Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
CAGL0L12232g8.261ON59159128810.0
YLR088W (GAA1)8.261ON61459817800.0
Skud_12.1568.261ON61259617760.0
Smik_12.1478.261ON61359717520.0
Suva_10.1728.261ON61459817220.0
TDEL0F038808.261ON57959116690.0
SAKL0H17050g8.261ON58456716590.0
Kpol_543.378.261ON57856616270.0
NCAS0B038608.261ON58356616050.0
AGR087C8.261ON57756715920.0
NDAI0J013908.261ON58356815860.0
KLTH0G13706g8.261ON58456715830.0
TBLA0F030808.261ON58356815810.0
ZYRO0C01672g8.261ON56956615640.0
Ecym_43098.261ON57756715570.0
KNAG0H032508.261ON58552915570.0
KAFR0B055508.261ON55555515270.0
Kwal_56.238048.261ON57856715270.0
KLLA0F19118g8.261ON57856815180.0
TPHA0A018208.261ON58156615150.0
TPHA0E004607.476ON57694860.084
Kpol_1013.787.476ON576156850.099
TDEL0C033907.476ON57681820.24
KLTH0E01914g7.476ON576114820.24
Skud_2.647.476ON57998810.29
Kpol_1028.967.476ON57974810.37
Smik_2.767.476ON579144810.37
YBL039C (URA7)7.476ON579144800.38
CAGL0F04433g7.476ON578100800.49
NDAI0J006307.476ON579100770.87
KAFR0B006807.476ON57794751.6
KNAG0F035607.476ON577100751.8
Kwal_55.198967.476ON576131751.9
Suva_2.807.476ON57998751.9
Suva_15.2355.285ON856123742.1
Kwal_26.71547.86ON121344723.8
TBLA0F026507.476ON580116714.6
NCAS0A148507.476ON57994714.7
Kpol_1023.1004.351ON91697715.5
Suva_12.1927.476ON57381707.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0L12232g
         (591 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0L12232g Chr12 (1324754..1326529) [1776 bp, 591 aa] {ON} sim...  1114   0.0  
YLR088W Chr12 (316107..317951) [1845 bp, 614 aa] {ON}  GAA1Subun...   690   0.0  
Skud_12.156 Chr12 (299282..301120) [1839 bp, 612 aa] {ON} YLR088...   688   0.0  
Smik_12.147 Chr12 (295948..297789) [1842 bp, 613 aa] {ON} YLR088...   679   0.0  
Suva_10.172 Chr10 (320928..322772) [1845 bp, 614 aa] {ON} YLR088...   667   0.0  
TDEL0F03880 Chr6 (722770..724509) [1740 bp, 579 aa] {ON} Anc_8.2...   647   0.0  
SAKL0H17050g Chr8 complement(1497051..1498805) [1755 bp, 584 aa]...   643   0.0  
Kpol_543.37 s543 (82589..84325) [1737 bp, 578 aa] {ON} (82589..8...   631   0.0  
NCAS0B03860 Chr2 complement(687424..689175) [1752 bp, 583 aa] {O...   622   0.0  
AGR087C Chr7 complement(890706..892439) [1734 bp, 577 aa] {ON} S...   617   0.0  
NDAI0J01390 Chr10 complement(319754..321505) [1752 bp, 583 aa] {...   615   0.0  
KLTH0G13706g Chr7 complement(1173326..1175080) [1755 bp, 584 aa]...   614   0.0  
TBLA0F03080 Chr6 complement(747695..749446) [1752 bp, 583 aa] {O...   613   0.0  
ZYRO0C01672g Chr3 complement(119344..121053) [1710 bp, 569 aa] {...   607   0.0  
Ecym_4309 Chr4 complement(656032..657765) [1734 bp, 577 aa] {ON}...   604   0.0  
KNAG0H03250 Chr8 complement(605885..607642) [1758 bp, 585 aa] {O...   604   0.0  
KAFR0B05550 Chr2 complement(1136432..1138099) [1668 bp, 555 aa] ...   592   0.0  
Kwal_56.23804 s56 complement(710216..711952) [1737 bp, 578 aa] {...   592   0.0  
KLLA0F19118g Chr6 (1771250..1772986) [1737 bp, 578 aa] {ON} simi...   589   0.0  
TPHA0A01820 Chr1 complement(367804..369549) [1746 bp, 581 aa] {O...   588   0.0  
TPHA0E00460 Chr5 complement(75495..77225) [1731 bp, 576 aa] {ON}...    38   0.084
Kpol_1013.78 s1013 complement(192175..193905) [1731 bp, 576 aa] ...    37   0.099
TDEL0C03390 Chr3 (599123..600853) [1731 bp, 576 aa] {ON} Anc_7.4...    36   0.24 
KLTH0E01914g Chr5 complement(178565..180295) [1731 bp, 576 aa] {...    36   0.24 
Skud_2.64 Chr2 complement(127777..129516) [1740 bp, 579 aa] {ON}...    36   0.29 
Kpol_1028.96 s1028 complement(214936..216675) [1740 bp, 579 aa] ...    36   0.37 
Smik_2.76 Chr2 complement(137720..139459) [1740 bp, 579 aa] {ON}...    36   0.37 
YBL039C Chr2 complement(143989..145728) [1740 bp, 579 aa] {ON}  ...    35   0.38 
CAGL0F04433g Chr6 (442206..443942) [1737 bp, 578 aa] {ON} highly...    35   0.49 
NDAI0J00630 Chr10 complement(128939..130678) [1740 bp, 579 aa] {...    34   0.87 
KAFR0B00680 Chr2 complement(131617..133350) [1734 bp, 577 aa] {O...    33   1.6  
KNAG0F03560 Chr6 (671620..673353) [1734 bp, 577 aa] {ON} Anc_7.4...    33   1.8  
Kwal_55.19896 s55 complement(168566..170296) [1731 bp, 576 aa] {...    33   1.9  
Suva_2.80 Chr2 complement(143951..145690) [1740 bp, 579 aa] {ON}...    33   1.9  
Suva_15.235 Chr15 complement(404831..407401) [2571 bp, 856 aa] {...    33   2.1  
Kwal_26.7154 s26 (237387..241028) [3642 bp, 1213 aa] {ON} YOL045...    32   3.8  
TBLA0F02650 Chr6 (639123..640865) [1743 bp, 580 aa] {ON} Anc_7.4...    32   4.6  
NCAS0A14850 Chr1 (2928086..2929825) [1740 bp, 579 aa] {ON} Anc_7...    32   4.7  
Kpol_1023.100 s1023 (235260..238010) [2751 bp, 916 aa] {ON} (235...    32   5.5  
Suva_12.192 Chr12 (298828..300549) [1722 bp, 573 aa] {ON} YBL039...    32   7.3  

>CAGL0L12232g Chr12 (1324754..1326529) [1776 bp, 591 aa] {ON}
           similar to uniprot|P39012 Saccharomyces cerevisiae
           YLR088w required for attachment of GPI anchor onto
           proteins
          Length = 591

 Score = 1114 bits (2881), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 550/591 (93%), Positives = 550/591 (93%)

Query: 1   MSLLQKVYRRLSERGAITKLLQQLPRVSNXXXXXXXXXXXXXPLDGQYRRTYISENALMP 60
           MSLLQKVYRRLSERGAITKLLQQLPRVSN             PLDGQYRRTYISENALMP
Sbjct: 1   MSLLQKVYRRLSERGAITKLLQQLPRVSNLLVVVAIVLLAILPLDGQYRRTYISENALMP 60

Query: 61  SQAYSYFRETEWNILRGYRSQIETLEHSSVDQRNEVVAEWLQEQGLKTALYEHEKWGKTL 120
           SQAYSYFRETEWNILRGYRSQIETLEHSSVDQRNEVVAEWLQEQGLKTALYEHEKWGKTL
Sbjct: 61  SQAYSYFRETEWNILRGYRSQIETLEHSSVDQRNEVVAEWLQEQGLKTALYEHEKWGKTL 120

Query: 121 YGVLHASRGDGTEAMVLAIPWKNVDDQFNLGGAALGVSLSQFFKRWPVWSKNIIVVFSED 180
           YGVLHASRGDGTEAMVLAIPWKNVDDQFNLGGAALGVSLSQFFKRWPVWSKNIIVVFSED
Sbjct: 121 YGVLHASRGDGTEAMVLAIPWKNVDDQFNLGGAALGVSLSQFFKRWPVWSKNIIVVFSED 180

Query: 181 SGAALRAWVDAYHTSLDLTAGSIEAAVVLDYPSKSDFFEYVEISYDGLNGELPNLDLVNI 240
           SGAALRAWVDAYHTSLDLTAGSIEAAVVLDYPSKSDFFEYVEISYDGLNGELPNLDLVNI
Sbjct: 181 SGAALRAWVDAYHTSLDLTAGSIEAAVVLDYPSKSDFFEYVEISYDGLNGELPNLDLVNI 240

Query: 241 AVSITEHEGMKVSLHGLPPNEMYNTDYFARLKIMFVGIKNWALSGVKRIHGNEAFSGWRI 300
           AVSITEHEGMKVSLHGLPPNEMYNTDYFARLKIMFVGIKNWALSGVKRIHGNEAFSGWRI
Sbjct: 241 AVSITEHEGMKVSLHGLPPNEMYNTDYFARLKIMFVGIKNWALSGVKRIHGNEAFSGWRI 300

Query: 301 QSVTLRAHGNEGQLDITCFGRIPEAMFRSVNNLLEKFHQSYFFYLLLAPRNFVSISNYLP 360
           QSVTLRAHGNEGQLDITCFGRIPEAMFRSVNNLLEKFHQSYFFYLLLAPRNFVSISNYLP
Sbjct: 301 QSVTLRAHGNEGQLDITCFGRIPEAMFRSVNNLLEKFHQSYFFYLLLAPRNFVSISNYLP 360

Query: 361 SAVIISVAFAVISLDSAINNDYLSIPFSSVNTLVPFIILSASVFVSFLISRVLIMLPIVE 420
           SAVIISVAFAVISLDSAINNDYLSIPFSSVNTLVPFIILSASVFVSFLISRVLIMLPIVE
Sbjct: 361 SAVIISVAFAVISLDSAINNDYLSIPFSSVNTLVPFIILSASVFVSFLISRVLIMLPIVE 420

Query: 421 SLLFGSVALTFLPLVMSKKNIHVINQAVAYRLKXXXXXXXXXXXXXXXMVNFALTFMIGL 480
           SLLFGSVALTFLPLVMSKKNIHVINQAVAYRLK               MVNFALTFMIGL
Sbjct: 421 SLLFGSVALTFLPLVMSKKNIHVINQAVAYRLKSIGSIYYSLILTSLLMVNFALTFMIGL 480

Query: 481 LAFPLTKLAVISTKTIADESRKSILKNTFILFITNPFISLWLFTATMDTDFNGSFSVIYN 540
           LAFPLTKLAVISTKTIADESRKSILKNTFILFITNPFISLWLFTATMDTDFNGSFSVIYN
Sbjct: 481 LAFPLTKLAVISTKTIADESRKSILKNTFILFITNPFISLWLFTATMDTDFNGSFSVIYN 540

Query: 541 RMITSWDTLGCWTWFIICLGWLPYWLXXXXXXXXXXXXXERTSILDDKKEN 591
           RMITSWDTLGCWTWFIICLGWLPYWL             ERTSILDDKKEN
Sbjct: 541 RMITSWDTLGCWTWFIICLGWLPYWLISVISSIPSQPIVERTSILDDKKEN 591

>YLR088W Chr12 (316107..317951) [1845 bp, 614 aa] {ON}  GAA1Subunit
           of the GPI (glycosylphosphatidylinositol):protein
           transamidase complex, removes the GPI-anchoring signal
           and attaches GPI to proteins in the ER
          Length = 614

 Score =  690 bits (1780), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 343/598 (57%), Positives = 441/598 (73%), Gaps = 37/598 (6%)

Query: 1   MSLLQKVYRRLSERGAITKLLQQLPRVSNXXXXXXXXXXXXXPLDGQYRRTYISENALMP 60
           M+LL+K++RR+ + G + +++  LP +S              P+DGQYRRTYISENALMP
Sbjct: 1   MALLEKLHRRIVDMGLVPRIIALLPVISMLCALFGFISIAILPMDGQYRRTYISENALMP 60

Query: 61  SQAYSYFRETEWNILRGYRSQIETLEHSSVDQRNEVVAEWLQEQGLKTALYEHEKWGKTL 120
           SQAYSYFRE+EWNILRGYRSQI+ + + +  +RN ++  WLQE G KTA+YE+E++G+TL
Sbjct: 61  SQAYSYFRESEWNILRGYRSQIKEMVNMTSMERNNLMGSWLQEFGTKTAIYENEQYGETL 120

Query: 121 YGVLHASRGDGTEAMVLAIPWKNVDDQFNLGGAALGVSLSQFFKRWPVWSKNIIVVFSED 180
           YGV+HA RGDGTEAMVLA+PW N DD+FN+GGAALGVSL++FF RWPVWSKNIIVVFSE+
Sbjct: 121 YGVMHAPRGDGTEAMVLAVPWFNSDDEFNIGGAALGVSLARFFSRWPVWSKNIIVVFSEN 180

Query: 181 SGAALRAWVDAYHTSLDLTAGSIEAAVVLDYPSKSDFFEYVEISYDGLNGELPNLDLVNI 240
             AALR+WV+AYHTSLDLT GSIEAAVVLDY S  DFFEYVEISYDGLNGELPNLDLVNI
Sbjct: 181 PRAALRSWVEAYHTSLDLTGGSIEAAVVLDYSSTEDFFEYVEISYDGLNGELPNLDLVNI 240

Query: 241 AVSITEHEGMKVSLHGLPPNEMYNTDYFARLKIMFVGIKNWALSGVKRIHGNEAFSGWRI 300
           A+SITEHEGMKVSLHGLP +++ N ++++RLKI+ +GI++WALSGVK+ HGNEAFSGWRI
Sbjct: 241 AISITEHEGMKVSLHGLPSDQLTNNNFWSRLKILCLGIRDWALSGVKKPHGNEAFSGWRI 300

Query: 301 QSVTLRAHGNEGQLDITCFGRIPEAMFRSVNNLLEKFHQSYFFYLLLAPRNFVSISNYLP 360
           QSVTL+AHGN G  DIT FGRIPEAMFRS+NNLLEKFHQS+FFYLLLAPR FVSIS+YLP
Sbjct: 301 QSVTLKAHGNSGH-DITTFGRIPEAMFRSINNLLEKFHQSFFFYLLLAPRQFVSISSYLP 359

Query: 361 SAVIISVAFAVISLDSAINNDYLSIPFSSVNTLVPFIILSASVFVSFLISRVLIMLPIVE 420
           SAV +S+AFA+ SL++ INN Y +I   S   LV  ++   S+ +SF++S+  +++P   
Sbjct: 360 SAVALSIAFAISSLNAFINNAYANISLFSEYNLVALLVWFVSLVISFVVSQAFLLIPSSG 419

