Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
CAGL0L12210g8.260ON29812981152160.0
Suva_10.1718.260ON2958300382320.0
YLR087C (CSF1)8.260ON2958299881910.0
Smik_12.1468.260ON2958299981880.0
Skud_12.1558.260ON2959300381480.0
NCAS0B050108.260ON2952298478740.0
KAFR0B027208.260ON2982303675240.0
NDAI0B019808.260ON2959300174460.0
KNAG0G020308.260ON2998304272660.0
TDEL0F038708.260ON2942300868040.0
Kpol_392.78.260ON2995304263740.0
ZYRO0C01694g8.260ON3006306362370.0
TPHA0J007308.260ON3046307956110.0
TBLA0E044208.260ON3148261755240.0
SAKL0H17072g8.260ON2997304254280.0
KLTH0G13728g8.260ON2966306347490.0
Kwal_YGOB_56.238088.260ON2941157226900.0
Kwal_56.23810singletonOFF2763135323060.0
Ecym_43108.260ON2943155723090.0
AGR088W8.260ON2887154720290.0
KLLA0F19096g8.260ON2923157819580.0
Kwal_56.23808singletonOFF62611452e-10
Smik_15.2872.171ON110858812.3
Skud_16.376.269ON1494133784.6
YPL183C (RTT10)6.177ON101396776.3
TDEL0D044503.178ON41968758.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0L12210g
         (2981 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0L12210g Chr12 complement(1315265..1324210) [8946 bp, 2981 a...  5865   0.0  
Suva_10.171 Chr10 complement(311672..320548) [8877 bp, 2958 aa] ...  3175   0.0  
YLR087C Chr12 complement(306855..315731) [8877 bp, 2958 aa] {ON}...  3159   0.0  
Smik_12.146 Chr12 complement(286690..295566) [8877 bp, 2958 aa] ...  3158   0.0  
Skud_12.155 Chr12 complement(290039..298918) [8880 bp, 2959 aa] ...  3143   0.0  
NCAS0B05010 Chr2 complement(922165..931023) [8859 bp, 2952 aa] {...  3037   0.0  
KAFR0B02720 Chr2 complement(549702..558650) [8949 bp, 2982 aa] {...  2902   0.0  
NDAI0B01980 Chr2 complement(483519..492398) [8880 bp, 2959 aa] {...  2872   0.0  
KNAG0G02030 Chr7 complement(453579..462575) [8997 bp, 2998 aa] {...  2803   0.0  
TDEL0F03870 Chr6 complement(713797..722625) [8829 bp, 2942 aa] {...  2625   0.0  
Kpol_392.7 s392 (10369..19356) [8988 bp, 2995 aa] {ON} (10369..1...  2459   0.0  
ZYRO0C01694g Chr3 (121250..130270) [9021 bp, 3006 aa] {ON} simil...  2407   0.0  
TPHA0J00730 Chr10 complement(165253..174393) [9141 bp, 3046 aa] ...  2165   0.0  
TBLA0E04420 Chr5 complement(1126342..1135788) [9447 bp, 3148 aa]...  2132   0.0  
SAKL0H17072g Chr8 (1498942..1507935) [8994 bp, 2997 aa] {ON} sim...  2095   0.0  
KLTH0G13728g Chr7 (1175228..1184128) [8901 bp, 2966 aa] {ON} sim...  1833   0.0  
Kwal_YGOB_56.23808 s56 (712095..712280,712384..721023) [8826 bp,...  1040   0.0  
Kwal_56.23810 s56 (712732..721023) [8292 bp, 2763 aa] {OFF} YLR0...   892   0.0  
Ecym_4310 Chr4 (657929..666760) [8832 bp, 2943 aa] {ON} similar ...   894   0.0  
AGR088W Chr7 (892680..901343) [8664 bp, 2887 aa] {ON} Syntenic h...   786   0.0  
KLLA0F19096g Chr6 complement(1762215..1770986) [8772 bp, 2923 aa...   758   0.0  
Kwal_56.23808 s56 (712095..712280) [186 bp, 62 aa] {OFF} YLR087C...    60   2e-10
Smik_15.287 Chr15 (486476..489802) [3327 bp, 1108 aa] {ON} YNL10...    36   2.3  
Skud_16.37 Chr16 complement(64157..68641) [4485 bp, 1494 aa] {ON...    35   4.6  
YPL183C Chr16 complement(199495..202536) [3042 bp, 1013 aa] {ON}...    34   6.3  
TDEL0D04450 Chr4 complement(811665..812924) [1260 bp, 419 aa] {O...    33   8.6  

>CAGL0L12210g Chr12 complement(1315265..1324210) [8946 bp, 2981 aa]
            {ON} similar to uniprot|Q12150 Saccharomyces cerevisiae
            YLR087c
          Length = 2981

 Score = 5865 bits (15216), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 2873/2981 (96%), Positives = 2873/2981 (96%)

Query: 1    MSYFQSSAGFRGESLGFKRNFSWVFLVDWILTVILTLATLFYLSRAFAYGVTFILEWLLW 60
            MSYFQSSAGFRGESLGFKRNFSWVFLVDWILTVILTLATLFYLSRAFAYGVTFILEWLLW
Sbjct: 1    MSYFQSSAGFRGESLGFKRNFSWVFLVDWILTVILTLATLFYLSRAFAYGVTFILEWLLW 60

Query: 61   KQAKVKVSIGALRISLLAGRVFFKNLTIIDKDRTITILEGSITWRYWLIRTRKSEYRVAQ 120
            KQAKVKVSIGALRISLLAGRVFFKNLTIIDKDRTITILEGSITWRYWLIRTRKSEYRVAQ
Sbjct: 61   KQAKVKVSIGALRISLLAGRVFFKNLTIIDKDRTITILEGSITWRYWLIRTRKSEYRVAQ 120

Query: 121  MAHASAGSSGNSEDDTKFDIANYMEKQLKLPCRFLFECEGFEMFIYNRTYAYDNIVNVLS 180
            MAHASAGSSGNSEDDTKFDIANYMEKQLKLPCRFLFECEGFEMFIYNRTYAYDNIVNVLS
Sbjct: 121  MAHASAGSSGNSEDDTKFDIANYMEKQLKLPCRFLFECEGFEMFIYNRTYAYDNIVNVLS 180

Query: 181  KVEREKFEKFMAENDFLDPSSDGSSDDKIEETSSATNSTDEETIANDRTFQNDTRKTLPR 240
            KVEREKFEKFMAENDFLDPSSDGSSDDKIEETSSATNSTDEETIANDRTFQNDTRKTLPR
Sbjct: 181  KVEREKFEKFMAENDFLDPSSDGSSDDKIEETSSATNSTDEETIANDRTFQNDTRKTLPR 240

Query: 241  YLEALPIEALLNKGSILIGNKFTPCVLILSFESAVALQDVGEAPSKLDLYRMKYEVRLKN 300
            YLEALPIEALLNKGSILIGNKFTPCVLILSFESAVALQDVGEAPSKLDLYRMKYEVRLKN
Sbjct: 241  YLEALPIEALLNKGSILIGNKFTPCVLILSFESAVALQDVGEAPSKLDLYRMKYEVRLKN 300

Query: 301  LEIMMKQNIDYDNEKSRNFEFDKGKLSRLWHRFTRIFKLVPFPFKSNRRKEQPHDNFMQK 360
            LEIMMKQNIDYDNEKSRNFEFDKGKLSRLWHRFTRIFKLVPFPFKSNRRKEQPHDNFMQK
Sbjct: 301  LEIMMKQNIDYDNEKSRNFEFDKGKLSRLWHRFTRIFKLVPFPFKSNRRKEQPHDNFMQK 360

Query: 361  WKGLSMYRNDMFGXXXXXXXXXXXXSSHEYAKFTSLLKSPRVTIHHDYDMPGWVPHGAHP 420
            WKGLSMYRNDMFG            SSHEYAKFTSLLKSPRVTIHHDYDMPGWVPHGAHP
Sbjct: 361  WKGLSMYRNDMFGEFDEFDDIEFDISSHEYAKFTSLLKSPRVTIHHDYDMPGWVPHGAHP 420

Query: 421  PSSYADGPDVGNNMAPPQYIFEINIFGGTVCYGPWAQRQTNHLQSLLSPSVSRTAKPIKK 480
            PSSYADGPDVGNNMAPPQYIFEINIFGGTVCYGPWAQRQTNHLQSLLSPSVSRTAKPIKK
Sbjct: 421  PSSYADGPDVGNNMAPPQYIFEINIFGGTVCYGPWAQRQTNHLQSLLSPSVSRTAKPIKK 480

Query: 481  LKPGSKRIYTVLKLTINAMEDVTWRIPTRESSKDVEFLMHYKETNDDYRPFGWIDIKVSR 540
            LKPGSKRIYTVLKLTINAMEDVTWRIPTRESSKDVEFLMHYKETNDDYRPFGWIDIKVSR
Sbjct: 481  LKPGSKRIYTVLKLTINAMEDVTWRIPTRESSKDVEFLMHYKETNDDYRPFGWIDIKVSR 540

Query: 541  DSCGIFDLAMCPTSKGFKNTIDVQLVDTEIRSSVNHDIFLKSKSFSFNCDIGYPLGWNAE 600
            DSCGIFDLAMCPTSKGFKNTIDVQLVDTEIRSSVNHDIFLKSKSFSFNCDIGYPLGWNAE
Sbjct: 541  DSCGIFDLAMCPTSKGFKNTIDVQLVDTEIRSSVNHDIFLKSKSFSFNCDIGYPLGWNAE 600

Query: 601  ANWTIIMDSNQLELFLLREHVTLIADTLTDFSSGEPVPYELFRPFVYHIKWNMKGYSFYL 660
            ANWTIIMDSNQLELFLLREHVTLIADTLTDFSSGEPVPYELFRPFVYHIKWNMKGYSFYL
Sbjct: 601  ANWTIIMDSNQLELFLLREHVTLIADTLTDFSSGEPVPYELFRPFVYHIKWNMKGYSFYL 660

Query: 661  NVNDHNIVNNPLDFNENCYLSIHGDDLTMNVMVPKKTITSRFTNMTYDIYTPMFRXXXXX 720
            NVNDHNIVNNPLDFNENCYLSIHGDDLTMNVMVPKKTITSRFTNMTYDIYTPMFR     
Sbjct: 661  NVNDHNIVNNPLDFNENCYLSIHGDDLTMNVMVPKKTITSRFTNMTYDIYTPMFRLLLNT 720

Query: 721  XXXXXXXEFMRNKEVGRSHDFRLKGSYLIYSELDIDNVDTLTVECSSRGTALHIYGFVIR 780
                   EFMRNKEVGRSHDFRLKGSYLIYSELDIDNVDTLTVECSSRGTALHIYGFVIR
Sbjct: 721  PPWNTLNEFMRNKEVGRSHDFRLKGSYLIYSELDIDNVDTLTVECSSRGTALHIYGFVIR 780

Query: 781  YLINVKMNYFGEFFHFVTSEEYTGNTRPTDLENIISEDRRDDDFSSYESVSRISSNSSDX 840
            YLINVKMNYFGEFFHFVTSEEYTGNTRPTDLENIISEDRRDDDFSSYESVSRISSNSSD 
Sbjct: 781  YLINVKMNYFGEFFHFVTSEEYTGNTRPTDLENIISEDRRDDDFSSYESVSRISSNSSDK 840

Query: 841  XXXXXXXXXXXXXXXXRTSNETDIWFTFSVWDGALILPETIYNADPCIALHFAELIVDLR 900
                            RTSNETDIWFTFSVWDGALILPETIYNADPCIALHFAELIVDLR
Sbjct: 841  NPKAKKKHSLKKSDLKRTSNETDIWFTFSVWDGALILPETIYNADPCIALHFAELIVDLR 900

Query: 901  SCNYYMDILATACDINLKRYVGKRADEIYEYVHLNNGKDHEVHGTLSDIYIHGHRMYGLP 960
            SCNYYMDILATACDINLKRYVGKRADEIYEYVHLNNGKDHEVHGTLSDIYIHGHRMYGLP
Sbjct: 901  SCNYYMDILATACDINLKRYVGKRADEIYEYVHLNNGKDHEVHGTLSDIYIHGHRMYGLP 960

Query: 961  PTEPTYFCQWDMDFGHLNIDSNMFFLQGLFGAFYKIGFGYKDLENILLYETEIIDDMTSL 1020
            PTEPTYFCQWDMDFGHLNIDSNMFFLQGLFGAFYKIGFGYKDLENILLYETEIIDDMTSL
Sbjct: 961  PTEPTYFCQWDMDFGHLNIDSNMFFLQGLFGAFYKIGFGYKDLENILLYETEIIDDMTSL 1020

Query: 1021 TIFINTIDIRLNDVDTTAHADLKLERFCFTLIDFENERYSKRMDIKIPSLEFNIFSNEDN 1080
            TIFINTIDIRLNDVDTTAHADLKLERFCFTLIDFENERYSKRMDIKIPSLEFNIFSNEDN
Sbjct: 1021 TIFINTIDIRLNDVDTTAHADLKLERFCFTLIDFENERYSKRMDIKIPSLEFNIFSNEDN 1080

Query: 1081 DLSLLNFKVDMNFTNFVQNQDFNKHRKIQRDYIVLNDAPYHRCAFLLPESYQKSRIYNEL 1140
            DLSLLNFKVDMNFTNFVQNQDFNKHRKIQRDYIVLNDAPYHRCAFLLPESYQKSRIYNEL
Sbjct: 1081 DLSLLNFKVDMNFTNFVQNQDFNKHRKIQRDYIVLNDAPYHRCAFLLPESYQKSRIYNEL 1140

Query: 1141 FGXXXXXXXXXXXXXXXTADTIEYVLEDLLEDYMGLFEGNYDIKESSVENLELSAIEATR 1200
            FG               TADTIEYVLEDLLEDYMGLFEGNYDIKESSVENLELSAIEATR
Sbjct: 1141 FGAIAPSSSLPPLPIPLTADTIEYVLEDLLEDYMGLFEGNYDIKESSVENLELSAIEATR 1200

Query: 1201 AITGIGAERTHSNPITLSDYAVESDNYVVKVESIVIDINPALYTTIEKLLKHIYDQDAVQ 1260
            AITGIGAERTHSNPITLSDYAVESDNYVVKVESIVIDINPALYTTIEKLLKHIYDQDAVQ
Sbjct: 1201 AITGIGAERTHSNPITLSDYAVESDNYVVKVESIVIDINPALYTTIEKLLKHIYDQDAVQ 1260

Query: 1261 IIDGIEIGIVKRLSSIHDGVTTMTNVKVQIKHFNLFWGEKESDNVSMFFDKMDFALTEKT 1320
            IIDGIEIGIVKRLSSIHDGVTTMTNVKVQIKHFNLFWGEKESDNVSMFFDKMDFALTEKT
Sbjct: 1261 IIDGIEIGIVKRLSSIHDGVTTMTNVKVQIKHFNLFWGEKESDNVSMFFDKMDFALTEKT 1320

Query: 1321 LEQNSEKNLLEMTVLAKIKAVRLTVVQQPGLIPTQERPPAITVGVEGFEFWSTAIEKQVN 1380
            LEQNSEKNLLEMTVLAKIKAVRLTVVQQPGLIPTQERPPAITVGVEGFEFWSTAIEKQVN
Sbjct: 1321 LEQNSEKNLLEMTVLAKIKAVRLTVVQQPGLIPTQERPPAITVGVEGFEFWSTAIEKQVN 1380

Query: 1381 SISVSSADITVDDAQVEWFFKYIVRQKYFFLDMLQSYNRIQNNRIESQKELISRLTAASE 1440
            SISVSSADITVDDAQVEWFFKYIVRQKYFFLDMLQSYNRIQNNRIESQKELISRLTAASE
Sbjct: 1381 SISVSSADITVDDAQVEWFFKYIVRQKYFFLDMLQSYNRIQNNRIESQKELISRLTAASE 1440

Query: 1441 YYQISHDPYVITKPAFIMRLSRGHVRENKSWKIITRLRHILTYLPKDWYLNVGQPLRDRK 1500
            YYQISHDPYVITKPAFIMRLSRGHVRENKSWKIITRLRHILTYLPKDWYLNVGQPLRDRK
Sbjct: 1441 YYQISHDPYVITKPAFIMRLSRGHVRENKSWKIITRLRHILTYLPKDWYLNVGQPLRDRK 1500

Query: 1501 FDPSQDARSIFMSIFSNWRSWEFSDVARSYIYGKLFLNDHAEXXXXXXXXXXXXNIGNFF 1560
            FDPSQDARSIFMSIFSNWRSWEFSDVARSYIYGKLFLNDHAE            NIGNFF
Sbjct: 1501 FDPSQDARSIFMSIFSNWRSWEFSDVARSYIYGKLFLNDHAEKKKQSLQKLFKLNIGNFF 1560

Query: 1561 MTVYSTNYDVDHSIVVSNAKLLLELTPSSTEPKENSLQREELIDISGTVDVIXXXXXXXX 1620
            MTVYSTNYDVDHSIVVSNAKLLLELTPSSTEPKENSLQREELIDISGTVDVI        
Sbjct: 1561 MTVYSTNYDVDHSIVVSNAKLLLELTPSSTEPKENSLQREELIDISGTVDVIKGKLSTKL 1620

Query: 1621 XXXXXXIPILTEGSEKQPVKPPQDTIPKPFKMNAAFMVNSCDIQLVMDATKLNMNVNDGR 1680
                  IPILTEGSEKQPVKPPQDTIPKPFKMNAAFMVNSCDIQLVMDATKLNMNVNDGR
Sbjct: 1621 LKLQKLIPILTEGSEKQPVKPPQDTIPKPFKMNAAFMVNSCDIQLVMDATKLNMNVNDGR 1680

Query: 1681 ISVLWENLQDSTAQAGSVVLFSKHTELVLKHINSVLAEGRVSNFYATFTTDTWAQRPTYL 1740
            ISVLWENLQDSTAQAGSVVLFSKHTELVLKHINSVLAEGRVSNFYATFTTDTWAQRPTYL
Sbjct: 1681 ISVLWENLQDSTAQAGSVVLFSKHTELVLKHINSVLAEGRVSNFYATFTTDTWAQRPTYL 1740

Query: 1741 IHSKSSSIHFRTMAKTERLVEAIKDIKLKIDQISEQLELERRLTQHPTVYDPNKSNVIAS 1800
            IHSKSSSIHFRTMAKTERLVEAIKDIKLKIDQISEQLELERRLTQHPTVYDPNKSNVIAS
Sbjct: 1741 IHSKSSSIHFRTMAKTERLVEAIKDIKLKIDQISEQLELERRLTQHPTVYDPNKSNVIAS 1800

Query: 1801 CLFSNVSMDIMPVSPFALKNSAKQIDFFYNKFDSDSWLIKLKDTDFFLTSDQTKEQYMRL 1860
            CLFSNVSMDIMPVSPFALKNSAKQIDFFYNKFDSDSWLIKLKDTDFFLTSDQTKEQYMRL
Sbjct: 1801 CLFSNVSMDIMPVSPFALKNSAKQIDFFYNKFDSDSWLIKLKDTDFFLTSDQTKEQYMRL 1860

Query: 1861 SMKKLQIRVNVSSSKPKLVDINLSTNLVKLTFSEPKNIVYSFLKDERVASESVHLLQTLK 1920
            SMKKLQIRVNVSSSKPKLVDINLSTNLVKLTFSEPKNIVYSFLKDERVASESVHLLQTLK
Sbjct: 1861 SMKKLQIRVNVSSSKPKLVDINLSTNLVKLTFSEPKNIVYSFLKDERVASESVHLLQTLK 1920

Query: 1921 PLFSISDDKESTPQSYQEKTEYLWSLDSSIDYFGILIPMTSTYYVMEFHSYVSSISNANG 1980
            PLFSISDDKESTPQSYQEKTEYLWSLDSSIDYFGILIPMTSTYYVMEFHSYVSSISNANG
Sbjct: 1921 PLFSISDDKESTPQSYQEKTEYLWSLDSSIDYFGILIPMTSTYYVMEFHSYVSSISNANG 1980

Query: 1981 APSGNLDITGHMSVENILFLIKESSLPDGLSKVIDIAVNVSTLQRVDDNSRSIQVESSHA 2040
            APSGNLDITGHMSVENILFLIKESSLPDGLSKVIDIAVNVSTLQRVDDNSRSIQVESSHA
Sbjct: 1981 APSGNLDITGHMSVENILFLIKESSLPDGLSKVIDIAVNVSTLQRVDDNSRSIQVESSHA 2040

Query: 2041 RICLSPDSLLRLLWGFNQGHKLSEHYLKYHSKSLWQSFAKSDDKQQDTNSIKSNETSFFS 2100
            RICLSPDSLLRLLWGFNQGHKLSEHYLKYHSKSLWQSFAKSDDKQQDTNSIKSNETSFFS
Sbjct: 2041 RICLSPDSLLRLLWGFNQGHKLSEHYLKYHSKSLWQSFAKSDDKQQDTNSIKSNETSFFS 2100

Query: 2101 SINSIHFLSYNLCVGWLFEYELGPPKGLITGYSRLFSAYENCMGKLTVIDSYFAAAQGNT 2160
            SINSIHFLSYNLCVGWLFEYELGPPKGLITGYSRLFSAYENCMGKLTVIDSYFAAAQGNT
Sbjct: 2101 SINSIHFLSYNLCVGWLFEYELGPPKGLITGYSRLFSAYENCMGKLTVIDSYFAAAQGNT 2160

Query: 2161 SSTFYPETNVKELFNRFYLPNMQILFWWKVIEGMKDVYVRFTGETLDVKYLSDFMLTIES 2220
            SSTFYPETNVKELFNRFYLPNMQILFWWKVIEGMKDVYVRFTGETLDVKYLSDFMLTIES
Sbjct: 2161 SSTFYPETNVKELFNRFYLPNMQILFWWKVIEGMKDVYVRFTGETLDVKYLSDFMLTIES 2220

Query: 2221 TLHSIKMFQKLKKELIVETPKREVVHIKEDKPXXXXXXXXXXXXXXXCHFKYDGGTYSVF 2280
            TLHSIKMFQKLKKELIVETPKREVVHIKEDKP               CHFKYDGGTYSVF
Sbjct: 2221 TLHSIKMFQKLKKELIVETPKREVVHIKEDKPVNSSNNILKNIKSVNCHFKYDGGTYSVF 2280

Query: 2281 NISDGSLNPTPAIEIKSPVISVDVLYKHEKQNTKHHSIRCLVNIDPTHNVLYATCAPLVK 2340
            NISDGSLNPTPAIEIKSPVISVDVLYKHEKQNTKHHSIRCLVNIDPTHNVLYATCAPLVK
Sbjct: 2281 NISDGSLNPTPAIEIKSPVISVDVLYKHEKQNTKHHSIRCLVNIDPTHNVLYATCAPLVK 2340

Query: 2341 NFVEDVRSIFGRYESENKHSETTPTSVQNIDYEKLLEDYDLAITVTSAKQQLSLSCEPKA 2400
            NFVEDVRSIFGRYESENKHSETTPTSVQNIDYEKLLEDYDLAITVTSAKQQLSLSCEPKA
Sbjct: 2341 NFVEDVRSIFGRYESENKHSETTPTSVQNIDYEKLLEDYDLAITVTSAKQQLSLSCEPKA 2400

Query: 2401 KVQADVGFEALTVSMTTNPFDIDEPLAFSFSIKDTKASIKHLFSRETSTSFGVGYLDLTL 2460
            KVQADVGFEALTVSMTTNPFDIDEPLAFSFSIKDTKASIKHLFSRETSTSFGVGYLDLTL
Sbjct: 2401 KVQADVGFEALTVSMTTNPFDIDEPLAFSFSIKDTKASIKHLFSRETSTSFGVGYLDLTL 2460

Query: 2461 LFTHTNRINTYGTSLISDIDLYFNVKQLQNLYLFLDIWQLSELLNPVTSSQEQVIRKDKK 2520
            LFTHTNRINTYGTSLISDIDLYFNVKQLQNLYLFLDIWQLSELLNPVTSSQEQVIRKDKK
Sbjct: 2461 LFTHTNRINTYGTSLISDIDLYFNVKQLQNLYLFLDIWQLSELLNPVTSSQEQVIRKDKK 2520

