLGGKVVYVPINPPKDMDQRVVKGTEWTV 185

Query: 294 DPXXXXXXXXXXXXNNI--KPSVLVVINPGNPTGAVLSEEAIEQIFTLAAKYGIIVIADE 351
           D             N I  K   +++  P NP G V + E + +I  +  K  +++I+DE
Sbjct: 186 D--------YEQFANAITDKTKAVIINTPHNPIGKVFTREELTRIGEICVKKNVVIISDE 237

Query: 352 VYQENVFED--VKFHSMKKVLRQLQMKQPGLYDNVQLASLHSTSKGVSGECGQRGGYMEL 409
           VY+   F D   +  ++   + QL +            S+ S  K  +   G R G++  
Sbjct: 238 VYEHLYFTDSFTRIATLSPEIGQLTL------------SVGSAGKSFAA-TGWRVGWV-- 282

Query: 410 VGFTHDIRQVVLKLASISLC---PVVTGQALVDLMVCPPQKGEESYEQDQEERRNIHKEL 466
           V    ++   V K A   +C   P    +A+ + +        ++ E +  E  N+ +E 
Sbjct: 283 VSLNPELLSYVSK-AHTRICFASPSPLQEAVANSI-------NDALEINYFE--NMRQEY 332

Query: 467 HKRATLLHDAFVKLDGISCQKPQGAMYL---FPKLELP--YKAIQEALHQDMSPDEFYCK 521
             +  +    F +L G+   +P+G  ++   F K+++P  Y   +E  ++  + D     
Sbjct: 333 KHKYDIFTSVFKEL-GLPYTEPEGTYFILVDFSKVKIPEGYSYPEEIANK--AKDFRIAY 389

Query: 522 SLLEKTGICTVPGSGF 537
            L+ + G+  +P + F
Sbjct: 390 WLINELGVVAIPPTEF 405

>Kpol_1032.39 s1032 complement(90576..91937) [1362 bp, 453 aa] {ON}
           complement(90576..91937) [1362 nt, 454 aa]
          Length = 453

 Score = 38.9 bits (89), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 78/362 (21%), Positives = 137/362 (37%), Gaps = 65/362 (17%)

Query: 202 AYSSSQGVLGIRKTVADFIT------NRDDGIIAYPEDIFLTAGASSAVDYLLSIFCRGE 255
            Y S++G L +R  + +F+       +RDD   + PE + LT+GAS  V   L+I  +  
Sbjct: 50  TYGSNEGALWVRTAITEFVNEKAFKFDRDDKARSKPEYLNLTSGASYGV---LNILLQAT 106

Query: 256 --ETGV----LIPIPQYPLYTATLALQNSHALPYYLNEETGWSTD--------------- 294
              TGV     I  P Y L                ++E+   S D               
Sbjct: 107 LPHTGVTKQAFIVSPTYFLINDCFIDAGFGGKLTAIDEKGEESIDLELLEAKLKHFESID 166

Query: 295 --PXXXXXXXXXXXXNNIKPS---------VLVVINPGNPTGAVLSEEAIEQIFTLAAKY 343
             P            N I  S         + V+    NP+G   + E   ++  LA KY
Sbjct: 167 PNPVNENGKELSIIKNPIDISHLKKVYKYVIYVIPTYSNPSGKTYNLETRCKLIELARKY 226

Query: 344 GIIVIADEVYQENVFEDVKFHSMKKVLRQLQMKQPGLYDNVQLASLHSTSKGVSGECGQR 403
            +++I D+VY      D+  +S+     + ++  P +   V +    +  +   G     
Sbjct: 227 DMLIITDDVY------DLLNYSINNDPDKFELPTP-IKRFVHIDRETNNDESSYGNTVSN 279

Query: 404 GGYMELV------GFTHDIRQVVLKLASISLCPVVTG--QALVDLMVCPPQKGEESYEQD 455
             + +++      G+   I +++    S     V  G    L  ++V     G      D
Sbjct: 280 ASFSKIIAPGLRFGYHESINKLLATQLSAGGANVSGGTPSQLTSMIV-----GTLLTNGD 334

Query: 456 QEE-RRNIHKELHKRATLLHDAFVKL--DGISCQKPQGAMYLFPKLELPYKAIQEA-LHQ 511
            E+  RN+ +   +RA  +++A +K    G   +K +G  + + KL   Y A++   L Q
Sbjct: 335 AEKILRNLIQTYCERADAMYNAMIKYLPKGTEIRKTEGGYFNWMKLTESYNALEVGKLAQ 394

Query: 512 DM 513
           DM
Sbjct: 395 DM 396

>TDEL0F00900 Chr6 complement(153488..154969) [1482 bp, 493 aa] {ON}
           Anc_2.102 YHR137W
          Length = 493

 Score = 38.9 bits (89), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 38/146 (26%), Positives = 61/146 (41%), Gaps = 33/146 (22%)

Query: 229 AYPE-DIFLTAGASSAVDYLLSIFCRGEETGVLIPIPQYPLYTATLALQNSHA------- 280
           AY E D+ L+ G+S ++  +   FC  E T VL+   ++        +QN+ A       
Sbjct: 114 AYDEWDVLLSNGSSDSMFKIFETFC-DESTTVLME--EFTFSPVISNVQNTGATCVPIKM 170

Query: 281 ------------LPYYLNEETGWSTDPXXXXXXXXXXXXNNIKPSVLVVINPG-NPTGAV 327
                       + Y  +    W+T P               KP ++  I  G NPTG  
Sbjct: 171 ELTTDPAKQGIDIAYLTHLLENWTTIPQYSHLN---------KPKMIYTIATGQNPTGMT 221

Query: 328 LSEEAIEQIFTLAAKYGIIVIADEVY 353
           LS E   QI+ LA K+ ++++ D+ Y
Sbjct: 222 LSMEKRRQIYALAQKHDLLILEDDPY 247

>TBLA0B00990 Chr2 complement(221196..222836) [1641 bp, 546 aa] {ON}
           Anc_2.102 YHR137W
          Length = 546

 Score = 39.3 bits (90), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 18/44 (40%), Positives = 28/44 (63%), Gaps = 1/44 (2%)

Query: 311 KPSVLVVINPG-NPTGAVLSEEAIEQIFTLAAKYGIIVIADEVY 353
           +PS+L  I+ G NPTG  +S E   +I+ LA KY  +++ D+ Y
Sbjct: 225 RPSILYTISTGQNPTGLTISMENRARIYKLAQKYNFLIVEDDPY 268

>Skud_10.156 Chr10 complement(294149..295531) [1383 bp, 460 aa] {ON}
           YJL060W (REAL)
          Length = 460

 Score = 38.9 bits (89), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 15/50 (30%), Positives = 28/50 (56%)

Query: 311 KPSVLVVINPGNPTGAVLSEEAIEQIFTLAAKYGIIVIADEVYQENVFED 360
           K   +++  P NP G V + E +  +  +  K+ +++I+DEVY+   F D
Sbjct: 214 KTKAVIINTPHNPIGKVFTREELTTLGNICVKHNVVIISDEVYEHLFFTD 263

>AFR548C Chr6 complement(1422283..1423776) [1494 bp, 497 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YGL202W
           (ARO8)
          Length = 497

 Score = 38.9 bits (89), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 32/125 (25%), Positives = 58/125 (46%), Gaps = 8/125 (6%)