Query: 421 SLLFGSVALTFLPLVMSKKNIHVINQAVAYRLKXXXXXXXXXXXXXXXMVNFALTFMIGL 480
            L+  S+A  FLPL++S+K IH I++ ++YRLK               M+NFA+  +IG 
Sbjct: 420 LLMTISMASCFLPLILSRK-IH-ISEPLSYRLKNVAFLYFSLVSTSLLMINFAMALLIGT 477

Query: 481 LAFPLTKLAVI------------STKTIADESRKSI--------------------LKNT 508
           LAFP+T +  I            S+  I  E +  I                    LKN 
Sbjct: 478 LAFPMTFVKTIVESSSEHEVTTQSSNPIKTEPKDEIELVENHMDTTPATPQQQKQKLKNL 537

Query: 509 FILFITNPFISLWLFTATMDTDFNGSFSVIYNRMITSWDTLGCWTWFIICLGWLPYWL 566
            +L +TNPFIS+ LF    D +F+G F +I N+++++W  L CW+WF++C+GWLP WL
Sbjct: 538 VLLILTNPFISITLFGLFFDDEFHG-FDII-NKLVSAWLDLKCWSWFVLCIGWLPCWL 593

>Skud_12.156 Chr12 (299282..301120) [1839 bp, 612 aa] {ON} YLR088W
           (REAL)
          Length = 612

 Score =  688 bits (1776), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 345/596 (57%), Positives = 439/596 (73%), Gaps = 35/596 (5%)

Query: 1   MSLLQKVYRRLSERGAITKLLQQLPRVSNXXXXXXXXXXXXXPLDGQYRRTYISENALMP 60
           M+LL+K++RR+ + G + +++  LP +S              P+DGQYRRTYISENALMP
Sbjct: 1   MALLEKLHRRIVDMGLVPRIIALLPVISTLCALFGFISIAILPMDGQYRRTYISENALMP 60

Query: 61  SQAYSYFRETEWNILRGYRSQIETLEHSSVDQRNEVVAEWLQEQGLKTALYEHEKWGKTL 120
           SQAYSYFRE+EWN+LRGYRSQIE +E+ +  +RN  +  WLQE G KTA+YE +++G+TL
Sbjct: 61  SQAYSYFRESEWNVLRGYRSQIEEMENMTSSERNNQMGSWLQEFGTKTAIYESQQYGETL 120

Query: 121 YGVLHASRGDGTEAMVLAIPWKNVDDQFNLGGAALGVSLSQFFKRWPVWSKNIIVVFSED 180
           YGV+HA RGDGTEAMVLAIPW N DD+FN+GGAALGVSL++FF RWPVWSKNIIVVFSE+
Sbjct: 121 YGVMHAPRGDGTEAMVLAIPWFNSDDEFNVGGAALGVSLARFFSRWPVWSKNIIVVFSEN 180

Query: 181 SGAALRAWVDAYHTSLDLTAGSIEAAVVLDYPSKSDFFEYVEISYDGLNGELPNLDLVNI 240
             AALR+WV+AYHTSLDLT GSIEAAVVLDY S  DFFEYVEISYDGLNGELPNLDLVNI
Sbjct: 181 PRAALRSWVEAYHTSLDLTGGSIEAAVVLDYSSAEDFFEYVEISYDGLNGELPNLDLVNI 240

Query: 241 AVSITEHEGMKVSLHGLPPNEMYNTDYFARLKIMFVGIKNWALSGVKRIHGNEAFSGWRI 300
           A+SITEHEGMKVSLHGLP +++ N D+++RLKI+ +GI++WALSGVK  HGNEAFSGWRI
Sbjct: 241 AISITEHEGMKVSLHGLPYDQLANNDFWSRLKILSLGIRDWALSGVKNPHGNEAFSGWRI 300

Query: 301 QSVTLRAHGNEGQLDITCFGRIPEAMFRSVNNLLEKFHQSYFFYLLLAPRNFVSISNYLP 360
           QSVTL+AHG+ G  DIT FGRIPEAMFRS+NNLLEKFHQS+FFYLLLAPR FVSIS+YLP
Sbjct: 301 QSVTLKAHGHGGH-DITTFGRIPEAMFRSINNLLEKFHQSFFFYLLLAPRQFVSISSYLP 359

Query: 361 SAVIISVAFAVISLDSAINNDYLSIPFSSVNTLVPFIILSASVFVSFLISRVLIMLPIVE 420
           SAV  SVAFA+ SL++ INN Y SI   S   LV  ++   S+ VSF+IS++ +++P V 
Sbjct: 360 SAVAFSVAFAISSLNAFINNAYASISLFSEYNLVALLVWFISLVVSFIISQIFLLVPSVG 419

Query: 421 SLLFGSVALTFLPLVMSKKNIHVINQAVAYRLKXXXXXXXXXXXXXXXMVNFALTFMIGL 480
            L+  S+A  FLPLV+S+K +H I++ ++YRLK               M+NFA+  +IG 
Sbjct: 420 LLMTISLATCFLPLVLSEK-VH-ISEPLSYRLKNVAFLYFSLVSTSLLMINFAMALLIGS 477

Query: 481 LAFPLT-------------KLAVISTKTIADESRKSILKN-----------------TFI 510
           LAFP+T             ++   S  ++  ESR  + ++                   +
Sbjct: 478 LAFPMTFIRTIVVGKSTEHEMGTKSHTSVKTESRDDLFEHHGDTVLEKAKKRQQLKNLLL 537

Query: 511 LFITNPFISLWLFTATMDTDFNGSFSVIYNRMITSWDTLGCWTWFIICLGWLPYWL 566
           L +TNPFIS+ LF    D +F+G F ++ N++I++W  L CW WF++C+GWLP WL
Sbjct: 538 LVLTNPFISITLFALVFDNEFHG-FDIV-NKLISAWLDLKCWNWFVLCIGWLPCWL 591

>Smik_12.147 Chr12 (295948..297789) [1842 bp, 613 aa] {ON} YLR088W
           (REAL)
          Length = 613

 Score =  679 bits (1752), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 341/597 (57%), Positives = 436/597 (73%), Gaps = 36/597 (6%)

Query: 1   MSLLQKVYRRLSERGAITKLLQQLPRVSNXXXXXXXXXXXXXPLDGQYRRTYISENALMP 60
           M+LL+K++RR+ + G + +++  LP VS              P+DGQYRRTYISENALMP
Sbjct: 1   MALLEKLHRRIVDMGLVPRIIASLPVVSMVCALFGFISIAILPMDGQYRRTYISENALMP 60

Query: 61  SQAYSYFRETEWNILRGYRSQIETLEHSSVDQRNEVVAEWLQEQGLKTALYEHEKWGKTL 120
           SQAYSYFRE+EWNILRGYRSQIE + + +  +RN ++  WLQE G KTA+YE+E++G+TL
Sbjct: 61  SQAYSYFRESEWNILRGYRSQIEEMVNMTSMERNNIMGSWLQEFGTKTAIYENEQYGETL 120

Query: 121 YGVLHASRGDGTEAMVLAIPWKNVDDQFNLGGAALGVSLSQFFKRWPVWSKNIIVVFSED 180
           YGV+HA RGDGTEAMVLA+PW N DD+FN+GGAALGVSL++FF RWPVWSKNII+VFSE+
Sbjct: 121 YGVMHAPRGDGTEAMVLAVPWFNSDDKFNVGGAALGVSLARFFSRWPVWSKNIIIVFSEN 180

Query: 181 SGAALRAWVDAYHTSLDLTAGSIEAAVVLDYPSKSDFFEYVEISYDGLNGELPNLDLVNI 240
             AALR+WV+AYHTSLDLT GSIEAAVV+DY S  DFFEYVEISYDGLNGELPNLDLVN+
Sbjct: 181 PCAALRSWVEAYHTSLDLTGGSIEAAVVVDYSSAEDFFEYVEISYDGLNGELPNLDLVNV 240

Query: 241 AVSITEHEGMKVSLHGLPPNEMYNTDYFARLKIMFVGIKNWALSGVKRIHGNEAFSGWRI 300
           A+SITEHEGMKVSLHGLP +++   +Y++RLK++ +GI++WAL+GVK  HGNEAFSGWRI
Sbjct: 241 AISITEHEGMKVSLHGLPLDQLTINNYWSRLKVLCLGIRDWALAGVKNPHGNEAFSGWRI 300

Query: 301 QSVTLRAHGNEGQLDITCFGRIPEAMFRSVNNLLEKFHQSYFFYLLLAPRNFVSISNYLP 360
           QSVTL+AHGN G  DIT FGRIPEAMFRS+NNLLEKFHQS+FFYLLLAPR FVSIS+YLP
Sbjct: 301 QSVTLKAHGNSGH-DITTFGRIPEAMFRSINNLLEKFHQSFFFYLLLAPRQFVSISSYLP 359

Query: 361 SAVIISVAFAVISLDSAINNDYLSIPFSSVNTLVPFIILSASVFVSFLISRVLIMLPIVE 420
           SAV +SVAFA+ SL++ INN Y SI   S   LV  ++   S+ +SF++S+V ++LP   
Sbjct: 360 SAVALSVAFAISSLNAFINNTYASISIFSEYNLVALLVWFISLVISFVVSQVFLLLPSAG 419

Query: 421 SLLFGSVALTFLPLVMSKKNIHVINQAVAYRLKXXXXXXXXXXXXXXXMVNFALTFMIGL 480
            L+  S+   FLPL++SKK +H I++ ++YRLK               M+NFA+  +IG 
Sbjct: 420 LLMAISMISCFLPLILSKK-VH-ISEPLSYRLKNVAFLYFSLVLTSLLMINFAMALLIGT 477

Query: 481 LAFPLTKLAV---------------ISTKTIADESRKSILKNTFIL-------------- 511
           LAFP+T +                 IS KT   E  + I     I+              
Sbjct: 478 LAFPMTLVKTIIESSGEHEVSAKPYISIKTEPKEETELIENYEDIMPGKSQQRQELKNLL 537

Query: 512 --FITNPFISLWLFTATMDTDFNGSFSVIYNRMITSWDTLGCWTWFIICLGWLPYWL 566
              +TNPFIS+ +F +  D +F G F VI N+++++W  L CW+WF++C+GWLP WL
Sbjct: 538 LLVLTNPFISITIFGSFFDDEFQG-FDVI-NKLVSAWLDLKCWSWFVLCIGWLPCWL 592

>Suva_10.172 Chr10 (320928..322772) [1845 bp, 614 aa] {ON} YLR088W
           (REAL)
          Length = 614

 Score =  667 bits (1722), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 339/598 (56%), Positives = 434/598 (72%), Gaps = 37/598 (6%)

Query: 1   MSLLQKVYRRLSERGAITKLLQQLPRVSNXXXXXXXXXXXXXPLDGQYRRTYISENALMP 60
           M+LL+K++RR+ + G + +++  LP +S              P+DGQYRRTYISENALMP
Sbjct: 1   MALLEKLHRRVVDMGLVPRVIALLPVISTLCALFGFISIAILPMDGQYRRTYISENALMP 60

Query: 61  SQAYSYFRETEWNILRGYRSQIETLEHSSVDQRNEVVAEWLQEQGLKTALYEHEKWGKTL 120
           SQAYSYFRETEWNILRGYRSQIE   + +  +RN ++  WLQE G KTA+YE+E++G+TL
Sbjct: 61  SQAYSYFRETEWNILRGYRSQIEETVNMTSTERNNLMGSWLQEFGTKTAIYENEQYGETL 120

Query: 121 YGVLHASRGDGTEAMVLAIPWKNVDDQFNLGGAALGVSLSQFFKRWPVWSKNIIVVFSED 180
           YGV+HA RGDGTEAMVLAIPW N + +FN+GGA+LGVSL++FF RWPVWSKNIIVVFSE+
Sbjct: 121 YGVMHAPRGDGTEAMVLAIPWFNSEKEFNVGGASLGVSLARFFSRWPVWSKNIIVVFSEN 180

Query: 181 SGAALRAWVDAYHTSLDLTAGSIEAAVVLDYPSKSDFFEYVEISYDGLNGELPNLDLVNI 240
             AALR+WV+AYHTSLDLT GSIEAAVVLDY S  DFFEYVE+SYDGLNGELPNLDLVN+
Sbjct: 181 PHAALRSWVEAYHTSLDLTGGSIEAAVVLDYSSAEDFFEYVEVSYDGLNGELPNLDLVNV 240

Query: 241 AVSITEHEGMKVSLHGLPPNEMYNTDYFARLKIMFVGIKNWALSGVKRIHGNEAFSGWRI 300
           A+SI EHEGMKVSLHGLP  ++ + D+F+RLKI+ +GI++WALSGVK  HGNEAFSGWRI
Sbjct: 241 AISIIEHEGMKVSLHGLPYEQLGDNDFFSRLKILCLGIRDWALSGVKNPHGNEAFSGWRI 300

Query: 301 QSVTLRAHGNEGQLDITCFGRIPEAMFRSVNNLLEKFHQSYFFYLLLAPRNFVSISNYLP 360
           QSVTL+AHG+ G  DIT FGRIPEAMFRS+NNLLEKFHQS+FFYLLLAPR FVSIS+YLP
Sbjct: 301 QSVTLKAHGHGGH-DITTFGRIPEAMFRSINNLLEKFHQSFFFYLLLAPRQFVSISSYLP 359

Query: 361 SAVIISVAFAVISLDSAINNDYLSIPFSSVNTLVPFIILSASVFVSFLISRVLIMLPIVE 420
           SAV +SVAFA+ SL++ INNDY SI   S   LV  ++   ++ VSF+IS++ + +    
Sbjct: 360 SAVALSVAFAMSSLNAFINNDYASISLFSEYNLVAVLVWFIAMVVSFVISQLFLSVLPAG 419

Query: 421 SLLFGSVALTFLPLVMSKKNIHVINQAVAYRLKXXXXXXXXXXXXXXXMVNFALTFMIGL 480
            L+  S+A+ FLP+ +S K +H I++ ++YRLK               M+NFA+  +IG 
Sbjct: 420 LLMTISLAICFLPIALSGK-VH-ISEPLSYRLKNVAFLYFSLVSTSLLMINFAMALLIGT 477

Query: 481 LAFPLTKLAVISTK--------------------------------TIADESRKSILKNT 508
           LAFP+T +  I+ +                                T+    ++  LKN 
Sbjct: 478 LAFPMTFIKTIAVERPAEPETGTRSNISIKTEPNDETQLNKHYKEGTLEKNQQRQKLKNL 537

Query: 509 FILFITNPFISLWLFTATMDTDFNGSFSVIYNRMITSWDTLGCWTWFIICLGWLPYWL 566
            +L +TNPFIS+ +F    D +F G F +I N+++++W  L CW+WFI+CLGWLP WL
Sbjct: 538 LLLILTNPFISITVFGLLFDDEFQG-FDII-NKLVSAWIDLKCWSWFILCLGWLPCWL 593