Query: 2521 KSVDKPIHNESQLPWCFTLIFTNVKGDIDLGPSLGLISLRLSRTWLATDHFSGKRQILHA 2580
            KSVDKPIHNESQLPWCFTLIFTNVKGDIDLGPSLGLISLRLSRTWLATDHFSGKRQILHA
Sbjct: 2521 KSVDKPIHNESQLPWCFTLIFTNVKGDIDLGPSLGLISLRLSRTWLATDHFSGKRQILHA 2580

Query: 2581 FVDDLLLISEGRLSGVVNIDGASWVSEVIWLQDSKRDNIPLVALSLNTDKIEIKAAFDYH 2640
            FVDDLLLISEGRLSGVVNIDGASWVSEVIWLQDSKRDNIPLVALSLNTDKIEIKAAFDYH
Sbjct: 2581 FVDDLLLISEGRLSGVVNIDGASWVSEVIWLQDSKRDNIPLVALSLNTDKIEIKAAFDYH 2640

Query: 2641 MFLIGTVNNILFQLHSERDMVGVAPDLLKVSFSCEEIKLCSTALVAANILDIYNTIIRMR 2700
            MFLIGTVNNILFQLHSERDMVGVAPDLLKVSFSCEEIKLCSTALVAANILDIYNTIIRMR
Sbjct: 2641 MFLIGTVNNILFQLHSERDMVGVAPDLLKVSFSCEEIKLCSTALVAANILDIYNTIIRMR 2700

Query: 2701 QDTKISYIETLKDSNMETNKQTLAYRDILKSLQLLRTDLTVSICSLQLQISPISLFDXXX 2760
            QDTKISYIETLKDSNMETNKQTLAYRDILKSLQLLRTDLTVSICSLQLQISPISLFD   
Sbjct: 2701 QDTKISYIETLKDSNMETNKQTLAYRDILKSLQLLRTDLTVSICSLQLQISPISLFDVEV 2760

Query: 2761 XXXXXXXXSARSETHSEAKLTTSLNMEVYDATLSLSTAKQELDEDALSKITVADYMTYAS 2820
                    SARSETHSEAKLTTSLNMEVYDATLSLSTAKQELDEDALSKITVADYMTYAS
Sbjct: 2761 VVINVVSVSARSETHSEAKLTTSLNMEVYDATLSLSTAKQELDEDALSKITVADYMTYAS 2820

Query: 2821 KIRGGTIIEIPRMGVQMTTWQEEKSDILEYLYSCKFHDKVAVRWNLGPVNFMKEMWTTHV 2880
            KIRGGTIIEIPRMGVQMTTWQEEKSDILEYLYSCKFHDKVAVRWNLGPVNFMKEMWTTHV
Sbjct: 2821 KIRGGTIIEIPRMGVQMTTWQEEKSDILEYLYSCKFHDKVAVRWNLGPVNFMKEMWTTHV 2880

Query: 2881 KAIAVRRSQVLTGSFNVSEKDVEKRIKEEENITKLNYVPVEEPQIDMPQIKDLGDATPPV 2940
            KAIAVRRSQVLTGSFNVSEKDVEKRIKEEENITKLNYVPVEEPQIDMPQIKDLGDATPPV
Sbjct: 2881 KAIAVRRSQVLTGSFNVSEKDVEKRIKEEENITKLNYVPVEEPQIDMPQIKDLGDATPPV 2940

Query: 2941 EWFGVNRKRFPAFTHQTAVVPVQNLVYLAQKQYAKTLGRSK 2981
            EWFGVNRKRFPAFTHQTAVVPVQNLVYLAQKQYAKTLGRSK
Sbjct: 2941 EWFGVNRKRFPAFTHQTAVVPVQNLVYLAQKQYAKTLGRSK 2981

>Suva_10.171 Chr10 complement(311672..320548) [8877 bp, 2958 aa] {ON}
            YLR087C (REAL)
          Length = 2958

 Score = 3175 bits (8232), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1552/3003 (51%), Positives = 2105/3003 (70%), Gaps = 80/3003 (2%)

Query: 5    QSSAGFRGESLGFKRNFSWVFLVDWILTVILTLATLFYLSRAFAYGVTFILEWLLWKQAK 64
            ++ +  RG  L  +++FSWVFLVDWILTVI  L T+FY+ R +AY V+FILEWLLWK+AK
Sbjct: 2    EAVSQLRGVPLTHQKDFSWVFLVDWILTVIACLTTIFYMGRIYAYLVSFILEWLLWKRAK 61

Query: 65   VKVSIGALRISLLAGRVFFKNLTIIDKDRTITILEGSITWRYWLIRTRKSEYRVAQMAHA 124
            +K+++  LRISLL GR++FK+L++I KD TI+ILEGS+TW+YWL+  RK     A++   
Sbjct: 62   IKINVETLRISLLGGRIYFKHLSVIHKDYTISILEGSLTWKYWLLNCRK-----AELIEN 116

Query: 125  SAGSSGNSEDDTKFDIANYMEKQLKLPCRFLFECEGFEMFIYNRTYAYDNIVNVLSKVER 184
               SSG               K ++LPC+FL ECEG E FIYNRT AYDN++N+LSK ER
Sbjct: 117  EKNSSG---------------KNIELPCKFLLECEGLEYFIYNRTLAYDNVINLLSKDER 161

Query: 185  EKFEKFMAENDFLDPSSDGSSDDKIEE--TSSATNSTDEETIANDRTFQNDTRKTLPRYL 242
            +KFEK++ E+ F +P SDGSS DK++E  + SA  +  + +I NDR +Q       P+ L
Sbjct: 162  DKFEKYLNEHSFPEPFSDGSSADKLDEDLSESAYTTNSDSSIINDRDYQETNIGKYPKGL 221

Query: 243  EALPIEALLNKGSILIGNKFTPCVLILSFESAVALQDVGEAPSKLDLYRMKYEVRLKNLE 302
               PIE  LN+GS+L+GNKFTP V+ILS+E+   + DV     +LDLYR K  + LKN E
Sbjct: 222  SFFPIELKLNRGSLLLGNKFTPSVMILSYENGEGIIDVLPPKERLDLYRNKTHLELKNFE 281

Query: 303  IMMKQNIDYDNEKSRNFEFDKGKLSRLWHRFTRIFKLVPFPFKSNR-RKEQPHDN-FMQK 360
            I +KQNI YD+     F+ D GK+S+LW  F R+ ++V  P    R +K  P D+ F QK
Sbjct: 282  ISIKQNIGYDDAIGLKFKLDTGKVSKLWKTFVRVLRVVTKPVIPRRGKKAGPSDDAFFQK 341

Query: 361  WKGLSMYRNDMF-GXXXXXXXXXXXXSSHEYAKFTSLLKSPRVTIHHDYDMPGWVPHGAH 419
            WKGLS+Y+                  +SHEYAKFTS+LK P+VT+ +D D+PG VPHGAH
Sbjct: 342  WKGLSLYKASAGDAKTSDLDDIEFDFTSHEYAKFTSILKCPKVTLSYDVDVPGVVPHGAH 401

Query: 420  PPSSYADGPDVGNNMAPPQYIFEINIFGGTVCYGPWAQRQTNHLQSLLSPSVSRTAKPIK 479
            P     DGPDVGNN APP +  ++ I GG++CYGPWAQRQ +HLQ +LSP VSRTAKPIK
Sbjct: 402  PTIPDIDGPDVGNNGAPPDFALDVQIHGGSICYGPWAQRQVSHLQRVLSPVVSRTAKPIK 461

Query: 480  KLKPGSKRIYTVLKLTINAMEDVTWRIPTRESSKDVEFLMHYKETNDDYRPFGWIDIKVS 539
            KL PGS+R+YT+ ++ I  MED TWRIPTRESSKD EFL HYK+T+++YRPFGW+D++  
Sbjct: 462  KLPPGSRRVYTLFRMNILIMEDTTWRIPTRESSKDAEFLQHYKKTSEEYRPFGWMDLRFC 521

Query: 540  RDSCGIFDLAMCPTSKGFKNTIDVQLVDTEIRSSVNHDIFLKSKSFSFNCDIGYPLGWNA 599
            +D+   F++++CPT +GFKN   V  V+TEIRSSVNHDI LKSK F  + DIGYPLGWN+
Sbjct: 522  KDTYANFNISVCPTVEGFKNDFHVHFVETEIRSSVNHDILLKSKVFDLDGDIGYPLGWNS 581

Query: 600  EANWTIIMDSNQLELFLLREHVTLIADTLTDFSSGEPVPYELFRPFVYHIKWNMKGYSFY 659
               W I M S QLE FLLREH+TL+ADTL+DFS+G+P PYELFRPFVY + W M GYS Y
Sbjct: 582  NTIWIINMKSEQLEAFLLREHITLVADTLSDFSAGDPTPYELFRPFVYKMNWEMDGYSIY 641

Query: 660  LNVNDHNIVNNPLDFNENCYLSIHGDDLTMNVMVPKKTITSRFTNMTYDIYTPMFRXXXX 719
            LNVNDHNIVNNPLDFNENCYLS+HGD LT+++ VP+++I   +T+M+Y+I TPMFR    
Sbjct: 642  LNVNDHNIVNNPLDFNENCYLSLHGDKLTIDITVPRESILGTYTDMSYEISTPMFRMMLN 701

Query: 720  XXXXXXXXEFMRNKEVGRSHDFRLKGSYLIYSELDIDNVDTLTVECSSRGTALHIYGFVI 779
                    EFM++KEVGRS+DF +KG YL+YSELDIDNVD+LT+ C+S  T LH YGFV+
Sbjct: 702  TPPWNTLNEFMKHKEVGRSYDFTIKGCYLLYSELDIDNVDSLTINCTSNSTVLHCYGFVM 761

Query: 780  RYLINVKMNYFGEFFHFVTSEEYTGNTRPTDLENIISEDRRDDDFSSYESVSRISSNSSD 839
            RYLINVKMNYFGEFF+FVTSEEYTG     ++  ++++    D  S+ +S  +  S  +D
Sbjct: 762  RYLINVKMNYFGEFFNFVTSEEYTGVLGAREVGEVVTKSSVVDLASTLDSEYQNGSMKND 821

Query: 840  XXXXXXXXXXXXXXXXXRTSNETDIWFTFSVWDGALILPETIYNADPCIALHFAELIVDL 899
                             RT+NETDIWFTFSVW+GALILPETIY+ DPCIALHF EL+VD 
Sbjct: 822  ----AEDNGPMKRSDLKRTTNETDIWFTFSVWNGALILPETIYSFDPCIALHFTELVVDF 877

Query: 900  RSCNYYMDILATACDINLKRYVGKRADEIYEYVHLNNGKDHEVHGTLSDIYIHGHRMYGL 959
            RSCNYYMDI+A     ++KR+V K+ +E+++++  NNG D + HG LSD+ IHGHRMYGL
Sbjct: 878  RSCNYYMDIMAVLNGTSIKRHVSKQINEVFDFIRRNNGADEQEHGVLSDLTIHGHRMYGL 937

Query: 960  PPTEPTYFCQWDMDFGHLNIDSNMFFLQGLFGAFYKIGFGYKDLENILLYETEIIDDMTS 1019
            PPTEPTYFCQWD++ G LNI+S++ FL+G F +FYK+GFGY DLENILLY+TE I+DMTS
Sbjct: 938  PPTEPTYFCQWDINLGELNINSDIEFLKGFFTSFYKVGFGYNDLENILLYDTETINDMTS 997

Query: 1020 LTIFINTIDIRLNDVDTTAHADLKLERFCFTLIDFENERYSKRMDIKIPSLEFNI--FSN 1077
            LT+    I+I LND    + + + +E   FTLIDFENERYS+R+DIK+P L  ++     
Sbjct: 998  LTVHAERINISLNDPVMKSQSIVSVESLLFTLIDFENERYSQRIDIKVPKLTVSLSCVMG 1057

Query: 1078 EDNDLSLLNFKVDMNFTNFVQNQDFNKHRKIQRDYIVLNDAPYHRCAFLLPESYQKSRIY 1137
            +  + S LNF+  + FTNF Q +D +K R  QR YI++ND+PYHRC FLLP  YQ S  Y
Sbjct: 1058 DGTNTSFLNFETKLRFTNFGQYKDSDKKRSEQRRYIMMNDSPYHRCPFLLPLFYQDSDTY 1117

Query: 1138 NELFGXXXXXXXXXXXXXXXTADTIEYVLEDLLEDYMGLFEGNYDIKESSVENLELSAIE 1197
             +L+G                 DTI+Y++ED++ +Y  L E     K+   E    S +E
Sbjct: 1118 QKLYGAIAPSSSIPTLPLPTLPDTIDYIIEDIVGEYATLLEATNPFKDLFAET--PSTVE 1175

Query: 1198 ATRAITGIGAERTHSNPITLSDYAV------ESDNYVVKVESIVIDINPALYTTIEKLLK 1251
              RA      +   ++P+     A       E DNYV+ V  I++DI+P L+   + LL+
Sbjct: 1176 PLRASFTEDDDEEAADPLEFKPVAFTEEINHERDNYVIDVSYILLDIDPLLFVFTKSLLE 1235

Query: 1252 HIYDQDAVQIIDGIEIGIVKRLSSIHDGVTTMTNVKVQIKHFNLFWGEKESDNVSMFFDK 1311
              Y +D VQ++D IEIGIVKRLS++ +G+ +++N+ + + + NL W E   +   ++ D+
Sbjct: 1236 QFYSEDMVQVLDDIEIGIVKRLSNLQEGIVSISNIDIHVAYLNLIWQETGEEGFELYLDR 1295

Query: 1312 MDFALTEKTLEQNSEKNLLEMTVLAKIKAVRLTVVQQPGLIPTQERPPAITVGVEGFEFW 1371
            +++ ++EK+LE+N     LE+ VLAK+K VR TV Q+     +++RPPA+++G+EGFE W
Sbjct: 1296 INYQMSEKSLEKNRTSKSLEVAVLAKVKTVRATVNQKKNPELSEDRPPALSLGLEGFEVW 1355

Query: 1372 STAIEKQVNSISVSSADITVDDAQVEWFFKYIVRQKYFFLDMLQSYNRIQNNRIESQKEL 1431
            S+  ++QVNS++++S+DIT+D++Q+EW F+Y   Q     ++  S N IQN R  ++ EL
Sbjct: 1356 SSTEDRQVNSLNLTSSDITIDESQMEWLFEYCSDQGNLIQEVFTSVNSIQNTRSSTKTEL 1415

Query: 1432 ISRLTAASEYYQISHDPYVITKPAFIMRLSRGHVRENKSWKIITRLRHILTYLPKDWYLN 1491
            IS+LTAASEYYQISHDPYVITKPAFIMRLS+GHVREN+SWKIITRLRHILTYLP DW  N
Sbjct: 1416 ISKLTAASEYYQISHDPYVITKPAFIMRLSKGHVRENRSWKIITRLRHILTYLPDDWQTN 1475

Query: 1492 VGQPLRDRKFDPSQDARSIFMSIFSNWRSWEFSDVARSYIYGKLFLNDHAEXXXXXXXXX 1551
            + + L++RK+  ++DA++IFMS+FS WR+WEFSDVARSYIYGKLFL DHA+         
Sbjct: 1476 IDKVLKERKYSFAKDAKNIFMSVFSTWRNWEFSDVARSYIYGKLFLADHAKHKGNSIKKL 1535

Query: 1552 XXXNIGNFFMTVYSTNYDVDHSIVVSNAKLLLELTPSSTEPKENSLQREELIDISGTVDV 1611
                +G+F++TVY   Y+V+H+ VV++A L+++LTP  T    N   REE I+I+G V  
Sbjct: 1536 LKCTMGSFYLTVYGEGYEVEHNFVVADANLVVDLTPPVTSLSSN---REETIEITGKVGS 1592

Query: 1612 IXXXXXXXXXXXXXXIPILTEGSEKQPVKPPQDTIPKPFKMNAAFMVNSCDIQLVMDATK 1671
            +              IP++   +E     P  + + K FKMN   +V+  +IQ+VMD TK
Sbjct: 1593 VKGKFSDKLLKLQDLIPLVVAVTEDDKSDPKAE-LSKQFKMNTVLLVDKSEIQVVMDKTK 1651

Query: 1672 LNMNVNDGRISVLWENLQDSTAQAGSVVLFSKHTELVLKHINSVLAEGRVSNFYATFTTD 1731
            +      GR+S+LWENL+DST+QAGS+V+FS+ +E+ LKH +++L E ++ +F    TT+
Sbjct: 1652 VMSRTVGGRVSLLWENLKDSTSQAGSLVIFSQKSEVWLKHGSTILGEAQLCDFSILATTE 1711

Query: 1732 TWAQRPTYLIHSKSSSIHFRTMAKTERLVEAIKDIKLKIDQISEQLELERRLTQHPTVYD 1791
             W+ +PT L++++ + +HFR M+ TE++V AI +IK  + ++ EQ++ + + +++ + + 
Sbjct: 1712 AWSHKPTILVNNQCADLHFRAMSTTEQMVNAITEIKESVLKVKEQIKFKPK-SKNKSQFV 1770

Query: 1792 PNKSNVIASCLFSNVSMDIMPVSPFALKNSAKQIDFFYNKFDSDSWLIKLKDTDFFLTSD 1851
             ++ N + SC FSNVS +IMP+SPF +++ AKQ+D ++NKF S+  L+ + DTDFF+TS 
Sbjct: 1771 GSRINTVLSCYFSNVSSEIMPLSPFYIRHEAKQLDIYFNKFGSNEILLSIWDTDFFMTSH 1830

Query: 1852 QTKEQYMRLSMKKLQIRVNVSSSKPKLVDINLSTNLVKLTFSEPKNIVYSFLKDERVASE 1911
            QTKEQY+R S   ++I+   S     L+++++S +++KLTFSEP+ IV SFL+DE++AS+
Sbjct: 1831 QTKEQYLRFSFGDIEIKGGFSKEAYSLINVDISISMIKLTFSEPRRIVNSFLQDEKLASQ 1890

Query: 1912 SVHLLQTLKPLFSISDD---KESTPQSYQEKTEYLWSLDSSIDYFGILIPMTSTYYVMEF 1968
             ++LL +L  LF  +D    K+ TP          W+LD++I YFGIL+P+ STY+V E 
Sbjct: 1891 GINLLSSLNSLFLTTDPMNAKKETPAKMIN-----WTLDTNISYFGILVPVASTYFVFEL 1945

Query: 1969 HSYVSSISNA-NGAPSGNLDITGHMSVENILFLIKESSLPDGLSKVIDIAVNVSTLQRVD 2027
            H  + S++N  NG       +TG +S+ENILFLIKE SLP GLSK++D ++ VSTLQR  
Sbjct: 1946 HMLLLSLTNTNNGLLPEQTRLTGQLSIENILFLIKERSLPIGLSKLLDFSIKVSTLQRTA 2005

Query: 2028 DNSRSIQVESSHARICLSPDSLLRLLWGFNQGHKLSEHYLKYHSKSLW--QSFAKSDDKQ 2085
            D  +S QVESSH R+CLSPDSLLRL+WG  +   + ++Y K H+ ++W  + F    DK 
Sbjct: 2006 DTEQSFQVESSHFRVCLSPDSLLRLIWGAYKLLDMVQYYSKRHAPNIWNIRMFTGKSDKP 2065

Query: 2086 QDTNSIKSNETSFFSSINSIHFLSYNLCVGWLFEYELGPPKGLITGYSRLFSAYENCMGK 2145
            ++   I  N         SIH LSY  C+GWLF+Y  G   GL+ GY+RLFSAYE   GK
Sbjct: 2066 KE---IPIN-------FRSIHILSYKFCIGWLFQYGAGDDPGLMFGYNRLFSAYEKDFGK 2115

Query: 2146 LTVIDSYFAAAQGNTSSTFYPETNVKELFNRFYLPNMQILFWWKVIEGMKDVYVRFTGET 2205
             T++D++F+ + GNTSSTF+ E N KE +NR +LPNMQI +W+K    +KD + RF GE 
Sbjct: 2116 FTIVDAFFSVSNGNTSSTFFSEGNEKEKYNRSFLPNMQISYWFKRCGELKDWFFRFHGEA 2175

Query: 2206 LDVKYLSDFMLTIESTLHSIKMFQKLKKELIVETPKREVVHIKEDKPXXXXXXXXXXXX- 2264
            LDV +L  FM  I+STL SI+ FQ+LKK  I++ P     +++   P             
Sbjct: 2176 LDVNFLPSFMDVIDSTLQSIRAFQELKKN-ILDMPHES--NMENSSPDAAPNTENASNSL 2232

Query: 2265 --------XXXCHFKYDGGTYSVFNISDGSLNPTPAIEIKSPVISVDVLYKHEKQNTKHH 2316
                       C+FKYDGG + V+   D      P+ E+KSPV++++  YKH++   K H
Sbjct: 2233 APFLDNIRSVNCNFKYDGGVFRVYTYDDIEAKSEPSFELKSPVVTINCTYKHDESKAKPH 2292

Query: 2317 SIRCLVNIDPTHNVLYATCAPLVKNFVEDVRSIFGRYESENKHSETTPTSVQNIDYEKLL 2376
             IR L+ +DPTHN LYA CAPL+  F E ++++  ++ +  K    T  S QN+DY++LL
Sbjct: 2293 RIRTLITVDPTHNTLYAGCAPLLMEFSESLQNMIKKHSTGEKKPNFTKPSTQNVDYKRLL 2352

Query: 2377 EDYDLAITVTSAKQQLSLSCEPKAKVQADVGFEALTVSMTTNPFDIDEPLAFSFSIKDTK 2436
            + +D+A+ +TSAKQQLSLSCEPKAKVQADVGFE+   SMTTN FD ++PL FS +++ TK
Sbjct: 2353 DQFDVAVKLTSAKQQLSLSCEPKAKVQADVGFESFLFSMTTNEFDSEQPLGFSLTLEQTK 2412

Query: 2437 ASIKHLFSRETSTSFGVGYLDLTLLFTHTNRINTYGTSLISDIDLYFNVKQLQNLYLFLD 2496
            ASIKH+FSRE STSF VG++DLTLLFTH + I+ YGTSL+SD+ ++FNVKQLQNLYLFLD
Sbjct: 2413 ASIKHIFSREVSTSFEVGFMDLTLLFTHPDVISMYGTSLVSDVSVFFNVKQLQNLYLFLD 2472

Query: 2497 IWQLSELLN--PVTSSQEQVIRKDKKKSVDKPIHNESQLPWCFTLIFTNVKGDIDLGPSL 2554
            IW+ S +L+  P      + +      S +  +   +++PWCFTLIFTN+ GD+DLGPSL
Sbjct: 2473 IWRFSSILHTRPTQRPNNKEVNMSTLSS-NSNVDVGTEIPWCFTLIFTNLSGDVDLGPSL 2531

Query: 2555 GLISLRLSRTWLATDHFSGKRQILHAFVDDLLLISEGRLSGVVNIDGASWVSEVIWLQDS 2614
            G+ISLR  RTWLATDH+  KRQ+LHAF D + L SEGRLSG+  +  ASWVSEV W  ++
Sbjct: 2532 GVISLRSQRTWLATDHYDEKRQLLHAFTDGISLTSEGRLSGLFEVANASWVSEVKWPLEN 2591

Query: 2615 KRDNIPLVALSLNTDKIEIKAAFDYHMFLIGTVNNILFQLHSERDMVGVAPDLLKVSFSC 2674
             ++  PLV+ SLN D + +KAAFDYHMFLIGT+NNI F LH+E+D  G+ PDLL+VSFS 
Sbjct: 2592 SKNTHPLVSTSLNIDDVAVKAAFDYHMFLIGTINNIRFHLHNEKDSKGILPDLLQVSFSS 2651

Query: 2675 EEIKLCSTALVAANILDIYNTIIRMRQDTKISYIETLKDSNMETNKQTLAYRDILKSLQL 2734
            +EI L STALVAANILDIYNTI+RMRQD KISY+ETL+DSN   +KQ + Y+DIL+SL+L
Sbjct: 2652 DEITLSSTALVAANILDIYNTIVRMRQDNKISYMETLRDSNPSESKQPILYKDILRSLKL 2711