Query: 233 DIFLTAGASSAVDYLLSIFCRGEETGVLIPIPQYPLYTATLAL--QNSHALPYYLNEETG 290
           D+  T G +SA +  L +FC   +T   I   +Y   ++ +A   Q   A P  L+E  G
Sbjct: 132 DVLATVGNTSAWESTLRVFCNRGDT---ILAEEYTFSSSLVAAEAQGVRAYPVPLDE-NG 187

Query: 291 WSTDPXXXXXXXXXXXXNNI-KPSVLVVINPG-NPTGAVLSEEAIEQIFTLAAKYGIIVI 348
              +             + + +P +L  +  G NPTG  LS +  + ++ LA ++ ++++
Sbjct: 188 MVPERLGELLDNWERWHDGVPRPKLLYTVPTGQNPTGTCLSNDRRQAVYRLAQQHDLLIV 247

Query: 349 ADEVY 353
            DE Y
Sbjct: 248 EDEPY 252

>KNAG0E01850 Chr5 (381827..382981) [1155 bp, 384 aa] {ON} Anc_2.252
           YIL116W
          Length = 384

 Score = 38.5 bits (88), Expect = 0.036,   Method: Compositional matrix adjust.
 Identities = 27/122 (22%), Positives = 55/122 (45%), Gaps = 7/122 (5%)

Query: 233 DIFLTAGASSAVDYLLSIFCRGEETGVLIPIPQYPLYTATLALQNSHALPY-YLNEETGW 291
           +I L  G+  ++D ++   C      +L+  P Y +Y+    + +   +    + E+  +
Sbjct: 89  NICLGVGSDESIDAIIRATCVPAREKILVLPPTYSMYSVCAKINDVEVVTCPLITEDNSF 148

Query: 292 STDPXXXXXXXXXXXXNNIKPSVLVVINPGNPTGAVLSEEAIEQIFTLAAKYGIIVIADE 351
             D             N+ +  +L + +PGNPTGA +    IE++     + G++V+ DE
Sbjct: 149 QMDSDKVLDILN----NDQEIKLLFITSPGNPTGAQIETARIEKVLQNWDR-GLVVV-DE 202

Query: 352 VY 353
            Y
Sbjct: 203 AY 204

>AEL170C Chr5 complement(318032..319408) [1377 bp, 458 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YJL060W
           (BNA3)
          Length = 458

 Score = 38.9 bits (89), Expect = 0.036,   Method: Compositional matrix adjust.
 Identities = 50/235 (21%), Positives = 96/235 (40%), Gaps = 30/235 (12%)

Query: 309 NIKPSVLVVINPGNPTGAVLSEEAIEQIFTLAAKYGIIVIADEVYQENVFEDVKFHSMKK 368
           N K   +++ +P NP G V + E + ++  +  + GI +I+DEVY+   F D +F  +  
Sbjct: 210 NEKTKAVIINSPHNPIGKVFTREELLKLGNICVEKGIYIISDEVYEHLYFTD-EFTRIAT 268

Query: 369 VLRQLQMKQPGLYDNVQLASLHSTSKGVSGECGQRGGYMELVGFTHDIRQVVLKLAS--- 425
           +  ++              S H+ + G +G+     G+   +G+     + +L LAS   
Sbjct: 269 LSEEI--------------SQHTLTVGSAGKSFAATGWR--IGWVISRNKELLALASKAH 312

Query: 426 ISLCPVVTGQALVDLMVCPPQKGEESYEQDQEERRNIHKELHKRATLLHDAFVKLDGISC 485
           + +C            V      + +Y  D    R  +++ ++R       F  L G+  
Sbjct: 313 VRICFSSPAPLQEACAVAIEHALKTTYYADT---RAAYQKKYER---FQKPFDDL-GLPY 365

Query: 486 QKPQGAMYL---FPKLELPYKAIQEALHQDMSPDEFYCKSLLEKTGICTVPGSGF 537
            + +G+ +L   F +L LP          D   D      L+ + G+  +P S F
Sbjct: 366 TRAEGSYFLLVDFSRLPLPADYHFPEELADKGRDFRVAYWLINELGLVAIPCSSF 420

>ZYRO0G20636g Chr7 complement(1700506..1701867) [1362 bp, 453 aa]
           {ON} highly similar to uniprot|P47039 Saccharomyces
           cerevisiae YJL060W BNA3 Arylformamidase involved in
           biosynthesis of nicotinic acid from tryptophan via
           kynurenine pathway potential Cdc28p substrate
          Length = 453

 Score = 38.5 bits (88), Expect = 0.039,   Method: Compositional matrix adjust.
 Identities = 33/140 (23%), Positives = 59/140 (42%), Gaps = 19/140 (13%)

Query: 232 EDIFLTAGASSAV-DYLLSIFCRGEETGVLIPIPQYPLYTATLALQNSHALPYYLN---- 286
           E++ +T GA+  +   L+ I   G+E  V++  P +  Y   + L     +   +N    
Sbjct: 123 ENVTITTGANEGILSSLMGILNPGDE--VIVFEPFFDQYIPNIELLGGKVVYVPINPPKD 180

Query: 287 ------EETGWSTDPXXXXXXXXXXXXNNIKPSVLVVINPGNPTGAVLSEEAIEQIFTLA 340
                 E   W+ D                K   L++  P NP G V ++E + +I  L 
Sbjct: 181 MDQRIVEGKDWTIDYEELAKAFTS------KTKALILNTPHNPIGKVFTKEELTKIGNLC 234

Query: 341 AKYGIIVIADEVYQENVFED 360
            +  +++I+DEVY+   F D
Sbjct: 235 VENNVVIISDEVYEFLYFTD 254

>YJL060W Chr10 (323386..324720) [1335 bp, 444 aa] {ON}
           BNA3Kynurenine aminotransferase, catalyzes formation of
           kynurenic acid from kynurenine; potential Cdc28p
           substrate
          Length = 444

 Score = 38.5 bits (88), Expect = 0.042,   Method: Compositional matrix adjust.
 Identities = 15/50 (30%), Positives = 28/50 (56%)

Query: 311 KPSVLVVINPGNPTGAVLSEEAIEQIFTLAAKYGIIVIADEVYQENVFED 360
           K   +++  P NP G V + E +  +  +  K+ +++I+DEVY+   F D
Sbjct: 198 KTKAVIINTPHNPIGKVFTREELTTLGNICVKHNVVIISDEVYEHLYFTD 247

>KLTH0B06270g Chr2 (508642..510219) [1578 bp, 525 aa] {ON} similar
           to uniprot|P38840 Saccharomyces cerevisiae YHR137W ARO9
           Aromatic aminotransferase catalyzes the first step of
           tryptophan phenylalanine and tyrosine catabolism
          Length = 525

 Score = 38.5 bits (88), Expect = 0.043,   Method: Compositional matrix adjust.
 Identities = 21/44 (47%), Positives = 27/44 (61%), Gaps = 1/44 (2%)

Query: 311 KPSVLVVINPG-NPTGAVLSEEAIEQIFTLAAKYGIIVIADEVY 353
           KP +L  I  G NPTG  LS E  +QI+ LA K+  I+I D+ Y
Sbjct: 239 KPKLLYTIPTGQNPTGMTLSFEKRKQIYALAEKHDFIIIEDDPY 282