>TDEL0F03880 Chr6 (722770..724509) [1740 bp, 579 aa] {ON} Anc_8.261
           YLR088W
          Length = 579

 Score =  647 bits (1669), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 318/591 (53%), Positives = 423/591 (71%), Gaps = 14/591 (2%)

Query: 1   MSLLQKVYRRLSERGAITKLLQQLPRVSNXXXXXXXXXXXXXPLDGQYRRTYISENALMP 60
           MSL+ K++RR+ + G + K++  LP +S              PL+G+YRRTYISENAL+P
Sbjct: 1   MSLIGKLHRRVIDLGLVPKIVAALPLLSMLFAVVSVGWLALLPLEGRYRRTYISENALLP 60

Query: 61  SQAYSYFRETEWNILRGYRSQIETLEHSSVDQRNEVVAEWLQEQGLKTALYEHEKWGKTL 120
           SQAYSYFRETEWN LRGYR+QIE L +S+  +RNE VA WL+E G+KTA+Y+ EK G TL
Sbjct: 61  SQAYSYFRETEWNTLRGYRTQIERLANSTSRERNEEVAGWLREFGVKTAIYQDEKHGDTL 120

Query: 121 YGVLHASRGDGTEAMVLAIPWKNVDDQFNLGGAALGVSLSQFFKRWPVWSKNIIVVFSED 180
           YGVLHA RGDGTEA++LA PW N D   NL G ++G++L++FF RWPVWSKNIIVV SE+
Sbjct: 121 YGVLHAQRGDGTEAVILAAPWTNADGMVNLSGVSIGIALTRFFSRWPVWSKNIIVVLSEN 180

Query: 181 SGAALRAWVDAYHTSLDLTAGSIEAAVVLDYPSKSDFFEYVEISYDGLNGELPNLDLVNI 240
              ++R+WV+AYHTSLDLT GSIEAAVVLDYP  +D+F++VEI YDGLNGE PNLDLVNI
Sbjct: 181 PKGSMRSWVEAYHTSLDLTGGSIEAAVVLDYPGVNDYFDHVEIHYDGLNGEEPNLDLVNI 240

Query: 241 AVSITEHEGMKVSLHGLPPNEMYNTDYFARLKIMFVGIKNWALSGVKRIHGNEAFSGWRI 300
           A+SITEHEGMKVSLHG+  +++ + D+++RL IM  GIKN ALSG+++++GNEAFSGWRI
Sbjct: 241 AISITEHEGMKVSLHGVSCDKISDNDFWSRLLIMLTGIKNAALSGLRKVNGNEAFSGWRI 300

Query: 301 QSVTLRAHGNEGQLDITCFGRIPEAMFRSVNNLLEKFHQSYFFYLLLAPRNFVSISNYLP 360
           Q+VTL+AHG EG+ D+T FGRIPEAMFRS+NNLLEKFHQS+FFY+LLAPR FVSIS+YLP
Sbjct: 301 QAVTLKAHGTEGRHDVTTFGRIPEAMFRSINNLLEKFHQSFFFYILLAPRYFVSISSYLP 360

Query: 361 SAVIISVAFAVISLDSAINNDYLSIPFSSVNTLVPFIILSASVFVSFLISRVLIMLPIVE 420
            AV +S++FA+ SLD+ INN+Y  +P SS   L+   +   S+   F I+++ +      
Sbjct: 361 CAVTLSISFALASLDAMINNNYKKLPLSSTYNLLSLSMWCISLLGCFGIAQLFLRFDAPT 420

Query: 421 SLLFGSVALTFLPLVMSKKNIHVINQAVAYRLKXXXXXXXXXXXXXXXMVNFALTFMIGL 480
            L+  S  ++FLPL++ KK    I + +AYRLK               MVNF L F +GL
Sbjct: 421 ILISFSALISFLPLLLKKK----IAEPLAYRLKSVAFLFFSLVLTSLLMVNFFLAFAMGL 476

Query: 481 LAFPLTKLAVISTKTIADESRKSILKNTFILFITNPFISLWLFTATMDTDFNGSFSVIYN 540
            AFP+T   ++ T ++ + S +  LKN+ +L ++NPFI+ ++F    + D  G F+V + 
Sbjct: 477 TAFPMT---LVRTSSLNNYSLRIKLKNSILLLLSNPFIASYIFCQCFEPDLPG-FTV-FT 531

Query: 541 RMITSWDTLGCWTWFIICLGWLPYWLXXXXXXXXXXXXXERTSILDDKKEN 591
              T+W  LGCWTWF+IC+GWLP WL              + + LDD+K+ 
Sbjct: 532 EFATAWKELGCWTWFVICIGWLPSWLMVALSTLNT-----QPAQLDDRKKK 577

>SAKL0H17050g Chr8 complement(1497051..1498805) [1755 bp, 584 aa]
           {ON} similar to uniprot|P39012 Saccharomyces cerevisiae
           YLR088W GAA1 Subunit of the GPI:protein transamidase
           complex removes the GPI-anchoring signal and attaches
           GPI (glycosylphosphatidylinositol) to proteins in the ER
          Length = 584

 Score =  643 bits (1659), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 315/567 (55%), Positives = 408/567 (71%), Gaps = 12/567 (2%)

Query: 1   MSLLQKVYRRLSERGAITKLLQQLPRVSNXXXXXXXX-XXXXXPLDGQYRRTYISENALM 59
           M+L++K++RR  + G + K +  LP +S               P DGQ+RRTYISENALM
Sbjct: 1   MALVEKLHRRFIDMGLLPKFIALLPTLSIFCAVVGVSWLALFIPTDGQFRRTYISENALM 60

Query: 60  PSQAYSYFRETEWNILRGYRSQIETLEHSSVDQRNEVVAEWLQEQGLKTALYEHEKWGKT 119
           PSQAYSYFRETEWN+LRGYR+QIE  + SS  +RNE V+ WLQ+ G KTA+Y +E++G+T
Sbjct: 61  PSQAYSYFRETEWNVLRGYRTQIELFKKSSTHERNEEVSSWLQQFGAKTAIYTNEEYGET 120

Query: 120 LYGVLHASRGDGTEAMVLAIPWKNVDDQFNLGGAALGVSLSQFFKRWPVWSKNIIVVFSE 179
           LYG+LHA RGDGTEAMVLA PW N ++Q+N GG AL VSLS+FF RWPVWSKNII+V SE
Sbjct: 121 LYGILHAPRGDGTEAMVLAAPWYNSENQYNTGGIALAVSLSRFFSRWPVWSKNIIIVLSE 180

Query: 180 DSGAALRAWVDAYHTSLDLTAGSIEAAVVLDYPSKSDFFEYVEISYDGLNGELPNLDLVN 239
           D  AALR+WV+AYHTSLDLT GSIEAAVV+D+P  +DFF+YVEI +DGLNGELPNLDLVN
Sbjct: 181 DPQAALRSWVEAYHTSLDLTGGSIEAAVVMDFPGSNDFFKYVEIHFDGLNGELPNLDLVN 240

Query: 240 IAVSITEHEGMKVSLHGLPPNEMYNTDYFARLKIMFVGIKNWALSGVKRIHGNEAFSGWR 299
           +AV ITEHEGMKVSLHG+   E+   D+F+R+K + +G+KN ALSG+K+ HGNE FSGWR
Sbjct: 241 VAVHITEHEGMKVSLHGISEEELGKNDFFSRMKTIILGVKNMALSGIKKSHGNEVFSGWR 300

Query: 300 IQSVTLRAHGNEGQLDITCFGRIPEAMFRSVNNLLEKFHQSYFFYLLLAPRNFVSISNYL 359
           I SVTL+A G +G  DIT FGRIPEA+FRSVNNLLEKFHQS+FFYLLLAPR FVSI +YL
Sbjct: 301 IHSVTLKACGTDGPFDITTFGRIPEAIFRSVNNLLEKFHQSFFFYLLLAPRLFVSIGSYL 360

Query: 360 PSAVIISVAFAVISLDSAINNDYLSIPFSSVNTLVPFIILSASVFVSFLISRVLIMLPIV 419
           P+AV +SV+FA+ SL++ +NN+Y S+P  S   +   +  + ++FVSF+ ++  +  P  
Sbjct: 361 PAAVALSVSFALASLNTILNNEYTSLPLLSTYNVFALLGFAVALFVSFITAQAFLYAPQP 420

Query: 420 ESLLFGSVALTFLPLVMSKKNIHVINQAVAYRLKXXXXXXXXXXXXXXXMVNFALTFMIG 479
           E LL  +V L  +P++ ++  I       +YRLK               +VNF+L F +G
Sbjct: 421 ELLLSLNVLLLLMPIIFTRVKIRT---PFSYRLKSFAYLYFSVVLTSLLVVNFSLAFGLG 477

Query: 480 LLAFPLTKLAVISTKTIADESRKSILKNTFILFITNPFISLWLFTATMDTDFNGSFSVIY 539
            LAFP+T +   S         ++ LKN  +L I+NPFI++WLF   +D +  G   V Y
Sbjct: 478 CLAFPMTLVRTTSGNL------RARLKNCVLLLISNPFIAIWLFAICVDRELQG-VQVFY 530

Query: 540 NRMITSWDTLGCWTWFIICLGWLPYWL 566
             + ++W  LGCWTWF+IC+GWLP WL
Sbjct: 531 G-LTSAWKDLGCWTWFVICIGWLPSWL 556

>Kpol_543.37 s543 (82589..84325) [1737 bp, 578 aa] {ON}
           (82589..84325) [1737 nt, 579 aa]
          Length = 578

 Score =  631 bits (1627), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 310/566 (54%), Positives = 412/566 (72%), Gaps = 10/566 (1%)

Query: 1   MSLLQKVYRRLSERGAITKLLQQLPRVSNXXXXXXXXXXXXXPLDGQYRRTYISENALMP 60
           MS+L+ + RRL + G + K L  LP++S              P+DGQ+RRTYISENALMP
Sbjct: 1   MSILENLQRRLIDAGLLPKFLAALPKLSMLLVSVSVMLMLYLPMDGQFRRTYISENALMP 60

Query: 61  SQAYSYFRETEWNILRGYRSQIETLEHSSVDQRNEVVAEWLQEQGLKTALYEHEKWGKTL 120
           SQAYSYFRETEWNILRGYR +IE L   S  +RN +++ WL+E GLKT++Y+++++G +L
Sbjct: 61  SQAYSYFRETEWNILRGYRKEIEVLSSHSSIERNAIMSSWLEEFGLKTSVYKNQEYGDSL 120

Query: 121 YGVLHASRGDGTEAMVLAIPWKNVDDQFNLGGAALGVSLSQFFKRWPVWSKNIIVVFSED 180
           YGV +A RGDGTE+MVLA+PW N +D+FN+ GAALGVSL++F  RWPVWSKNIIVVFSE+
Sbjct: 121 YGVFNAPRGDGTESMVLAVPWYNAEDEFNVSGAALGVSLARFLSRWPVWSKNIIVVFSEN 180

Query: 181 SGAALRAWVDAYHTSLDLTAGSIEAAVVLDYPSKSDFFEYVEISYDGLNGELPNLDLVNI 240
              ALR+WV+AYHTSLDLT GSIEAAVVLDYP  SD+FEY+E+ Y+G NG LPNLDLVNI
Sbjct: 181 PREALRSWVEAYHTSLDLTGGSIEAAVVLDYPGVSDYFEYIEVHYNGYNGVLPNLDLVNI 240

Query: 241 AVSITEHEGMKVSLHGLPPNEMYNTDYFARLKIMFVGIKNWALSGVKRIHGNEAFSGWRI 300
           A+SI EHEG+KVSLHGL P+EM N DY++RLK++ +G KN AL+GV+ ++GNEAFSGWRI
Sbjct: 241 AISIAEHEGLKVSLHGLTPDEMGNGDYWSRLKMISLGTKNLALTGVREVYGNEAFSGWRI 300

Query: 301 QSVTLRAHGNEGQLDITCFGRIPEAMFRSVNNLLEKFHQSYFFYLLLAPRNFVSISNYLP 360
           Q++TL+A G+    D+T FGR+ EAMFRS+NNLLEKFHQS+FFY LLAPR FVSI +YLP
Sbjct: 301 QALTLKARGDTNH-DVTTFGRVAEAMFRSINNLLEKFHQSFFFYFLLAPRYFVSIGSYLP 359

Query: 361 SAVIISVAFAVISLDSAINNDYLSIPFSSVNTLVPFIILSASVFVSFLISRVLIMLPIVE 420
           +AV++S++FAV S+DS +NN Y+S+  SS   L+ FI  + SV V F +       P   
Sbjct: 360 AAVVLSISFAVASIDSFVNNQYVSMVDSSYYNLLSFIFWAVSVIVCFFLGNSFTYYPQPL 419

Query: 421 SLLFGSVALTFLPLVMSKKNIHVINQAVAYRLKXXXXXXXXXXXXXXXMVNFALTFMIGL 480
            LL G+V ++ +PL  + KN+  I++ +AYRLK               +VNF L F +GL
Sbjct: 420 LLLLGNVVISTIPLA-APKNLS-ISEPLAYRLKTISFMYLSLVMTSLLVVNFPLAFGMGL 477

Query: 481 LAFPLTKLAVISTKTIADESRKSILKNTFILFITNPFISLWLFTATMDTDFNGSFSVIYN 540
            A+P+T + + +T  +  ++R SIL     L I+NPFI+ WLF   +++  +G    IY 
Sbjct: 478 FAYPMTLVMLNNTDNLRLKTRNSIL-----LAISNPFIAFWLFITIVESKLDG-IEAIYG 531

Query: 541 RMITSWDTLGCWTWFIICLGWLPYWL 566
            ++ +W+ LG WTWFI C+GW P W+
Sbjct: 532 -LVDAWNKLGSWTWFIFCIGWFPSWI 556

>NCAS0B03860 Chr2 complement(687424..689175) [1752 bp, 583 aa] {ON}
           Anc_8.261 YLR088W
          Length = 583

 Score =  622 bits (1605), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 302/566 (53%), Positives = 403/566 (71%), Gaps = 6/566 (1%)

Query: 1   MSLLQKVYRRLSERGAITKLLQQLPRVSNXXXXXXXXXXXXXPLDGQYRRTYISENALMP 60
           M L ++V R++  RG I K++  LP +S              P +GQYR TYISENALMP
Sbjct: 1   MGLFERVQRQVIARGLIPKVISLLPLISTLCIVLGIVIIGILPFEGQYRNTYISENALMP 60

Query: 61  SQAYSYFRETEWNILRGYRSQIETLEHSSVDQRNEVVAEWLQEQGLKTALYEHEKWGKTL 120
           SQAYSYFRE+EWNI+RGYRSQI  L ++S  +RN +++EWLQ+ G KT +Y++ + G TL
Sbjct: 61  SQAYSYFRESEWNIVRGYRSQIVELRNASAVERNAIMSEWLQQFGTKTDIYQNHETGDTL 120