Query: 2735 LRTDLTVSICSLQLQISPISLFDXXXXXXXXXXXSARSETHSEAKLTTSLNMEVYDATLS 2794
            LRTDL+V+I SL++QISPISLFD           S RSETHS  KL T L ++V D + +
Sbjct: 2712 LRTDLSVNISSLKVQISPISLFDVEVLVVRIDKVSIRSETHSGKKLKTDLQLQVLDVSAA 2771

Query: 2795 LSTAKQELDEDALSKITVADYMTYASKIRGGTIIEIPRMGVQMTTWQEEKSDILEYLYSC 2854
            LST+K+ELDE+  + I + DYM YASKI GGTII+IP++ V MTT QEEK++ LEYL++C
Sbjct: 2772 LSTSKEELDEEIGASIAIDDYMHYASKIVGGTIIDIPKLAVHMTTLQEEKTNNLEYLFAC 2831

Query: 2855 KFHDKVAVRWNLGPVNFMKEMWTTHVKAIAVRRSQVLTGSFNVSEKDVEKRIKEEENITK 2914
             F DK++VRWNLGP+NF+KEMWTTHVKA+AVRRSQ    SF  +E+++E+ IK EEN +K
Sbjct: 2832 SFSDKISVRWNLGPINFIKEMWTTHVKALAVRRSQTANISFGQTEEELEESIKREENASK 2891

Query: 2915 LNYVPVEEPQIDMPQIKDLGDATPPVEWFGVNRKRFPAFTHQTAVVPVQNLVYLAQKQYA 2974
             NY+ +EEPQI++PQI+DLG+ATPP+EWFGVNRKR P FTHQTAV+PVQ LVYLA+KQY 
Sbjct: 2892 FNYIALEEPQIEVPQIRDLGEATPPMEWFGVNRKRLPKFTHQTAVIPVQKLVYLAEKQYV 2951

Query: 2975 KTL 2977
            K L
Sbjct: 2952 KIL 2954

>YLR087C Chr12 complement(306855..315731) [8877 bp, 2958 aa] {ON}
            CSF1Protein required for fermentation at low temperature;
            the authentic, non-tagged protein is detected in highly
            purified mitochondria in high-throughput studies
          Length = 2958

 Score = 3159 bits (8191), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1547/2998 (51%), Positives = 2101/2998 (70%), Gaps = 70/2998 (2%)

Query: 5    QSSAGFRGESLGFKRNFSWVFLVDWILTVILTLATLFYLSRAFAYGVTFILEWLLWKQAK 64
            ++ +  RG  L  +++FSWVFLVDWILTV++ L  +FY+ R +AY V+FILEWLLWK+AK
Sbjct: 2    EAISQLRGVPLTHQKDFSWVFLVDWILTVVVCLTMIFYMGRIYAYLVSFILEWLLWKRAK 61

Query: 65   VKVSIGALRISLLAGRVFFKNLTIIDKDRTITILEGSITWRYWLIRTRKSEYRVAQMAHA 124
            +K+++  LR+SLL GR+ FKNL++I KD TI++LEGS+TW+YWL+  RK     A++   
Sbjct: 62   IKINVETLRVSLLGGRIHFKNLSVIHKDYTISVLEGSLTWKYWLLNCRK-----AELIEN 116

Query: 125  SAGSSGNSEDDTKFDIANYMEKQLKLPCRFLFECEGFEMFIYNRTYAYDNIVNVLSKVER 184
            +  SSG               K+ KLPC+   ECEG E+FIYNRT AYDN++N+LSK ER
Sbjct: 117  NKSSSG---------------KKAKLPCKISVECEGLEIFIYNRTVAYDNVINLLSKDER 161

Query: 185  EKFEKFMAENDFLDPSSDGSSDDKIEE--TSSATNSTDEETIANDRTFQNDTRKTLPRYL 242
            +KFEK++ E+ F +P SDGSS DK++E  + SA  +  + +I NDR +Q       P+ L
Sbjct: 162  DKFEKYLNEHSFPEPFSDGSSADKLDEDLSESAYTTNSDASIVNDRDYQETDIGKHPKLL 221

Query: 243  EALPIEALLNKGSILIGNKFTPCVLILSFESAVALQDVGEAPSKLDLYRMKYEVRLKNLE 302
              LPIE   ++GS+L+GNKFTP V+ILS+ES   + DV     +LDLYR K ++  KN E
Sbjct: 222  MFLPIELKFSRGSLLLGNKFTPSVMILSYESGKGIIDVLPPKERLDLYRNKTQMEFKNFE 281

Query: 303  IMMKQNIDYDNEKSRNFEFDKGKLSRLWHRFTRIFKLVPFPFKSNRRKEQP---HDNFMQ 359
            I +KQNI YD+     F+ D+GK+S+LW  F R+F++V  P    + K+      DNF  
Sbjct: 282  ISIKQNIGYDDAIGLKFKIDRGKVSKLWKTFVRVFQIVTKPVVPKKTKKSAGTSDDNFYH 341

Query: 360  KWKGLSMYRNDMF-GXXXXXXXXXXXXSSHEYAKFTSLLKSPRVTIHHDYDMPGWVPHGA 418
            KWKGLS+Y+                  ++HEYAKFTS+LK P+VTI +D D+PG VPHGA
Sbjct: 342  KWKGLSLYKASAGDAKASDLDDVEFDLTNHEYAKFTSILKCPKVTIAYDVDVPGVVPHGA 401

Query: 419  HPPSSYADGPDVGNNMAPPQYIFEINIFGGTVCYGPWAQRQTNHLQSLLSPSVSRTAKPI 478
            HP     DGPDVGNN APP +  ++ I GG++CYGPWAQRQ +HLQ +LSP VSRTAKPI
Sbjct: 402  HPTIPDIDGPDVGNNGAPPDFALDVQIHGGSICYGPWAQRQVSHLQRVLSPVVSRTAKPI 461

Query: 479  KKLKPGSKRIYTVLKLTINAMEDVTWRIPTRESSKDVEFLMHYKETNDDYRPFGWIDIKV 538
            KKL PGS+RIYT+ ++ I+ MED TWRIPTRESSKD EFL HYKETN++YRPFGW+D++ 
Sbjct: 462  KKLPPGSRRIYTLFRMNISIMEDTTWRIPTRESSKDPEFLKHYKETNEEYRPFGWMDLRF 521

Query: 539  SRDSCGIFDLAMCPTSKGFKNTIDVQLVDTEIRSSVNHDIFLKSKSFSFNCDIGYPLGWN 598
             +D+   F++++CPT +GF+N   V  ++TEIRSSVNHDI LKSK F  + DIGYPLGWN
Sbjct: 522  CKDTYANFNISVCPTVQGFQNNFHVHFLETEIRSSVNHDILLKSKVFDIDGDIGYPLGWN 581

Query: 599  AEANWTIIMDSNQLELFLLREHVTLIADTLTDFSSGEPVPYELFRPFVYHIKWNMKGYSF 658
            ++A W I M S QLE FLLREH+TL+ADTL+DFS+G+P PYELFRPFVY + W M+GYS 
Sbjct: 582  SKAIWIINMKSEQLEAFLLREHITLVADTLSDFSAGDPTPYELFRPFVYKVNWEMEGYSI 641

Query: 659  YLNVNDHNIVNNPLDFNENCYLSIHGDDLTMNVMVPKKTITSRFTNMTYDIYTPMFRXXX 718
            YLNVNDHNIVNNPLDFNENCYLS+HGD L+++V VP+++I   +T+M+Y+I TPMFR   
Sbjct: 642  YLNVNDHNIVNNPLDFNENCYLSLHGDKLSIDVTVPRESILGTYTDMSYEISTPMFRMML 701

Query: 719  XXXXXXXXXEFMRNKEVGRSHDFRLKGSYLIYSELDIDNVDTLTVECSSRGTALHIYGFV 778
                     EFM++KEVGR++DF +KGSYL+YSELDIDNVDTL +EC+S+ T LH YGFV
Sbjct: 702  NTPPWNTLNEFMKHKEVGRAYDFTIKGSYLLYSELDIDNVDTLVIECNSKSTVLHCYGFV 761

Query: 779  IRYLINVKMNYFGEFFHFVTSEEYTGNTRPTDLENIISEDRRDDDFSSYESVSRISSNSS 838
            +RYL NVKMNYFGEFF+FVTSEEYTG     ++ ++ ++    D  S+ +S  + SS  +
Sbjct: 762  MRYLTNVKMNYFGEFFNFVTSEEYTGVLGAREVGDVTTKSSVADLASTVDSGYQNSSLKN 821

Query: 839  DXXXXXXXXXXXXXXXXXRTSNETDIWFTFSVWDGALILPETIYNADPCIALHFAELIVD 898
            +                 RT+NETDIWFTFSVWDGALILPETIY+ DPCIALHFAEL+VD
Sbjct: 822  ESEDKGPMKRSDLK----RTTNETDIWFTFSVWDGALILPETIYSFDPCIALHFAELVVD 877

Query: 899  LRSCNYYMDILATACDINLKRYVGKRADEIYEYVHLNNGKDHEVHGTLSDIYIHGHRMYG 958
             RSCNYYMDI+A     ++KR+V K+ +E+++++  NNG D + HG LSD+ IHGHRMYG
Sbjct: 878  FRSCNYYMDIMAVLNGTSIKRHVSKQINEVFDFIRRNNGADEQEHGLLSDLTIHGHRMYG 937

Query: 959  LPPTEPTYFCQWDMDFGHLNIDSNMFFLQGLFGAFYKIGFGYKDLENILLYETEIIDDMT 1018
            LPPTEPTYFCQWD++ G L IDS++ F++G F +FYKIGFGY DLENILLY+TE I+DMT
Sbjct: 938  LPPTEPTYFCQWDINLGDLCIDSDIEFIKGFFNSFYKIGFGYNDLENILLYDTETINDMT 997

Query: 1019 SLTIFINTIDIRLNDVDTTAHADLKLERFCFTLIDFENERYSKRMDIKIPSL--EFNIFS 1076
            SLT+ +  I I L D    + + +  E   FTLIDFENE+YS+R+D+KIP L    N   
Sbjct: 998  SLTVHVEKIRIGLKDPVMKSQSVISAESILFTLIDFENEKYSQRIDVKIPKLTISLNCVM 1057

Query: 1077 NEDNDLSLLNFKVDMNFTNFVQNQDFNKHRKIQRDYIVLNDAPYHRCAFLLPESYQKSRI 1136
             +  D S L F+  + FTNF Q +D +K R  QR YI ++D+PYHRC FLLP  YQ S  
Sbjct: 1058 GDGVDTSFLKFETKLRFTNFEQYKDIDKKRSEQRRYITIHDSPYHRCPFLLPLFYQDSDT 1117

Query: 1137 YNELFGXXXXXXXXXXXXXXXTADTIEYVLEDLLEDYMGLFEGNYDIKESSVENLELSAI 1196
            Y  L+G                 DTI+Y++ED++ +Y  L E     K    E    S +
Sbjct: 1118 YQNLYGAIAPSSSIPTLPLPTLPDTIDYIIEDIVGEYATLLETTNPFKNIFAETP--STM 1175

Query: 1197 EATRAITGIGAERTHSNPITLSDYAV------ESDNYVVKVESIVIDINPALYTTIEKLL 1250
            E +RA          ++P +    A       E DNYVV V  I++D++P L+   + LL
Sbjct: 1176 EPSRASFSEDDNDEEADPSSFKPVAFTEDRNHERDNYVVDVSYILLDVDPLLFIFAKSLL 1235

Query: 1251 KHIYDQDAVQIIDGIEIGIVKRLSSIHDGVTTMTNVKVQIKHFNLFWGEKESDNVSMFFD 1310
            + +Y ++ VQ++D IEIGIVKRLS++ +G+T+++N+ + I + NL W E   +   ++ D
Sbjct: 1236 EQLYSENMVQVLDDIEIGIVKRLSNLQEGITSISNIDIHIAYLNLIWQETGEEGFELYLD 1295

Query: 1311 KMDFALTEKTLEQNSEKNLLEMTVLAKIKAVRLTVVQQPGLIPTQERPPAITVGVEGFEF 1370
            ++D+ ++EK+LE+N    LLE+  LAK+K VR+TV Q+     +++RPPA+++G+EGFE 
Sbjct: 1296 RIDYQMSEKSLEKNRTNKLLEVAALAKVKTVRVTVNQKKNPDLSEDRPPALSLGIEGFEV 1355

Query: 1371 WSTAIEKQVNSISVSSADITVDDAQVEWFFKYIVRQKYFFLDMLQSYNRIQNNRIESQKE 1430
            WS+  ++QVNS++++S+DIT+D++Q+EW F+Y   Q     ++  S+N IQN R  S+ E
Sbjct: 1356 WSSTEDRQVNSLNLTSSDITIDESQMEWLFEYCSDQGNLIQEVCTSFNSIQNTRSNSKTE 1415

Query: 1431 LISRLTAASEYYQISHDPYVITKPAFIMRLSRGHVRENKSWKIITRLRHILTYLPKDWYL 1490
            LIS+LTAASEYYQISHDPYVITKPAFIMRLS+GHVREN+SWKIITRLRHILTYLP DW  
Sbjct: 1416 LISKLTAASEYYQISHDPYVITKPAFIMRLSKGHVRENRSWKIITRLRHILTYLPDDWQS 1475

Query: 1491 NVGQPLRDRKFDPSQDARSIFMSIFSNWRSWEFSDVARSYIYGKLFLNDHAEXXXXXXXX 1550
            N+ + L+++K+  ++DA++IFMS+FS WR+WEFSDVARSYIYGKLF  ++ +        
Sbjct: 1476 NIDEVLKEKKYTSAKDAKNIFMSVFSTWRNWEFSDVARSYIYGKLFTAENEKHKQNLIKK 1535

Query: 1551 XXXXNIGNFFMTVYSTNYDVDHSIVVSNAKLLLELTPSSTEPKENSLQREELIDISGTVD 1610
                 +G+F++TVY   Y+V+H+ VV++A L+++LTP  T    N   REE I+I+G V 
Sbjct: 1536 LLKCTMGSFYLTVYGEGYEVEHNFVVADANLVVDLTPPVTSLPSN---REETIEITGRVG 1592

Query: 1611 VIXXXXXXXXXXXXXXIPILTEGSEKQPVKPPQDTIPKPFKMNAAFMVNSCDIQLVMDAT 1670
             +              IP++    E     P ++ + K FKMN   +V+  ++QLVMD T
Sbjct: 1593 SVKGKFSDRLLKLQDLIPLIAAVGEDDKSDPKKE-LSKQFKMNTVLLVDKSELQLVMDQT 1651

Query: 1671 KLNMNVNDGRISVLWENLQDSTAQAGSVVLFSKHTELVLKHINSVLAEGRVSNFYATFTT 1730
            KL      GR+S+LWENL+DST+QAGS+V+FS+ +E+ LKH + +L E ++ +F    TT
Sbjct: 1652 KLMSRTVGGRVSLLWENLKDSTSQAGSLVIFSQKSEVWLKHTSVILGEAQLRDFSVLATT 1711

Query: 1731 DTWAQRPTYLIHSKSSSIHFRTMAKTERLVEAIKDIKLKIDQISEQLELERRLTQHPTVY 1790
            + W+ +PT LI+++ + +HFR M+ TE+LV AI +I+  +  I E+++ + +  +     
Sbjct: 1712 EAWSHKPTILINNQCADLHFRAMSSTEQLVTAITEIRESLMMIKERIKFKPKSKKKSQFV 1771

Query: 1791 DPNKSNVIASCLFSNVSMDIMPVSPFALKNSAKQIDFFYNKFDSDSWLIKLKDTDFFLTS 1850
            D  K N + SC FSNVS ++MP+SPF +++ AKQ+D ++NKF S+  L+ + DTDFF+TS
Sbjct: 1772 D-QKINTVLSCYFSNVSSEVMPLSPFYIRHEAKQLDIYFNKFGSNEILLSIWDTDFFMTS 1830

Query: 1851 DQTKEQYMRLSMKKLQIRVNVSSSKPKLVDINLSTNLVKLTFSEPKNIVYSFLKDERVAS 1910
             QTKEQY+R S   ++I+  +S     L+++++S +++KLTFSEP+ IV SFL+DE++AS
Sbjct: 1831 HQTKEQYLRFSFGDIEIKGGISREGYSLINVDISISMIKLTFSEPRRIVNSFLQDEKLAS 1890

Query: 1911 ESVHLLQTLKPLFSISDDKESTPQSYQEKTEYL--WSLDSSIDYFGILIPMTSTYYVMEF 1968
            + ++LL +LKPLF  S+     P+  ++    +  W+LD+SI YFG+L+P+ STY+V E 
Sbjct: 1891 QGINLLYSLKPLFFSSN----LPKKEKQAPSIMINWTLDTSITYFGVLVPVASTYFVFEL 1946

Query: 1969 HSYVSSISNAN-GAPSGNLDITGHMSVENILFLIKESSLPDGLSKVIDIAVNVSTLQRVD 2027
            H  + S++N N G       +TG  S+ENILFLIKE SLP GLSK++D ++ VSTLQR  
Sbjct: 1947 HMLLLSLTNTNNGMLPEETKVTGQFSIENILFLIKERSLPIGLSKLLDFSIKVSTLQRTV 2006

Query: 2028 DNSRSIQVESSHARICLSPDSLLRLLWGFNQGHKLSEHYLKYHSKSLWQSFAKSDDKQQD 2087
            D  +S QVESSH R+CLSPDSLLRL+WG ++   LS +Y + H+ ++W +      K   
Sbjct: 2007 DTEQSFQVESSHFRVCLSPDSLLRLMWGAHKLLDLSHYYSRRHAPNIWNT------KMFT 2060

Query: 2088 TNSIKSNETSFFSSINSIHFLSYNLCVGWLFEYELGPPKGLITGYSRLFSAYENCMGKLT 2147
              S KS E     +  SIH LSY  C+GW+F+Y  G   GL+ GY+RLFSAYE   GK T
Sbjct: 2061 GKSDKSKEMPI--NFRSIHILSYKFCIGWIFQYGAGSNPGLMLGYNRLFSAYEKDFGKFT 2118

Query: 2148 VIDSYFAAAQGNTSSTFYPETNVKELFNRFYLPNMQILFWWKVIEGMKDVYVRFTGETLD 2207
            V+D++F+ A GNTSSTF+ E N K+ +NR +LPNMQI +W+K    +KD + RF GE LD
Sbjct: 2119 VVDAFFSVANGNTSSTFFSEGNEKDKYNRSFLPNMQISYWFKRCGELKDWFFRFHGEALD 2178

Query: 2208 VKYLSDFMLTIESTLHSIKMFQKLKKEL--IVETPKRE----VVHIKEDKPXXXXXXXXX 2261
            V ++  FM  IESTL S++ FQ+LKK +  + E+ + E          +           
Sbjct: 2179 VNFVPSFMDVIESTLQSMRAFQELKKNILDVSESLRAENDNSYASTSVESASSSLAPFLD 2238

Query: 2262 XXXXXXCHFKYDGGTYSVFNISDGSLNPTPAIEIKSPVISVDVLYKHEKQNTKHHSIRCL 2321
                   +FKYDGG + V+   D      P+ EIKSPV++++  YKH++   K H  R L
Sbjct: 2239 NIRSVNSNFKYDGGVFRVYTYEDIETKSEPSFEIKSPVVTINCTYKHDEDKVKPHKFRTL 2298

Query: 2322 VNIDPTHNVLYATCAPLVKNFVEDVRSIFGRYESENKHSETTPTSVQNIDYEKLLEDYDL 2381
            + +DPTHN LYA CAPL+  F E ++ +  ++ ++ K + T P+S QN+DY++LL+ +D+
Sbjct: 2299 ITVDPTHNTLYAGCAPLLMEFSESLQKMIKKHSTDEKPNFTKPSS-QNVDYKRLLDQFDV 2357

Query: 2382 AITVTSAKQQLSLSCEPKAKVQADVGFEALTVSMTTNPFDIDEPLAFSFSIKDTKASIKH 2441
            A+ +TSAKQQLSLSCEPKAKVQADVGFE+   SM TN FD ++PL FS +++ TKASIKH
Sbjct: 2358 AVKLTSAKQQLSLSCEPKAKVQADVGFESFLFSMATNEFDSEQPLEFSLTLEHTKASIKH 2417

Query: 2442 LFSRETSTSFGVGYLDLTLLFTHTNRINTYGTSLISDIDLYFNVKQLQNLYLFLDIWQLS 2501
            +FSRE STSF VG++DLTLLFTH + I+ YGT L+SD+ ++FNVKQLQNLYLFLDIW+ S
Sbjct: 2418 IFSREVSTSFEVGFMDLTLLFTHPDVISMYGTGLVSDLSVFFNVKQLQNLYLFLDIWRFS 2477

Query: 2502 ELLN--PVTSSQEQVIRKDKKKSVDKPIHNESQLPWCFTLIFTNVKGDIDLGPSLGLISL 2559
             +L+  PV  +  + I      S +      +++PWCFTLIFTNV GD+DLGPSLG+ISL
Sbjct: 2478 SILHTRPVQRTVNKEIEMSSLTSTNYA-DAGTEIPWCFTLIFTNVSGDVDLGPSLGMISL 2536

Query: 2560 RLSRTWLATDHFSGKRQILHAFVDDLLLISEGRLSGVVNIDGASWVSEVIWLQDSKRDNI 2619
            R  RTWLATDH++ KRQ+LHAF D + L SEGRLSG+  +  ASW+SEV W  +  ++  
Sbjct: 2537 RTQRTWLATDHYNEKRQLLHAFTDGISLTSEGRLSGLFEVANASWLSEVKWPPEKSKNTH 2596

Query: 2620 PLVALSLNTDKIEIKAAFDYHMFLIGTVNNILFQLHSERDMVGVAPDLLKVSFSCEEIKL 2679
            PLV+ SLN D I +KAAFDYHMFLIGT++NI F LH+E+D  GV PDLL+VSFS +EI L
Sbjct: 2597 PLVSTSLNIDDIAVKAAFDYHMFLIGTISNIHFHLHNEKDAKGVLPDLLQVSFSSDEIIL 2656

Query: 2680 CSTALVAANILDIYNTIIRMRQDTKISYIETLKDSNMETNKQTLAYRDILKSLQLLRTDL 2739
             STALV ANILDIYNTI+RMRQD KISY+ETL+DSN   ++Q + Y+DIL+SL+LLRTDL
Sbjct: 2657 SSTALVVANILDIYNTIVRMRQDNKISYMETLRDSNPGESRQPILYKDILRSLKLLRTDL 2716

Query: 2740 TVSICSLQLQISPISLFDXXXXXXXXXXXSARSETHSEAKLTTSLNMEVYDATLSLSTAK 2799
            +V+I S ++QISPISLFD           S RSETHS  KL T L ++V D + +LST+K
Sbjct: 2717 SVNISSSKVQISPISLFDVEVLVIRIDKVSIRSETHSGKKLKTDLQLQVLDVSAALSTSK 2776

Query: 2800 QELDEDALSKITVADYMTYASKIRGGTIIEIPRMGVQMTTWQEEKSDILEYLYSCKFHDK 2859
            +ELDE+  + I + DYM YASKI GGTII+IP++ V MTT QEEK++ LEYL++C F DK
Sbjct: 2777 EELDEEVGASIAIDDYMHYASKIVGGTIIDIPKLAVHMTTLQEEKTNNLEYLFACSFSDK 2836

Query: 2860 VAVRWNLGPVNFMKEMWTTHVKAIAVRRSQVLTGSFNVSEKDVEKRIKEEENITKLNYVP 2919
            ++VRWNLGPV+F+KEMWTTHVKA+AVRRSQV   SF  +E+++E+ IK+EE  +K NY+ 
Sbjct: 2837 ISVRWNLGPVDFIKEMWTTHVKALAVRRSQVANISFGQTEEELEESIKKEEAASKFNYIA 2896