>Kwal_33.14582 s33 complement(728649..730226) [1578 bp, 525 aa] {ON}
           YHR137W (ARO9) - aromatic amino acid aminotransferase II
           [contig 102] FULL
          Length = 525

 Score = 38.5 bits (88), Expect = 0.049,   Method: Compositional matrix adjust.
 Identities = 19/44 (43%), Positives = 27/44 (61%), Gaps = 1/44 (2%)

Query: 311 KPSVLVVINPG-NPTGAVLSEEAIEQIFTLAAKYGIIVIADEVY 353
           +P +L  I  G NPTG  LS E  +QI+ LA K+  I++ D+ Y
Sbjct: 239 RPKLLYTIPTGQNPTGMTLSREKRQQIYDLAEKHDFIIVEDDPY 282

>CAGL0G01254g Chr7 (119281..120795) [1515 bp, 504 aa] {ON} highly
           similar to uniprot|P53090 Saccharomyces cerevisiae
           YGL202w ARO8
          Length = 504

 Score = 38.1 bits (87), Expect = 0.056,   Method: Compositional matrix adjust.
 Identities = 30/123 (24%), Positives = 56/123 (45%), Gaps = 7/123 (5%)

Query: 233 DIFLTAGASSAVDYLLSIFC-RGEETGVLIPIPQYPLYTATLALQNSHALPYYLNEETGW 291
           D+  T G ++A +  L +FC RG+     + + +   ++++LA   +  +  +       
Sbjct: 132 DVVATTGNTNAWESTLRVFCNRGD-----VILAEAHSFSSSLASAEAQGIITFPVPIDAH 186

Query: 292 STDPXXXXXXXXXXXXNNIKPSVLVVINPG-NPTGAVLSEEAIEQIFTLAAKYGIIVIAD 350
              P               KP +L  I  G NPTG+ L+ E  ++I+ +A K+  ++I D
Sbjct: 187 GIIPEKLEALLDNWTEGAPKPKLLYTIPTGQNPTGSSLNAERKKEIYRIAQKHDFLIIED 246

Query: 351 EVY 353
           E Y
Sbjct: 247 EPY 249

>Skud_7.69 Chr7 (120729..122231) [1503 bp, 500 aa] {ON} YGL202W
           (REAL)
          Length = 500

 Score = 37.7 bits (86), Expect = 0.068,   Method: Compositional matrix adjust.
 Identities = 29/123 (23%), Positives = 54/123 (43%), Gaps = 7/123 (5%)

Query: 233 DIFLTAGASSAVDYLLSIFC-RGEETGVLIPIPQYPLYTATLALQNSHALPYYLNEETGW 291
           D+  TAG ++  +  L +FC RG+     + + +   ++++LA   +  +  +       
Sbjct: 134 DVLATAGNTNGWESTLRVFCNRGD-----VILAEAHSFSSSLASAEAQGVITFPIPIDAG 188

Query: 292 STDPXXXXXXXXXXXXNNIKPSVLVVINPG-NPTGAVLSEEAIEQIFTLAAKYGIIVIAD 350
              P               KP +L  I  G NPTG  +++   E I+ +A K+  I++ D
Sbjct: 189 GIIPEKLAKIMDNWTAGAPKPKLLYTIPTGQNPTGTSIADHRKEAIYKIAQKHDFIIVED 248

Query: 351 EVY 353
           E Y
Sbjct: 249 EPY 251

>SAKL0G14564g Chr7 complement(1256845..1257795) [951 bp, 316 aa]
           {ON} similar to uniprot|P41903 Saccharomyces cerevisiae
           YJR019C TES1 Thioesterase peroxisomal acyl-CoA
           thioesterase
          Length = 316

 Score = 37.4 bits (85), Expect = 0.070,   Method: Compositional matrix adjust.
 Identities = 20/71 (28%), Positives = 36/71 (50%), Gaps = 3/71 (4%)

Query: 183 QDAIDRAKRLLD-DIGGSVGAYSSSQGVLGIRKTVADFITNRDDGIIAY--PEDIFLTAG 239
           Q   + A RL + ++ G++  YS     L  R  + DF+   + G++ Y  P D+F +  
Sbjct: 134 QSEYEVAHRLFEKEVVGNLERYSRINPTLSDRSNLKDFVDRFEKGVVDYRFPRDMFHSKH 193

Query: 240 ASSAVDYLLSI 250
           A+  +DY L +
Sbjct: 194 ATDTLDYYLRV 204

>Suva_6.136 Chr6 complement(227366..228700) [1335 bp, 444 aa] {ON}
           YJL060W (REAL)
          Length = 444

 Score = 37.7 bits (86), Expect = 0.073,   Method: Compositional matrix adjust.
 Identities = 14/50 (28%), Positives = 28/50 (56%)

Query: 311 KPSVLVVINPGNPTGAVLSEEAIEQIFTLAAKYGIIVIADEVYQENVFED 360
           K   +++  P NP G V + + +  +  +  K+ +++I+DEVY+   F D
Sbjct: 198 KTKAVIINTPNNPIGKVFTHDELTTLGNICVKHNVVIISDEVYEHLYFTD 247

>Suva_7.61 Chr7 (112022..113524) [1503 bp, 500 aa] {ON} YGL202W
           (REAL)
          Length = 500

 Score = 37.7 bits (86), Expect = 0.075,   Method: Compositional matrix adjust.
 Identities = 32/123 (26%), Positives = 53/123 (43%), Gaps = 7/123 (5%)

Query: 233 DIFLTAGASSAVDYLLSIFC-RGEETGVLIPIPQYPLYTATLALQNSHALPYYLNEETGW 291
           D+  TAG ++A +  L +FC RG+   +L     +    A    Q   A P  ++ +   
Sbjct: 134 DVVATAGNTNAWESTLRVFCNRGDV--ILAEAHSFSSSLAAAEAQGIIAFPVPIDAD--- 188

Query: 292 STDPXXXXXXXXXXXXNNIKPSVLVVINPG-NPTGAVLSEEAIEQIFTLAAKYGIIVIAD 350
              P               KP +L  I  G NPTG  +++   E I+ +A K+  +++ D
Sbjct: 189 GIIPEKLAKIMDNWTPGAPKPKLLYTIPTGQNPTGTSIADHRKEAIYKIAQKHDFLIVED 248

Query: 351 EVY 353
           E Y
Sbjct: 249 EPY 251

>Kpol_1035.30 s1035 (69909..71414) [1506 bp, 501 aa] {ON}
           (69909..71414) [1506 nt, 502 aa]
          Length = 501

 Score = 37.4 bits (85), Expect = 0.088,   Method: Compositional matrix adjust.
 Identities = 19/44 (43%), Positives = 27/44 (61%), Gaps = 1/44 (2%)

Query: 311 KPSVLVVINPG-NPTGAVLSEEAIEQIFTLAAKYGIIVIADEVY 353
           KP+VL  I  G NPTG  LS E   +I+ +  K+ II++ D+ Y
Sbjct: 208 KPTVLYTIATGQNPTGMTLSMEKRRKIYKICQKHDIIIVEDDPY 251

>Kwal_14.2574 s14 complement(818144..819475) [1332 bp, 443 aa] {ON}
           YJL060W (BNA3) - 1:1 [contig 224] FULL
          Length = 443

 Score = 37.4 bits (85), Expect = 0.088,   Method: Compositional matrix adjust.
 Identities = 16/48 (33%), Positives = 28/48 (58%)