Query: 121 YGVLHASRGDGTEAMVLAIPWKNVDDQFNLGGAALGVSLSQFFKRWPVWSKNIIVVFSED 180
           YGV HA RGDGTE+MVLAIPW N D +FN+ GAALGV+L+++F RWPVWSKNIIVVF+E+
Sbjct: 121 YGVFHAPRGDGTESMVLAIPWFNADGEFNVNGAALGVALARYFSRWPVWSKNIIVVFTEN 180

Query: 181 SGAALRAWVDAYHTSLDLTAGSIEAAVVLDYPSKSDFFEYVEISYDGLNGELPNLDLVNI 240
             AALR+WV+AYHTSLDLT GSIEAA+VLD+  + D F+Y+EI YDGLNGELPNLD+VNI
Sbjct: 181 PKAALRSWVEAYHTSLDLTGGSIEAAIVLDFAGEGDLFDYMEIYYDGLNGELPNLDMVNI 240

Query: 241 AVSITEHEGMKVSLHGLPPNEMYNTDYFARLKIMFVGIKNWALSGVKRIHGNEAFSGWRI 300
            V   EHEGMKVSLHG P +++     F+RLKI+   IKN ALSGVK+ +GNEAFSGWRI
Sbjct: 241 GVFTAEHEGMKVSLHGTPFDKIKEDTLFSRLKILMSSIKNSALSGVKKTYGNEAFSGWRI 300

Query: 301 QSVTLRAHGNEGQLDITCFGRIPEAMFRSVNNLLEKFHQSYFFYLLLAPRNFVSISNYLP 360
           QSVTLRA G  G  D+T FGR+PEAMFRS+NNLLEKFHQS+FFYL+LAPR+FVSIS+YLP
Sbjct: 301 QSVTLRARGQNGPFDVTSFGRVPEAMFRSINNLLEKFHQSFFFYLMLAPRHFVSISSYLP 360

Query: 361 SAVIISVAFAVISLDSAINNDYLSIPFSSVNTLVPFIILSASVFVSFLISRVLIMLPIVE 420
           S V IS+ FA+ SL+S  NN Y ++PF S+ TL+  +    S+ V+F++S + I  P   
Sbjct: 361 STVAISIGFALASLNSYFNNPYYTLPFFSLYTLLSILFWFVSLVVTFIVSNIFIYSPFPT 420

Query: 421 SLLFGSVALTFLPLVMSKKNIHVINQAVAYRLKXXXXXXXXXXXXXXXMVNFALTFMIGL 480
            LL  ++ +   P ++  K    +   ++YRL+               MVNF L F +GL
Sbjct: 421 ILLAVNIIICLYPAIL--KGNAFMKDLLSYRLRSTAFLFMSLLLTSLLMVNFPLAFGMGL 478

Query: 481 LAFPLTKLAVISTKTIADESRKSILKNTFILFITNPFISLWLFTATMDTDFNGSFSVIYN 540
           L+FP+T++  I++ T      ++ +KN+ +L ++NPFI+ WLF+   D +F+G    ++ 
Sbjct: 479 LSFPMTQVKTITSDT--PTISRTRVKNSVLLLVSNPFIATWLFSLLCDNEFSG--LDVFE 534

Query: 541 RMITSWDTLGCWTWFIICLGWLPYWL 566
           R++++   LGCWTW ++C+GW   WL
Sbjct: 535 RLVSASRELGCWTWLVLCVGWWTPWL 560

>AGR087C Chr7 complement(890706..892439) [1734 bp, 577 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR088W
           (GAA1)
          Length = 577

 Score =  617 bits (1592), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 296/567 (52%), Positives = 407/567 (71%), Gaps = 11/567 (1%)

Query: 1   MSLLQKVYRRLSERGAITKLLQQLPRVSNXXXXXXXX-XXXXXPLDGQYRRTYISENALM 59
           M++L+K++R++ + G + K++  L ++S               P++GQYRRTYISENALM
Sbjct: 1   MAVLEKLHRKVVDMGLVPKIIFSLAKISYVTTLLSVAWLTLFLPMEGQYRRTYISENALM 60

Query: 60  PSQAYSYFRETEWNILRGYRSQIETLEHSSVDQRNEVVAEWLQEQGLKTALYEHEKWGKT 119
           PSQAYSYFRE+EWNILRGYRS+I+ +   + D+RN +VA W++E G K A+Y  ++ G+T
Sbjct: 61  PSQAYSYFRESEWNILRGYRSEIDGMRTLTADERNRIVASWMEEYGAKAAVYNDDRHGET 120

Query: 120 LYGVLHASRGDGTEAMVLAIPWKNVDDQFNLGGAALGVSLSQFFKRWPVWSKNIIVVFSE 179
           LY VLHA+RGDGTEAMVLA PW+ V+ Q+N GG AL V++ ++F RWPVWSKNII+V SE
Sbjct: 121 LYAVLHATRGDGTEAMVLAAPWETVEGQYNTGGVALAVAMGRYFSRWPVWSKNIIIVLSE 180

Query: 180 DSGAALRAWVDAYHTSLDLTAGSIEAAVVLDYPSKSDFFEYVEISYDGLNGELPNLDLVN 239
           D  A+LR+WV AYHT LDLT GSIEAA+VLDYP  +D+F++VEISY+GLNG +PNLDL+N
Sbjct: 181 DPHASLRSWVQAYHTKLDLTGGSIEAAIVLDYPGTNDYFQHVEISYEGLNGGMPNLDLLN 240

Query: 240 IAVSITEHEGMKVSLHGLPPNEMYNTDYFARLKIMFVGIKNWALSGVKRIHGNEAFSGWR 299
           +AV ITEHEGMKV+LHG P  E+    YF+R++++  GIK+ ALSG+KR  GNEAFSGWR
Sbjct: 241 VAVHITEHEGMKVALHGTPWEELGTDTYFSRMRLLLKGIKDMALSGIKRTSGNEAFSGWR 300

Query: 300 IQSVTLRAHGNEGQLDITCFGRIPEAMFRSVNNLLEKFHQSYFFYLLLAPRNFVSISNYL 359
           IQSVTL+A G  G  DIT FGR+PEAMFRSVNNLLEKFHQS+FFYLLLAPR FVSI +YL
Sbjct: 301 IQSVTLKARGTNGSFDITTFGRVPEAMFRSVNNLLEKFHQSFFFYLLLAPRYFVSIGSYL 360

Query: 360 PSAVIISVAFAVISLDSAINNDYLSIPFSSVNTLVPFIILSASVFVSFLISRVLIMLPIV 419
           P+AV +S++FAV++ DS +NN++ S+P  S+  +   +  S ++ VS + + V   LP  
Sbjct: 361 PAAVGLSISFAVMACDSVLNNEFASLPLISIYNIWALLAFSVALLVSAITAEVFFYLPAP 420

Query: 420 ESLLFGSVALTFLPLVMSKKNIHVINQAVAYRLKXXXXXXXXXXXXXXXMVNFALTFMIG 479
             LL  +V ++F+P  + K   + I +  ++R K               ++NF L FM+G
Sbjct: 421 ALLLAFNVVVSFMPFALVK---YKIQKPFSHRFKAAAYLYFSTVLSSLLVMNFQLAFMVG 477

Query: 480 LLAFPLTKLAVISTKTIADESRKSILKNTFILFITNPFISLWLFTATMDTDFNGSFSVIY 539
           LLAFP+T +     +T    S +  +KN+ +L ++NPFIS+ +F    + +  G FSV Y
Sbjct: 478 LLAFPMTFV-----RTTVHASVRQKMKNSLLLLLSNPFISICVFVHLFEPELTG-FSVFY 531

Query: 540 NRMITSWDTLGCWTWFIICLGWLPYWL 566
           + +I +W+ LGCWTW+++CLGW P W+
Sbjct: 532 S-LIDAWNDLGCWTWYVLCLGWYPAWI 557

>NDAI0J01390 Chr10 complement(319754..321505) [1752 bp, 583 aa] {ON}
           Anc_8.261 YLR088W
          Length = 583

 Score =  615 bits (1586), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 299/568 (52%), Positives = 410/568 (72%), Gaps = 9/568 (1%)

Query: 1   MSLLQKVYRRLSERGAITKLLQQLPRVSNXXXXXXXXXXXXXPLDGQYRRTYISENALMP 60
           M LL++V R +  RG I K++ QLP++S              P+DGQYR TYISENALMP
Sbjct: 1   MGLLERVQRVIVSRGLIPKIMAQLPKISIIFVAISILMIAILPMDGQYRNTYISENALMP 60

Query: 61  SQAYSYFRETEWNILRGYRSQIETLEHSSVDQRNEVVAEWLQEQGLKTALYEHEKWGKTL 120
           SQAYSYFRETEWNI+RGYR+++  +E+S+  +RN+++  WL E G+KT +YE+    + L
Sbjct: 61  SQAYSYFRETEWNIVRGYRNELVHMENSTSRERNQIMESWLNEFGVKTQIYENRD-NEVL 119

Query: 121 YGVLHASRGDGTEAMVLAIPWKNVDDQFNLGGAALGVSLSQFFKRWPVWSKNIIVVFSED 180
           YGV HA RGDGTEA+VLA+PW NVD +FN  GAA+GV+L+++F RWPVWSKNIIVVFSE+
Sbjct: 120 YGVFHAPRGDGTEAIVLAVPWFNVDGEFNTNGAAVGVALARYFSRWPVWSKNIIVVFSEN 179

Query: 181 SGAALRAWVDAYHTSLDLTAGSIEAAVVLDYPSKSDFFEYVEISYDGLNGELPNLDLVNI 240
             +ALR+WV+AY+TSLDLT GSIEAA+VLD P ++D+F+Y+E+ YDGLNGELPNLDLVNI
Sbjct: 180 PDSALRSWVEAYYTSLDLTGGSIEAAIVLDSPGENDYFDYLEVYYDGLNGELPNLDLVNI 239

Query: 241 AVSITEHEGMKVSLHGLPPNEMYNTDYFARLKIMFVGIKNWALSGVKRIHGNEAFSGWRI 300
            + I EHEGM+VSLHG P +++   +Y+ RLKI+   I++ A SG+ + HGNEAFSGWRI
Sbjct: 240 GIYIAEHEGMRVSLHGTPFDQIKENNYWTRLKILVASIQSSAFSGLTKTHGNEAFSGWRI 299

Query: 301 QSVTLRAHGNEGQLDITCFGRIPEAMFRSVNNLLEKFHQSYFFYLLLAPRNFVSISNYLP 360
           QS+TL+  GN G LDITCFGR+PEAMFRS+NNLLEKFHQS+FFYLLLAPR FVSIS+YLP
Sbjct: 300 QSITLKTKGNSGPLDITCFGRVPEAMFRSINNLLEKFHQSFFFYLLLAPRQFVSISSYLP 359

Query: 361 SAVIISVAFAVISLDSAINNDYLSIPFSSVNTLVPFIILSASVFVSFLISRVLIMLPIVE 420
           SAVI+SVAF +  +DS INN   ++PF S  TL+P I+ + ++   F+++++ ++L    
Sbjct: 360 SAVILSVAFVIAFMDSYINNPSFALPFFSNYTLIPAIVWTVTLVACFILAQLFLIL--PI 417

Query: 421 SLLFGSVALTFLPLVMSKKNIHVINQAVAYRLKXXXXXXXXXXXXXXXMVNFALTFMIGL 480
             L   + +      +  +N  +   AV+ RL+               MVNF L+FMIGL
Sbjct: 418 PSLLLLINIVISISSIIIQNKKLFKPAVSNRLRSFAFLHLSLILTSLLMVNFPLSFMIGL 477

Query: 481 LAFPLTKLAVISTKTIADESRKSILKNTFILFITNPFISLWLF-TATMDTDFNGSFSV-I 538
           +AFP+TK+  I+    A+ + +  L+N  +L I+NPFI+L ++   + ++   G   + +
Sbjct: 478 MAFPMTKVRSIT----ANTAPQIKLENIILLMISNPFIALIIYNNVSSNSGLQGLQGLRV 533

Query: 539 YNRMITSWDTLGCWTWFIICLGWLPYWL 566
            NR+I++W  + CWTWF++CLGWLP W+
Sbjct: 534 INRLISAWKDMRCWTWFVLCLGWLPSWI 561

>KLTH0G13706g Chr7 complement(1173326..1175080) [1755 bp, 584 aa]
           {ON} similar to uniprot|P39012 Saccharomyces cerevisiae
           YLR088W GAA1 Subunit of the GPI:protein transamidase
           complex removes the GPI-anchoring signal and attaches
           GPI (glycosylphosphatidylinositol) to proteins in the ER
          Length = 584

 Score =  614 bits (1583), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 307/567 (54%), Positives = 395/567 (69%), Gaps = 13/567 (2%)

Query: 1   MSLLQKVYRRLSERGAITKLLQQLPRVSNXXXXXXXX-XXXXXPLDGQYRRTYISENALM 59
           M+L++K+ RR+ + G + ++++ LP++S               PL+GQYR TYISENALM
Sbjct: 1   MALIEKLQRRIIDLGLLPRIVRFLPKLSILCGILGICWLTLLLPLEGQYRHTYISENALM 60

Query: 60  PSQAYSYFRETEWNILRGYRSQIETLEHSSVDQRNEVVAEWLQEQGLKTALYEHEKWGKT 119
           PSQAYSYFRETEWNILRGYR+QI+ LE  S  +RNEVVA W QE G KTA YE +  G T
Sbjct: 61  PSQAYSYFRETEWNILRGYRTQIQVLEEKSSKERNEVVASWFQEFGAKTAFYEDDLHGNT 120

Query: 120 LYGVLHASRGDGTEAMVLAIPWKNVDDQFNLGGAALGVSLSQFFKRWPVWSKNIIVVFSE 179
           +YGVLHA RGDGTEAMVLA PW N D ++N+GGAAL  +LS+FF RWPVWSKNII+VFS+
Sbjct: 121 MYGVLHAPRGDGTEAMVLAAPWYNGDGEYNIGGAALATALSRFFSRWPVWSKNIIIVFSD 180

Query: 180 DSGAALRAWVDAYHTSLDLTAGSIEAAVVLDYPSKSDFFEYVEISYDGLNGELPNLDLVN 239
           D  A+LR+WV AYHTSLDLT GSIE+AVVLDYP  +DFF+YVEI Y GLNGELPNLDLVN
Sbjct: 181 DPEASLRSWVHAYHTSLDLTGGSIESAVVLDYPGSNDFFKYVEIYYAGLNGELPNLDLVN 240