Query: 2920 VEEPQIDMPQIKDLGDATPPVEWFGVNRKRFPAFTHQTAVVPVQNLVYLAQKQYAKTL 2977
            +EEPQI++PQI+DLGDATPP+EWFGVNRK+FP FTHQTAV+PVQ LVYLA+KQY K L
Sbjct: 2897 LEEPQIEVPQIRDLGDATPPMEWFGVNRKKFPKFTHQTAVIPVQKLVYLAEKQYVKIL 2954

>Smik_12.146 Chr12 complement(286690..295566) [8877 bp, 2958 aa] {ON}
            YLR087C (REAL)
          Length = 2958

 Score = 3158 bits (8188), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1551/2999 (51%), Positives = 2104/2999 (70%), Gaps = 72/2999 (2%)

Query: 5    QSSAGFRGESLGFKRNFSWVFLVDWILTVILTLATLFYLSRAFAYGVTFILEWLLWKQAK 64
            ++ +  RG  L  +++FSWVFLVDWILT++  L  +FY+ R +AY V+FILEWLLWK+AK
Sbjct: 2    EAVSQLRGVPLTHQKDFSWVFLVDWILTIVACLTMVFYMGRIYAYLVSFILEWLLWKRAK 61

Query: 65   VKVSIGALRISLLAGRVFFKNLTIIDKDRTITILEGSITWRYWLIRTRKSEYRVAQMAHA 124
            VK+++  LR+SLL GR+ FK+L++I KD TI+ILEGSITW+YWL+  RK     A++   
Sbjct: 62   VKINVETLRVSLLGGRIHFKHLSVIHKDYTISILEGSITWKYWLLNCRK-----AELIDN 116

Query: 125  SAGSSGNSEDDTKFDIANYMEKQLKLPCRFLFECEGFEMFIYNRTYAYDNIVNVLSKVER 184
            +   S N+               +KLPC+F  ECEG E+FIYNRT AYDN++N+LSK ER
Sbjct: 117  NKSPSKNN---------------VKLPCKFCLECEGLEIFIYNRTVAYDNVINLLSKDER 161

Query: 185  EKFEKFMAENDFLDPSSDGSSDDKIEE--TSSATNSTDEETIANDRTFQNDTRKTLPRYL 242
            +KFEK++ E+ F +P SDGSS DK++E  + SA  +  + +I NDR +Q       P++L
Sbjct: 162  DKFEKYLNEHSFPEPFSDGSSADKLDEDLSESAYTTNSDASIINDRDYQETDIGKHPQFL 221

Query: 243  EALPIEALLNKGSILIGNKFTPCVLILSFESAVALQDVGEAPSKLDLYRMKYEVRLKNLE 302
            + LPIE   ++GS+L+GNKFTP V+ILS+ES   + DV     ++DLYR K ++  KN E
Sbjct: 222  KFLPIELNFSRGSLLLGNKFTPSVMILSYESGEGIVDVLPPKERVDLYRNKTQMEFKNFE 281

Query: 303  IMMKQNIDYDNEKSRNFEFDKGKLSRLWHRFTRIFKLVPFPFKSNRRKEQ---PHDNFMQ 359
            I +KQNI YD+     F+ D GK+S+LW  F R+ +LV  P  S R K+     +D+F Q
Sbjct: 282  ISIKQNIGYDDAIGLKFKLDTGKVSKLWKAFIRVLQLVSKPVVSKRTKKNTRSSNDSFYQ 341

Query: 360  KWKGLSMYR-NDMFGXXXXXXXXXXXXSSHEYAKFTSLLKSPRVTIHHDYDMPGWVPHGA 418
            KWKGLS+Y+                  ++HEYAKFTS+LK P+VTI +D D+PG VPHGA
Sbjct: 342  KWKGLSLYKATSGEAKANDLDDIEFDLTNHEYAKFTSILKCPKVTISYDVDVPGVVPHGA 401

Query: 419  HPPSSYADGPDVGNNMAPPQYIFEINIFGGTVCYGPWAQRQTNHLQSLLSPSVSRTAKPI 478
            HP  S  DGPDVGNN APP +  ++ I GG++CYGPWAQRQ +HLQ +LSP VSRTAKPI
Sbjct: 402  HPTISDIDGPDVGNNGAPPDFALDVQIHGGSICYGPWAQRQVSHLQRVLSPVVSRTAKPI 461

Query: 479  KKLKPGSKRIYTVLKLTINAMEDVTWRIPTRESSKDVEFLMHYKETNDDYRPFGWIDIKV 538
            KKL PGS+R+YT+ ++ I+  ED TWRIPTRE+SKD EFL HYKET+++YRPFGW+D++ 
Sbjct: 462  KKLPPGSRRVYTLFRMNISITEDTTWRIPTRETSKDAEFLQHYKETSEEYRPFGWMDLRF 521

Query: 539  SRDSCGIFDLAMCPTSKGFKNTIDVQLVDTEIRSSVNHDIFLKSKSFSFNCDIGYPLGWN 598
             +D+   F++++CPT +GF+N   V  V+TEIRSSVNHDI LKSK F+ + DIGYPLGWN
Sbjct: 522  CKDTYANFNISVCPTVEGFQNNFHVHFVETEIRSSVNHDILLKSKVFNIDGDIGYPLGWN 581

Query: 599  AEANWTIIMDSNQLELFLLREHVTLIADTLTDFSSGEPVPYELFRPFVYHIKWNMKGYSF 658
            ++A W I M S QLE FLLREH+TL+ADTL+DFS+G+P PYELFRPFVY + W M+GYS 
Sbjct: 582  SKAIWIINMKSEQLEAFLLREHITLVADTLSDFSAGDPTPYELFRPFVYKVNWEMEGYSI 641

Query: 659  YLNVNDHNIVNNPLDFNENCYLSIHGDDLTMNVMVPKKTITSRFTNMTYDIYTPMFRXXX 718
            YLNVNDHNIVNNPLDFNENCYLS+HGD L ++V VP+++I   +T+++Y+I TPMFR   
Sbjct: 642  YLNVNDHNIVNNPLDFNENCYLSLHGDKLAIDVTVPRESILGTYTDISYEISTPMFRMML 701

Query: 719  XXXXXXXXXEFMRNKEVGRSHDFRLKGSYLIYSELDIDNVDTLTVECSSRGTALHIYGFV 778
                     EFM++KEVGR++DF +KG+YL+YSELDIDNVDTL +EC+S  T LH YGFV
Sbjct: 702  NTPPWNTLNEFMKHKEVGRAYDFTIKGTYLLYSELDIDNVDTLVIECTSNSTVLHCYGFV 761

Query: 779  IRYLINVKMNYFGEFFHFVTSEEYTGNTRPTDLENIISEDRRDDDFSSYESVSRISSNSS 838
            +RYL NVKMNYFGEFF+FVTSEEYTG     D+ ++ ++    D  S+ +S  + SS  +
Sbjct: 762  MRYLTNVKMNYFGEFFNFVTSEEYTGVLGARDVGDVTTKSSVVDLASTVDSGYQNSSVKN 821

Query: 839  DXXXXXXXXXXXXXXXXXRTSNETDIWFTFSVWDGALILPETIYNADPCIALHFAELIVD 898
            +                 RT+NETDIWFTFSVW+GALILPETIY+ DPCIALHF+EL+VD
Sbjct: 822  NSEAKGPMKRSDLK----RTTNETDIWFTFSVWNGALILPETIYSFDPCIALHFSELVVD 877

Query: 899  LRSCNYYMDILATACDINLKRYVGKRADEIYEYVHLNNGKDHEVHGTLSDIYIHGHRMYG 958
             RSCNYYMDI+A     ++KR+V K+ +E+++++  NNG D + HG+LSD+ IHGHRMYG
Sbjct: 878  FRSCNYYMDIMAVLDGTSIKRHVSKQINEVFDFIRRNNGADEQEHGSLSDLTIHGHRMYG 937

Query: 959  LPPTEPTYFCQWDMDFGHLNIDSNMFFLQGLFGAFYKIGFGYKDLENILLYETEIIDDMT 1018
            LPPTEPTYFCQWD++ G L+IDS++ F++G F +FYKIGFGY DLENILLY+TE IDDMT
Sbjct: 938  LPPTEPTYFCQWDINLGDLSIDSDVEFIKGFFSSFYKIGFGYNDLENILLYDTETIDDMT 997

Query: 1019 SLTIFINTIDIRLNDVDTTAHADLKLERFCFTLIDFENERYSKRMDIKIPSLE--FNIFS 1076
            SLT+    I I L D    + + +  E   FTLIDFENE YS+R+D+K+P L+   N   
Sbjct: 998  SLTVHAERIRISLEDPVMKSQSVISAESILFTLIDFENENYSQRIDVKVPKLKISLNCVM 1057

Query: 1077 NEDNDLSLLNFKVDMNFTNFVQNQDFNKHRKIQRDYIVLNDAPYHRCAFLLPESYQKSRI 1136
             +  D+S L F+  + FTNF Q +D +K R  QR YI  +D+PYHRC+FLLP  YQ S  
Sbjct: 1058 GDGVDMSFLKFETKLRFTNFEQYKDIDKKRSEQRKYITFHDSPYHRCSFLLPLFYQDSDT 1117

Query: 1137 YNELFGXXXXXXXXXXXXXXXTADTIEYVLEDLLEDYMGLFEGNYDIKESSVEN---LEL 1193
            Y +L+G                 DTI++++ED++ +Y  L E     K+S  E    +E 
Sbjct: 1118 YQKLYGAIAPSSSIPTLPLPTLPDTIDFIIEDIVGEYATLLEAANPFKDSFAETPSTVEP 1177

Query: 1194 SAIEATRAITGIGAERTHSNPITLS-DYAVESDNYVVKVESIVIDINPALYTTIEKLLKH 1252
            S    T       A  +   P   + D   E DNYVV V  I++DI+P L+   + LL+ 
Sbjct: 1178 SKASFTEDDNDEEASSSGFKPGAFTEDGDDEKDNYVVDVSYILLDIDPLLFVFTKSLLEQ 1237

Query: 1253 IYDQDAVQIIDGIEIGIVKRLSSIHDGVTTMTNVKVQIKHFNLFWGEKESDNVSMFFDKM 1312
            +Y ++ VQ++D IEIGIVKRLS++ +G+T+++N+ + I + NL W E   +   ++ D++
Sbjct: 1238 LYSENMVQVLDDIEIGIVKRLSNLQEGITSISNIDIHIAYLNLIWQETGEEGFELYLDRI 1297

Query: 1313 DFALTEKTLEQNSEKNLLEMTVLAKIKAVRLTVVQQPGLIPTQERPPAITVGVEGFEFWS 1372
            D+ + EK+LE+N    LLE+  LA++K VR+TV Q+     +++RPPA+++G+EGFE WS
Sbjct: 1298 DYQMREKSLEKNRTTKLLEVAALARVKTVRVTVNQKKNPDLSEDRPPALSLGLEGFEIWS 1357

Query: 1373 TAIEKQVNSISVSSADITVDDAQVEWFFKYIVRQKYFFLDMLQSYNRIQNNRIESQKELI 1432
            +   +QVNS++++S+DIT+D++Q+EW F+Y   Q     ++  S++ IQ+ R  S+ ELI
Sbjct: 1358 STEGRQVNSLNLTSSDITIDESQMEWLFQYCSDQANLLQEVATSFHSIQDTRTSSKTELI 1417

Query: 1433 SRLTAASEYYQISHDPYVITKPAFIMRLSRGHVRENKSWKIITRLRHILTYLPKDWYLNV 1492
            S LTAASEYYQISHDPYVITKPAFIMRLS+GHVREN+SWKIITRLRHILTYLP DW  N+
Sbjct: 1418 SELTAASEYYQISHDPYVITKPAFIMRLSKGHVRENRSWKIITRLRHILTYLPDDWQNNI 1477

Query: 1493 GQPLRDRKFDPSQDARSIFMSIFSNWRSWEFSDVARSYIYGKLFLNDHAEXXXXXXXXXX 1552
             + L++RK+  + DA++IFMS+FS WR+WEFSDVARSYIYGKLF  D+ +          
Sbjct: 1478 DKVLKERKYTSANDAKNIFMSVFSTWRNWEFSDVARSYIYGKLFSTDNEKHKQNLIKKLL 1537

Query: 1553 XXNIGNFFMTVYSTNYDVDHSIVVSNAKLLLELTPSSTEPKENSLQREELIDISGTVDVI 1612
               +G+F++TVY   Y+V+H+ VV++A L+++LTP  T     SL REE I+I+G +  +
Sbjct: 1538 KCTMGSFYLTVYGEGYEVEHNFVVADANLVVDLTPPVTSL---SLNREETIEITGRIGSV 1594

Query: 1613 XXXXXXXXXXXXXXIPILTEGSEKQPVKPPQDTIPKPFKMNAAFMVNSCDIQLVMDATKL 1672
                          IP++    E     P  + + K F+MN   +V+  ++QLVMD TKL
Sbjct: 1595 KGKFSDRLLKLQDLIPLVAAVGEDDKSDPKTE-LSKQFRMNTVLLVDKSELQLVMDETKL 1653

Query: 1673 NMNVNDGRISVLWENLQDSTAQAGSVVLFSKHTELVLKHINSVLAEGRVSNFYATFTTDT 1732
                  GR+S+LWENL+DST+QAGSVV+FS+ +E+ LKH + +L E ++ +F    TT+ 
Sbjct: 1654 MSRTVGGRVSLLWENLKDSTSQAGSVVIFSQKSEVWLKHASIILGEAQLRDFSILATTEA 1713

Query: 1733 WAQRPTYLIHSKSSSIHFRTMAKTERLVEAIKDIKLKIDQISEQLELERRLTQHPTVYDP 1792
            W+ +PT LI+++ + +HFR M+ TE+ V AI +I+    +I E+++ + +  +    +  
Sbjct: 1714 WSHKPTILINNQCADLHFRAMSSTEQTVTAITEIRESALKIKERIKFKPKSKKKSQ-FVG 1772

Query: 1793 NKSNVIASCLFSNVSMDIMPVSPFALKNSAKQIDFFYNKFDSDSWLIKLKDTDFFLTSDQ 1852
             K N + +C FSNVS +IMP+SPF +++ AKQ+D ++NKF S+  LI + DTDFF+TS Q
Sbjct: 1773 QKINTVLTCYFSNVSSEIMPLSPFYIRHEAKQLDIYFNKFGSNEILISIWDTDFFMTSHQ 1832

Query: 1853 TKEQYMRLSMKKLQIRVNVSSSKPKLVDINLSTNLVKLTFSEPKNIVYSFLKDERVASES 1912
            TKEQY+R S   ++I+  VS     L+++++S +++KLTFSEP+ IV SFL+DE++AS+ 
Sbjct: 1833 TKEQYLRFSFGDIEIKGGVSKEGYSLINVDISISMIKLTFSEPRRIVNSFLQDEKLASQG 1892

Query: 1913 VHLLQTLKPLFSISDDKESTPQSYQEKTEYL--WSLDSSIDYFGILIPMTSTYYVMEFHS 1970
            ++LL +LK LF  S+     P+  ++    +  W+LD+SI YFGILIP+ STY+V E H 
Sbjct: 1893 INLLCSLKSLFFSSN----IPKKEKQVPALMINWTLDTSISYFGILIPVASTYFVFELHM 1948

Query: 1971 YVSSISNAN-GAPSGNLDITGHMSVENILFLIKESSLPDGLSKVIDIAVNVSTLQRVDDN 2029
             + S++N N G       +TG  S+ENILFLIKE SLP GLSKV+D ++ VSTLQR  D 
Sbjct: 1949 LLLSLTNTNNGMLPEETKVTGQFSIENILFLIKERSLPIGLSKVLDFSIKVSTLQRTIDT 2008

Query: 2030 SRSIQVESSHARICLSPDSLLRLLWGFNQGHKLSEHYLKYHSKSLW--QSFAKSDDKQQD 2087
             +S QVESSH R+CLSPDSLLRL+WG ++   L  +Y K+H+ ++W  + F    DK ++
Sbjct: 2009 EQSFQVESSHFRVCLSPDSLLRLMWGAHKLLDLGHYYTKHHAPNIWNIKMFTGKSDKPKE 2068

Query: 2088 TNSIKSNETSFFSSINSIHFLSYNLCVGWLFEYELGPPKGLITGYSRLFSAYENCMGKLT 2147
               I  N         SIH LSY  C+GWLF+Y  G   GL+ GY+RLFSAYE   GK T
Sbjct: 2069 ---IPLN-------FRSIHILSYKFCIGWLFQYGTGSDPGLMLGYNRLFSAYERDFGKFT 2118

Query: 2148 VIDSYFAAAQGNTSSTFYPETNVKELFNRFYLPNMQILFWWKVIEGMKDVYVRFTGETLD 2207
            V+DS+F+ A GNTSSTF+ E N K+ +NR +LPNMQI +W+K    +KD + RF GE LD
Sbjct: 2119 VVDSFFSVANGNTSSTFFSEGNEKDKYNRSFLPNMQISYWFKRCGELKDWFFRFHGEALD 2178

Query: 2208 VKYLSDFMLTIESTLHSIKMFQKLKKEL--IVETPKREVVHIK-----EDKPXXXXXXXX 2260
            V ++  FM  I+STL S++ FQ+LK+ +  + E    E  +I      E+ P        
Sbjct: 2179 VNFVPSFMDVIDSTLQSMRAFQELKRNILDVSENSHSEDSNIYAASSVENAPSSLAPFLN 2238

Query: 2261 XXXXXXXCHFKYDGGTYSVFNISDGSLNPTPAIEIKSPVISVDVLYKHEKQNTKHHSIRC 2320
                    +FKYDGG + V+   D      P+ EIKSPV++++  YKH++   + H IR 
Sbjct: 2239 NIRSVN-SNFKYDGGVFRVYTYEDIEAKSEPSFEIKSPVVTINCTYKHDEDKVRPHKIRT 2297

Query: 2321 LVNIDPTHNVLYATCAPLVKNFVEDVRSIFGRYESENKHSETTPTSVQNIDYEKLLEDYD 2380
            L+ +DPTHN LYA CAPL+  F E ++ +  ++ ++ K + T P S QN+DY++LL+ +D
Sbjct: 2298 LITVDPTHNTLYAGCAPLLMEFSESLQKMIKKHSTDEKPNFTKP-SPQNVDYKRLLDQFD 2356

Query: 2381 LAITVTSAKQQLSLSCEPKAKVQADVGFEALTVSMTTNPFDIDEPLAFSFSIKDTKASIK 2440
            +A+ +TSAKQQLSLSCEPKAKVQADVGFE+   S+TTN FD + PL FS +++ TKASIK
Sbjct: 2357 VAVKLTSAKQQLSLSCEPKAKVQADVGFESFLFSVTTNEFDSEHPLEFSLTLEHTKASIK 2416

Query: 2441 HLFSRETSTSFGVGYLDLTLLFTHTNRINTYGTSLISDIDLYFNVKQLQNLYLFLDIWQL 2500
            H+FSRE STSF VG++DLT+LFTH + I+ YG  L+SD++++FNVKQLQNLYLFLDIW+ 
Sbjct: 2417 HIFSREVSTSFEVGFMDLTILFTHPDVISMYGIGLVSDLNVFFNVKQLQNLYLFLDIWRF 2476

Query: 2501 SELLNPVTSSQEQVIRKDKKKSVDKPIHNE--SQLPWCFTLIFTNVKGDIDLGPSLGLIS 2558
            S +L+    +Q  V +     S+    H +  +++PWCFTLIFTNV GD+DLGPSLG+IS
Sbjct: 2477 SSILH-TRPAQRSVNKGIDMHSLTSTSHVDLGTEIPWCFTLIFTNVSGDVDLGPSLGVIS 2535

Query: 2559 LRLSRTWLATDHFSGKRQILHAFVDDLLLISEGRLSGVVNIDGASWVSEVIWLQDSKRDN 2618
            LR  RTWLATDH+  KRQ+LHAF D + L SEGRLSG+  +  ASW+SEV W  +  ++ 
Sbjct: 2536 LRTQRTWLATDHYDEKRQLLHAFTDGISLTSEGRLSGLFEVANASWLSEVKWSPEKGKNT 2595

Query: 2619 IPLVALSLNTDKIEIKAAFDYHMFLIGTVNNILFQLHSERDMVGVAPDLLKVSFSCEEIK 2678
             PLV+ SLN D + IKAAFDYHMFLIGT+NNI FQLH+E+D  GV PDLL+VSFS +EI 
Sbjct: 2596 HPLVSTSLNIDDMAIKAAFDYHMFLIGTINNIHFQLHNEKDAKGVLPDLLQVSFSSDEII 2655

Query: 2679 LCSTALVAANILDIYNTIIRMRQDTKISYIETLKDSNMETNKQTLAYRDILKSLQLLRTD 2738
            L STALVAANILDIYNTI+RMRQD KISY+ETL+DSN   ++Q + Y+DIL+SL+LLRTD
Sbjct: 2656 LSSTALVAANILDIYNTIVRMRQDNKISYMETLRDSNPGESRQPVLYKDILRSLKLLRTD 2715

Query: 2739 LTVSICSLQLQISPISLFDXXXXXXXXXXXSARSETHSEAKLTTSLNMEVYDATLSLSTA 2798
            L+VSI SL++QISPISLFD           S RSETHS  KL T L ++V D + +LST+
Sbjct: 2716 LSVSISSLKVQISPISLFDVEVLVVRIDKVSIRSETHSGKKLKTDLQLQVLDVSAALSTS 2775

Query: 2799 KQELDEDALSKITVADYMTYASKIRGGTIIEIPRMGVQMTTWQEEKSDILEYLYSCKFHD 2858
            K+ELDE+  + I + DYM YASKI GGTII+IP++ V MTT QEEK++ LEYL++C F D
Sbjct: 2776 KEELDEEVGASIAIDDYMHYASKIVGGTIIDIPKLAVHMTTLQEEKTNNLEYLFACSFSD 2835

Query: 2859 KVAVRWNLGPVNFMKEMWTTHVKAIAVRRSQVLTGSFNVSEKDVEKRIKEEENITKLNYV 2918
            K++VRWNLGPVNF+KEMWTTHVKA+AVRRSQ+   SF  +E+++E+ I +EE  +K NY+
Sbjct: 2836 KISVRWNLGPVNFIKEMWTTHVKALAVRRSQIANISFGQTEEELEESINKEETASKFNYI 2895

Query: 2919 PVEEPQIDMPQIKDLGDATPPVEWFGVNRKRFPAFTHQTAVVPVQNLVYLAQKQYAKTL 2977
             +EEPQI++PQI+DLGDATPP+EWFGVNRKRFP FTHQTAV+PVQ LVYLA+KQY K L
Sbjct: 2896 ALEEPQIEVPQIRDLGDATPPMEWFGVNRKRFPKFTHQTAVIPVQKLVYLAEKQYVKIL 2954

>Skud_12.155 Chr12 complement(290039..298918) [8880 bp, 2959 aa] {ON}
            YLR087C (REAL)
          Length = 2959

 Score = 3143 bits (8148), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1542/3003 (51%), Positives = 2104/3003 (70%), Gaps = 79/3003 (2%)

Query: 5    QSSAGFRGESLGFKRNFSWVFLVDWILTVILTLATLFYLSRAFAYGVTFILEWLLWKQAK 64
            ++ +  RG  L  +++FSWVFLVDWILTV++ L  +FY+ R +AY VTFILEWLLWK+A 
Sbjct: 2    EAISQLRGVPLTHQKDFSWVFLVDWILTVVICLTMIFYMGRIYAYLVTFILEWLLWKRAN 61

Query: 65   VKVSIGALRISLLAGRVFFKNLTIIDKDRTITILEGSITWRYWLIRTRKSEYRVAQMAHA 124
            +K+++  LR+SLL GR+ FK+L++I KD TI++LEGS+TW+YWL+  RK+E         
Sbjct: 62   IKINVETLRVSLLGGRIHFKHLSVIHKDYTISVLEGSLTWKYWLLNCRKAEL-------- 113

Query: 125  SAGSSGNSEDDTKFDIANYMEKQLKLPCRFLFECEGFEMFIYNRTYAYDNIVNVLSKVER 184
                  N++D         + K +KLPC+F  ECEG E+FIYNRT AYDN++N+LSK ER
Sbjct: 114  ----IENNKDS--------LSKNVKLPCKFSLECEGLEIFIYNRTVAYDNVINLLSKDER 161