Query: 311 KPSVLVVINPGNPTGAVLSEEAIEQIFTLAAKYGIIVIADEVYQENVF 358
           K   L++  P NP G V + E + +I  +  K+ +++I+DEVY+   F
Sbjct: 197 KTKALILNTPHNPVGKVFTREELLRIGEICVKHNVVIISDEVYEHLYF 244

>KNAG0B05320 Chr2 (1028845..1030146) [1302 bp, 433 aa] {ON}
           Anc_1.321 YJL060W
          Length = 433

 Score = 37.4 bits (85), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 37/169 (21%), Positives = 71/169 (42%), Gaps = 20/169 (11%)

Query: 203 YSSSQGVLGIRKTVADFITNRDDGIIAYPEDIFLTAGASSAV-DYLLSIFCRGEETGVLI 261
           YS ++G   + K +AD  T      ++  ++I +  GA+ A+   L+ +  +G+E  V++
Sbjct: 77  YSPTRGRPNLIKALADLYTPLYGQQLS-ADNITVHTGANEAIFSCLMGLLNKGDE--VIV 133

Query: 262 PIPQYPLYTATLALQNS----------HALPYYLNEETGWSTDPXXXXXXXXXXXXNNIK 311
             P +  Y + + L               L   +   T W  D              N +
Sbjct: 134 FEPFFDQYISNIELAGGVVRYVPINPPRELDDRVTRGTEWEIDWDILEKTI------NSR 187

Query: 312 PSVLVVINPGNPTGAVLSEEAIEQIFTLAAKYGIIVIADEVYQENVFED 360
              +++  P NP G V + E + ++  +     I++I+DEVY+   F D
Sbjct: 188 TKCVIINTPHNPIGKVFTREELLRLGKICVDNNIVIISDEVYEHLYFSD 236

>NDAI0B03730 Chr2 complement(935131..936291) [1161 bp, 386 aa] {ON}
           Anc_2.252 YIL116W
          Length = 386

 Score = 37.0 bits (84), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 29/125 (23%), Positives = 53/125 (42%), Gaps = 11/125 (8%)

Query: 232 EDIFLTAGASSAVDYLLSIFCRGEETGVLIPIPQYPLYTATLALQNSHALP---YYLNEE 288
           E++ L  G+  ++D ++   C   +  +L+  P Y +Y+    + +   +     Y N  
Sbjct: 89  ENLCLGVGSDESIDAIIRATCVPGKEKILVLPPTYSMYSVCAEINDIEIVECPLLYKNNS 148

Query: 289 TGWSTDPXXXXXXXXXXXXNNIKPSVLVVINPGNPTGAVLSEEAIEQIFTLAAKYGIIVI 348
               T+             N+    +L + +PGNPTGA +  E IE +  L      +V+
Sbjct: 149 FQMDTE------SVLTVLQNDPLIKLLFITSPGNPTGARIETERIETV--LQNWTDGLVV 200

Query: 349 ADEVY 353
            DE Y
Sbjct: 201 VDEAY 205

>KLLA0F01617g Chr6 complement(154025..155359) [1335 bp, 444 aa] {ON}
           highly similar to uniprot|P47039 Saccharomyces
           cerevisiae YJL060W BNA3 Arylformamidase
          Length = 444

 Score = 37.0 bits (84), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 17/52 (32%), Positives = 28/52 (53%)

Query: 309 NIKPSVLVVINPGNPTGAVLSEEAIEQIFTLAAKYGIIVIADEVYQENVFED 360
           N +   +++  P NP G V + E + Q+  +  K  I +I+DEVY+   F D
Sbjct: 196 NERTKCIILNTPHNPIGKVFTREELTQLGDICVKNNIYIISDEVYEHLYFGD 247

>NDAI0I02830 Chr9 complement(669885..671387) [1503 bp, 500 aa] {ON}
           Anc_3.511
          Length = 500

 Score = 37.0 bits (84), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 32/123 (26%), Positives = 51/123 (41%), Gaps = 7/123 (5%)

Query: 233 DIFLTAGASSAVDYLLSIFC-RGEETGVLIPIPQYPLYTATLALQNSHALPYYLNEETGW 291
           DI  TAG ++A +  L +FC RG+   +L     +    A    Q     P  +++    
Sbjct: 133 DIIATAGNTNAWESTLRVFCNRGDV--ILAEAHSFSSCLAAAQAQGITTFPIPIDDN--- 187

Query: 292 STDPXXXXXXXXXXXXNNIKPSVLVVINPG-NPTGAVLSEEAIEQIFTLAAKYGIIVIAD 350
              P               KP +L  I  G NPTG  L    +E+I+ +A K+  +++ D
Sbjct: 188 GIIPEKLEKILDNWTPGAPKPKLLYTIPTGQNPTGTSLPAHRMEEIYRIAQKHDFLIVED 247

Query: 351 EVY 353
             Y
Sbjct: 248 APY 250

>ZYRO0A01672g Chr1 (136284..137444) [1161 bp, 386 aa] {ON} highly
           similar to uniprot|P07172 Saccharomyces cerevisiae
           YIL116W HIS5 Histidinol-phosphate aminotransferase
           catalyzes the seventh step in histidine biosynthesis
           responsive to general control of amino acid biosynthesis
           mutations cause histidine auxotrophy and sensitivity to
           Cu Co and Ni salts
          Length = 386

 Score = 36.6 bits (83), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 28/124 (22%), Positives = 55/124 (44%), Gaps = 9/124 (7%)

Query: 232 EDIFLTAGASSAVDYLLSIFCRGEETGVLIPIPQYPLYTATLALQNSHALPYYLNEETGW 291
           E++ L  G+  ++D ++   C   +  +L+  P Y +Y+    + +   +   L      
Sbjct: 87  ENLCLGVGSDESIDAIIRACCVPAKEKILVLPPTYSMYSVCAHINDVEIVKCPL-----I 141

Query: 292 STDPXXXXXXXXXXXXNNIKPSV--LVVINPGNPTGAVLSEEAIEQIFTLAAKYGIIVIA 349
           ++D                 PS+  + + +PGNPTGA +    IE+I     + G++V+ 
Sbjct: 142 TSDNSFQANTDEVIKTAQNDPSIKLIFITSPGNPTGAKVETSRIEKILQNWDR-GMVVV- 199

Query: 350 DEVY 353
           DE Y
Sbjct: 200 DEAY 203

>KLTH0H10648g Chr8 complement(919601..920932) [1332 bp, 443 aa] {ON}
           highly similar to uniprot|P47039 Saccharomyces
           cerevisiae YJL060W BNA3 Arylformamidase involved in
           biosynthesis of nicotinic acid from tryptophan via
           kynurenine pathway potential Cdc28p substrate
          Length = 443

 Score = 36.6 bits (83), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 16/48 (33%), Positives = 27/48 (56%)

Query: 311 KPSVLVVINPGNPTGAVLSEEAIEQIFTLAAKYGIIVIADEVYQENVF 358
           K   L++  P NP G V + E + QI  +  +  +++I+DEVY+   F
Sbjct: 197 KTKALILNTPHNPVGKVFTREELLQIGQICVENNVVIISDEVYEHLYF 244

>Ecym_6319 Chr6 complement(607599..608663) [1065 bp, 354 aa] {ON}
           similar to Ashbya gossypii AEL170C
          Length = 354