Query: 240 IAVSITEHEGMKVSLHGLPPNEMYNTDYFARLKIMFVGIKNWALSGVKRIHGNEAFSGWR 299
           +AV ITEHEGMKVSL+G+   EM   +YF+++K M VG+K  ALSGV+  +GNEAFSGWR
Sbjct: 241 VAVHITEHEGMKVSLNGVSEEEMEKRNYFSKMKTMMVGVKKMALSGVQSCYGNEAFSGWR 300

Query: 300 IQSVTLRAHGNEGQLDITCFGRIPEAMFRSVNNLLEKFHQSYFFYLLLAPRNFVSISNYL 359
           IQ++ LRA G +G  DIT FGRIPEA FRSVNNLLEKFHQS+FFYLLLAPR FVSI++YL
Sbjct: 301 IQAIVLRARGTDGPFDITTFGRIPEATFRSVNNLLEKFHQSFFFYLLLAPRYFVSIASYL 360

Query: 360 PSAVIISVAFAVISLDSAINNDYLSIPFSSVNTLVPFIILSASVFVSFLISRVLIMLPIV 419
           P+AV  SV+F V +LD  + +   + P  SV+ L   I  + ++ +SF +S +       
Sbjct: 361 PAAVAFSVSFIVATLDCVLKSGASNTPAFSVHNLSAVIGFTVALLLSFALSILFSHWQYS 420

Query: 420 ESLLFGSVALTFLPLVMSKKNIHVINQAVAYRLKXXXXXXXXXXXXXXXMVNFALTFMIG 479
             L+  +  +  LP +  ++ I   +   +Y+ K               ++NFAL F IG
Sbjct: 421 SLLISCNAVIAVLPAIFGRQGIEASH---SYQFKSVAFLYLSVVLTSLLVINFALAFGIG 477

Query: 480 LLAFPLTKLAVISTKTIADESRKSILKNTFILFITNPFISLWLFTATMDTDFNGSFSVIY 539
           LLAFPL  +    T      SR+ + KNT +L ++NPFIS  LF  T +   +G    ++
Sbjct: 478 LLAFPLILVKAPMT------SRQRV-KNTILLILSNPFISTLLFVNTFEPQLSG--LQLF 528

Query: 540 NRMITSWDTLGCWTWFIICLGWLPYWL 566
           +R++ +W  LGCWTW ++C+GWLP WL
Sbjct: 529 HRLVQAWQKLGCWTWSVVCIGWLPSWL 555

>TBLA0F03080 Chr6 complement(747695..749446) [1752 bp, 583 aa] {ON}
           Anc_8.261 YLR088W
          Length = 583

 Score =  613 bits (1581), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 303/568 (53%), Positives = 401/568 (70%), Gaps = 10/568 (1%)

Query: 1   MSLLQKVYRRLSERGAITKLLQQLPRVSNXXXXXXXXXXXXXPLDGQYRRTYISENALMP 60
           M+LL  ++RR+ + G + K++++LP VS              P+DGQYR TYISENALMP
Sbjct: 1   MALLATIHRRVIDMGLVPKIMKRLPLVSIFLAAIGIVLFLMLPMDGQYRHTYISENALMP 60

Query: 61  SQAYSYFRETEWNILRGYRSQIETLEHSSVDQRNEVVAEWLQEQGLKTALYEHEKWGKTL 120
           SQAYSYFRE+EWNILRGYR++I+         RN V+ +WL+E G KT++Y ++++G TL
Sbjct: 61  SQAYSYFRESEWNILRGYRTEIDIFPSMPSRDRNLVMTQWLEEFGTKTSVYHNDEYGDTL 120

Query: 121 YGVLHASRGDGTEAMVLAIPWKNVDDQFNLGGAALGVSLSQFFKRWPVWSKNIIVVFSED 180
           YG+ +A RGDGTEA+VLAIPW N D +FN GGAALG++LS+FF RWP+WSKNIIVVFSE+
Sbjct: 121 YGIFNAPRGDGTEAIVLAIPWYNADGEFNTGGAALGIALSRFFSRWPIWSKNIIVVFSEN 180

Query: 181 SGAALRAWVDAYHTSLDLTAGSIEAAVVLDYPSKSDFFEYVEISYDGLNGELPNLDLVNI 240
              ALR+WVDAYH SLDLT GSIEAA+V+DYPS SDFF+YVEI Y G+NGELPNLDL+NI
Sbjct: 181 PDGALRSWVDAYHHSLDLTGGSIEAAIVMDYPSSSDFFDYVEIYYHGINGELPNLDLLNI 240

Query: 241 AVSITEHEGMKVSLHGLPPNEMYNTDYFARLKIMFVGIKNWALSGVKRIHGNEAFSGWRI 300
           A+ ITEHEGM+VSLHGLP   ++  +YF+RL+ + +G K+  LSG+K  HGNEAFSG+RI
Sbjct: 241 AIQITEHEGMQVSLHGLPKESLHQNNYFSRLRTLLLGTKDALLSGIKPRHGNEAFSGFRI 300

Query: 301 QSVTLRAH--GNEGQLDITCFGRIPEAMFRSVNNLLEKFHQSYFFYLLLAPRNFVSISNY 358
           Q++TL+A    +    DIT FGRI EA FRSVNNLLEKFHQS+FFYL+LAP+ FVSIS+Y
Sbjct: 301 QAITLKAKFTPDNNDHDITSFGRIAEASFRSVNNLLEKFHQSFFFYLILAPKYFVSISSY 360

Query: 359 LPSAVIISVAFAVISLDSAINNDYLSIPFSSVNTLVPFIILSASVFVSFLISRVLIMLPI 418
           LPSAV  SVAFA+ SL S INN Y ++P  S   L+  ++ + S+  SF ++R+ ++   
Sbjct: 361 LPSAVTFSVAFAISSLSSYINNSYSTLPIFSEYNLLAGLLFTISITFSFFVARLSLLFTE 420

Query: 419 VESLLFGSVALTFLPLVMSKKNIHVINQAVAYRLKXXXXXXXXXXXXXXXMVNFALTFMI 478
              L+ GSV L+ LP ++  +    I + ++YRLK               ++NF+L F I
Sbjct: 421 PRLLVLGSVFLSVLPHLLGNR--FTIPEPLSYRLKSIAFLYISLVLTSLLVLNFSLAFGI 478

Query: 479 GLLAFPLTKLAVISTKTIADESRKSILKNTFILFITNPFISLWLFTATMDTDFNGSFSVI 538
           G+L F +T +  I+  +    S +  ++NT  L ++NPF S+ LFT   D D  G    I
Sbjct: 479 GILGFAMTAVKTITIHS----SMRVRVRNTMHLLLSNPFTSVLLFTYIFDKDIYG--IKI 532

Query: 539 YNRMITSWDTLGCWTWFIICLGWLPYWL 566
           +   I SW+TL CWTWFIIC+GWLP W+
Sbjct: 533 FYEFIHSWNTLNCWTWFIICVGWLPPWI 560

>ZYRO0C01672g Chr3 complement(119344..121053) [1710 bp, 569 aa] {ON}
           similar to uniprot|P39012 Saccharomyces cerevisiae
           YLR088W GAA1 Subunit of the GPI:protein transamidase
           complex removes the GPI-anchoring signal and attaches
           GPI (glycosylphosphatidylinositol) to proteins in the ER
          Length = 569

 Score =  607 bits (1564), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 296/566 (52%), Positives = 393/566 (69%), Gaps = 21/566 (3%)

Query: 1   MSLLQKVYRRLSERGAITKLLQQLPRVSNXXXXXXXXXXXXXPLDGQYRRTYISENALMP 60
           M+L++++ RR+ E G + K++  LP VS              P++GQ+RRTYISENALMP
Sbjct: 1   MALIEQLQRRVVEMGLVPKIIALLPLVSMICAMISSLWLATLPIEGQFRRTYISENALMP 60

Query: 61  SQAYSYFRETEWNILRGYRSQIETLEHSSVDQRNEVVAEWLQEQGLKTALYEHEKWGKTL 120
           SQAYSYFRE+EWNILRGYRSQIE     S ++RNE +AEWLQE G KT++Y +E++G +L
Sbjct: 61  SQAYSYFRESEWNILRGYRSQIEHFGEISNNERNEQMAEWLQEFGAKTSIYNNEEYGDSL 120

Query: 121 YGVLHASRGDGTEAMVLAIPWKNVDDQFNLGGAALGVSLSQFFKRWPVWSKNIIVVFSED 180
           YG+LHA RGDGTEA++LA+PW N +   N+GGA+LG+SLS+FF RWPVWSKNII+VFSE+
Sbjct: 121 YGILHAERGDGTEAILLAVPWYNAEGDLNVGGASLGISLSRFFSRWPVWSKNIIIVFSEN 180

Query: 181 SGAALRAWVDAYHTSLDLTAGSIEAAVVLDYPSKSDFFEYVEISYDGLNGELPNLDLVNI 240
              ALR+WV AYHTSLDLT GSIEAA+VLDYP  +D+F+Y EISY GLNGELPNLDLVNI
Sbjct: 181 PNVALRSWVQAYHTSLDLTGGSIEAAIVLDYPGTNDYFDYAEISYGGLNGELPNLDLVNI 240

Query: 241 AVSITEHEGMKVSLHGLPPNEMYNTDYFARLKIMFVGIKNWALSGVKRIHGNEAFSGWRI 300
           AVSITEHEG+ VSLHG+ P  + +  Y++RLKI+  GI   A +G++ + GNEAFSGWRI
Sbjct: 241 AVSITEHEGVHVSLHGMTPESINDESYWSRLKILLCGIYRDAFAGLEPLQGNEAFSGWRI 300

Query: 301 QSVTLRAHGNE-GQLDITCFGRIPEAMFRSVNNLLEKFHQSYFFYLLLAPRNFVSISNYL 359
           QSVT++AHG E G  DIT FGRIPEAMFRS+NNLLEKFHQSYFFY+L+APR FVSIS+YL
Sbjct: 301 QSVTIKAHGKEGGNNDITTFGRIPEAMFRSINNLLEKFHQSYFFYMLVAPRYFVSISSYL 360

Query: 360 PSAVIISVAFAVISLDSAINNDYLSIPFSSVNTLVPFIILSASVFVSFLISRVLIMLPIV 419
           P+ V+++  FA+ SL+S + N Y ++ F S   L   +    S+ VSF+ S++ + +P  
Sbjct: 361 PATVVLTAGFALASLNSLLANQYSNLSFYSHYNLKALLFWLVSILVSFVFSQLFLYVPST 420

Query: 420 ESLLFGSVALTFLPLVMSKKNIHVINQAVAYRLKXXXXXXXXXXXXXXXMVNFALTFMIG 479
             L+   V +  LPL   +  +  I + +++RL+               MVNF L F++G
Sbjct: 421 ILLVAFIVVMLLLPLAAGR--LWTITEPLSHRLQMYAFLYMSLVVTSLMMVNFTLAFVVG 478

Query: 480 LLAFPLTKLAVISTKTIADESRKSILKNTFILFITNPFISLWLFTATMDTDFNGSFSVIY 539
           +LAFP+T +            R    K   +L I+NP +S ++               + 
Sbjct: 479 ILAFPMTAVGT---------QRSLTFKKYALLIISNPLVSFFIVKPHPQ---------LL 520

Query: 540 NRMITSWDTLGCWTWFIICLGWLPYW 565
            ++I++W  LGCWTWF++CLGWLP W
Sbjct: 521 QKLISAWQDLGCWTWFVLCLGWLPSW 546

>Ecym_4309 Chr4 complement(656032..657765) [1734 bp, 577 aa] {ON}
           similar to Ashbya gossypii AGR087C
          Length = 577

 Score =  604 bits (1557), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 282/567 (49%), Positives = 395/567 (69%), Gaps = 11/567 (1%)

Query: 1   MSLLQKVYRRLSERGAITKLLQQLPRVSNXXXXXXXX-XXXXXPLDGQYRRTYISENALM 59
           M++L+K++RR+ + G + +++  LP++S               PL+GQYRRTYISENALM
Sbjct: 1   MAVLEKLHRRIVDMGLVPRIIASLPKISIFCALLSISWLTLFLPLEGQYRRTYISENALM 60

Query: 60  PSQAYSYFRETEWNILRGYRSQIETLEHSSVDQRNEVVAEWLQEQGLKTALYEHEKWGKT 119
           PSQAYSYFRE+EWNILRGYR ++E L+   + +RN +VA W++E G KT++  + ++G+T
Sbjct: 61  PSQAYSYFRESEWNILRGYRRELENLKDLDIHERNTIVASWMEEYGAKTSINTNNQYGET 120

Query: 120 LYGVLHASRGDGTEAMVLAIPWKNVDDQFNLGGAALGVSLSQFFKRWPVWSKNIIVVFSE 179
           LYG++H SRGDGTEAMVLA PW   D  +N GGAAL +SL+++F RWPVWSKNIIVV S 
Sbjct: 121 LYGIVHTSRGDGTEAMVLAAPWTTTDGLYNNGGAALAISLARYFARWPVWSKNIIVVLSA 180

Query: 180 DSGAALRAWVDAYHTSLDLTAGSIEAAVVLDYPSKSDFFEYVEISYDGLNGELPNLDLVN 239
           D  A+LRAWV AYHT LDLT GSIE+AVVLDYP  +D+F+Y+EI Y+GLNG LPNLDL+N
Sbjct: 181 DPQASLRAWVKAYHTKLDLTGGSIESAVVLDYPGTNDYFKYIEIGYNGLNGGLPNLDLIN 240

Query: 240 IAVSITEHEGMKVSLHGLPPNEMYNTDYFARLKIMFVGIKNWALSGVKRIHGNEAFSGWR 299
            AV I+EHEGMKVSLHG+P  E+    Y  RLK +  GIK+  L+G+K   G+EAF+GWR
Sbjct: 241 TAVHISEHEGMKVSLHGMPFVELSQDTYKLRLKTLLSGIKDMTLAGIKNTTGHEAFNGWR 300

Query: 300 IQSVTLRAHGNEGQLDITCFGRIPEAMFRSVNNLLEKFHQSYFFYLLLAPRNFVSISNYL 359
           IQSVTL+AHG +G  D+T FGR+PEA+FRSVNNLLEKFHQS+FFYLLL+PR+FVSI +YL
Sbjct: 301 IQSVTLKAHGQDGPFDVTTFGRVPEAIFRSVNNLLEKFHQSFFFYLLLSPRSFVSIGSYL 360

Query: 360 PSAVIISVAFAVISLDSAINNDYLSIPFSSVNTLVPFIILSASVFVSFLISRVLIMLPIV 419
           P+A+ +S +FA+ S DS +NN+Y  +P  S+  +      + ++ +SF+ +     +P+ 
Sbjct: 361 PAAIALSASFAIASADSILNNEYSKLPLLSIYNIWALFAFAVALMISFVTAEAFAYMPLP 420

Query: 420 ESLLFGSVALTFLPLVMSKKNIHVINQAVAYRLKXXXXXXXXXXXXXXXMVNFALTFMIG 479
             LL  +VAL+F+   + K   + I +  +YR K               +VNFAL   +G
Sbjct: 421 SLLLAFNVALSFISFTVIK---YKIQKPFSYRFKAFAHLYFSIVLTSLLVVNFALALAVG 477