Query: 185  EKFEKFMAENDFLDPSSDGSSDDKIEE--TSSATNSTDEETIANDRTFQNDTRKTLPRYL 242
            +KFEK++ E+ F +  SDGSS DK++E  + SA  +  + +I NDR +Q      LP++L
Sbjct: 162  DKFEKYLNEHSFPESFSDGSSADKLDEDLSESAYTTNSDASIINDRDYQETDIGKLPKFL 221

Query: 243  EALPIEALLNKGSILIGNKFTPCVLILSFESAVALQDVGEAPSKLDLYRMKYEVRLKNLE 302
            + LPIE   N+GS+L+GNKFTP V+ILS+E+   + DV     +LDLYR K ++  KN E
Sbjct: 222  KFLPIELKFNRGSLLLGNKFTPSVMILSYENGEGVIDVLPPKERLDLYRNKTQMEFKNFE 281

Query: 303  IMMKQNIDYDNEKSRNFEFDKGKLSRLWHRFTRIFKLVPFPF--KSNRRKEQPHDN-FMQ 359
            I +KQNI YD+     F+ D GK+S+LW  F R+ ++V  P   K N++K  P D+ F Q
Sbjct: 282  ISIKQNIGYDDAIGLKFKLDTGKVSKLWKTFVRVLRIVTKPIISKKNKKKTGPSDDSFFQ 341

Query: 360  KWKGLSMYRNDMF-GXXXXXXXXXXXXSSHEYAKFTSLLKSPRVTIHHDYDMPGWVPHGA 418
            KWKGLS+Y+                  ++HEYAKFTS+LK P++TI +D D+ G+VPHGA
Sbjct: 342  KWKGLSLYKAAPGDAKPSDLDDIEFDFTNHEYAKFTSILKCPKLTIAYDVDVSGFVPHGA 401

Query: 419  HPPSSYADGPDVGNNMAPPQYIFEINIFGGTVCYGPWAQRQTNHLQSLLSPSVSRTAKPI 478
            HP     DGPDVGNN APP +  ++ I GG++CYGPWAQRQ +HLQ +LSP VSRT+KP+
Sbjct: 402  HPTIPDIDGPDVGNNGAPPDFALDVQIHGGSICYGPWAQRQVSHLQRVLSPVVSRTSKPV 461

Query: 479  KKLKPGSKRIYTVLKLTINAMEDVTWRIPTRESSKDVEFLMHYKETNDDYRPFGWIDIKV 538
            KKL PGS+RIYT+ ++ +  MED TWRIPTRE+SKD EFL HYKET+++YRPFGW+D++ 
Sbjct: 462  KKLPPGSRRIYTLFRMNVLIMEDTTWRIPTRETSKDAEFLQHYKETSEEYRPFGWMDLRF 521

Query: 539  SRDSCGIFDLAMCPTSKGFKNTIDVQLVDTEIRSSVNHDIFLKSKSFSFNCDIGYPLGWN 598
             +D+   F++ +CPT +GF+N   V  V+TEIRSSVNHDI LKSK F+ + DIGYPLGWN
Sbjct: 522  CKDTYANFNVVLCPTVEGFQNNFHVHFVETEIRSSVNHDILLKSKVFNLDGDIGYPLGWN 581

Query: 599  AEANWTIIMDSNQLELFLLREHVTLIADTLTDFSSGEPVPYELFRPFVYHIKWNMKGYSF 658
            ++A W I M S QLE FLLREH+TL+ADTL+DFS+GEP PYELFRPFVY + W M+GYS 
Sbjct: 582  SKAIWIINMKSQQLEAFLLREHITLVADTLSDFSAGEPTPYELFRPFVYKVNWEMEGYSI 641

Query: 659  YLNVNDHNIVNNPLDFNENCYLSIHGDDLTMNVMVPKKTITSRFTNMTYDIYTPMFRXXX 718
            YLNVNDHNIVNNPLDFNENCYLS+HGD L +++ VP+++I   +T+++Y+I TPMFR   
Sbjct: 642  YLNVNDHNIVNNPLDFNENCYLSLHGDRLYIDITVPRESILGTYTDISYEISTPMFRMML 701

Query: 719  XXXXXXXXXEFMRNKEVGRSHDFRLKGSYLIYSELDIDNVDTLTVECSSRGTALHIYGFV 778
                     EFM++KEVGR++DF +KGSYL+YSELDIDNVDTL +EC+S  T LH YGFV
Sbjct: 702  NTPPWNTLNEFMKHKEVGRAYDFTVKGSYLLYSELDIDNVDTLVIECTSNSTVLHCYGFV 761

Query: 779  IRYLINVKMNYFGEFFHFVTSEEYTGNTRPTDLENIISEDRRDDDFSSYESVSRISSNSS 838
            +RYL NVKMNYFGEFF+FVTSEEYTG     ++  II++    D  S+ +S  + SS  +
Sbjct: 762  MRYLTNVKMNYFGEFFNFVTSEEYTGVLGAREVGEIITKSSVLDLASTLDSGYQNSSLKN 821

Query: 839  DXXXXXXXXXXXXXXXXXRTSNETDIWFTFSVWDGALILPETIYNADPCIALHFAELIVD 898
            +                 RT+NETDIWFTFSVW+GALILPETIY+ DPCIALHF EL+VD
Sbjct: 822  E----SEDKDPVKRSDLKRTTNETDIWFTFSVWNGALILPETIYSLDPCIALHFTELVVD 877

Query: 899  LRSCNYYMDILATACDINLKRYVGKRADEIYEYVHLNNGKDHEVHGTLSDIYIHGHRMYG 958
             RSCNYYMDI+A     ++KR+V K  +E+++++  NNG + + HGTLSD+ IHGHRM+G
Sbjct: 878  FRSCNYYMDIMAVLNGTSIKRHVSKPINEVFDFIRRNNGANEQEHGTLSDLTIHGHRMFG 937

Query: 959  LPPTEPTYFCQWDMDFGHLNIDSNMFFLQGLFGAFYKIGFGYKDLENILLYETEIIDDMT 1018
            LPPTEPTYFCQWD++ G L IDS++ F++G F +FYKIGFGY DLENILLY+TE +DDMT
Sbjct: 938  LPPTEPTYFCQWDINLGDLTIDSDIEFIKGFFNSFYKIGFGYNDLENILLYDTETVDDMT 997

Query: 1019 SLTIFINTIDIRLNDVDTTAHADLKLERFCFTLIDFENERYSKRMDIKIPSL--EFNIFS 1076
            SLT+    I I  ND    + + +  E   FTLIDFENERYS+R+D+KIP L    +   
Sbjct: 998  SLTVHAERIKISFNDPVMKSQSVVTAESLLFTLIDFENERYSQRIDVKIPKLIISLSCVM 1057

Query: 1077 NEDNDLSLLNFKVDMNFTNFVQNQDFNKHRKIQRDYIVLNDAPYHRCAFLLPESYQKSRI 1136
             +  D S L F+  + FTNF Q +D +K R  QR YI  +D+PYHRC FLLP  YQ S  
Sbjct: 1058 GDGVDTSFLKFETKLRFTNFEQYKDIDKKRSEQRRYITAHDSPYHRCPFLLPLFYQDSDT 1117

Query: 1137 YNELFGXXXXXXXXXXXXXXXTADTIEYVLEDLLEDYMGLFEGNYDIKESSVENLELSAI 1196
            Y +L+G                 DTI++++ED++ +Y  L E     K+   E    S +
Sbjct: 1118 YQKLYGAIAPSSSIPTLPLPTLPDTIDFIIEDIVGEYATLLETTNPFKDIFAET--PSTV 1175

Query: 1197 EATRAITGIGAERTHSNPITLSDYAV------ESDNYVVKVESIVIDINPALYTTIEKLL 1250
            E +RA +        ++P+     A       +  NYV+ V  I++D++P L+   + LL
Sbjct: 1176 EPSRASSTEDDNDERADPLEFKPIAFTEGRNHQRGNYVIDVSYILLDVDPLLFVFTKSLL 1235

Query: 1251 KHIYDQDAVQIIDGIEIGIVKRLSSIHDGVTTMTNVKVQIKHFNLFWGEKESDNVSMFFD 1310
            K  Y +D VQ++D IEIGIVK+LS++ +G+T+++N+ V I + NL W E   +   ++ D
Sbjct: 1236 KEFYSEDMVQVLDDIEIGIVKQLSNLQEGITSISNIDVHIAYMNLIWQETGEEGFELYLD 1295

Query: 1311 KMDFALTEKTLEQNSEKNLLEMTVLAKIKAVRLTVVQQPGLIPTQERPPAITVGVEGFEF 1370
            ++D+ ++EK+LE+N    LLE+  LA+IK VR+TV Q+     +++RPPA+++G+EGFE 
Sbjct: 1296 RIDYQMSEKSLEKNRTSKLLEVATLARIKTVRVTVNQKRNPDLSEDRPPALSLGLEGFEV 1355

Query: 1371 WSTAIEKQVNSISVSSADITVDDAQVEWFFKYIVRQKYFFLDMLQSYNRIQNNRIESQKE 1430
            WS+  ++QVNS++++S+DIT+D++Q+EW F+Y   Q     + L S++ IQ+ RI S+ E
Sbjct: 1356 WSSTEDRQVNSLNLTSSDITIDESQMEWLFEYCSDQGNLIQEALNSFHSIQSTRISSKTE 1415

Query: 1431 LISRLTAASEYYQISHDPYVITKPAFIMRLSRGHVRENKSWKIITRLRHILTYLPKDWYL 1490
            LIS+LTAASEYYQISHDPYVITKPAFIMRLS+GHVREN+SWKIITRLRHILTYLP DW  
Sbjct: 1416 LISKLTAASEYYQISHDPYVITKPAFIMRLSKGHVRENRSWKIITRLRHILTYLPDDWQD 1475

Query: 1491 NVGQPLRDRKFDPSQDARSIFMSIFSNWRSWEFSDVARSYIYGKLFLNDHAEXXXXXXXX 1550
            N+ + L++RK+  ++DA++IFMS+FS WR+WEFSDVARSYIYGKLF  D+AE        
Sbjct: 1476 NIEKVLKERKYTSAKDAKNIFMSVFSTWRNWEFSDVARSYIYGKLFSVDNAEHKQNLMKK 1535

Query: 1551 XXXXNIGNFFMTVYSTNYDVDHSIVVSNAKLLLELTPSSTEPKENSLQREELIDISGTVD 1610
                 +G+F++TVY   Y+V+H+ V+++A L+++LTP  T     SL REE I+I+G V 
Sbjct: 1536 LLKCTMGSFYLTVYGEGYEVEHNFVIADANLVVDLTPPVTSL---SLNREETIEITGRVG 1592

Query: 1611 VIXXXXXXXXXXXXXXIPILTE--GSEKQPVKPPQDTIPKPFKMNAAFMVNSCDIQLVMD 1668
             +              IP++    G +K   K     + K FKMN   +V+  +IQLVMD
Sbjct: 1593 SVKGKFSDRLLKLQDLIPLVAAVGGGDKSDAKA---ELSKQFKMNTVLLVDKSEIQLVMD 1649

Query: 1669 ATKLNMNVNDGRISVLWENLQDSTAQAGSVVLFSKHTELVLKHINSVLAEGRVSNFYATF 1728
             TKL      GR+S+LWENL+DST+QAGS+V+FS+ +E+ LKH + +L E ++ +F    
Sbjct: 1650 QTKLMSRTVGGRVSLLWENLKDSTSQAGSLVIFSQKSEVWLKHASIILCEAQLRDFSILA 1709

Query: 1729 TTDTWAQRPTYLIHSKSSSIHFRTMAKTERLVEAIKDIKLKIDQISEQLELERRLTQHPT 1788
            TT+ W+ +PT LI+++ + +HFR M+ TE+ V  I +I+  + +I ++++ + +  +   
Sbjct: 1710 TTEAWSHKPTILINNQCADLHFRAMSTTEQTVTVITEIRESVLKIKDRIKFKPKSKKRSQ 1769

Query: 1789 VYDPNKSNVIASCLFSNVSMDIMPVSPFALKNSAKQIDFFYNKFDSDSWLIKLKDTDFFL 1848
               P K N++ SC FSNVS +IMP+SPF +++ AKQ+D ++NKF S+  L+ + DTDFF+
Sbjct: 1770 FVGP-KINIVLSCYFSNVSSEIMPLSPFYIRHEAKQLDIYFNKFGSNEVLLSIWDTDFFM 1828

Query: 1849 TSDQTKEQYMRLSMKKLQIRVNVSSSKPKLVDINLSTNLVKLTFSEPKNIVYSFLKDERV 1908
            TS QTKEQY+R S   ++I+  +S     L+++++S +++KLTFSEP+ IV SFL+DE++
Sbjct: 1829 TSHQTKEQYLRFSFGDIEIKGGISKEDYSLINVDISISMIKLTFSEPRRIVNSFLQDEKL 1888

Query: 1909 ASESVHLLQTLKPLFSISDDKESTPQSYQEKTEYLWSLDSSIDYFGILIPMTSTYYVMEF 1968
            AS+ ++LL +LK L   S   +   +    +    W+LD+SI YFGIL+P+ STY+V E 
Sbjct: 1889 ASQGINLLSSLKSLLFTSGLPKKKKKKAPARM-INWTLDTSITYFGILVPVASTYFVFEL 1947

Query: 1969 HSYVSSISNA-NGAPSGNLDITGHMSVENILFLIKESSLPDGLSKVIDIAVNVSTLQRVD 2027
            H  + S++N  NG       +TG  S+ENILFLIKE SLP GLSK++D ++ VSTLQR  
Sbjct: 1948 HMLLLSLTNTNNGMLPEEAKVTGQFSIENILFLIKERSLPIGLSKLLDFSIKVSTLQRTV 2007

Query: 2028 DNSRSIQVESSHARICLSPDSLLRLLWGFNQGHKLSEHYLKYHSKSLW--QSFAKSDDKQ 2085
            D  +S QVESSH R+CLSPDSLLRL+WG ++   L  +Y + H+ ++W  + F    DK 
Sbjct: 2008 DTEQSFQVESSHFRVCLSPDSLLRLMWGAHKLLDLGHYYSRRHAPNIWDIKMFTGKSDKP 2067

Query: 2086 QDTNSIKSNETSFFSSINSIHFLSYNLCVGWLFEYELGPPKGLITGYSRLFSAYENCMGK 2145
            ++   I  N         SIH LSY  C+GWLF+Y  G   GL+ GY+RLFSAYE   GK
Sbjct: 2068 KE---IPIN-------FRSIHILSYKFCIGWLFQYGAGSDPGLMLGYNRLFSAYEKDFGK 2117

Query: 2146 LTVIDSYFAAAQGNTSSTFYPETNVKELFNRFYLPNMQILFWWKVIEGMKDVYVRFTGET 2205
             TV+D++F+ A GN SSTF+ E N K+ +NR +LPNMQI +W+K    +KD + RF GE 
Sbjct: 2118 FTVVDAFFSVANGNKSSTFFSEGNEKDKYNRSFLPNMQISYWFKRCGELKDWFFRFHGEA 2177

Query: 2206 LDVKYLSDFMLTIESTLHSIKMFQKLKKELIVETPKREVVHIKEDKPXXXXXXXXXXXX- 2264
            LDV ++  FM  I+STL S++ FQ+LKK ++      E  H+++D P             
Sbjct: 2178 LDVNFVPSFMDVIDSTLQSVRAFQELKKNIL---DVSEDSHMEDDNPYATSSMESASNSL 2234

Query: 2265 --------XXXCHFKYDGGTYSVFNISDGSLNPTPAIEIKSPVISVDVLYKHEKQNTKHH 2316
                        +FKYDGG + V+   D      P+ EIKSPV++++  YKH +   K H
Sbjct: 2235 APFLDNIRSVNSNFKYDGGVFRVYTYDDIEAKSEPSFEIKSPVVTINCTYKHNENEAKPH 2294

Query: 2317 SIRCLVNIDPTHNVLYATCAPLVKNFVEDVRSIFGRYESENKHSETTPTSVQNIDYEKLL 2376
             IR L+ +DPT N LYA CAPL+  F E ++ +  ++ +++K S T P+S QN+DY++LL
Sbjct: 2295 RIRILIAVDPTLNTLYAGCAPLLMEFSESLQKMIKKHSTDDKPSFTKPSS-QNVDYKRLL 2353

Query: 2377 EDYDLAITVTSAKQQLSLSCEPKAKVQADVGFEALTVSMTTNPFDIDEPLAFSFSIKDTK 2436
            + +D+A+ +TSAKQQLSLSCEPKAKVQADVGFE+   SMTTN FD ++PL FS +++ TK
Sbjct: 2354 DQFDVAVKLTSAKQQLSLSCEPKAKVQADVGFESFLFSMTTNEFDSEQPLEFSLTLQQTK 2413

Query: 2437 ASIKHLFSRETSTSFGVGYLDLTLLFTHTNRINTYGTSLISDIDLYFNVKQLQNLYLFLD 2496
            ASI+H+FSRE STSF VG++DLTLLFTH + I+ YGTSL+SD+ ++FNVKQLQNLYLFLD
Sbjct: 2414 ASIRHIFSREVSTSFEVGFMDLTLLFTHPDVISMYGTSLVSDLSVFFNVKQLQNLYLFLD 2473

Query: 2497 IWQLSELLN--PVTSSQEQVIRKDKKKSVDKPIHNESQLPWCFTLIFTNVKGDIDLGPSL 2554
            IW+ S +L+  PV  S  + I      S +  +   +++PWCFTLIFTNV GD+DLGPSL
Sbjct: 2474 IWRFSSILHTRPVQGSISKEIDMSSLTSTNY-VDVGAEIPWCFTLIFTNVSGDVDLGPSL 2532

Query: 2555 GLISLRLSRTWLATDHFSGKRQILHAFVDDLLLISEGRLSGVVNIDGASWVSEVIWLQDS 2614
            G+ISLR  RTWLATDH+S KRQ+LHAF D + L SEGRLSG+  +  ASW+SEV W  + 
Sbjct: 2533 GVISLRTQRTWLATDHYSEKRQLLHAFTDGVSLTSEGRLSGLFEVANASWISEVKWSLEK 2592

Query: 2615 KRDNIPLVALSLNTDKIEIKAAFDYHMFLIGTVNNILFQLHSERDMVGVAPDLLKVSFSC 2674
             +++ PLV+ SLN D + +KAAFDYHMFLIGT+NNI FQLH+E+D  G+ PDLL+VSFS 
Sbjct: 2593 SKNSHPLVSTSLNIDDVAVKAAFDYHMFLIGTINNIQFQLHNEKDAKGILPDLLQVSFSS 2652

Query: 2675 EEIKLCSTALVAANILDIYNTIIRMRQDTKISYIETLKDSNMETNKQTLAYRDILKSLQL 2734
            +EI L STALVAANILDIYNTI+RMRQD KISY+ETL+DSN   +KQ + Y+DIL+SL+L
Sbjct: 2653 DEITLSSTALVAANILDIYNTIVRMRQDNKISYMETLRDSNPGESKQPILYKDILRSLKL 2712

Query: 2735 LRTDLTVSICSLQLQISPISLFDXXXXXXXXXXXSARSETHSEAKLTTSLNMEVYDATLS 2794
            LRTDL+++I SL++QISPISLFD           S RSETHS  KL T L ++V D + +
Sbjct: 2713 LRTDLSLNISSLKVQISPISLFDVEVLVVRIKNVSIRSETHSGKKLKTDLQLQVLDVSAA 2772

Query: 2795 LSTAKQELDEDALSKITVADYMTYASKIRGGTIIEIPRMGVQMTTWQEEKSDILEYLYSC 2854
            LST+K+ELDE+  + I + DY+ YASKI GGTII+IP++ V MTT QEEK++ +EYL++C
Sbjct: 2773 LSTSKEELDEEIGASIAIDDYIHYASKIVGGTIIDIPKLAVHMTTLQEEKTNNIEYLFAC 2832

Query: 2855 KFHDKVAVRWNLGPVNFMKEMWTTHVKAIAVRRSQVLTGSFNVSEKDVEKRIKEEENITK 2914
             F DK++V+WNLGPVNF+KEMWTTHVKA+AVR+SQ+   SF  +E+++E+ IK +E  +K
Sbjct: 2833 SFSDKISVKWNLGPVNFIKEMWTTHVKALAVRQSQIANVSFGQTEEELEESIKTKETTSK 2892

Query: 2915 LNYVPVEEPQIDMPQIKDLGDATPPVEWFGVNRKRFPAFTHQTAVVPVQNLVYLAQKQYA 2974
             NY+ +EEPQI +PQI+DLGDATPP+EWFGVNRKRFP FTHQTAV+PVQ LVYLA+KQY 
Sbjct: 2893 FNYIALEEPQIQVPQIRDLGDATPPMEWFGVNRKRFPKFTHQTAVIPVQKLVYLAEKQYV 2952

Query: 2975 KTL 2977
            K L
Sbjct: 2953 KIL 2955

>NCAS0B05010 Chr2 complement(922165..931023) [8859 bp, 2952 aa] {ON}
            Anc_8.260 YLR087C
          Length = 2952

 Score = 3037 bits (7874), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1498/2984 (50%), Positives = 2048/2984 (68%), Gaps = 51/2984 (1%)

Query: 10   FRGESLGFKRNFSWVFLVDWILTVILTLATLFYLSRAFAYGVTFILEWLLWKQAKVKVSI 69
            F+G  L  +RNFSW+FLV WILTVIL+L+ +FYL R  AY +TFILEWLLWK AKVKV+I
Sbjct: 7    FQGVPLTRQRNFSWIFLVTWILTVILSLSFIFYLGRTIAYIITFILEWLLWKHAKVKVNI 66

Query: 70   GALRISLLAGRVFFKNLTIIDKDRTITILEGSITWRYWLIRTRKSEYRVAQMAHASAGSS 129
             +LRISLL GR+FFKN+TII KD TI+ILEG+ITWRYWL  TRK E++ A +       +
Sbjct: 67   QSLRISLLGGRIFFKNVTIIHKDSTISILEGNITWRYWLFNTRKPEFQEASVDETQTKPT 126

Query: 130  GNSEDDTKFDIANYMEKQLKLPCRFLFECEGFEMFIYNRTYAYDNIVNVLSKVEREKFEK 189
                      I N+     +LPCRF+   EG E+F+YN+T AYDNI+ + SK ER +FEK
Sbjct: 127  S---------IKNW-----QLPCRFVVNLEGLEIFLYNKTVAYDNIIQMFSKEERFQFEK 172

Query: 190  FMAENDFLDPSSDGSSDDKIEETSSATNSTDEETIA-NDRTFQNDTRKTLPRYLEALPIE 248
            F+ E    D ++  S DD   +TS +T++   E+ A NDR FQ +   T   +L  LPI+
Sbjct: 173  FLNEQILSDSATVKSMDDSQFDTSESTSTDKSESSATNDRVFQEEETDT-SSFLRFLPIQ 231

Query: 249  ALLNKGSILIGNKFTPCVLILSFESAVALQDVGEAPSKLDLYRMKYEVRLKNLEIMMKQN 308
             L+ +GS+++GNKFTP +LI+S +SA AL D  +   KLDLY+ K    L N E  +KQN
Sbjct: 232  FLVTRGSLILGNKFTPSLLIVSADSADALMDFAQPKEKLDLYKFKLSAELINTEATLKQN 291

Query: 309  IDYDNEKSRNFEFDKGKLSRLWHRFTRIFKLVPFPFK---SNRRKEQPHDNFMQKWKGLS 365
            I +D + S  F+ D+GK+S +W+ FTR+  ++  P +    +RRK +  D F  KW+GL+
Sbjct: 292  IGFDEDVSMKFKLDRGKVSEVWNHFTRMLGILYKPLRFTHMHRRKNEHEDKFQAKWRGLA 351

Query: 366  MYRNDMFGXXXXXXXXXXXX-SSHEYAKFTSLLKSPRVTIHHDYDMPGWVPHGAHPPSSY 424
            +Y+    G             ++HEYAKF+S+LKSP+VT    +DMPG VPHGAHP  S 
Sbjct: 352  LYKGTGLGERRNDIDDIEFDFANHEYAKFSSILKSPKVTFTSQHDMPGIVPHGAHPTISV 411