 Score = 36.2 bits (82), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 62/285 (21%), Positives = 117/285 (41%), Gaps = 43/285 (15%)

Query: 231 PEDIFLTAGASSAV-DYLLSIFCRGEETGVLIPI-PQYPLYTATLALQNSHA-------L 281
           PE+I +T GA+  +   L+S+   G+E  VL P   QY      L     H        L
Sbjct: 99  PENIQVTTGANVGIFACLMSLLNPGDEVIVLEPFFDQYIYNIKVLGGIVKHVPLTPPKDL 158

Query: 282 PYYLNEETGWSTDPXXXXXXXXXXXXNNIKPSVLVVINPGNPTGAVLSEEAIEQIFTLAA 341
                + + W+ D                K   +++ +P NPTG V + E +  +  +  
Sbjct: 159 KTRRTKGSEWTLDFDQFRSAISE------KTKAVIINSPHNPTGKVFTREELLTLGNICV 212

Query: 342 KYGIIVIADEVYQENVF--EDVKFHSMKKVLRQLQMKQPGLYDNVQLASLHSTSKGVSGE 399
           +  + +I+DEVY+   F  E VK  S+   +  + +            ++ S  K +   
Sbjct: 213 EKNVYIISDEVYENLYFTPECVKLASLSPEISNITL------------TIGSAGK-IFAV 259

Query: 400 CGQRGGYMELVGFTHDIRQVVLKLASISLCPVVTGQALVDLMVCPPQKGEESYEQDQEER 459
            G R G++     + ++   +LKLAS +   +         + C     + +   D  +R
Sbjct: 260 TGWRIGWI----ISENVE--LLKLASSAHIKICFSSPSPPQLAC-AHAIDIALNSDYFDR 312

Query: 460 RNIHKELHKRATLLHDAFVKLDGISCQKPQGAMYL---FPKLELP 501
             + K+  ++  +L   F +L G+    P+G+ ++   F KL++P
Sbjct: 313 --MRKDYIEKVEILTSVFEEL-GMPYTVPEGSYFIVVDFSKLKIP 354

>KLTH0G19624g Chr7 complement(1697587..1698993) [1407 bp, 468 aa]
           {ON} similar to uniprot|P10356 Saccharomyces cerevisiae
           YER152C Hypothetical ORF
          Length = 468

 Score = 36.2 bits (82), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 15/32 (46%), Positives = 23/32 (71%)

Query: 322 NPTGAVLSEEAIEQIFTLAAKYGIIVIADEVY 353
           NPTGA+ S  +  ++  LA KY I++I+D+VY
Sbjct: 198 NPTGAIYSRSSRLKLLELARKYDILIISDDVY 229

>ZYRO0C06028g Chr3 (457564..459054) [1491 bp, 496 aa] {ON} highly
           similar to uniprot|P53090 Saccharomyces cerevisiae
           YGL202W ARO8 Aromatic aminotransferase expression is
           regulated by general control of amino acid biosynthesis
          Length = 496

 Score = 36.2 bits (82), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 30/124 (24%), Positives = 53/124 (42%), Gaps = 9/124 (7%)

Query: 233 DIFLTAGASSAVDYLLSIFCRGEETGVLIPIPQYPLYT--ATLALQNSHALPYYLNEETG 290
           ++  + G ++A +  L IFC   + G ++   +Y   +  A    Q    +P  ++    
Sbjct: 131 EVIASVGNTNAWESTLRIFC---DRGDVVLFEEYSFSSCLAACEAQGVTTIPIPID---A 184

Query: 291 WSTDPXXXXXXXXXXXXNNIKPSVLVVINPG-NPTGAVLSEEAIEQIFTLAAKYGIIVIA 349
           +   P            N  KP +L  I  G NPTG  L  +  E I+ +A K+  +++ 
Sbjct: 185 FGIVPEKLEDLLDNWTPNAPKPKLLYTIPTGQNPTGTSLPNDRREAIYRIAQKHDFLIVE 244

Query: 350 DEVY 353
           DE Y
Sbjct: 245 DEPY 248

>KLTH0B00176g Chr2 (10791..12137) [1347 bp, 448 aa] {ON} similar to
           uniprot|P10356 Saccharomyces cerevisiae YER152C
           Hypothetical ORF
          Length = 448

 Score = 36.2 bits (82), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 15/32 (46%), Positives = 23/32 (71%)

Query: 322 NPTGAVLSEEAIEQIFTLAAKYGIIVIADEVY 353
           NPTGA+ S  +  ++  LA KY I++I+D+VY
Sbjct: 199 NPTGAIYSRSSRLKLLELARKYDILIISDDVY 230

>KNAG0H03730 Chr8 (690872..692443) [1572 bp, 523 aa] {ON} Anc_2.102
           YHR137W
          Length = 523

 Score = 35.8 bits (81), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 17/44 (38%), Positives = 27/44 (61%), Gaps = 1/44 (2%)

Query: 311 KPSVLVVINPG-NPTGAVLSEEAIEQIFTLAAKYGIIVIADEVY 353
           KP+++  +  G NPTG  LS E   QI+ LA ++  I++ D+ Y
Sbjct: 241 KPTLMYTVVTGQNPTGVSLSYEKRRQIYALAQRHNFIIVEDDPY 284

>Kpol_480.1 s480 (215..1357) [1143 bp, 380 aa] {ON} (215..1357)
           [1143 nt, 381 aa]
          Length = 380

 Score = 35.8 bits (81), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 31/47 (65%), Gaps = 2/47 (4%)

Query: 308 NNIKPSVLVVINPGNPTGAVLSEEAIEQIFTLAAKYGIIVIADEVYQ 354
           NN K  ++++ NP NP G+V+ ++ ++QI  L  +  I + +DEVY+
Sbjct: 150 NNTK--LIIINNPNNPLGSVIKKDLLKQICKLCEENDIYLHSDEVYR 194

>Ecym_7228 Chr7 (473169..474635) [1467 bp, 488 aa] {ON} similar to
           Ashbya gossypii AGR167W
          Length = 488

 Score = 35.0 bits (79), Expect = 0.47,   Method: Compositional matrix adjust.
 Identities = 30/125 (24%), Positives = 54/125 (43%), Gaps = 8/125 (6%)

Query: 233 DIFLTAGASSAVDYLLSIFCRGEETGVLIPIPQYPLYTATLALQNSHALPYYLNEETGWS 292
           D+ +TAG++ A D  L +FC   ++ +L    +   Y++++    +  +     E  G  
Sbjct: 129 DVLITAGSTQAWDASLRLFCNPGDSVLL----ESWTYSSSVEAAEAQGMYCVGVEIDGHG 184

Query: 293 TDPXXXXXXXXXXXX---NNIKPSVLVVINPG-NPTGAVLSEEAIEQIFTLAAKYGIIVI 348
             P                   P +L VI  G NP G  L++E    I+ +  KY +++I
Sbjct: 185 VVPEKLEWLLQNWDDLHPGRSLPKLLYVIPTGQNPMGVTLADERKPLIYNIIQKYDMVLI 244