Query: 480 LLAFPLTKLAVISTKTIADESRKSILKNTFILFITNPFISLWLFTATMDTDFNGSFSVIY 539
           +LAFP++      TKT  + + +  L+N+ +L  +NPFI+ W+     +    G  + ++
Sbjct: 478 VLAFPMSL-----TKTTTNATMQQKLRNSLLLMSSNPFIASWILCQLFEAQLAG--TSLF 530

Query: 540 NRMITSWDTLGCWTWFIICLGWLPYWL 566
           + +I +W  LGCWTW+++C+GW P W+
Sbjct: 531 HSLIDAWTQLGCWTWYVLCIGWYPSWI 557

>KNAG0H03250 Chr8 complement(605885..607642) [1758 bp, 585 aa] {ON}
           Anc_8.261 YLR088W
          Length = 585

 Score =  604 bits (1557), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 294/529 (55%), Positives = 387/529 (73%), Gaps = 13/529 (2%)

Query: 43  PLDGQYRRTYISENALMPSQAYSYFRETEWNILRGYRSQIETLEHSSVD--QRNEVVAEW 100
           P++GQYR TYISENALMPSQAYSYFRETEWNILRGYR++IE L    V    R ++VA W
Sbjct: 43  PMNGQYRNTYISENALMPSQAYSYFRETEWNILRGYRTEIEVLNSRGVSASDRYDIVAGW 102

Query: 101 LQEQGLKTALYEHEKWGKTLYGVLHASRGDGTEAMVLAIPWKNVDDQFNLGGAALGVSLS 160
           L E G KTA+Y +E+ G TLYGVLHA RGDGTEAMVL  PW N + +FN+GG+AL ++LS
Sbjct: 103 LNEFGAKTAVYRNEEMGDTLYGVLHAPRGDGTEAMVLCAPWNNSEGEFNIGGSALAIALS 162

Query: 161 QFFKRWPVWSKNIIVVFSEDSGAALRAWVDAYHTSLDLTAGSIEAAVVLDYPSKSDFFEY 220
           ++F RWPVWSKNIIVVFS++   ALR+WV+AYHTSLDLT GSIEAAV+LDYPS +D+F Y
Sbjct: 163 RYFSRWPVWSKNIIVVFSDNPSVALRSWVEAYHTSLDLTGGSIEAAVILDYPSNNDYFNY 222

Query: 221 VEISYDGLNGELPNLDLVNIAVSITEHEGMKVSLHGLPPNEMYNTDYFARLKIMFVGIKN 280
            EI ++GLNGELPNLDLVN+AV IT+HEGMKVSLHGLP +E+   +Y++RLK++F+G+K+
Sbjct: 223 TEIHFEGLNGELPNLDLVNVAVHITQHEGMKVSLHGLPRSELEKNNYWSRLKLLFLGMKD 282

Query: 281 WALSGVKRIHGNEAFSGWRIQSVTLRAHGNEGQLDITCFGRIPEAMFRSVNNLLEKFHQS 340
             L+G+K+ HGNE FSGWRIQ+VTL+A G EGQ+DIT FGRIPEAMFRS+NNLLEKFHQS
Sbjct: 283 STLAGMKKAHGNEVFSGWRIQAVTLKARG-EGQIDITTFGRIPEAMFRSINNLLEKFHQS 341

Query: 341 YFFYLLLAPRNFVSISNYLPSAVIISVAFAVISLDSAINNDYLSIPFSSVNTLVPFIILS 400
           +FFY LL+P NFVSIS+YLPSAV++S+ FA+ ++D+ +NN Y S       TL+  +   
Sbjct: 342 FFFYFLLSPNNFVSISSYLPSAVLLSITFAIAAVDATVNNAYAS-ALHITYTLLAALASV 400

Query: 401 ASVFVSFLISRVLI---MLPIVESLLFGSVALTFLPLVMSKKNIHVINQAVAYRLKXXXX 457
            S+ VSFL++   +     P+   L+ GSV L   PLVMS+ N + + + V YR++    
Sbjct: 401 ISLLVSFLVAHWFLYSTTSPLY--LILGSVVLAVSPLVMSRSN-NALREPVCYRMRTLGY 457

Query: 458 XXXXXXXXXXXMVNFALTFMIGLLAFPLTKLAVISTKTIADESRKSILKNTFILFITNPF 517
                      M+NF L F IGL  +P+T +  ++  + +  S K  L+N+ +L I+NPF
Sbjct: 458 IYYSLILTSLLMLNFPLAFSIGLFGYPMTLVKPLNIYSKSQMSLK--LRNSVLLVISNPF 515

Query: 518 ISLWLFTATMDTDFNGSFSVIYNRMITSWDTLGCWTWFIICLGWLPYWL 566
           ++ WL    ++     +  V +  + ++W  L CWTWF++CLGWLP WL
Sbjct: 516 VATWLICTVVENSEFPNLDV-FAALFSAWKDLNCWTWFVLCLGWLPTWL 563

>KAFR0B05550 Chr2 complement(1136432..1138099) [1668 bp, 555 aa]
           {ON} Anc_8.261 YLR088W
          Length = 555

 Score =  592 bits (1527), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 296/555 (53%), Positives = 392/555 (70%), Gaps = 11/555 (1%)

Query: 1   MSLLQKVYRRLSERGAITKLLQQLPRVSNXXXXXXXXXXXXXPLDGQYRRTYISENALMP 60
           M L+++V R+++  G + KL + LP  S              P+DGQYR TYISENALMP
Sbjct: 1   MGLVERVKRQVAVMGLVPKLKKYLPLFSKIIALISLISIAILPIDGQYRNTYISENALMP 60

Query: 61  SQAYSYFRETEWNILRGYRSQIETLEHSSVDQRNEVVAEWLQEQGLKTALYEHEKWGKTL 120
           SQAYSYFRETEWNILRGYR+Q+E +    + +RN+++  WL + G KT  + +     T+
Sbjct: 61  SQAYSYFRETEWNILRGYRTQVENMVDLPLTERNDIMETWLNDIGAKTDTHNN----STI 116

Query: 121 YGVLHASRGDGTEAMVLAIPWKNVDDQFNLGGAALGVSLSQFFKRWPVWSKNIIVVFSED 180
           YG+ H+ RGDGTEA+VLAIPW N + QFN GGAALGVSL++FF RWP+WSKNIIVVFSED
Sbjct: 117 YGIFHSPRGDGTEAIVLAIPWHNSEGQFNTGGAALGVSLARFFWRWPIWSKNIIVVFSED 176

Query: 181 SGAALRAWVDAYHTSLDLTAGSIEAAVVLDYPSKSDFFEYVEISYDGLNGELPNLDLVNI 240
           +GA+LR+WV+AYHTSLDLT GSIEAAV+LDY S+SDFF+YVEI YDGLNGELPNLDLVNI
Sbjct: 177 TGASLRSWVEAYHTSLDLTGGSIEAAVILDYASESDFFDYVEIHYDGLNGELPNLDLVNI 236

Query: 241 AVSITEHEGMKVSLHGLPPNEMYNTDYFARLKIMFVGIKNWALSGVKRIHGNEAFSGWRI 300
           AVSITEHEGMKVSLHGLP  E+     ++R K++   IK+ +L+G+K+ HGNEAFSGWRI
Sbjct: 237 AVSITEHEGMKVSLHGLPREELEERSLWSRFKMLLRSIKDSSLAGIKKPHGNEAFSGWRI 296

Query: 301 QSVTLRAHGNEGQLDITCFGRIPEAMFRSVNNLLEKFHQSYFFYLLLAPRNFVSISNYLP 360
           Q++TL+A G EG +DIT FGRIPEAMFRS+NNLLEKFHQS+F+YLLLAPRNFVSIS+YLP
Sbjct: 297 QALTLKACG-EGGIDITTFGRIPEAMFRSINNLLEKFHQSFFYYLLLAPRNFVSISSYLP 355

Query: 361 SAVIISVAFAVISLDSAINNDYLSIPFSSVNTLVPFIILSASVFVSFLISRVLIMLPIVE 420
           +AV +S+AFA  SL   +N++  SIPF S  TL   I+   S+  SF  +   +      
Sbjct: 356 AAVGLSLAFACSSLGEFVNDNQDSIPFISSYTLEAIIVWFLSITFSFCFAITYLKYTFPV 415

Query: 421 SLLFGSVALTFLPLVMSKKNIHVINQAVAYRLKXXXXXXXXXXXXXXXMVNFALTFMIGL 480
            L+F  +  +F+PL+     +      VA+R+K               M+NF L   IG+
Sbjct: 416 MLMFICILFSFIPLISRGLPLAETKITVAHRMKAFAFGYFSLVLTSLLMINFPLALTIGV 475

Query: 481 LAFPLTKLAVISTKTIADESRKSILKNTFILFITNPFISLWLFTATMDTDFNGSFSVIYN 540
           LAFP+T + + +T   + ++    LKN+ +L ++NP+IS+  F+   D++  G  ++  +
Sbjct: 476 LAFPMTLVKISNTLPTSSQA----LKNSMLLLVSNPYISICAFSNIFDSELTGLATL--D 529

Query: 541 RMITSWDTLGCWTWF 555
           R+I +W+ + CWTWF
Sbjct: 530 RLIPAWNDMNCWTWF 544

>Kwal_56.23804 s56 complement(710216..711952) [1737 bp, 578 aa] {ON}
           YLR088W (GAA1) - Possible component of GPI:protein
           transamidase [contig 173] FULL
          Length = 578

 Score =  592 bits (1527), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 305/567 (53%), Positives = 395/567 (69%), Gaps = 13/567 (2%)

Query: 1   MSLLQKVYRRLSERGAITKLLQQLPRVSNXXXXXXXX-XXXXXPLDGQYRRTYISENALM 59
           M+L++++ R++ + G + ++++ LP++S               PL+GQYR TYISENALM
Sbjct: 1   MALIERLQRKVIDLGLLPRIVRFLPKLSVLCGIIGIFWVTLLLPLEGQYRHTYISENALM 60

Query: 60  PSQAYSYFRETEWNILRGYRSQIETLEHSSVDQRNEVVAEWLQEQGLKTALYEHEKWGKT 119
           PSQAYSYFRETEWNILRGYR+QI+TLE+ S  +RNE++  WLQE G+KTALYE E  G T
Sbjct: 61  PSQAYSYFRETEWNILRGYRTQIQTLENKSSLERNEILGSWLQEFGVKTALYEDESCGNT 120

Query: 120 LYGVLHASRGDGTEAMVLAIPWKNVDDQFNLGGAALGVSLSQFFKRWPVWSKNIIVVFSE 179
           LYGVLHA RGDGTEAMVL+ PW N D +FN GG AL V+L+++F RWPVWSKNIIVVFS+
Sbjct: 121 LYGVLHAPRGDGTEAMVLSAPWFNGDGEFNKGGTALVVALARYFSRWPVWSKNIIVVFSD 180

Query: 180 DSGAALRAWVDAYHTSLDLTAGSIEAAVVLDYPSKSDFFEYVEISYDGLNGELPNLDLVN 239
           D  A+LR+WV AYHTSLDLT GSIE+AVVLDYP  +DFF+YVEI Y GLNGELPNLDLVN
Sbjct: 181 DPKASLRSWVQAYHTSLDLTGGSIESAVVLDYPGVNDFFKYVEIYYAGLNGELPNLDLVN 240

Query: 240 IAVSITEHEGMKVSLHGLPPNEMYNTDYFARLKIMFVGIKNWALSGVKRIHGNEAFSGWR 299
           +A+ +TEHEGMKVSL+G+P +EM N DYFAR+K M VGIK  ALSGV+R +GNEAFSGWR
Sbjct: 241 VAIHVTEHEGMKVSLNGIPEDEMQNRDYFARMKTMVVGIKKMALSGVQRCYGNEAFSGWR 300

Query: 300 IQSVTLRAHGNEGQLDITCFGRIPEAMFRSVNNLLEKFHQSYFFYLLLAPRNFVSISNYL 359
           IQ+V LRA G+ G  DIT FGR+PEA+FRSVNNLLEKFHQS+FFYLLLAPR FVSI++YL
Sbjct: 301 IQAVVLRARGDHGPFDITTFGRVPEAVFRSVNNLLEKFHQSFFFYLLLAPRYFVSIASYL 360

Query: 360 PSAVIISVAFAVISLDSAINNDYLSIPFSSVNTLVPFIILSASVFVSFLISRVLIMLPIV 419
           P+AV  SV+F V +LD+ +     +     +  +   +  + ++  SF +S         
Sbjct: 361 PAAVAFSVSFIVAALDNVLCQGASTSQSGILPNIAAVVGFTVALLFSFTVSVTFARFHHP 420

Query: 420 ESLLFGSVALTFLPLVMSKKNIHVINQAVAYRLKXXXXXXXXXXXXXXXMVNFALTFMIG 479
             L+  SV     P+++++  I     + A+RLK               +VNFAL F IG
Sbjct: 421 VILISWSVMTALAPILLNRVRIQ---SSYAHRLKAVAYLYLSVVLTSLLVVNFALAFGIG 477

Query: 480 LLAFPLTKLAVISTKTIADESRKSILKNTFILFITNPFISLWLFTATMDTDFNGSFSVIY 539
           LLAFPL  +   +T        + + KN+ +L ++NPFIS  LF    +    G    I 
Sbjct: 478 LLAFPLILVKNSTTP-------RLLFKNSLLLLLSNPFISTCLFAYFFEPLLPG--LQIL 528

Query: 540 NRMITSWDTLGCWTWFIICLGWLPYWL 566
            +++ +W+  GCWTW ++C+GWLP WL
Sbjct: 529 EQLVQAWNEFGCWTWCVVCIGWLPSWL 555

>KLLA0F19118g Chr6 (1771250..1772986) [1737 bp, 578 aa] {ON} similar
           to uniprot|P39012 Saccharomyces cerevisiae YLR088W GAA1
           Subunit of the GPI:protein transamidase complex removes
           the GPI-anchoring signal and attaches GPI
           (glycosylphosphatidylinositol) to proteins in the ER
          Length = 578

 Score =  589 bits (1518), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 296/568 (52%), Positives = 394/568 (69%), Gaps = 11/568 (1%)

Query: 1   MSLLQKVYRRLSERGAITKLLQQLPRVSNXXXXXXXX-XXXXXPLDGQYRRTYISENALM 59
           M+L++K++RR+   G I K + +L ++S               P DGQ+RRTYISENAL+
Sbjct: 1   MALVEKLHRRIISIGLIPKFISKLSQLSLLCCVIGLGWLVFMLPSDGQFRRTYISENALL 60