Query: 425  ADGPDVGNNMAPPQYIFEINIFGGTVCYGPWAQRQTNHLQSLLSPSVSRTAKPIKKLKPG 484
             DGPDVGN+ APP Y  +I IFGG+VC+GPWAQRQ +HL  LLSP VSRTAKP+K+L PG
Sbjct: 412  LDGPDVGNSGAPPDYSLDIQIFGGSVCFGPWAQRQADHLWKLLSPVVSRTAKPVKRLTPG 471

Query: 485  SKRIYTVLKLTINAMEDVTWRIPTRESSKDVEFLMHYKETNDDYRPFGWIDIKVSRDSCG 544
             +RIYT  ++ +  M+D TWRIPTRESSKD EFL HY+ETN +YRPFGWID+K S+++  
Sbjct: 472  CRRIYTYGQVLVTIMDDATWRIPTRESSKDFEFLQHYRETNGEYRPFGWIDLKFSKETTV 531

Query: 545  IFDLAMCPTSKGFKNTIDVQLVDTEIRSSVNHDIFLKSKSFSFNCDIGYPLGWNAEANWT 604
                A+CPT  GFKN I + L + E RSSVNHDI LK K F F+ D  +PLGWN EA WT
Sbjct: 532  NTTFALCPTVDGFKNNIKIHLTENETRSSVNHDILLKCKYFDFDIDTSFPLGWNDEATWT 591

Query: 605  IIMDSNQLELFLLREHVTLIADTLTDFSSGEPVPYELFRPFVYHIKWNMKGYSFYLNVND 664
            I ++S+Q+E F+LREH+TLIADTLTDFSSGEP PYELFRPF+Y I W + GYS YLNVND
Sbjct: 592  INLNSSQMEAFILREHITLIADTLTDFSSGEPTPYELFRPFIYSINWKIDGYSLYLNVND 651

Query: 665  HNIVNNPLDFNENCYLSIHGDDLTMNVMVPKKTITSRFTNMTYDIYTPMFRXXXXXXXXX 724
            HNIVNNPLDFNENCYLS HGD+L+++ ++PK +IT+R T+++Y I TPMFR         
Sbjct: 652  HNIVNNPLDFNENCYLSFHGDELSLDFLIPKTSITARHTDISYTIKTPMFRLLLNTPPWN 711

Query: 725  XXXEFMRNKEVGRSHDFRLKGSYLIYSELDIDNVDTLTVECSSRGTALHIYGFVIRYLIN 784
               EFM++KEVGRS+DF++ GSYLIYS+LDIDNVDT+ ++C+S+GT L  YGFV+RYLIN
Sbjct: 712  TLNEFMKHKEVGRSYDFKVVGSYLIYSDLDIDNVDTIMMDCTSKGTTLQCYGFVVRYLIN 771

Query: 785  VKMNYFGEFFHFVTSEEYTGNTRPTDLENIISEDRRDDDFSSYESVSRISSNSSDXXXXX 844
            VKMNYFG+FFHFVTSEEYTG  R  + +    +   + D       S  +   +D     
Sbjct: 772  VKMNYFGDFFHFVTSEEYTGAIRANEDD---MQYASESDDDRSSISSFDTMQGNDAPGRR 828

Query: 845  XXXXXXXXXXXXRTSNETDIWFTFSVWDGALILPETIYNADPCIALHFAELIVDLRSCNY 904
                        RT+NETD+WFTF+VW+GAL+LPETIYN DPC+ LHF EL++DLRSCNY
Sbjct: 829  RLHTELQRSDLKRTTNETDLWFTFTVWEGALLLPETIYNCDPCVGLHFGELVIDLRSCNY 888

Query: 905  YMDILATACDINLKRYVGKRADEIYEYVHLNNGKDHEVHGTLSDIYIHGHRMYGLPPTEP 964
            YMD+LA   D+++KRYV K   EI+E +H NNG+++  HG+LS + IHGHRMYGLPP EP
Sbjct: 889  YMDLLANMNDVSIKRYVSKHPHEIFEAIHKNNGEEYHTHGSLSSLTIHGHRMYGLPPMEP 948

Query: 965  TYFCQWDMDFGHLNIDSNMFFLQGLFGAFYKIGFGYKDLENILLYETEIIDDMTSLTIFI 1024
            TYFCQWD D G L+I S++ FL+G F +F +IGFGY DLENILLYE E  DDMTS+T+ +
Sbjct: 949  TYFCQWDFDLGTLDIASDIEFLRGFFSSFTRIGFGYVDLENILLYEKETYDDMTSVTVNL 1008

Query: 1025 NTIDIRLNDVDTTAHADLKLERFCFTLIDFENERYSKRMDIKIPSLEFNIFSNEDNDLS- 1083
              + + L +     +A   L    FT IDFENE+YS R+D+ IP+LEF++F  E++  + 
Sbjct: 1009 EKLSVMLQEPKLNMYASFDLNNLYFTFIDFENEKYSTRLDLIIPTLEFSLFIKEEDGTTK 1068

Query: 1084 -LLNFKVDMNFTNFVQNQDFNKHRKIQRDYIVLNDAPYHRCAFLLPESYQKSRIYNELFG 1142
             L   +  +  TNFVQ+QDF++HRK QR+YI L+DAPYHRC+F+LP+ YQ +  Y ELFG
Sbjct: 1069 KLFTLETKVKITNFVQSQDFDEHRKTQREYIKLHDAPYHRCSFILPQEYQDAEQYQELFG 1128

Query: 1143 XXXXXXXXXXXXXXXTADTIEYVLEDLLEDYMGLFEGNYDIKESSVENLELSAIEATRAI 1202
                              T ++++EDLL ++  L E +   +    +    + +      
Sbjct: 1129 AIAPSSSLPPLPVPLIPSTTDFIIEDLLGEFQDLLETSSPFRMPFSDQDYATDVSDDETE 1188

Query: 1203 TGIGAERTHSNPITLSDYAVESDNYVVKVESIVIDINPALYTTIEKLLKHIYDQDAVQII 1262
              I     ++    + +   E D++++ V  I I+I P +  +I   L     ++ VQII
Sbjct: 1189 EDIDPLEFNTPSEAIQNDKCERDSFIIDVSFISIEICPDILDSIGTFLMLFSTENIVQII 1248

Query: 1263 DGIEIGIVKRLSSIHDGVTTMTNVKVQIKHFNLFWGEKESDNVSMFFDKMDFALTEKTLE 1322
            D IEI  V RLS++ +G   +TNVK+ I + +LFWG +    V ++ D++DFA+ EKT+E
Sbjct: 1249 DDIEIATVNRLSNLREGAFKLTNVKINILYLDLFWGSRTDTGVGIYLDRIDFAMCEKTVE 1308

Query: 1323 QNSEKNLLEMTVLAKIKAVRLTVVQQPGLIPTQERPPAITVGVEGFEFWSTAIEKQVNSI 1382
            +N EK L+E+TVL KI++VR TV Q       +ERPPA+++ +EG+E WS+ +E QVNS+
Sbjct: 1309 ENKEKKLIELTVLNKIRSVRGTVNQTAANSKNEERPPALSLVIEGWEIWSSTVEDQVNSL 1368

Query: 1383 SVSSADITVDDAQVEWFFKYIVRQKYFFLDMLQSYNRIQNNRIESQKELISRLTAASEYY 1442
            ++ S DITVD+AQ+EW F Y   Q     DM+++ + IQ  +IES+KELIS LTAASEYY
Sbjct: 1369 NILSTDITVDEAQLEWLFGYFDNQGLQIQDMIKTSDTIQKRKIESRKELISSLTAASEYY 1428

Query: 1443 QISHDPYVITKPAFIMRLSRGHVRENKSWKIITRLRHILTYLPKDWYLNVGQPLRDRKFD 1502
            QISHDPYVITKPAFI RLSRGHVREN+SWKIITRLRHILTYLP+DW+  + + L   K  
Sbjct: 1429 QISHDPYVITKPAFITRLSRGHVRENRSWKIITRLRHILTYLPEDWHSTINRSLTQSKTA 1488

Query: 1503 PS-QDARSIFMSIFSNWRSWEFSDVARSYIYGKLFLNDHAEXXXXXXXXXXXXNIGNFFM 1561
             + QDA+ IF+S+FSNWR+WEFSD+ARSYIY KLFLN H+              I +FF+
Sbjct: 1489 ATTQDAKGIFISVFSNWRNWEFSDIARSYIYRKLFLNQHSNQEIHTTKKSITIKIASFFV 1548

Query: 1562 TVYSTNYDVDHSIVVSNAKLLLELTPSSTEPKENSLQREELIDISGTVDVIXXXXXXXXX 1621
            TVYS  Y+V+H+ +++   LLLE   +++   ++SL RE + +I+GT+            
Sbjct: 1549 TVYSAGYEVEHNFIITRTNLLLE---TNSPTSDSSLSRETIFNITGTLGTAKGKLSDKII 1605

Query: 1622 XXXXXIPIL--TEGSEKQPVKPPQDTIPKPFKMNAAFMVNSCDIQLVMDATKLNMNVNDG 1679
                 +P L  T+G +    K   D + K FK+N   +    ++Q+ +  T+L   V   
Sbjct: 1606 MIKNLLPSLKITDGGKS---KETFDFV-KSFKLNTLILCERGELQIDIGNTRLVSRVFGA 1661

Query: 1680 RISVLWENLQDSTAQAGSVVLFSKHTELVLKHINSVLAEGRVSNFYATFTTDTWAQRPTY 1739
            R+S+LWE+ +D T+QA S+ ++++  E+ LKHIN+ LAE ++ +F    TT++W+ +PT 
Sbjct: 1662 RLSMLWESPKDLTSQAVSLAVYTQRAEIHLKHINATLAEIQIRDFSLIVTTESWSYKPTI 1721

Query: 1740 LIHSKSSSIHFRTMAKTERLVEAIKDIKLKIDQISEQLELERRLTQHPTV--YDPN-KSN 1796
            L++S+ S +H   M  T+ LV +IK+I   I +I + L    R  +   V  + P  K N
Sbjct: 1722 LVNSQCSDLHLMAMTATDILVASIKEIMENIHRIEQDLLAGTRAEKITKVESHGPKPKVN 1781

Query: 1797 VIASCLFSNVSMDIMPVSPFALKNSAKQIDFFYNKFDSDSWLIKLKDTDFFLTSDQTKEQ 1856
             I +C F+N+S ++MP+SPF +++ AKQ+D ++N+F S+  L+ + D D +LTS  TK+Q
Sbjct: 1782 TILTCFFTNISFELMPISPFFIRHEAKQLDIYFNRFGSNEILLSVWDADIYLTSHLTKQQ 1841

Query: 1857 YMRLSMKKLQIRVNVSSSKPKLVDINLSTNLVKLTFSEPKNIVYSFLKDERVASESVHLL 1916
            Y R S   LQ++ N+ +  P  +++ LS +++KLT S+ + ++ SFL+DE++ +ES+   
Sbjct: 1842 YFRFSFGDLQLKGNMVND-PYHINLYLSASILKLTVSDVQKLIPSFLQDEKILTESIEDF 1900

Query: 1917 QTLKPLFSISDDKESTPQSYQEKTEYLWSLDSSIDYFGILIPMTSTYYVMEFHSYVSSIS 1976
             TL  LF +S +++S P+  ++  ++ WS+D++I+YFG+L P+ S Y++ E    ++S++
Sbjct: 1901 ITLD-LFGLSKNQKSKPE--KDNNKFSWSIDTNINYFGLLAPIGSAYFLFELRMLLASLT 1957

Query: 1977 NANGAPSGNLDITGHMSVENILFLIKESSLPDGLSKVIDIAVNVSTLQRVDDNSRSIQVE 2036
                      DI+G  SVEN+LF IKE +LP  LSK++D ++ VS LQ+  + S + Q+E
Sbjct: 1958 KMGSDIPNQSDISGQFSVENVLFFIKERALPVRLSKLLDFSIKVSALQKKKNTSNTYQIE 2017

Query: 2037 SSHARICLSPDSLLRLLWGFNQGHKLSEHYLKYHSKSLWQSFAKSDDKQQDTNSIKSNET 2096
            SSH R+CLSP+SL+RLLW  NQ     ++Y  +H  + W      D + +  N  K+ + 
Sbjct: 2018 SSHFRVCLSPESLVRLLWATNQVSTSIQYYKDHHVDNKW------DLRSKLNNIPKAPDL 2071

Query: 2097 SFFSSINSIHFLSYNLCVGWLFEYELGPPKGLITGYSRLFSAYENCMGKLTVIDSYFAAA 2156
                ++ S H LSYN CVGWLF  +     GLI GY+RLFSAYE  +GKLT++D +F+ A
Sbjct: 2072 PL--NVPSFHILSYNFCVGWLFSVDSKSEPGLILGYNRLFSAYEKNLGKLTLVDVFFSIA 2129

Query: 2157 QGNTSSTFYPETNVKELFNRFYLPNMQILFWWKVIEGMKDVYVRFTGETLDVKYLSDFML 2216
             GN+S  F+ E   K+ +NR YLPNMQI +W+K    M+D++VRF GE LDV +LS ++ 
Sbjct: 2130 NGNSSDNFFSEGKEKDKYNRSYLPNMQISYWFKDAGTMRDLFVRFHGEALDVTFLSSYLD 2189

Query: 2217 TIESTLHSIKMFQKLKKELIVETPKREVVHIKEDKPXXXXXXXXXXXXXXXCHFKYDGGT 2276
             IES L S++ FQ+LKK+LI   PK++ V+  +                  C FKYDGG 
Sbjct: 2190 VIESALTSVQTFQELKKDLIPGLPKKQKVNDDKTLELNTLSPFLANIRSISCQFKYDGGV 2249

Query: 2277 YSVFNISDGSLNPTPAIEIKSPVISVDVLYKHEKQNTKHHSIRCLVNIDPTHNVLYATCA 2336
            + +F++ D      P+ E+ SP + +D+ YKH +  TK H IR L+ I+ THN+LYA CA
Sbjct: 2250 FKIFSLEDAETQSEPSFEVNSPNVVIDLNYKHLENRTKQHWIRSLIKINSTHNILYAKCA 2309

Query: 2337 PLVKNFVEDVRSIFGRYESENKHSETTPTSVQNIDYEKLLEDYDLAITVTSAKQQLSLSC 2396
            PL+ +F E ++ +  ++ S  + + + P+S QN+DY++LL+ +D+A+ +TSAKQQLSLSC
Sbjct: 2310 PLLSDFFERIQGMVKKHSSSEESTLSKPSS-QNLDYKRLLDSFDIALKITSAKQQLSLSC 2368

Query: 2397 EPKAKVQADVGFEALTVSMTTNPFDIDEPLAFSFSIKDTKASIKHLFSRETSTSFGVGYL 2456
            EPKAKVQAD+GF++   ++TTN  D  EPL+FS S++ T+ASIKH+FSRETSTS GV ++
Sbjct: 2369 EPKAKVQADIGFQSFIFTVTTNDLDAAEPLSFSLSVEKTEASIKHIFSRETSTSIGVDFV 2428

Query: 2457 DLTLLFTHTNRINTYGTSLISDIDLYFNVKQLQNLYLFLDIWQLSELLNPVTSSQEQVIR 2516
            D+TL+FTH + IN +GT+LIS+I+L+FNVKQLQNLYLFLDIW+LS+LL    ++     +
Sbjct: 2429 DVTLMFTHPDVINVHGTALISNINLFFNVKQLQNLYLFLDIWRLSDLLKSKPANDIVKAK 2488

Query: 2517 KDKKKSVDKPIHNESQLPWCFTLIFTNVKGDIDLGPSLGLISLRLSRTWLATDHFSGKRQ 2576
             D   S+ +    ES +PWCFTLIFTNVKGD+DLGPSLG+IS++L RTW ATDH+   R+
Sbjct: 2489 TDSSLSIAQLSDPESIIPWCFTLIFTNVKGDVDLGPSLGVISVQLKRTWFATDHYKNMRK 2548

Query: 2577 ILHAFVDDLLLISEGRLSGVVNIDGASWVSEVIWLQDSKRDNIPLVALSLNTDKIEIKAA 2636
            +LHAF D   L S+GRLSG+  + GASW+SEV W  D+  +  PLV++++N D+I  KAA
Sbjct: 2549 VLHAFTDGTSLSSKGRLSGIFELKGASWISEVNWPTDTTINAHPLVSITMNIDEISTKAA 2608

Query: 2637 FDYHMFLIGTVNNILFQLHSERDMVGVAPDLLKVSFSCEEIKLCSTALVAANILDIYNTI 2696
            FDYHMFLIG +NN    LHSE+D+ GV PDLLKV+F CE I LCSTALVAANILDIYNT 
Sbjct: 2609 FDYHMFLIGAINNTRVHLHSEKDVNGVMPDLLKVTFLCESITLCSTALVAANILDIYNTA 2668

Query: 2697 IRMRQDTKISYIETLKDSNMETNKQTLAYRDILKSLQLLRTDLTVSICSLQLQISPISLF 2756
            +RMRQD KISYIETL++SN   +K  + Y DIL+SL LL+TD++V I +L +QISPI+LF
Sbjct: 2669 MRMRQDNKISYIETLRESNEAESKPPINYTDILRSLNLLQTDVSVDIYTLNIQISPITLF 2728

Query: 2757 DXXXXXXXXXXXSARSETHSEAKLTTSLNMEVYDATLSLSTAKQELDEDALSKITVADYM 2816
            D           SARSETHS  KL T L M+VYDA++SLST+K+E+DE  +SKI+V +Y+
Sbjct: 2729 DVEVLVITIESISARSETHSGKKLMTELEMQVYDASVSLSTSKEEMDEATVSKISVKNYL 2788

Query: 2817 TYASKIRGGTIIEIPRMGVQMTTWQEEKSDILEYLYSCKFHDKVAVRWNLGPVNFMKEMW 2876
             YASKI GGTIIEIP++ V MTT+QEEKSDILEYLY+C F DK++VRWNLGP+NF+KEMW
Sbjct: 2789 QYASKIVGGTIIEIPKLLVSMTTFQEEKSDILEYLYTCVFDDKLSVRWNLGPINFIKEMW 2848

Query: 2877 TTHVKAIAVRRSQVLTGSFNVSEKDVEKRIKEEENITKLNYVPVEEPQIDMPQIKDLGDA 2936
            TTH++AIAVRRSQV+      SE+DVEKRIKEEEN ++  YV +E P+IDMPQI+DLGDA
Sbjct: 2849 TTHIRAIAVRRSQVVGVLDGQSEEDVEKRIKEEENFSRFKYVALEPPRIDMPQIRDLGDA 2908

Query: 2937 TPPVEWFGVNRKRFPAFTHQTAVVPVQNLVYLAQKQYAKTLGRS 2980
            TPP+EWFGVNRKRFPAFTHQTAV  VQ LVY A+++YA  LG S
Sbjct: 2909 TPPMEWFGVNRKRFPAFTHQTAVFLVQKLVYSAEREYANILGSS 2952

>KAFR0B02720 Chr2 complement(549702..558650) [8949 bp, 2982 aa] {ON}
            Anc_8.260 YLR087C
          Length = 2982

 Score = 2902 bits (7524), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1446/3036 (47%), Positives = 2010/3036 (66%), Gaps = 118/3036 (3%)

Query: 6    SSAGFRGESLGFKRNFSWVFLVDWILTVILTLATLFYLSRAFAYGVTFILEWLLWKQAKV 65
            SS+ F+   +   +NFSWVFL+DWIL V+L L+ +FY+ RA AY  + ILEWLLWK+A +
Sbjct: 3    SSSEFQSVPISGGKNFSWVFLLDWILLVVLCLSVIFYVGRAIAYITSLILEWLLWKRAHI 62

Query: 66   KVSIGALRISLLAGRVFFKNLTIIDKDRTITILEGSITWRYWLIRTRKSEYRVAQMAHAS 125
            KV+I +LRISLL GR+FFKN+TII KD TI++L+G++TWRYWL++TRK  Y +      S
Sbjct: 63   KVNIESLRISLLGGRIFFKNVTIIHKDYTISLLQGTLTWRYWLLKTRKPSYHLE-----S 117

Query: 126  AGSSGNSEDDTKFDIANYMEKQLKLPCRFLFECEGFEMFIYNRTYAYDNIVNVLSKVERE 185
              S+G +           M+K  +LPCRF+  CEG E+F+YNRT++YDNI+N+ SK ER 
Sbjct: 118  KDSNGVT-----------MKKNEQLPCRFVLHCEGAEIFVYNRTWSYDNIINLFSKEERI 166

Query: 186  KFEKFMAENDFLDPSSDGS-----SDDKIEETSSATNSTDEETIA------------NDR 228
            KF+KF+ E  F D SS  S     ++    E++S T   DE+ +             NDR
Sbjct: 167  KFQKFLDEQIFNDHSSYSSKTTNGANSSTGESNSDTKLNDEDFVESGYSSQSTYNQNNDR 226

Query: 229  TFQNDTRKTLPRYLEALPIEALLNKGSILIGNKFTPCVLILSFESAVALQDVGEAPSKLD 288
             F          +L+  P+E  +++ S+  GNKFTP ++I+S E    + D  +   KLD
Sbjct: 227  IFDQAKSDKDSLFLQTFPVEIEVHRASLAFGNKFTPSLVIISSEHGTGIIDYCQPKEKLD 286

Query: 289  LYRMKYEVRLKNLEIMMKQNIDYDNEKSRNFEFDKGKLSRLWHRFTRIFKLVPFPFKSNR 348
            LY+MK  +   N  + +K NI Y  E    F+ D+GKLSRLW RFT I  ++  P    +
Sbjct: 287  LYKMKLAIETHNFAVTVKPNIGYKEEMLLKFKIDRGKLSRLWKRFTPITGIITRPLGLTQ 346

Query: 349  RKE---QPHDNFMQKWKGLSMYRNDMF-GXXXXXXXXXXXXSSHEYAKFTSLLKSPRVTI 404
            RK+   +P D F+QKW+GLS+Y+  +F               +HEYAKF+S++K P+   
Sbjct: 347  RKKKRNEPPDLFIQKWQGLSLYKGTIFEPTTDDLDDIQFDFLNHEYAKFSSVVKCPKAIF 406

Query: 405  HHDYDMPGWVPHGAHPPSSYADGPDVGNNMAPPQYIFEINIFGGTVCYGPWAQRQTNHLQ 464
             ++YD+PG VPHGAHP +S  DGPDVGNN APP +  +I IFGG++CYGPW QRQ N + 
Sbjct: 407  TYEYDIPGCVPHGAHPTNSEIDGPDVGNNGAPPTHSLDIQIFGGSICYGPWTQRQMNFIH 466

Query: 465  SLLSPSVSRTAKPIKKLKPGSKRIYTVLKLTINAMEDVTWRIPTRESSKDVEFLMHYKET 524
            S+L+P+VSRT  P+K+  PGS RIYT  KL+I+ M+D TWRI TRE SKD  FL HYKET
Sbjct: 467  SMLAPAVSRTESPVKRRVPGSTRIYTATKLSISIMDDTTWRIATREPSKDNIFLKHYKET 526

Query: 525  NDDYRPFGWIDIKVSRDSCGIFDLAMCPTSKGFKNTIDVQLVDTEIRSSVNHDIFLKSKS 584
            NDDYRPFGWID++ S++S   F  A+ PT++GFKN I++ L   EIRSSVNHDI +K K 
Sbjct: 527  NDDYRPFGWIDLRFSKESYAYFTFALVPTTEGFKNDINIHLAQNEIRSSVNHDILMKCKF 586

Query: 585  FSFNCDIGYPLGWNAEANWTIIMDSNQLELFLLREHVTLIADTLTDFSSGEPVPYELFRP 644
            F F+ D+ YPL WN  A WTI M+SNQLE FLLREH+TLIADTLTDF+SGEP PYELFRP
Sbjct: 587  FDFDIDVSYPLVWNDRATWTIDMNSNQLETFLLREHITLIADTLTDFTSGEPTPYELFRP 646