Query: 349 ADEVY 353
            D+ Y
Sbjct: 245 EDDPY 249

>SAKL0D06886g Chr4 complement(571478..572821) [1344 bp, 447 aa] {ON}
           highly similar to uniprot|P47039 Saccharomyces
           cerevisiae YJL060W BNA3 Arylformamidase involved in
           biosynthesis of nicotinic acid from tryptophan via
           kynurenine pathway potential Cdc28p substrate
          Length = 447

 Score = 35.0 bits (79), Expect = 0.48,   Method: Compositional matrix adjust.
 Identities = 15/48 (31%), Positives = 27/48 (56%)

Query: 311 KPSVLVVINPGNPTGAVLSEEAIEQIFTLAAKYGIIVIADEVYQENVF 358
           K   L++  P NP G V + E + +I  +  +  +++I+DEVY+   F
Sbjct: 201 KTKALILNTPHNPIGKVFTREELLEIGNICVENNVVIISDEVYEHLYF 248

>TPHA0O01520 Chr15 (304547..306058) [1512 bp, 503 aa] {ON} Anc_2.102
           YHR137W
          Length = 503

 Score = 35.0 bits (79), Expect = 0.57,   Method: Compositional matrix adjust.
 Identities = 18/44 (40%), Positives = 26/44 (59%), Gaps = 1/44 (2%)

Query: 311 KPSVLVVINPG-NPTGAVLSEEAIEQIFTLAAKYGIIVIADEVY 353
           KP +L  I  G NPTG  LS E   +I+ +  K+ II++ D+ Y
Sbjct: 208 KPKMLYTIATGQNPTGMTLSMEKRRKIYEICQKHDIIILEDDPY 251

>Kwal_8.585 s8 (15757..17097) [1341 bp, 446 aa] {ON} YER152C -
           Hypothetical ORF [contig 311] FULL
          Length = 446

 Score = 34.7 bits (78), Expect = 0.61,   Method: Compositional matrix adjust.
 Identities = 14/32 (43%), Positives = 23/32 (71%)

Query: 322 NPTGAVLSEEAIEQIFTLAAKYGIIVIADEVY 353
           NP+GA  S+E   ++  LA +Y I++I+D+VY
Sbjct: 200 NPSGATYSQECRLKLLDLARRYDILIISDDVY 231

>YIL116W Chr9 (142928..144085) [1158 bp, 385 aa] {ON}
           HIS5Histidinol-phosphate aminotransferase, catalyzes the
           seventh step in histidine biosynthesis; responsive to
           general control of amino acid biosynthesis; mutations
           cause histidine auxotrophy and sensitivity to Cu, Co,
           and Ni salts
          Length = 385

 Score = 34.3 bits (77), Expect = 0.80,   Method: Compositional matrix adjust.
 Identities = 27/123 (21%), Positives = 54/123 (43%), Gaps = 7/123 (5%)

Query: 232 EDIFLTAGASSAVDYLLSIFCRGEETGVLIPIPQYPLYTATLALQNSHALPYYLNEETG- 290
           +++ L  G+  ++D ++   C   +  +L+  P Y +Y+    + +   +   L    G 
Sbjct: 88  DNLCLGVGSDESIDAIIRACCVPGKEKILVLPPTYSMYSVCANINDIEVVQCPLTVSDGS 147

Query: 291 WSTDPXXXXXXXXXXXXNNIKPSVLVVINPGNPTGAVLSEEAIEQIFTLAAKYGIIVIAD 350
           +  D             N+    ++ V +PGNPTGA +    IE++       G++V+ D
Sbjct: 148 FQMD----TEAVLTILKNDSLIKLMFVTSPGNPTGAKIKTSLIEKVLQ-NWDNGLVVV-D 201

Query: 351 EVY 353
           E Y
Sbjct: 202 EAY 204

>KNAG0G00550 Chr7 (96823..97986) [1164 bp, 387 aa] {ON} Anc_1.472
          Length = 387

 Score = 34.3 bits (77), Expect = 0.80,   Method: Compositional matrix adjust.
 Identities = 22/85 (25%), Positives = 42/85 (49%), Gaps = 7/85 (8%)

Query: 314 VLVVINPGNPTGAVLSEEAIEQIFTLAAKYGIIVIADEVYQENVFEDVKFHSMKKVLRQL 373
           ++++ NP NP G V+S+E +  I  L  +  + +  DEVY+        FHS+   +   
Sbjct: 155 LIIINNPNNPLGCVISDELLTSICELCKEKNVYLHCDEVYRP------IFHSLPSGVTTP 208

Query: 374 QMKQPGLYDNVQLASLHSTSKGVSG 398
           +     +YDN  ++   S +  ++G
Sbjct: 209 R-SAAQIYDNAVVSGSMSKAFSLAG 232

>Suva_9.78 Chr9 (137747..138907) [1161 bp, 386 aa] {ON} YIL116W
           (REAL)
          Length = 386

 Score = 34.3 bits (77), Expect = 0.80,   Method: Compositional matrix adjust.
 Identities = 27/124 (21%), Positives = 58/124 (46%), Gaps = 9/124 (7%)

Query: 232 EDIFLTAGASSAVDYLLSIFCRGEETGVLIPIPQYPLYTATLALQNSHAL--PYYLNEET 289
           +++ L  G+  ++D ++   C   +  +L+  P Y +Y+    + +   +  P  +++ +
Sbjct: 88  DNLCLGVGSDESIDAIIRACCVPGKEKILVLPPTYSMYSVCANINDIEVVQCPLVVSDNS 147

Query: 290 GWSTDPXXXXXXXXXXXXNNIKPSVLVVINPGNPTGAVLSEEAIEQIFTLAAKYGIIVIA 349
            +  D             N+    ++ V +PGNPTGA +    IEQ+     + G++V+ 
Sbjct: 148 -FQMD----VEAVLTILENDPLIKLVFVTSPGNPTGAKIKTSLIEQVLQ-NWQNGLVVV- 200

Query: 350 DEVY 353
           DE Y
Sbjct: 201 DEAY 204

>KAFR0J01580 Chr10 complement(287313..288464) [1152 bp, 383 aa] {ON}
           Anc_2.252 YIL116W
          Length = 383

 Score = 34.3 bits (77), Expect = 0.91,   Method: Compositional matrix adjust.
 Identities = 27/123 (21%), Positives = 53/123 (43%), Gaps = 7/123 (5%)

Query: 232 EDIFLTAGASSAVDYLLSIFCRGEETGVLIPIPQYPLYTATLALQNSHALPY-YLNEETG 290
           E+  L  G+  ++D ++   C   +  +L+  P Y +Y+    + +   +    + E+  
Sbjct: 87  ENFCLGVGSDESIDAIIRASCVPSKEKILVLPPTYSMYSVCANINDVDVVTCPLITEDNS 146

Query: 291 WSTDPXXXXXXXXXXXXNNIKPSVLVVINPGNPTGAVLSEEAIEQIFTLAAKYGIIVIAD 350
           +  D             N+    ++ + +PGNPTGA +  + IE  + L      +VI D
Sbjct: 147 FQIDATEILNILA----NDPLIKLVFITSPGNPTGAKIEIDRIE--YLLKNWDQGLVIVD 200

Query: 351 EVY 353
           E Y
Sbjct: 201 EAY 203

>NCAS0G04050 Chr7 complement(753216..754370) [1155 bp, 384 aa] {ON}
           Anc_1.472
          Length = 384

 Score = 34.3 bits (77), Expect = 0.92,   Method: Compositional matrix adjust.
 Identities = 18/53 (33%), Positives = 28/53 (52%), Gaps = 6/53 (11%)