Query: 60  PSQAYSYFRETEWNILRGYRSQIETLEH-SSVDQRNEVVAEWLQEQGLKTALYEHEKWGK 118
           PSQAYSYFRE+EWNILRGYR+Q++  ++ S+    N  V++WLQE G+KTA+Y+ E++G+
Sbjct: 61  PSQAYSYFRESEWNILRGYRTQLDLFQYVSTTHDSNAEVSKWLQEFGVKTAIYDDEQYGE 120

Query: 119 TLYGVLHASRGDGTEAMVLAIPWKNVDDQFNLGGAALGVSLSQFFKRWPVWSKNIIVVFS 178
           TLYG+ HA RGDGTEAMV+A PW N + ++N GGAAL +SL +FF RWPVWSKNII+V S
Sbjct: 121 TLYGIFHAPRGDGTEAMVIAAPWYNENREYNTGGAALAISLVRFFSRWPVWSKNIIIVLS 180

Query: 179 EDSGAALRAWVDAYHTSLDLTAGSIEAAVVLDYPSKSDFFEYVEISYDGLNGELPNLDLV 238
           ED  A+LR+WV AYHTSLDLT GSIE+A+VLDYP  SD F+Y+EI YDGLNGE PNLDLV
Sbjct: 181 EDPKASLRSWVTAYHTSLDLTGGSIESAIVLDYPGTSDRFDYMEIHYDGLNGETPNLDLV 240

Query: 239 NIAVSITEHEGMKVSLHGLPPNEMYNTDYFARLKIMFVGIKNWALSGVKRIHGNEAFSGW 298
           N+AV I EHEG+KVSLHGLP +E+   DY +RLK M +GIK+  LSG+K  +GNEAFSGW
Sbjct: 241 NVAVHIAEHEGIKVSLHGLPFSELDRNDYNSRLKTMLLGIKDSVLSGIKNCYGNEAFSGW 300

Query: 299 RIQSVTLRAHGNEGQLDITCFGRIPEAMFRSVNNLLEKFHQSYFFYLLLAPRNFVSISNY 358
           RIQS+TL+A G +G  DIT FGR+PEA+ RSVNNLLEKFHQS+FFYLLLAPR F+SI  Y
Sbjct: 301 RIQSLTLKAKGIDGPHDITTFGRVPEALSRSVNNLLEKFHQSFFFYLLLAPRYFISIGTY 360

Query: 359 LPSAVIISVAFAVISLDSAINNDYLSIPFSSVNTLVPFIILSASVFVSFLISRVLIMLPI 418
           L +AV +SVAF   +L+  +NN Y  +P  S+  +   +    S+  +F  S++ +  P+
Sbjct: 361 LATAVAVSVAFVFAALNQILNNKYGELPLLSIYNIWSILTFCISLVFAFATSQLFVYFPL 420

Query: 419 VESLLFGSVALTFLPLVMSKKNIHVINQAVAYRLKXXXXXXXXXXXXXXXMVNFALTFMI 478
              LL  S   + LPL +S+  +  I +  +YR K               ++NF+L  ++
Sbjct: 421 PRVLLGLSGIFSVLPL-LSRTRLR-IQEPFSYRFKAFAYIYMAIVLTSLLVLNFSLAIVM 478

Query: 479 GLLAFPLTKLAVISTKTIADESRKSILKNTFILFITNPFISLWLFTATMDTDFNGSFSVI 538
           GLLAFP+T+     T TI + + +  +KN  +L I+NPFI+ W     ++   +G F V 
Sbjct: 479 GLLAFPMTR-----TTTIIESNLRLSIKNLVLLIISNPFIATWAVVNFVEPRLSG-FKVF 532

Query: 539 YNRMITSWDTLGCWTWFIICLGWLPYWL 566
           Y  +I +   LGCWTW+IICLGW P WL
Sbjct: 533 Y-ALIEASQQLGCWTWYIICLGWYPSWL 559

>TPHA0A01820 Chr1 complement(367804..369549) [1746 bp, 581 aa] {ON}
           Anc_8.261 YLR088W
          Length = 581

 Score =  588 bits (1515), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 287/566 (50%), Positives = 404/566 (71%), Gaps = 9/566 (1%)

Query: 1   MSLLQKVYRRLSERGAITKLLQQLPRVSNXXXXXXXXXXXXXPLDGQYRRTYISENALMP 60
           M+L++ ++RR ++ G + K++ +L  VSN             PLDGQYRRTYISENAL+P
Sbjct: 1   MALIEVLHRRATKLGLLPKVIGKLSIVSNILVLISIGLILCLPLDGQYRRTYISENALLP 60

Query: 61  SQAYSYFRETEWNILRGYRSQIETLEHSSVDQRNEVVAEWLQEQGLKTALYEHEKWGKTL 120
           SQAYSYFRE+EWNILRGYR+ IE L       RNEV++ WL + G+K A+Y++   G TL
Sbjct: 61  SQAYSYFRESEWNILRGYRTAIEALIDKPARVRNEVISSWLTDFGMKHAVYDNAADGDTL 120

Query: 121 YGVLHASRGDGTEAMVLAIPWKNVDDQFNLGGAALGVSLSQFFKRWPVWSKNIIVVFSED 180
           YGV ++ RGDGTEA+VLA+PW N D++ N+GGAALG+SLS++F RWP+WSKNII+V SE+
Sbjct: 121 YGVYNSQRGDGTEAIVLAVPWYNTDNEVNIGGAALGISLSRYFSRWPIWSKNIILVISEN 180

Query: 181 SGAALRAWVDAYHTSLDLTAGSIEAAVVLDYPSKSDFFEYVEISYDGLNGELPNLDLVNI 240
              A+++WVDAYH SLDLT GS+EAA+VLD+PSKS++FE+VE+ ++G+NGELPNLD+VN+
Sbjct: 181 PHKAMKSWVDAYHNSLDLTGGSLEAAIVLDFPSKSEYFEFVELYFNGINGELPNLDIVNV 240

Query: 241 AVSITEHEGMKVSLHGLPPNEMYNTDYFARLKIMFVGIKNWALSGVKRIHGNEAFSGWRI 300
           A+S+ EHEG+KVSL GL  +EMY + YF RLK +  G+KN ALSG ++++GNEAFSG RI
Sbjct: 241 AISVIEHEGVKVSLQGLNLSEMYTSSYFNRLKTLLFGVKNSALSGTRKLYGNEAFSGRRI 300

Query: 301 QSVTLRAHGNEGQLDITCFGRIPEAMFRSVNNLLEKFHQSYFFYLLLAPRNFVSISNYLP 360
           Q++TL+A G EG  DIT FGRIPEA+FRSVNNLLEKFHQS+FFY L+APR+FVSI +YLP
Sbjct: 301 QALTLKACGTEGH-DITTFGRIPEAIFRSVNNLLEKFHQSFFFYFLVAPRHFVSIGSYLP 359

Query: 361 SAVIISVAFAVISLDSAINNDYLSIPFSSVNTLVPFIILSASVFVSFLISRVLIMLPIVE 420
           SAV +S++F + +  S INN Y+++P S  ++++  II   S+ +SF+  ++        
Sbjct: 360 SAVCLSISFGISAAHSYINNQYITVPLSDNSSILALIIFFGSIAISFIFLQINETFLQPH 419

Query: 421 SLLFGSVALTFLPLVMSKKNIHVINQAVAYRLKXXXXXXXXXXXXXXXMVNFALTFMIGL 480
            ++   + ++FLPL    + +  I   ++YRLK               ++NFAL F +GL
Sbjct: 420 LMILAFLLISFLPLTNIPQPLITIQPCLSYRLKSFAFIYISLVLTSLLVMNFALAFGMGL 479

Query: 481 LAFPLTKLAVISTKTIADE-SRKSILKNTFILFITNPFISLWLFTATMDTDFNGSFSVIY 539
           LAFPLT      TK+ ++  + KS + N F L I+NPFI++++F +  + D   +F V +
Sbjct: 480 LAFPLT-----FTKSCSEMITFKSKVINCFYLAISNPFIAIFIFVSIFEDDIT-NFEV-F 532

Query: 540 NRMITSWDTLGCWTWFIICLGWLPYW 565
           + +I+S+  +G WTW I C+GW   W
Sbjct: 533 SDLISSFKYMGNWTWAITCIGWFTTW 558

>TPHA0E00460 Chr5 complement(75495..77225) [1731 bp, 576 aa] {ON}
           Anc_7.476 YJR103W
          Length = 576

 Score = 37.7 bits (86), Expect = 0.084,   Method: Compositional matrix adjust.
 Identities = 31/94 (32%), Positives = 47/94 (50%), Gaps = 13/94 (13%)

Query: 78  YRSQIETLEHSSVDQRNEVVAEWLQEQGLKTALYEHEK------WGK--TLYGVLHASRG 129
           Y S I+ LEHSS+  RN++  +W++   L+    E EK      W K  T  G+L    G
Sbjct: 319 YLSVIKALEHSSMKCRNKLEIQWVEASDLEPETQETEKDKFHAAWNKVSTADGIL-VPGG 377

Query: 130 ---DGTEAMVLAIPWKNVDDQFNLGGAALGVSLS 160
               GTE M+LA  W   +++    G  LG+ ++
Sbjct: 378 FGYRGTEGMILAAKWAR-ENKVPYLGVCLGLQIA 410

>Kpol_1013.78 s1013 complement(192175..193905) [1731 bp, 576 aa]
           {ON} complement(192175..193905) [1731 nt, 577 aa]
          Length = 576

 Score = 37.4 bits (85), Expect = 0.099,   Method: Compositional matrix adjust.
 Identities = 41/156 (26%), Positives = 67/156 (42%), Gaps = 31/156 (19%)

Query: 78  YRSQIETLEHSSVDQRNEVVAEWLQEQGLKTALYE------HEKWGK--TLYGVLHAS-- 127
           Y S I+ LEHSS+  R ++   W++   L+    E      HE W K  T  G+L     
Sbjct: 319 YLSVIKALEHSSMKCRKKLEIRWVESSDLEPEQQEIAKKQFHEAWNKVSTSDGILVPGGF 378

Query: 128 RGDGTEAMVLAIPWKNVDDQFNLGGAALGVSLS--QFFKR------------WP-VWSKN 172
              GTE M+LA  W   ++     G  LG+ ++  +F +             +P + +KN
Sbjct: 379 GHRGTEGMILAAKWAR-ENHVPYLGVCLGLQIATIEFMRNIVGLKEGQSAEFFPDIEAKN 437

Query: 173 IIVVF-----SEDSGAALRAWVDAYHTSLDLTAGSI 203
            +VV+      E+ G  +R      H + D  + +I
Sbjct: 438 HVVVYMPEVDKENMGGTMRLGSRPTHFTEDSESSTI 473

>TDEL0C03390 Chr3 (599123..600853) [1731 bp, 576 aa] {ON} Anc_7.476
           YJR103W
          Length = 576

 Score = 36.2 bits (82), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 29/81 (35%), Positives = 38/81 (46%), Gaps = 14/81 (17%)

Query: 73  NILRGYRSQIETLEHSSVDQRNEVVAEWLQEQGLKTALYE------HEKWGK--TLYGVL 124
           N+   Y S I+ LEHSS+  R  +   W++   L+    E      HE W K  T  G+L
Sbjct: 314 NLKDSYLSVIKALEHSSMKCRTHLEILWVEASDLEPESQEVDKAKFHEAWNKVSTADGIL 373

Query: 125 ----HASRGDGTEAMVLAIPW 141
                 SR  GTE M+LA  W
Sbjct: 374 VPGGFGSR--GTEGMILAAKW 392

>KLTH0E01914g Chr5 complement(178565..180295) [1731 bp, 576 aa] {ON}
           highly similar to uniprot|P28274 Saccharomyces
           cerevisiae YBL039C
          Length = 576

 Score = 36.2 bits (82), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 37/114 (32%), Positives = 52/114 (45%), Gaps = 16/114 (14%)

Query: 73  NILRGYRSQIETLEHSSVDQRNEVVAEWLQEQGLKTALYEHEK------WGK--TLYGVL 124
           N+   Y S I+ LEHSS+     +   W++   L+    EHEK      W K     GVL
Sbjct: 314 NLKDSYLSVIKALEHSSMRCHRRLEIVWVEASDLEPETTEHEKSKFHEAWNKLSAADGVL 373

Query: 125 ----HASRGDGTEAMVLAIPWKNVDDQFNLGGAALGVSLSQF-FKRWPVWSKNI 173
                 +R  GTE MVLA  W   ++   L G  LG+ ++   F R  +  KN+
Sbjct: 374 VPGGFGTR--GTEGMVLAAKWARENNIPYL-GVCLGLQVATLEFARNVLGMKNV 424

>Skud_2.64 Chr2 complement(127777..129516) [1740 bp, 579 aa] {ON}
           YBL039C (REAL)
          Length = 579

 Score = 35.8 bits (81), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 31/98 (31%), Positives = 47/98 (47%), Gaps = 11/98 (11%)

Query: 73  NILRGYRSQIETLEHSSVDQRNEVVAEWLQEQGLKTALYE------HEKWG--KTLYGVL 124
           N+   Y S I++LEHSS+  R ++  +W++   L+    E      HE W    T  G+L
Sbjct: 314 NLKDSYLSVIKSLEHSSMKCRRKLEIKWVEATDLEPETQESNKLKFHEAWNMVSTADGIL 373

Query: 125 -HASRG-DGTEAMVLAIPWKNVDDQFNLGGAALGVSLS 160
                G  GTE MVLA  W   ++     G  LG+ ++
Sbjct: 374 IPGGFGVRGTEGMVLAARWAR-ENHIPFLGVCLGLQIA 410

>Kpol_1028.96 s1028 complement(214936..216675) [1740 bp, 579 aa]
           {ON} complement(214936..216675) [1740 nt, 580 aa]
          Length = 579

 Score = 35.8 bits (81), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 27/74 (36%), Positives = 36/74 (48%), Gaps = 10/74 (13%)

Query: 78  YRSQIETLEHSSVDQRNEVVAEWLQEQGLKTALYE------HEKWGK--TLYGVLHAS-- 127
           Y S I+ LEHSS+  RN++   W++   L+    E      H+ W K  T  GVL     
Sbjct: 319 YLSVIKALEHSSMKCRNKLEILWVESSHLEPETQETDKEKFHDAWNKVSTADGVLVPGGF 378

Query: 128 RGDGTEAMVLAIPW 141
              GTE M+LA  W
Sbjct: 379 GHRGTEGMILAAKW 392

>Smik_2.76 Chr2 complement(137720..139459) [1740 bp, 579 aa] {ON}
           YBL039C (REAL)
          Length = 579

 Score = 35.8 bits (81), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 41/144 (28%), Positives = 62/144 (43%), Gaps = 31/144 (21%)

Query: 73  NILRGYRSQIETLEHSSVDQRNEVVAEWLQEQGLKTALYE------HEKWG--KTLYGVL 124
           N+   Y S I+ LEHSS+  R ++  +W++   L+    E      HE W    T  G+L
Sbjct: 314 NLKDSYLSVIKALEHSSMKCRRKLEIKWVEATDLEPETQESNKTKFHEAWNMVSTADGIL 373