Query: 645  FVYHIKWNMKGYSFYLNVNDHNIVNNPLDFNENCYLSIHGDDLTMNVMVPKKTITSRFTN 704
                I W M  Y  YLNVNDHNIVNNPLDFNENCYLS+HGDDL +NV +P + IT++F  
Sbjct: 647  SETFINWKMDAYFIYLNVNDHNIVNNPLDFNENCYLSLHGDDLLINVTIPSEDITAQFNE 706

Query: 705  MTYDIYTPMFRXXXXXXXXXXXXEFMRNKEVGRSHDFRLKGSYLIYSELDIDNVDTLTVE 764
            +TY+I TPMFR            EFM+ KEVGRS+DF  KGSYL+YSELD+DNVDT+++ 
Sbjct: 707  ITYNITTPMFRLLLNTPPWNTLNEFMKYKEVGRSYDFSAKGSYLLYSELDVDNVDTISII 766

Query: 765  CSSRGTALHIYGFVIRYLINVKMNYFGEFFHFVTSEEYTGNTR---------PTDLENII 815
            C SRGT L  YGFVIRYL NVKMNYFG+FF+F+TSEEYTG TR          ++L +  
Sbjct: 767  CESRGTTLQCYGFVIRYLANVKMNYFGDFFNFITSEEYTGITRDEELEEELISSNLSD-- 824

Query: 816  SEDRRD---------DDFSSYESVSRISSNSSDXXXXXXXXXXXXXXXXXRTSNETDIWF 866
            +ED  D         DD  S E   R +   SD                 RT+NETD++ 
Sbjct: 825  NEDNGDVYSDGESGMDDAISQEIPERTTLKRSD---------------LRRTANETDLFL 869

Query: 867  TFSVWDGALILPETIYNADPCIALHFAELIVDLRSCNYYMDILATACDINLKRYVGKRAD 926
            TFSVWDGA+ILPETIYN D C AL F ELI+DLRS NYYMD+LA+  D  ++RY  K   
Sbjct: 870  TFSVWDGAIILPETIYNCDNCTALKFGELIIDLRSSNYYMDLLASLEDTVMERYTEKSPI 929

Query: 927  EIYEYVHLNNGKDHEVHGTLSDIYIHGHRMYGLPPTEPTYFCQWDMDFGHLNIDSNMFFL 986
            +I++ V  +N +  E  G LSD+ IHGHRM+GLPP EPTYFC+WD D G LN++S   FL
Sbjct: 930  DIFKSVLHDNRESSEAQGFLSDLSIHGHRMFGLPPNEPTYFCKWDFDIGVLNVNSEFDFL 989

Query: 987  QGLFGAFYKIGFGYKDLENILLYETEIIDDMTSLTIFINTIDIRLNDVDTTAHADLKLER 1046
            +G   +F +IGFG+KDLENILLY  E+I+DMTSLT+    I + L +  +     LK + 
Sbjct: 990  KGFLTSFSRIGFGFKDLENILLYSKEVINDMTSLTVNAQEISVNLKNEVSGIDMALKTQH 1049

Query: 1047 FCFTLIDFENERYSKRMDIKIPSLEFNIFS--NEDNDLSLLNFKVDMNFTNFVQNQDFNK 1104
              FT IDFE+  YS R+D+ IPSL+ +++    +     L NF   ++ T+F Q ++F +
Sbjct: 1050 VNFTSIDFESANYSSRLDLIIPSLKMSMYGLDIDGKKARLFNFTTKVHLTDFAQKKNFKR 1109

Query: 1105 HRKIQRDYIVLNDAPYHRCAFLLPESYQKSRIYNELFGXXXXXXXXXXXXXXXTADTIEY 1164
            HR +QR+YI LNDA +HR +FLLP+S+QK  +YNEL+G                  T+++
Sbjct: 1110 HRSMQRNYITLNDAAFHRTSFLLPQSFQKKELYNELYGSIVPSSSLPVLALPILPKTVDF 1169

Query: 1165 VLEDLLEDYMGLFEGNYDIKESSVENLELSAIEATRAITGIGAERTHSNPITLSDYAV-- 1222
            +LED L +Y+ L +      + ++  +   +       +    E    +P+  S+  V  
Sbjct: 1170 ILEDFLGEYVSLLD------DRTIFRMPFGSTNTPNQASTHHEEDM--DPLEFSNSTVST 1221

Query: 1223 ----ESDNYVVKVESIVIDINPALYTTIEKLLKHIYDQDAVQIIDGIEIGIVKRLSSIHD 1278
                + DN V+ +E I ++INP++ T IE L   +Y+++ VQ+ID IEI  +K LS+  +
Sbjct: 1222 EKNYQCDNLVIDIEYISVEINPSISTYIESLSSTVYEENIVQVIDDIEIETIKILSTFQE 1281

Query: 1279 GVTTMTNVKVQIKHFNLFWGEKESDNVSMFFDKMDFALTEKTLEQNSEKNLLEMTVLAKI 1338
            G +++TN+K+++ + +++WGE++   + ++ DK+DF ++++ +E++ EK LLE+T+LAK 
Sbjct: 1282 GTSSITNIKLRVLYSDIYWGERDRYGIELYLDKLDFEMSQRNIEKDREKGLLEITMLAKT 1341

Query: 1339 KAVRLTVVQQPGLIPTQERPPAITVGVEGFEFWSTAIEKQVNSISVSSADITVDDAQVEW 1398
            +++R ++ ++      +ERPPA+++ VEG E WS   EKQVNSI   S DIT+D++Q+EW
Sbjct: 1342 RSIRASISEEGSTKNEKERPPALSLVVEGCELWSATAEKQVNSIDTISTDITIDESQLEW 1401

Query: 1399 FFKYIVRQKYFFLDMLQSYNRIQNNRIESQKELISRLTAASEYYQISHDPYVITKPAFIM 1458
             F ++  Q     +++ + N +Q     S+++LIS+LTAA+++YQISHDPYVITKPAFI 
Sbjct: 1402 LFLFVNEQNQNLQNIITTLNSVQAEHTVSRRKLISKLTAANDFYQISHDPYVITKPAFIT 1461

Query: 1459 RLSRGHVRENKSWKIITRLRHILTYLPKDWYLNVGQPLRDRKFDPSQDARSIFMSIFSNW 1518
            RLS+GHVREN+SWKIITRLRHILTY+P DW   V   L+++  +   +A+ +FMS+FSNW
Sbjct: 1462 RLSKGHVRENRSWKIITRLRHILTYIPSDWESGVENYLKEKSLNDQDEAKKVFMSVFSNW 1521

Query: 1519 RSWEFSDVARSYIYGKLFLNDHAEXXXXXXXXXXXXNIGNFFMTVYSTNYDVDHSIVVSN 1578
            R+WEFSDVARSYIYG+LFL + AE            N+ +FF+T Y+  YD+D + V++N
Sbjct: 1522 RNWEFSDVARSYIYGRLFLTNQAEKHKQSMRRIIKVNLSSFFLTSYTAGYDIDQNFVLTN 1581

Query: 1579 AKLLLELTPSSTEPKENSLQREELIDISGTVDVIXXXXXXXXXXXXXXIPILTEGSEKQP 1638
            A ++ E TP  TE     + RE+LI+++G++  +              IP+L +  EK  
Sbjct: 1582 ANIVFEQTPPFTEA---GVSREKLINLTGSIGSVKGNFSDELLRLKELIPLLNKEQEKME 1638

Query: 1639 VKPP--QDTIPKPFKMNAAFMVNSCDIQLVMDATKLNMNVNDGRISVLWENLQDSTAQAG 1696
              P    D IPK FK+NA  +    ++QLV+  +KL   + +G++S+L ++ +++ + AG
Sbjct: 1639 RSPSFQVDNIPKSFKLNALLLFEKTEVQLVIGESKLTNRILNGKVSLLLDHPKEAISPAG 1698

Query: 1697 SVVLFSKHTELVLKHINSVLAEGRVSNFYATFTTDTWAQRPTYLIHSKSSSIHFRTMAKT 1756
            S++L++K +E ++ H N+ L E +V +F  + T ++W+ +PT L+ ++ +  H ++MAKT
Sbjct: 1699 SIILYAKRSETLITHRNTTLVENQVRDFSLSATVESWSSKPTVLVSTQCAHFHIKSMAKT 1758

Query: 1757 ERLVEAIKDIKLKIDQISEQLELERRLTQHPTVYDPNKS----NVIASCLFSNVSMDIMP 1812
              LV ++K++   +  I +QL +  RL +      P K      +   C  SNVS +IMP
Sbjct: 1759 ATLVNSVKEMVQTVKNIDKQLSISDRLAEGEN-KSPKKKLKDVEIEVVCQLSNVSFEIMP 1817

Query: 1813 VSPFALKNSAKQIDFFYNKFDSDSWLIKLKDTDFFLTSDQTKEQYMRLSMKKLQIRVNVS 1872
            +SPF +++  K+ D  + +F S + +I + DTDFFL SD TK+QY R+S    QI  N+ 
Sbjct: 1818 ISPFYIRHETKKFDLKFKQFGSQNVMIDVWDTDFFLRSDLTKQQYFRISFGDFQITYNLI 1877

Query: 1873 SSKPKLVDINLSTNLVKLTFSEPKNIVYSFLKDERVASESVHLLQTLKPLFSISDDKEST 1932
              +  +VD N+S +++KLTFSEP  I+ SFL+DER ASES  LL+ LKP      +    
Sbjct: 1878 EGEFIIVDANVSASMIKLTFSEPNRILSSFLQDERTASESFKLLKALKPFLLPQTEGRLQ 1937

Query: 1933 PQSYQEKTEYLWSLDSSIDYFGILIPMTSTYYVMEFHSYVSSISNANGAPSGNLDIT-GH 1991
            P + +E     W LD+ I YFGIL+P+++TY+V E H+ V S+S+ +       D T   
Sbjct: 1938 PATTKEMR---WLLDTDIKYFGILVPISTTYFVFETHALVLSMSDIDTEKYTEKDETQSQ 1994

Query: 1992 MSVENILFLIKESSLPDGLSKVIDIAVNVSTLQRVDDNSRSIQVESSHARICLSPDSLLR 2051
            +S+EN++FLIK+  +P  LS+++D +++ ST+Q++ +   S QVES+H RI LSP SL+R
Sbjct: 1995 VSIENVVFLIKDRGIPSALSRMLDFSISFSTIQKMMELDTSFQVESNHFRIFLSPYSLVR 2054

Query: 2052 LLWGFNQGHKLSEHYLKYHSKSLWQSFAKSDDKQQDTNSIKSNETSFFSSINSIHFLSYN 2111
            L+WG  Q   L+ +Y +     LW      D K       K   +S   +++S H LSYN
Sbjct: 2055 LVWGGQQFLGLANYYKEQRGTDLW------DIKASKLKKEKKGSSSIGMNMSSFHVLSYN 2108

Query: 2112 LCVGWLFEYELGPPKGLITGYSRLFSAYENCMGKLTVIDSYFAAAQGNTSSTFYPETNVK 2171
             C+GW+F        G++ G+SRLFSAYE   GKLT++D++F+ A+G TS+TFYP  +  
Sbjct: 2109 FCIGWMFPEANASAPGIMLGFSRLFSAYEGGYGKLTLVDAFFSVARGATSATFYPRESEL 2168

Query: 2172 ELFNRFYLPNMQILFWWKVIEGMKDVYVRFTGETLDVKYLSDFMLTIESTLHSIKMFQKL 2231
            E  NR YLPNMQI +W K    MKDV++RF GE LDV +L+ F+  IES L S ++FQ+L
Sbjct: 2169 ESVNRSYLPNMQIAYWVKKSGLMKDVFIRFHGEALDVSFLTTFITVIESMLQSFQVFQEL 2228

Query: 2232 KKELIVETPKREVVHIKEDKPXXXXXXXXXXXXXXXCHFKYDGGTYSVFNISDGSLNPTP 2291
            K  LI   P         +                 C FKYDGG + VF+  D   +  P
Sbjct: 2229 KTSLI--QPNTSTTENNTEPKIKSLAPFLSNIKSVNCQFKYDGGVFKVFSFEDIESHLEP 2286

Query: 2292 AIEIKSPVISVDVLYKHEKQNTKHHSIRCLVNIDPTHNVLYATCAPLVKNFVEDVRSIFG 2351
            + E+K+P + +D  YKH   + K H IR LV I  THN L+A CAPL+  F+E +  +  
Sbjct: 2287 SFELKTPGVIIDFNYKHNIGSLKPHWIRALVAIGSTHNTLFAVCAPLIAEFLEHIHEMVK 2346

Query: 2352 RYESENKHSETTPTSV-----QNIDYEKLLEDYDLAITVTSAKQQLSLSCEPKAKVQADV 2406
            ++ S  KH E+  T++     QNIDY++LL+ +D+A  +TS++Q+LSLSCEPKAKVQADV
Sbjct: 2347 KHSSNTKH-ESIATNLSKAPSQNIDYKRLLDGFDIAFKLTSSEQKLSLSCEPKAKVQADV 2405

Query: 2407 GFEALTVSMTTNPFDIDEPLAFSFSIKDTKASIKHLFSRETSTSFGVGYLDLTLLFTHTN 2466
            GF++  + + TN  D  EPL FS SIK TKASIKH+FS+ETSTSFG+  +DL  +FTH +
Sbjct: 2406 GFDSFIIGIVTNNLDETEPLTFSLSIKKTKASIKHIFSKETSTSFGLDLIDLNFMFTHPD 2465

Query: 2467 RINTYGTSLISDIDLYFNVKQLQNLYLFLDIWQLSELLNPVTSSQE-QVIRKDKKKSVDK 2525
             IN YGT LIS++DLYFNVKQLQNLYLF+DIW+LS  + P    +     R++K  ++ +
Sbjct: 2466 IINMYGTGLISEVDLYFNVKQLQNLYLFIDIWKLSSFIRPGPKGKSNNGKRENKHLTLPQ 2525

Query: 2526 PIHNESQLPWCFTLIFTNVKGDIDLGPSLGLISLRLSRTWLATDHFSGKRQILHAFVDDL 2585
            P +   ++PW FTLIFTN+ G  DLGPSLG++SL+L RTW+A+DH+  KRQ++ AF D L
Sbjct: 2526 PSNLYGEIPWSFTLIFTNINGSADLGPSLGVLSLKLKRTWVASDHYQDKRQVIRAFTDYL 2585

Query: 2586 LLISEGRLSGVVNIDGASWVSEVIWLQDSKRDNIPLVALSLNTDKIEIKAAFDYHMFLIG 2645
              +S+GRLSG+  +DGASW+SEV W ++ +  N PLV +S+N D + +KAAFDYHMFLIG
Sbjct: 2586 SFVSKGRLSGIFELDGASWMSEVSWPKEKRTHNYPLVNVSVNIDNLSLKAAFDYHMFLIG 2645

Query: 2646 TVNNILFQLHSERDMVGVAPDLLKVSFSCEEIKLCSTALVAANILDIYNTIIRMRQDTKI 2705
            T++   F LHSE+D+VG  PDLLKV+F+CE I +CSTALVAANILD+YNT++RMRQD KI
Sbjct: 2646 TISTAKFSLHSEKDIVGTMPDLLKVNFTCEMINICSTALVAANILDLYNTVMRMRQDNKI 2705

Query: 2706 SYIETLKDSN-METNKQTLAYRDILKSLQLLRTDLTVSICSLQLQISPISLFDXXXXXXX 2764
             Y+ETL++S+ +ET      YRDIL+SL LL+TD++ +I  L+LQ+SPI+LFD       
Sbjct: 2706 LYLETLRESDTLETRGNPDNYRDILRSLNLLQTDVSTNIHVLKLQVSPIALFDLEVLVIN 2765

Query: 2765 XXXXSARSETHSEAKLTTSLNMEVYDATLSLSTAKQELDEDALSKITVADYMTYASKIRG 2824
                SAR+ T +  KL T L +EVYD  ++LST+K+E+DED +S I+VADYM YASKI G
Sbjct: 2766 IENISARAGTFAGEKLKTILELEVYDGYVALSTSKREIDEDTVSAISVADYMEYASKISG 2825

Query: 2825 GTIIEIPRMGVQMTTWQEEKSDILEYLYSCKFHDKVAVRWNLGPVNFMKEMWTTHVKAIA 2884
            GTIIE+P++ + MT+WQEE SDILEYLY C F DK+AV+WNLGPVNF+KEMWTTHVKA+A
Sbjct: 2826 GTIIEVPKLNIAMTSWQEENSDILEYLYKCTFEDKIAVKWNLGPVNFIKEMWTTHVKALA 2885

Query: 2885 VRRSQVLTGSFNVSEKDVEKRIKEEENITKLNYVPVEEPQIDMPQIKDLGDATPPVEWFG 2944
            VRRSQ +  +   ++++V+KRIKEEENI+KL YVP+EEP+IDMPQI+DLGDATPP+EWFG
Sbjct: 2886 VRRSQNVLDTDMQTDEEVQKRIKEEENISKLKYVPIEEPRIDMPQIRDLGDATPPLEWFG 2945

Query: 2945 VNRKRFPAFTHQTAVVPVQNLVYLAQKQYAKTLGRS 2980
            VNRKR PAFTHQT VVPVQ LV+ A+KQYA  L  S
Sbjct: 2946 VNRKRLPAFTHQTVVVPVQKLVHAAEKQYASLLDNS 2981

>NDAI0B01980 Chr2 complement(483519..492398) [8880 bp, 2959 aa] {ON}
            Anc_8.260 YLR087C
          Length = 2959

 Score = 2872 bits (7446), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1424/3001 (47%), Positives = 2016/3001 (67%), Gaps = 82/3001 (2%)

Query: 10   FRGESLGFKRNFSWVFLVDWILTVILTLATLFYLSRAFAYGVTFILEWLLWKQAKVKVSI 69
            F+   L  +++FSWVFLVDWIL +I+TL  +FYLSR  AYG++FILEW LWK++ VK++I
Sbjct: 7    FQRIPLTKQKDFSWVFLVDWILILIVTLFVIFYLSRTLAYGISFILEWFLWKRSNVKINI 66

Query: 70   GALRISLLAGRVFFKNLTIIDKDRTITILEGSITWRYWLIRTRKSEYRVAQMAHASAGSS 129
             ++RIS L GRVFFKN+ II +D TI+ LE ++TWRYWL+  RKS Y   ++   ++ +S
Sbjct: 67   ESIRISPLGGRVFFKNVVIIHQDYTISFLEANVTWRYWLLNVRKSGYDTPELPDKASANS 126

Query: 130  GNSEDDTKFDIANYMEKQLKLPCRFLFECEGFEMFIYNRTYAYDNIVNVLSKVEREKFEK 189
                              +KLPCRF  E EG E+F+YNR  AYDNI+   SK ER +FEK
Sbjct: 127  ------------------VKLPCRFFLEFEGLEIFVYNRGVAYDNIIGQFSKEERNQFEK 168

Query: 190  FMAENDFLDPSSDGSSDDKIEET----SSATNSTDEETIANDRTFQNDTRKTLPRYLEAL 245
            F+ E  F D  ++ S+ +   E     S+ T  +D  T  NDR FQ +  +  P++L+ L
Sbjct: 169  FLNEQVFTDSKAEVSNSESNSEEDTFESAGTFKSDSST-TNDRVFQEELSER-PQFLDFL 226

Query: 246  PIEALLNKGSILIGNKFTPCVLILSFESAVALQDVGEAPSKLDLYRMKYEVRLKNLEIMM 305
            PI+  ++ GS++IGNKFTP ++I S  S   + DV +   KLDLY++++ +  K   I +
Sbjct: 227  PIDFKVSHGSLIIGNKFTPSLMIGSCSSCTGMIDVCQPSEKLDLYKLRFLLDFKTFAIDI 286

Query: 306  KQNIDYDNEKSRNFEFDKGKLSRLWHRFTRIF-----KLVPFPFKSNRRKEQPHDNFMQK 360
            KQNI ++ E S  F+ D+ ++S++W +F ++       +     +SN+  E+  D F +K
Sbjct: 287  KQNIGFNEEFSMKFKIDRNRVSKMWQQFNKVLLTCYSHMKLSHLRSNKVSEE--DPFYEK 344

Query: 361  WKGLSMYRNDMFGXXXXXXXXXXXX-SSHEYAKFTSLLKSPRVTIHHDYDMPGWVPHGAH 419
            W+GLS+YR  +FG             ++HEYAKF+S++++P+     + D+PG VPHGAH
Sbjct: 345  WRGLSLYRGTIFGKSNDDINDIDFDFANHEYAKFSSIVRTPQAIFTFECDIPGIVPHGAH 404

Query: 420  PPSSYADGPDVGNNMAPPQYIFEINIFGGTVCYGPWAQRQTNHLQSLLSPSVSRTAKPIK 479
            P  +  DGPDVGN+ APP++  EI I GG++C+GPWAQRQ N L  LLSP  SR AKP K
Sbjct: 405  PTLTATDGPDVGNSGAPPEFSLEIQISGGSICFGPWAQRQLNSLIRLLSPIASRNAKPTK 464

Query: 480  KLKPGSKRIYTVLKLTINAMEDVTWRIPTRESSKDVEFLMHYKETNDDYRPFGWIDIKVS 539
            +L PG  RIYT  K TI+  E+ TWRIPTRESSKD EFL HY+ETN++YRPFGWID+K S
Sbjct: 465  RLTPGCTRIYTQFKTTISTTEETTWRIPTRESSKDPEFLQHYRETNEEYRPFGWIDLKFS 524

Query: 540  RDSCGIFDLAMCPTSKGFKNTIDVQLVDTEIRSSVNHDIFLKSKSFSFNCDIGYPLGWNA 599
            +D+     +A CPT +GFKNT+D+ L D EIRSSVNHDI LK KSF+F  DIG+PLGWN 
Sbjct: 525  KDTYICSTVAQCPTKEGFKNTLDIHLGDNEIRSSVNHDILLKCKSFNFVMDIGFPLGWNE 584

Query: 600  EANWTIIMDSNQLELFLLREHVTLIADTLTDFSSGEPVPYELFRPFVYHIKWNMKGYSFY 659
            EA WTI ++S QLE F+LREH+TLIADTLTDFSSGEP PYELFRPFVY I W + GYS Y
Sbjct: 585  EATWTIDLESTQLEAFILREHITLIADTLTDFSSGEPTPYELFRPFVYRINWKINGYSLY 644

Query: 660  LNVNDHNIVNNPLDFNENCYLSIHGDDLTMNVMVPKKTITSRFTNMTYDIYTPMFRXXXX 719
            LNVNDHNIVNNPLDFNENCYLS HGD L ++++VPK+ +++ FT ++Y IYTPMFR    
Sbjct: 645  LNVNDHNIVNNPLDFNENCYLSFHGDILQIDLVVPKREVSAGFTEVSYTIYTPMFRLVLN 704

Query: 720  XXXXXXXXEFMRNKEVGRSHDFRLKGSYLIYSELDIDNVDTLTVECSSRGTALHIYGFVI 779
                    EFM+NKEVGRSHDF++ GSYLIYSELDIDNVDT+ +ECSS+ T L  YGFVI
Sbjct: 705  TPPWNTLNEFMKNKEVGRSHDFKITGSYLIYSELDIDNVDTIIIECSSQSTVLQCYGFVI 764

Query: 780  RYLINVKMNYFGEFFHFVTSEEYTGNTRPTDLENIISEDRRDDD---FSSYESVSRISSN 836
            RYL NVKMNYFG+FFHFVTSEEYTG  R  +++N  ++ +  +D    SSYES+      
Sbjct: 765  RYLTNVKMNYFGDFFHFVTSEEYTGEIRANEVQNQFTDRQLYEDKASLSSYESIE----- 819

Query: 837  SSDXXXXXXXXXXXXXXXXXRTSNETDIWFTFSVWDGALILPETIYNADPCIALHFAELI 896
            +S                  R +NETD+WFTF+VW+GA++LPETIYN DPCI LHF EL+
Sbjct: 820  TSSVRKEQTGDSKIKRSDLKRATNETDLWFTFTVWEGAILLPETIYNCDPCIGLHFGELL 879