Query: 314 VLVVINPGNPTGAVLSEEAIEQIFTLAAKYGIIVIADEVYQENVFEDVKFHSM 366
           ++++ NP NP G+ +S E +  I  L  +  I +  DEVY+        FHSM
Sbjct: 154 LIIINNPNNPLGSAISTETLNDICQLCEENNIYLHCDEVYKP------IFHSM 200

>KNAG0G01680 Chr7 complement(369892..371250) [1359 bp, 452 aa] {ON}
           Anc_8.204 YER152C
          Length = 452

 Score = 33.9 bits (76), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 14/34 (41%), Positives = 22/34 (64%)

Query: 321 GNPTGAVLSEEAIEQIFTLAAKYGIIVIADEVYQ 354
            NP+G   S E  +++  LA KY +++IAD+VY 
Sbjct: 205 ANPSGMSFSLETKKKLLDLARKYDMLIIADDVYD 238

>TDEL0D05790 Chr4 complement(1045218..1046711) [1494 bp, 497 aa]
           {ON} Anc_3.511 YGL202W
          Length = 497

 Score = 33.9 bits (76), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 16/44 (36%), Positives = 28/44 (63%), Gaps = 1/44 (2%)

Query: 311 KPSVLVVINPG-NPTGAVLSEEAIEQIFTLAAKYGIIVIADEVY 353
           +P +L  I  G NPTG  L+++  ++I+ +A K+  ++I DE Y
Sbjct: 205 RPKLLYTIPTGQNPTGTSLADDRKKEIYRIAQKHDFLIIEDEPY 248

>CAGL0C01243g Chr3 (128629..129780) [1152 bp, 383 aa] {ON} highly
           similar to uniprot|P07172 Saccharomyces cerevisiae
           YIL116w HIS5
          Length = 383

 Score = 33.5 bits (75), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 30/122 (24%), Positives = 52/122 (42%), Gaps = 5/122 (4%)

Query: 232 EDIFLTAGASSAVDYLLSIFCRGEETGVLIPIPQYPLYTATLALQNSHALPYYLNEETGW 291
           +++ L  G+  ++D ++   C   +  +L   P Y +Y+    + +   L   L  E   
Sbjct: 87  DNLCLGVGSDESIDAVIRACCVPGKEKILTLPPTYSMYSVCANINDVEVLECPLIYEDN- 145

Query: 292 STDPXXXXXXXXXXXXNNIKPSVLVVINPGNPTGAVLSEEAIEQIFTLAAKYGIIVIADE 351
           S  P              IK  ++ + +PGNPTGA +    I +I  L +  G  V+ DE
Sbjct: 146 SFQPDSQKVISILSSDPLIK--LVFLTSPGNPTGAKIDSNIIIKI--LESWDGGFVVVDE 201

Query: 352 VY 353
            Y
Sbjct: 202 AY 203

>TDEL0A01600 Chr1 (289263..290690) [1428 bp, 475 aa] {ON} Anc_8.204
           YER152C
          Length = 475

 Score = 33.9 bits (76), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 14/32 (43%), Positives = 21/32 (65%)

Query: 322 NPTGAVLSEEAIEQIFTLAAKYGIIVIADEVY 353
           NPTG   S E   ++  +A KY +++IAD+VY
Sbjct: 202 NPTGTTYSTETKLKLIEIARKYDMLIIADDVY 233

>Skud_9.55 Chr9 (119747..120904) [1158 bp, 385 aa] {ON} YIL116W
           (REAL)
          Length = 385

 Score = 33.5 bits (75), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 27/123 (21%), Positives = 55/123 (44%), Gaps = 7/123 (5%)

Query: 232 EDIFLTAGASSAVDYLLSIFCRGEETGVLIPIPQYPLYTATLALQNSHALPYYLN-EETG 290
           +++ L  G+  ++D ++   C   +  +L+  P Y +Y+    + +   +   L   +  
Sbjct: 88  DNLCLGVGSDESIDAIIRACCVPGKEKILVLPPTYSMYSVCANINDVEVVQCPLTVSDNS 147

Query: 291 WSTDPXXXXXXXXXXXXNNIKPSVLVVINPGNPTGAVLSEEAIEQIFTLAAKYGIIVIAD 350
           +  D             N+    ++ V +PGNPTGA +    IE+I     + G++V+ D
Sbjct: 148 FQMD----TEAALTILKNDPLIKLIFVTSPGNPTGAKIKTCLIEKILQ-NWENGLVVV-D 201

Query: 351 EVY 353
           E Y
Sbjct: 202 EAY 204

>KLLA0F22000g Chr6 complement(2044973..2047354) [2382 bp, 793 aa]
           {ON} similar to uniprot|P42935 Saccharomyces cerevisiae
           YGR200C ELP2 Elongator protein part of the six-subunit
           RNA polymerase II Elongator histone acetyltransferase
           complex target of Kluyveromyces lactis zymocin
          Length = 793

 Score = 33.5 bits (75), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 13/30 (43%), Positives = 18/30 (60%)

Query: 392 TSKGVSGECGQRGGYMELVGFTHDIRQVVL 421
           +SKG S   G  GG+   + FTHD + V+L
Sbjct: 325 SSKGASTATGSSGGFWSCIWFTHDGKDVIL 354

>Ecym_5542 Chr5 (1099530..1100870) [1341 bp, 446 aa] {ON} similar to
           Ashbya gossypii AGR141C
          Length = 446

 Score = 33.1 bits (74), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 45/162 (27%), Positives = 71/162 (43%), Gaps = 14/162 (8%)

Query: 322 NPTGAVLSEEAIEQIFTLAAKYGIIVIADEVYQENVFEDVKFHSMKKVLRQLQMKQPGLY 381
           NP+G   S     ++  LA KY I++I+D+VY   V+ D    ++ K L +L       Y
Sbjct: 199 NPSGKTYSVSTRLKLVELARKYDILLISDDVYDLLVY-DQPCDALPKCLPRLTHLDRASY 257

Query: 382 DNVQLASLHSTSKGVSGEC---GQRGGYMELVGFTHDIRQVVLKLASIS-LCPVVTGQAL 437
           +  +    ++ S     +    G R GY E V     + Q+    A+IS   P      L
Sbjct: 258 EYGENGYGNTISNATFSKVIAPGLRCGYQESVNMNL-VYQLSQGGANISGGSPAQLNSML 316

Query: 438 VDLMVCPPQKGEESYEQDQEERRNIHKELHKRATLLHDAFVK 479
           +  +      GE   +   E+ R I+K    RAT+L+DA  K
Sbjct: 317 IGTLFI---NGEA--DVILEDLRTIYK---YRATVLYDAIKK 350

>KLLA0D11110g Chr4 (948248..949840) [1593 bp, 530 aa] {ON} similar
           to uniprot|P38840 Saccharomyces cerevisiae YHR137W ARO9
           Aromatic aminotransferase catalyzes the first step of
           tryptophan phenylalanine and tyrosine catabolism
          Length = 530

 Score = 33.1 bits (74), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 17/44 (38%), Positives = 26/44 (59%), Gaps = 1/44 (2%)