Query: 125 -HASRG-DGTEAMVLAIPWKNVDDQFNLGGAALGVSLSQF-FKR-------------WP- 167
                G  GTE M+LA  W   ++     G  LG+ ++   F R             +P 
Sbjct: 374 IPGGFGIRGTEGMILAARWAR-ENHIPFLGVCLGLQIATIEFTRSVLGKKDSHSAEFYPD 432

Query: 168 VWSKNIIVVF-----SEDSGAALR 186
           +  KN +VVF      E  G ++R
Sbjct: 433 IDEKNHVVVFMPEIDKETMGGSMR 456

>YBL039C Chr2 complement(143989..145728) [1740 bp, 579 aa] {ON}
           URA7Major CTP synthase isozyme (see also URA8),
           catalyzes the ATP-dependent transfer of the amide
           nitrogen from glutamine to UTP, forming CTP, the final
           step in de novo biosynthesis of pyrimidines; involved in
           phospholipid biosynthesis
          Length = 579

 Score = 35.4 bits (80), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 42/144 (29%), Positives = 62/144 (43%), Gaps = 31/144 (21%)

Query: 73  NILRGYRSQIETLEHSSVDQRNEVVAEWLQEQGLKTALYE------HEKWG--KTLYGVL 124
           N+   Y S I+ LEHSS+  R ++  +W++   L+    E      HE W    T  G+L
Sbjct: 314 NLKDSYLSVIKALEHSSMKCRRKLDIKWVEATDLEPEAQESNKTKFHEAWNMVSTADGIL 373

Query: 125 -HASRG-DGTEAMVLAIPWKNVDDQFNLGGAALGVSLSQF-FKR-------------WP- 167
                G  GTE MVLA  W   ++     G  LG+ ++   F R             +P 
Sbjct: 374 IPGGFGVRGTEGMVLAARWAR-ENHIPFLGVCLGLQIATIEFTRSVLGRKDSHSAEFYPD 432

Query: 168 VWSKNIIVVF-----SEDSGAALR 186
           +  KN +VVF      E  G ++R
Sbjct: 433 IDEKNHVVVFMPEIDKETMGGSMR 456

>CAGL0F04433g Chr6 (442206..443942) [1737 bp, 578 aa] {ON} highly
           similar to uniprot|P28274 Saccharomyces cerevisiae
           YBL039c URA7 CTP synthase 1 or uniprot|P38627
           Saccharomyces cerevisiae YJR103w URA8
          Length = 578

 Score = 35.4 bits (80), Expect = 0.49,   Method: Compositional matrix adjust.
 Identities = 31/100 (31%), Positives = 47/100 (47%), Gaps = 15/100 (15%)

Query: 73  NILRGYRSQIETLEHSSVDQRNEVVAEWLQEQGLKTALYE------HEKWGK--TLYGVL 124
           N+   Y S I+ LEHSS+  R ++   W++   L+    +      HE W K  T  G+L
Sbjct: 314 NLKDSYLSVIKALEHSSMKCRRKLEIMWVEATDLEPETQDTEKAKFHEAWNKVSTADGIL 373

Query: 125 ----HASRGDGTEAMVLAIPWKNVDDQFNLGGAALGVSLS 160
                 SR  GTE M+LA  W   ++     G  LG+ ++
Sbjct: 374 VPGGFGSR--GTEGMMLASRWAR-ENHIPFLGVCLGLQIA 410

>NDAI0J00630 Chr10 complement(128939..130678) [1740 bp, 579 aa] {ON}
           Anc_7.476 YBL039C
          Length = 579

 Score = 34.3 bits (77), Expect = 0.87,   Method: Compositional matrix adjust.
 Identities = 31/100 (31%), Positives = 47/100 (47%), Gaps = 15/100 (15%)

Query: 73  NILRGYRSQIETLEHSSVDQRNEVVAEWLQEQGLKTALYE------HEKWGK--TLYGVL 124
           N+   Y S I+ LEHSS+  R  +  +W++   L+    E      HE W K  T  G+L
Sbjct: 314 NLKDSYLSVIKALEHSSMKCRRILDIKWVEATDLEPEAQEIDKAKFHEAWKKVSTADGIL 373

Query: 125 ----HASRGDGTEAMVLAIPWKNVDDQFNLGGAALGVSLS 160
                 +R  GTE M+LA  W   ++     G  LG+ ++
Sbjct: 374 VPGGFGTR--GTEGMMLASRWAR-ENHIPFLGVCLGLQIA 410

>KAFR0B00680 Chr2 complement(131617..133350) [1734 bp, 577 aa] {ON}
           Anc_7.476 YJR103W
          Length = 577

 Score = 33.5 bits (75), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 30/94 (31%), Positives = 45/94 (47%), Gaps = 13/94 (13%)

Query: 78  YRSQIETLEHSSVDQRNEVVAEWLQEQGLKTALYE------HEKWGK--TLYGVLHASRG 129
           Y S I+ LEHSS+  R ++   W++   L+    E      HE W K  T  G+L    G
Sbjct: 319 YLSVIKALEHSSMKVRRKLEIMWVEATDLEPEAQEAEKSKFHEAWEKVSTADGIL-VPGG 377

Query: 130 ---DGTEAMVLAIPWKNVDDQFNLGGAALGVSLS 160
               GTE M+LA  W   +++    G  LG+ ++
Sbjct: 378 FGIRGTEGMILAARWAR-ENKIPFLGICLGLQIA 410

>KNAG0F03560 Chr6 (671620..673353) [1734 bp, 577 aa] {ON} Anc_7.476
           YJR103W
          Length = 577

 Score = 33.5 bits (75), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 29/100 (29%), Positives = 50/100 (50%), Gaps = 15/100 (15%)

Query: 73  NILRGYRSQIETLEHSSVDQRNEVVAEWLQEQGLKTALYEHEK------WGK--TLYGVL 124
           N+   Y S I+ LEHSS+  R ++  +W++   L+  + E +K      W +  T  G+L
Sbjct: 314 NLKDSYLSVIKALEHSSMMCRRKLEIKWVEATDLEPEMQEADKEKFHFAWKEVTTADGIL 373

Query: 125 ----HASRGDGTEAMVLAIPWKNVDDQFNLGGAALGVSLS 160
                 +R  GTE M+LA  W   +++    G  LG+ ++
Sbjct: 374 VPGGFGTR--GTEGMILAARWAR-ENKIPYLGVCLGLQIA 410

>Kwal_55.19896 s55 complement(168566..170296) [1731 bp, 576 aa] {ON}
           YBL039C (URA7) - CTP synthase, highly homologus to URA8
           CTP synthase [contig 159] FULL
          Length = 576

 Score = 33.5 bits (75), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 39/131 (29%), Positives = 57/131 (43%), Gaps = 17/131 (12%)

Query: 73  NILRGYRSQIETLEHSSVDQRNEVVAEWLQEQGLKTALYE------HEKWGK--TLYGVL 124
           N+   Y S I+ LEHSS+     +   W++   L+    E      H+ W K  T  GVL
Sbjct: 314 NLKDSYLSVIKALEHSSMRCHRRLEIVWVEASDLEPETNELEKSKFHDAWKKLSTADGVL 373

Query: 125 ----HASRGDGTEAMVLAIPWKNVDDQFNLGGAALGVSLSQF-FKRWPVWSKNIIVV-FS 178
                 +R  GTE M+LA  W   ++   L G  LG+ ++   F R  +  KN+    F 
Sbjct: 374 VPGGFGTR--GTEGMILAAKWARENNVPYL-GVCLGLQVATLEFARNVLGMKNVTSAEFD 430

Query: 179 EDSGAALRAWV 189
            D     +A V
Sbjct: 431 PDCKEEDKAVV 441

>Suva_2.80 Chr2 complement(143951..145690) [1740 bp, 579 aa] {ON}
           YBL039C (REAL)
          Length = 579

 Score = 33.5 bits (75), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 29/98 (29%), Positives = 46/98 (46%), Gaps = 11/98 (11%)

Query: 73  NILRGYRSQIETLEHSSVDQRNEVVAEWLQEQGLKTALYE------HEKWG--KTLYGVL 124
           N+   Y S I+ LEHSS+  R ++  +W++   L+    +      HE W    T  G+L
Sbjct: 314 NLKDSYLSVIKALEHSSMKCRRKLEIKWVEATDLEPETQDSNKPKFHEAWNMVSTADGIL 373

Query: 125 -HASRG-DGTEAMVLAIPWKNVDDQFNLGGAALGVSLS 160
                G  GTE M+LA  W   ++     G  LG+ ++
Sbjct: 374 IPGGFGVRGTEGMILAARWAR-ENHIPYLGVCLGLQIA 410

>Suva_15.235 Chr15 complement(404831..407401) [2571 bp, 856 aa] {ON}
           YHR047C (REAL)
          Length = 856

 Score = 33.1 bits (74), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 26/123 (21%), Positives = 50/123 (40%), Gaps = 1/123 (0%)

Query: 197 DLTAGSIEAAVVLDYPSKSDFFEYVEISYDGLNGELPNLDLVNIAVSITEHEGMKVSLHG 256
           DL     E +  +D        + VE+++  ++     L+ V+  + I + E  +  +  
Sbjct: 22  DLETFKFEGSAKIDLQINDHSIDSVELNFLEIDFHSVFLEGVS-TIEIKKDESQQTVIFV 80

Query: 257 LPPNEMYNTDYFARLKIMFVGIKNWALSGVKRIHGNEAFSGWRIQSVTLRAHGNEGQLDI 316
            P   + N   FA+L+I F GI N  ++G  R    +  +G      T +    + +   
Sbjct: 81  FPNGTLKNLGVFAKLEIKFTGILNDQMAGFYRAKYTDKVTGETRYMATTQMEATDARRAF 140

Query: 317 TCF 319
            CF
Sbjct: 141 PCF 143

>Kwal_26.7154 s26 (237387..241028) [3642 bp, 1213 aa] {ON} YOL045W -
            Hypothetical ORF [contig 47] FULL
          Length = 1213

 Score = 32.3 bits (72), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 14/44 (31%), Positives = 26/44 (59%), Gaps = 1/44 (2%)

Query: 207  VVLDYPSKSDFFEYVEISYDGLNGELPNLDLVNIAVSITEHEGM 250
            ++LD+    D++ Y+E +  G +G +   DL+ +   +TEHE M
Sbjct: 1023 MLLDFFEDDDYY-YIETAVHGTSGSIDLFDLIEMKTDMTEHEAM 1065

>TBLA0F02650 Chr6 (639123..640865) [1743 bp, 580 aa] {ON} Anc_7.476
           YJR103W
          Length = 580

 Score = 32.0 bits (71), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 33/116 (28%), Positives = 53/116 (45%), Gaps = 18/116 (15%)

Query: 78  YRSQIETLEHSSVDQRNEVVAEWLQEQGLKTALYE------HEKWGK--TLYGVLHASRG 129
           Y S I+ LEHSS+  +  +   W++   L+    E      HE W K  T  G+L    G
Sbjct: 319 YLSVIKALEHSSMQCKRILQILWVEASDLEPETQESHKTKFHEAWNKVSTADGIL-VPGG 377

Query: 130 ---DGTEAMVLAIPWKNVDDQFNLGGAALGVSLSQFFKRWPVWSKNIIVVFSEDSG 182
               GTE M+LA  W   +++    G  LG+ ++        +++N+I +    SG
Sbjct: 378 FGLRGTEGMILACKWAR-ENKVPFLGVCLGLQVATI-----EFARNVIGIKDGISG 427

>NCAS0A14850 Chr1 (2928086..2929825) [1740 bp, 579 aa] {ON}
           Anc_7.476 YBL039C
          Length = 579

 Score = 32.0 bits (71), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 30/94 (31%), Positives = 44/94 (46%), Gaps = 13/94 (13%)

Query: 78  YRSQIETLEHSSVDQRNEVVAEWLQEQGLKTALYE------HEKWGK--TLYGVLHASRG 129
           Y S I++LEHSS+  R ++   W++   L+    E       E W K  T  GVL    G
Sbjct: 319 YLSVIKSLEHSSMKCRRKLDIRWVEATDLEPETQETDKVKFQEAWDKVTTSDGVL-VPGG 377

Query: 130 ---DGTEAMVLAIPWKNVDDQFNLGGAALGVSLS 160
               GTE M+LA  W   ++     G  LG+ ++
Sbjct: 378 FGVRGTEGMMLAARWAR-ENHIPFLGVCLGLQIA 410

>Kpol_1023.100 s1023 (235260..238010) [2751 bp, 916 aa] {ON}
           (235260..238010) [2751 nt, 917 aa]
          Length = 916

 Score = 32.0 bits (71), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 30/97 (30%), Positives = 47/97 (48%), Gaps = 6/97 (6%)

Query: 211 YPSKSDFFEYVEISYDGLNGELPNLDLVNIAVSITEHEGMKVSLHGLPP--NEMYNTDYF 268
           +PS      Y+++ Y   N   P + L +I  SI E+  + +SL  L    +++ N DY 
Sbjct: 340 FPSAIQLNHYIDLYYRHFNNYYPFIHLFSINPSI-ENYPLLISLASLGSLYDKLQNNDYQ 398

Query: 269 ARLKIMFVGIKNWALSGVKRIHGNEAFSGWRIQSVTL 305
              KI ++ IKN+ L   K  H  E+   W IQ + L
Sbjct: 399 ILYKIAWLNIKNF-LEITKNNH--ESTPLWVIQGIVL 432

>Suva_12.192 Chr12 (298828..300549) [1722 bp, 573 aa] {ON} YBL039C
           (REAL)
          Length = 573

 Score = 31.6 bits (70), Expect = 7.3,   Method: Compositional matrix adjust.
 Identities = 26/81 (32%), Positives = 38/81 (46%), Gaps = 14/81 (17%)

Query: 73  NILRGYRSQIETLEHSSVDQRNEVVAEWLQEQGLKTALYE------HEKWGK--TLYGVL 124
           N+   Y S  ++LEH+S+  R ++   W++   L+    E      HE W K  +  G+L
Sbjct: 314 NLKDSYLSVTKSLEHASMKCRRQLEILWVEASDLEPETQELDKNKFHESWNKLSSADGIL 373

Query: 125 ----HASRGDGTEAMVLAIPW 141
                 SR  G E MVLA  W
Sbjct: 374 VPGGFGSR--GIEGMVLAAKW 392

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.323    0.137    0.414 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 55,271,188
Number of extensions: 2222285
Number of successful extensions: 5493
Number of sequences better than 10.0: 49
Number of HSP's gapped: 5545
Number of HSP's successfully gapped: 51
Length of query: 591
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 476
Effective length of database: 40,294,809
Effective search space: 19180329084
Effective search space used: 19180329084
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.5 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (22.0 bits)
S2: 69 (31.2 bits)