Query: 311 KPSVLVVINPG-NPTGAVLSEEAIEQIFTLAAKYGIIVIADEVY 353
           KP +L  I  G NPTG    +E  ++I+ L  K+ II++ D+ Y
Sbjct: 244 KPRLLYTIVTGQNPTGMTQCKEKRQKIYDLCEKHDIIIVEDDPY 287

>SAKL0H18612g Chr8 (1655787..1657124) [1338 bp, 445 aa] {ON} highly
           similar to gnl|GLV|KLLA0E00935g Kluyveromyces lactis
           KLLA0E00935g and similar to YER152C uniprot|P10356
           Saccharomyces cerevisiae YER152C Hypothetical ORF
          Length = 445

 Score = 32.7 bits (73), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 26/50 (52%), Gaps = 3/50 (6%)

Query: 202 AYSSSQGVLGIRKTVADF---ITNRDDGIIAYPEDIFLTAGASSAVDYLL 248
            Y S +G L +R+ + DF   +    D + + PE I LT GAS  V  +L
Sbjct: 50  TYGSDEGALWVRQAICDFSNHVFGLSDSVKSKPEFINLTGGASYGVMNIL 99

>NCAS0B06440 Chr2 complement(1218759..1219916) [1158 bp, 385 aa]
           {ON} Anc_2.252 YIL116W
          Length = 385

 Score = 32.7 bits (73), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 29/142 (20%), Positives = 63/142 (44%), Gaps = 9/142 (6%)

Query: 213 RKTVADFITNRDDGIIAYPEDIFLTAGASSAVDYLLSIFCRGEETGVLIPIPQYPLYTAT 272
           R T + F  +RD   +   E++ L  G+  ++D ++   C   +  +L+  P Y +Y+  
Sbjct: 71  RNTTSAF-KDRDLATLT-NENLCLGVGSDESIDAIIRACCVPAKEKILVLPPTYSMYSVC 128

Query: 273 LALQNSHALPY-YLNEETGWSTDPXXXXXXXXXXXXNNIKPSVLVVINPGNPTGAVLSEE 331
             + +   +    + E+  +  +             N+    ++ + +PGNPTG  +  +
Sbjct: 129 ANINDIEVVECPLIYEDNSFQLNSDKVLDILK----NDPLIKLVFITSPGNPTGVKIETK 184

Query: 332 AIEQIFTLAAKYGIIVIADEVY 353
            IE++       G++V+ DE Y
Sbjct: 185 RIEKVLQ-NWDNGLVVV-DEAY 204

>Smik_9.53 Chr9 (120672..121838) [1167 bp, 388 aa] {ON} YIL116W
           (REAL)
          Length = 388

 Score = 32.3 bits (72), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 29/125 (23%), Positives = 53/125 (42%), Gaps = 11/125 (8%)

Query: 232 EDIFLTAGASSAVDYLLSIFCRGEETGVLIPIPQYPLYTATLALQNSHALPYYLNEETGW 291
           +++ L  G+  ++D ++   C   +  +L+  P Y +Y+    + +   +   L      
Sbjct: 88  DNLCLGVGSDESIDAIIRACCVPGKEKILVLPPTYSMYSVCANINDVEVVQCPLT----V 143

Query: 292 STDPXXXXXXXXXXXXNN---IKPSVLVVINPGNPTGAVLSEEAIEQIFTLAAKYGIIVI 348
           S +             NN   IK  ++   +PGNPTGA +    IE++  L      IV+
Sbjct: 144 SDNSFQMNTEAVLTILNNDPLIK--IMFATSPGNPTGAKIKTCLIEEV--LQKWDNGIVV 199

Query: 349 ADEVY 353
            DE Y
Sbjct: 200 VDEAY 204

>TDEL0C04090 Chr3 complement(722310..723461) [1152 bp, 383 aa] {ON}
           Anc_2.252 YIL116W
          Length = 383

 Score = 32.3 bits (72), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 31/128 (24%), Positives = 58/128 (45%), Gaps = 17/128 (13%)

Query: 232 EDIFLTAGASSAVDYLLSIFCR-GEETGVLIPIPQYPLYTATLALQNSHALPYYL-NEET 289
           E++ L  G+  ++D ++   C  G+E  + +P P Y +Y+   ++ +   +   L   + 
Sbjct: 85  ENLCLGVGSDESIDAIIRATCVPGKEKIMAMP-PTYGMYSVCASVNDVEIVKCPLVTSDN 143

Query: 290 GWSTDPXXXXXXXXXXXXNNIKPSVLV----VINPGNPTGAVLSEEAIEQIFTLAAKYGI 345
            +  D             + +K   L+    + +PGNPTGA +    IE+I       GI
Sbjct: 144 SFQVD--------TEAVLDTLKKDPLIKLVFITSPGNPTGAKIETSRIEKILQ-NWDQGI 194

Query: 346 IVIADEVY 353
           +V+ DE Y
Sbjct: 195 LVV-DEAY 201

>CAGL0G06028g Chr7 complement(579261..580874) [1614 bp, 537 aa] {ON}
           similar to uniprot|P38840 Saccharomyces cerevisiae
           YHR137w ARO9 aromatic amino acid aminotransferase II
          Length = 537

 Score = 32.0 bits (71), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 16/44 (36%), Positives = 25/44 (56%), Gaps = 1/44 (2%)

Query: 311 KPSVLVVINPG-NPTGAVLSEEAIEQIFTLAAKYGIIVIADEVY 353
           KP +L  I  G NPTG  +  E   +I+ LA K+  +++ D+ Y
Sbjct: 240 KPRILYTICTGQNPTGVTIPMENRRKIYELAHKHNFLILEDDPY 283

>Smik_10.150 Chr10 (249211..252732) [3522 bp, 1173 aa] {ON} YJL092W
           (REAL)
          Length = 1173

 Score = 31.6 bits (70), Expect = 6.5,   Method: Compositional matrix adjust.
 Identities = 19/69 (27%), Positives = 36/69 (52%), Gaps = 2/69 (2%)

Query: 78  EIHHHSHNNLPFLPAEQATLKDVNECVLNAKYAVRGAIPMRAEELKTQLMENPHSLPFND 137
           E H  +  N+PFL  E  ++ D++E   ++  +++GA P ++  +   LME   +  F +
Sbjct: 915 EFHCSTGRNVPFLRREDRSITDISE--RSSTRSLKGASPNKSSRVSHVLMEQSPTRLFKN 972

Query: 138 IINANIGNP 146
            +  NI  P
Sbjct: 973 NVVRNIHVP 981

>Smik_5.319 Chr5 complement(477840..479171) [1332 bp, 443 aa] {ON}
           YER152C (REAL)
          Length = 443

 Score = 31.2 bits (69), Expect = 7.4,   Method: Compositional matrix adjust.
 Identities = 13/33 (39%), Positives = 21/33 (63%)

Query: 321 GNPTGAVLSEEAIEQIFTLAAKYGIIVIADEVY 353
            NP+G   S E   ++  +A KY ++VI+D+VY
Sbjct: 195 ANPSGNTYSLETRRRLIDIARKYDMLVISDDVY 227

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.135    0.400 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 59,284,316
Number of extensions: 2519587
Number of successful extensions: 6919
Number of sequences better than 10.0: 125
Number of HSP's gapped: 7007
Number of HSP's successfully gapped: 125
Length of query: 574
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 459
Effective length of database: 40,294,809
Effective search space: 18495317331
Effective search space used: 18495317331
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 68 (30.8 bits)