Query: 897  VDLRSCNYYMDILATACDINLKRYVGKRADEIYEYVHLNNGKDHEVHGTLSDIYIHGHRM 956
            +D RSCNYYMD+LA+  DI+L+RY+GK+ +EIYE V  +NG  ++ +G+LSD+ IH HRM
Sbjct: 880  IDFRSCNYYMDLLASMNDISLRRYIGKQQNEIYESVRQDNGCGNKKYGSLSDMVIHAHRM 939

Query: 957  YGLPPTEPTYFCQWDMDFGHLNIDSNMFFLQGLFGAFYKIGFGYKDLENILLYETEIIDD 1016
            YGLPP EPTYFCQWD   G L+++ ++ FL+G   +F KI FG  DLENILLYE E+IDD
Sbjct: 940  YGLPPLEPTYFCQWDFSLGTLDLNCDISFLEGFITSFNKISFGLVDLENILLYEKEVIDD 999

Query: 1017 MTSLTIFINTIDIRLNDVDTTAHADLKLERFCFTLIDFENERYSKRMDIKIPSLEFNIF- 1075
            MTSLT+ +  I I + + +         E   F+ I+FENE+Y  R+D++IP   FN+F 
Sbjct: 1000 MTSLTVDVKKISIMIRESEMDTFLLCTAEELYFSNINFENEKYCTRLDLRIPI--FNLFM 1057

Query: 1076 --SNEDNDLSLLNFKVDMNFTNFVQNQDFNKHRKIQRDYIVLNDAPYHRCAFLLPESYQK 1133
               N      L  F+  +N +NF +  D   H+  Q++YI L+DAPYHRCAF+LP S Q 
Sbjct: 1058 YTMNGAKKEKLFEFETKVNLSNFEKPNDIATHKSKQQEYITLHDAPYHRCAFILPPSLQD 1117

Query: 1134 SRIYNELFGXXXXXXXXXXXXXXXTADTIEYVLEDLLEDYMGLFEGN--YDIKESSVENL 1191
            S IY +LFG                  TI+Y+++DLL  +  + E    + I  S   + 
Sbjct: 1118 SEIYQDLFGSIAPSSSLPPLPIPLLPATIDYIVDDLLGCFPEILESENPFRIPFSPATSP 1177

Query: 1192 EL-SAIEATRAITGIGAERTHSNPITLSDY-AVESDNYVVKVESIVIDINPALYTTIEKL 1249
            +L +  E +   +    +       T  D     SDN+V+ +    + INP L++ ++  
Sbjct: 1178 KLGNPFEGSDTESDEELDPLEFKTETSGDSETFASDNFVIDISYCSLSINPRLWSYLDNC 1237

Query: 1250 LKHIYDQDAVQIIDGIEIGIVKRLSSIHDGVTTMTNVKVQIKHFNLFWGEKESDNVSMFF 1309
             +H   QD VQI+D IEIGIV  LS + +G+ T  N+K+QI + +LFWG++++  +S++ 
Sbjct: 1238 REHFCSQDIVQILDDIEIGIVNHLSDLQEGIETARNIKLQILYLDLFWGDRQNAGISLYL 1297

Query: 1310 DKMDFALTEKTLEQNSEKNLLEMTVLAKIKAVRLTVVQQPGLIPTQERPPAITVGVEGFE 1369
            D++D  + +K LE+N+E  + E+T L KI++VR T+ +   +    ERPPA+++ +EG E
Sbjct: 1298 DRIDLEMCQKMLEENNETKITEVTFLNKIRSVRATINEASSVGKADERPPALSLVIEGSE 1357

Query: 1370 FWSTAIEKQVNSISVSSADITVDDAQVEWFFKYIVRQKYFFLDMLQSYNRIQNNRIESQK 1429
             WS     QVNS+++ SADIT+D+AQ++W F+YI +Q     ++  +   IQ +R  ++K
Sbjct: 1358 IWSCITNAQVNSLNILSADITIDEAQIDWLFQYIDKQLTLSQEIASALQSIQESRSTTRK 1417

Query: 1430 ELISRLTAASEYYQISHDPYVITKPAFIMRLSRGHVRENKSWKIITRLRHILTYLPKDWY 1489
            +L+S+L  ASEYYQISHDPYVITKPAFI RLSRGHVREN+SWKIITRLRHILTYLP DW 
Sbjct: 1418 QLVSKLAVASEYYQISHDPYVITKPAFITRLSRGHVRENRSWKIITRLRHILTYLPIDW- 1476

Query: 1490 LNVGQPLRDRKFDPS-QDARSIFMSIFSNWRSWEFSDVARSYIYGKLFLNDHAEXXXXXX 1548
            L V   +R+++   +  D  + F+S+FSNWR+WEFSD+ARSYIY  +F   H++      
Sbjct: 1477 LRVIDEMRNQQDSHTLPDPGNAFISVFSNWRNWEFSDIARSYIYRNMFSEGHSKKQENSM 1536

Query: 1549 XXXXXXNIGNFFMTVYSTNYDVDHSIVVSNAKLLLELTPSSTEPKENSLQREELIDISGT 1608
                   + + F TVYST Y+V+H+ +++   +++E  P+ +   ++S+ +E++I+++G+
Sbjct: 1537 ENSIKLKLASLFFTVYSTGYEVEHNFILTRTNVVVETLPAIS---DSSIIQEKIINVTGS 1593

Query: 1609 VDVIXXXXXXXXXXXXXXIPILTEGSEKQPVKPPQDTIPKPFKMNAAFMVNSCDIQLVMD 1668
            +  I              +P L+     +P  P      + FK+N   +    ++Q V+ 
Sbjct: 1594 LGTIKGKTSHKLINLKKLLPELSMKKNLKPSTP----FLRCFKLNMLLLFERSELQFVLG 1649

Query: 1669 ATKLNMNVNDGRISVLWENLQDSTAQAGSVVLFSKHTELVLKHINSVLAEGRVSNFYATF 1728
            A+K+   V  G++S+LWE+ +D  ++A S+ ++++ +E+ +KH N +LAE ++  F    
Sbjct: 1650 ASKVMSRVFGGKLSMLWESPKDLASKAISMTVYAQRSEMWMKHHNIILAESQMREFSIII 1709

Query: 1729 TTDTWAQRPTYLIHSKSSSIHFRTMAKTERLVEAIKDIKLKIDQISEQLELE-----RRL 1783
            T ++W+ +PT L++ + + IHFR M  T+ L +++ +I   I ++ +    +     +++
Sbjct: 1710 TAESWSYKPTVLVNLQCTDIHFRAMTATDVLAKSVGEIIENIKELEKLFYSDSDSGIQQI 1769

Query: 1784 TQHPTVYDPNKSNVIASCLFSNVSMDIMPVSPFALKNSAKQIDFFYNKFDSDSWLIKLKD 1843
            +Q+P +    K N++ +C F+NV+++IMP+SPF+ +++AKQ+D ++N+  S+  ++ + D
Sbjct: 1770 SQYPVM--EQKINMVLTCYFTNVNLEIMPLSPFSFRHNAKQLDIYFNRLGSNDLVLSVWD 1827

Query: 1844 TDFFLTSDQTKEQYMRLSMKKLQIRVNVSSSKPKLVDINLSTNLVKLTFSEPKNIVYSFL 1903
            TD FL S  TKE+Y R S   +Q++ N+  +    ++I++S ++VKLT  + + ++ SFL
Sbjct: 1828 TDLFLISHLTKEEYFRFSFGNIQLKGNILENPNYTINIDVSASIVKLTLGDIRRLIPSFL 1887

Query: 1904 KDERVASESVHLLQTLKPLFSISDDKESTPQSYQEKTEYLWSLDSSIDYFGILIPMTSTY 1963
            +DE++  ES+    +LK LF     K+  P + +      WSL+S+I+YFG+L+P++STY
Sbjct: 1888 QDEKILIESLEQFSSLK-LF---QRKKPAPSTEKSGRTVTWSLESNINYFGLLVPISSTY 1943

Query: 1964 YVMEFHSYVSSISNANGAPSGNLDITGHMSVENILFLIKESSLPDGLSKVIDIAVNVSTL 2023
            +++E H  + S++   G  S    ++G  S++N+ FL+KE SLP  LSK++D ++ VSTL
Sbjct: 1944 FILELHMLLMSLNKIQGISSKYNGLSGQFSIDNVCFLLKEKSLPADLSKILDFSIKVSTL 2003

Query: 2024 QRVDDNSRSIQVESSHARICLSPDSLLRLLWGFNQGHKLSEHYLKYHSKSLWQSFAKSDD 2083
            Q++    RS Q+ES H R+CLSP SL  +LW  NQ    +  Y K H+   W+       
Sbjct: 2004 QKLKVTPRSFQIESPHFRVCLSPGSLAHMLWRGNQALT-NIRYYKEHTSVAWEKVINF-- 2060

Query: 2084 KQQDTNSIKSNETSFFSSINSIHFLSYNLCVGWLFEYELGPPKGLITGYSRLFSAYENCM 2143
              ++TN+    +  F     S H LSYN CVGWLF  E     GLI GYSRLFSAYE   
Sbjct: 2061 --KNTNNSAEVQADF----PSFHVLSYNFCVGWLFSPEFDNEPGLIIGYSRLFSAYEKNF 2114

Query: 2144 GKLTVIDSYFAAAQGNTSSTFYPETNVKELFNRFYLPNMQILFWWKVIEGMKDVYVRFTG 2203
            GKLT+ID+YF+ A G TS TF+ + + K+ +NR YLPNMQI +W K    ++DVY+RF G
Sbjct: 2115 GKLTLIDAYFSVANGKTSDTFFSKGHEKDRYNRSYLPNMQISYWLKNEGLLRDVYLRFHG 2174

Query: 2204 ETLDVKYLSDFMLTIESTLHSIKMFQKLKKELI-VETPKREVVHIKEDKPXXXXXXXXXX 2262
            E LDV +L+ F+  IES+L SI+ FQ+LK++L+   +  +E       +P          
Sbjct: 2175 EALDVNFLASFIDVIESSLESIQKFQELKRDLVGTASNIKEQTQSTTQEPIGDISPFFTG 2234

Query: 2263 XXXXXCHFKYDGGTYSVFNISDGSLNPTPAIEIKSPVISVDVLYKHEKQNTKHHS-IRCL 2321
                 C F+YDGG + VF+ ++ S +  P+ EIKSP + +D+ YK+ ++ T+  + IR L
Sbjct: 2235 IRSINCQFQYDGGVFKVFSSAEASNHLKPSFEIKSPNVIIDMNYKYNEKKTQTPTWIRTL 2294

Query: 2322 VNIDPTHNVLYATCAPLVKNFVEDVRSIFGRYESENKHSETTPTSVQNIDYEKLLEDYDL 2381
            + I+ THN L+A CAPL+  F E ++ +  R+ S+ + S T   S QNIDY+++L+ +D+
Sbjct: 2295 ITINSTHNTLFAKCAPLIAEFSEGIQKMVKRHSSDREPSGTN-ISKQNIDYKRMLDSFDV 2353

Query: 2382 AITVTSAKQQLSLSCEPKAKVQADVGFEALTVSMTTNPFDIDEPLAFSFSIKDTKASIKH 2441
            A+ V SAKQ LSL CEP+AKVQAD+GF++ T ++TTN +D +EPL F+ S++ T+ASIKH
Sbjct: 2354 AVEVISAKQLLSLCCEPRAKVQADIGFQSFTFTVTTNDYDPEEPLIFALSVEKTEASIKH 2413

Query: 2442 LFSRETSTSFGVGYLDLTLLFTHTNRINTYGTSLISDIDLYFNVKQLQNLYLFLDIWQLS 2501
            +FSRE STSFGV ++DLT++FTH N IN  GT LISD+ ++FNVKQLQNLYLFLDIW+LS
Sbjct: 2414 IFSREASTSFGVDFIDLTVMFTHPNSINILGTGLISDVHVFFNVKQLQNLYLFLDIWKLS 2473

Query: 2502 ELLNPVTSSQEQVIRKD-KKKSVDKPIHNESQLPWCFTLIFTNVKGDIDLGPSLGLISLR 2560
             LLN    ++    R D K  S  +    +S +PWCFTLIF+N+ GD+DLGP+LG++SL 
Sbjct: 2474 NLLNSKPMNEVVKSRTDLKSLSSVQSKDTDSTIPWCFTLIFSNINGDVDLGPTLGVLSLH 2533

Query: 2561 LSRTWLATDHFSGKRQILHAFVDDLLLISEGRLSGVVNIDGASWVSEVIWLQDSKRDNIP 2620
              RTW ATDH+   R++LHA+   + L S+GRLSG++ +DGASW+SEV W      ++ P
Sbjct: 2534 FKRTWFATDHYKSTRKVLHAYTKGITLTSKGRLSGILELDGASWISEVNWPIYENINDYP 2593

Query: 2621 LVALSLNTDKIEIKAAFDYHMFLIGTVNNILFQLHSERDMVGVAPDLLKVSFSCEEIKLC 2680
            LV++SLN D++E K AFDYHMFL+G +NNI   +HSE+D+ G+ PDLLKV+  CE IKLC
Sbjct: 2594 LVSISLNIDRVETKVAFDYHMFLVGAINNIDVHIHSEKDINGIKPDLLKVNVICEAIKLC 2653

Query: 2681 STALVAANILDIYNTIIRMRQDTKISYIETLKDSNMETNKQTLAYRDILKSLQLLRTDLT 2740
            STALVAANILDIYNT++R+RQD KISYIETLK+SN    +Q L Y+DIL+SL L++TD++
Sbjct: 2654 STALVAANILDIYNTVMRLRQDNKISYIETLKESNTSEPRQALDYKDILRSLNLIQTDVS 2713

Query: 2741 VSICSLQLQISPISLFDXXXXXXXXXXXSARSETHSEAKLTTSLNMEVYDATLSLSTAKQ 2800
            V I +L +QISPISLFD           SARSETH+  KL T L M+VYDA+++LST+K+
Sbjct: 2714 VDIYTLNIQISPISLFDAEILVVNIENISARSETHAGNKLKTELEMQVYDASVALSTSKE 2773

Query: 2801 ELDEDALSKITVADYMTYASKIRGGTIIEIPRMGVQMTTWQEEKSDILEYLYSCKFHDKV 2860
            ELDED ++ I+V DYM YA +I GG IIE PR+ + MTT+Q+EKSDILEYLY+C F DK+
Sbjct: 2774 ELDEDIIATISVEDYMHYAGRISGGVIIEAPRLLIAMTTYQKEKSDILEYLYTCSFGDKI 2833

Query: 2861 AVRWNLGPVNFMKEMWTTHVKAIAVRRSQVLTGSFNVSEKDVEKRIKEEENITKLNYVPV 2920
            +VRWNLGPVNF+KEMW THV+A+AVRRSQ+      VSE+DV KRIK+EE  ++  YVP+
Sbjct: 2834 SVRWNLGPVNFIKEMWATHVRAMAVRRSQIDVTFGPVSEEDVGKRIKKEEEFSRFQYVPL 2893

Query: 2921 EEPQIDMPQIKDLGDATPPVEWFGVNRKRFPAFTHQTAVVPVQNLVYLAQKQYAKTLGRS 2980
            EEP+IDMPQI+DLGDATPP+EWFG+NRKRFPAFTHQTAV+ VQ LV+ A+K+Y   LG S
Sbjct: 2894 EEPRIDMPQIRDLGDATPPLEWFGLNRKRFPAFTHQTAVILVQKLVHTAEKEYGSILGHS 2953

Query: 2981 K 2981
            +
Sbjct: 2954 Q 2954

>KNAG0G02030 Chr7 complement(453579..462575) [8997 bp, 2998 aa] {ON}
            Anc_8.260 YLR087C
          Length = 2998

 Score = 2803 bits (7266), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1412/3042 (46%), Positives = 1996/3042 (65%), Gaps = 121/3042 (3%)

Query: 10   FRGESLGFKRNFSWVFLVDWILTVILTLATLFYLSRAFAYGVTFILEWLLWKQAKVKVSI 69
            F   SL   ++FSWVFLVDWILT+IL++  LFY+ RA A+ ++FI EWLLWK+ ++KV+I
Sbjct: 8    FNSISLDKGKDFSWVFLVDWILTLILSITVLFYVGRAIAWFISFIAEWLLWKRYRLKVNI 67

Query: 70   GALRISLLAGRVFFKNLTIIDKDRTITILEGSITWRYWLIRTRKSEYRVAQMAHASAGSS 129
             +LR+SLL GR+FFKNLTIIDKD TI+ L G I+WRYWL R R  ++     A    G+S
Sbjct: 68   ESLRVSLLGGRIFFKNLTIIDKDYTISFLIGQISWRYWLFRPRIPQFLTELNAEDDDGAS 127

Query: 130  GNSEDDTKFDIANYMEKQLKLPCRFLFECEGFEMFIYNRTYAYDNIVNVLSKVEREKFEK 189
                          +++  KL CR L ECEG E+F+YNRT AYDN + + SK ER KFE+
Sbjct: 128  --------------LQRNEKLACRLLLECEGVELFLYNRTVAYDNTIKMFSKEERAKFEE 173

Query: 190  FMAENDFLDPSSDG----------SSDDKIE---ETSSATNSTDEETIANDRTFQND-TR 235
            F+ E+ F D +S             + D++E    T S+ + ++E  +ANDR F ++ T 
Sbjct: 174  FLNEHVFTDRASTESSNGSSSEESKAQDEVEIKSYTESSFDESNESQMANDRIFHDEETG 233

Query: 236  KTLPRYLEALPIEALLNKGSILIGNKFTPCVLILSFESAVALQDVGEAPSKLDLYRMKYE 295
            K L  +L  LP++  ++  S ++GNKFTP +LI+S +SA  + D  +   KLD+Y+ K  
Sbjct: 234  KNL--FLNYLPLQIKVSHASYVVGNKFTPSLLIVSADSAEGVMDYCQPKEKLDIYKTKLT 291

Query: 296  VRLKNLEIMMKQNIDYDNEKSRNFEFDKGKLSRLWHRFTRIFKLVPFPFK-SNRRKEQPH 354
            +  KN+ + +KQNI Y+ E    F+   GKLS+LW  F +    V  P   S ++K +P 
Sbjct: 292  MDAKNVSVSLKQNIGYNEEVLLKFKLTTGKLSKLWDNFVKATAFVRKPLGLSRKKKNRPS 351

Query: 355  --DNFMQKWKGLSMYRNDMF-GXXXXXXXXXXXXSSHEYAKFTSLLKSPRVTIHHDYDMP 411
               NF QKW+GLS+Y+N MF              + HEYAKFTS++K PR  + +++D+P
Sbjct: 352  VTANFHQKWRGLSLYKNYMFEDVQNDLDDIEFDLAGHEYAKFTSIIKCPRAILTYEFDIP 411

Query: 412  GWVPHGAHPPSSYADGPDVGNNMAPPQYIFEINIFGGTVCYGPWAQRQTNHLQSLLSPSV 471
            G+VPHGAHP  S  DGPD+GNN APP +  EI +FGG++CYGPWAQRQ   +QSLL+P +
Sbjct: 412  GFVPHGAHPTLSSIDGPDIGNNGAPPTFGLEIQLFGGSLCYGPWAQRQVAFIQSLLAPQI 471

Query: 472  SRTAKPIKKLKPGSKRIYTVLKLTINAMEDVTWRIPTRESSKDVEFLMHYKETNDDYRPF 531
            SR  KP+K L+PG +R+YT+ KL I   ED+TWRIPTRESSKD EFL HYK TN+DYRPF
Sbjct: 472  SRDQKPVKPLQPGERRMYTLFKLGIVVNEDITWRIPTRESSKDAEFLRHYKNTNEDYRPF 531

Query: 532  GWIDIKVSRDSCGIFDLAMCPTSKGFKNTIDVQLVDTEIRSSVNHDIFLKSKSFSFNCDI 591
            GW+D+K S+DS   F+ A+C T+ G +NT+ + L D+EIRSSVNHDIF+KSKS  F+ ++
Sbjct: 532  GWLDLKFSKDSYASFNFALCSTADGSQNTMKIHLGDSEIRSSVNHDIFIKSKSLDFDLNL 591

Query: 592  GYPLGWNAEANWTIIMDSNQLELFLLREHVTLIADTLTDFSSGEPVPYELFRPFVYHIKW 651
            G+PLGWN +A WTI + S+QLE FLLREH+TLIADT++DFS+GEP PYELFRPF+Y I W
Sbjct: 592  GFPLGWNEKAKWTINVASSQLETFLLREHITLIADTMSDFSTGEPTPYELFRPFLYTINW 651

Query: 652  NMKGYSFYLNVNDHNIVNNPLDFNENCYLSIHGDDLTMNVMVPKKTITSRFTNMTYDIYT 711
             + GYS YLNVNDHNIVNNPLDFNENCYLS HGD L +++ VPK  I +R T+++Y+IYT
Sbjct: 652  KLDGYSIYLNVNDHNIVNNPLDFNENCYLSFHGDILNVDITVPKDRIDARATDISYNIYT 711

Query: 712  PMFRXXXXXXXXXXXXEFMRNKEVGRSHDFRLKGSYLIYSELDIDNVDTLTVECSSRGTA 771
            PMFR            EFM++KEVGR++DFR  G+YLIY+ELD+DNVD +T+ CSS+ T 
Sbjct: 712  PMFRLMLNAPPWNTLNEFMKHKEVGRAYDFRTTGNYLIYNELDVDNVDMITIICSSKSTV 771

Query: 772  LHIYGFVIRYLINVKMNYFGEFFHFVTSEEYTGNTRPTDLENIISEDRRDDDFSSYESVS 831
            LH YGFVIRYL+N+KMNYFG+FFHFVTSEEYT              ++  DD S++  VS
Sbjct: 772  LHCYGFVIRYLMNIKMNYFGDFFHFVTSEEYTEKISSKGYGEGSLFEKYSDDASTF--VS 829

Query: 832  RISSNSSDXXXXXXXXXXXXXXXXXRTSNETDIWFTFSVWDGALILPETIYNADPCIALH 891
                N+ +                 R +NETD+W TF++W+GAL+LPETIYN DPCIALH
Sbjct: 830  DFDKNNEE---DDKVKVPRGPADVRRKTNETDLWLTFNIWEGALLLPETIYNCDPCIALH 886

Query: 892  FAELIVDLRSCNYYMDILATACDINLKRYVGKRADEIYEYVHLNNGKDHEVHGTLSDIYI 951
            F EL +D+RS NYYMD+LA+  DI L++Y   + +EI+E V   NG+D + H  +S+I I
Sbjct: 887  FGELAIDVRSTNYYMDLLASLDDIILRQYSNVQPNEIFENVRQCNGRDVKGHSYISNINI 946

Query: 952  HGHRMYGLPPTEPTYFCQWDMDFGHLNIDSNMFFLQGLFGAFYKIGFGYKDLENILLYET 1011
            HGHRMYGLPPTEPTYFC+WD D G + ++S + F++GL  +F KIGFG+ DLEN+LLYE 
Sbjct: 947  HGHRMYGLPPTEPTYFCKWDFDLGTIKLESEVDFMKGLVTSFQKIGFGFDDLENVLLYEK 1006

Query: 1012 EIIDDMTSLTIFINTIDIRLNDVDTTAHADLKLERFCFTLIDFENERYSKRMDIKIPSLE 1071
            E++DDMT++T+ +    I +++ +  + A+L L    F  IDFENE+YS RMDI+IP L+
Sbjct: 1007 EVVDDMTAVTVNVKDFKIIIHNPELHSRAELILNNMQFCNIDFENEKYSTRMDIRIPLLK 1066

Query: 1072 FNIFS---NEDNDLSLLNFKVDMNFTNFVQNQDFNKHRKIQRDYIVLNDAPYHRCAFLLP 1128
             +++        +LS  NF+  +NFTNF   ++  +HR +QRDYI +NDAP+HRC F+LP
Sbjct: 1067 LSLYGYNYEASKELSFFNFETKINFTNFCNYKNCVQHRALQRDYITMNDAPFHRCGFILP 1126

Query: 1129 ESYQKSRIYNELFGXXXXXXXXXXXXXXXTADTIEYVLEDLLEDYMGLFEGNYDIKESSV 1188
             SYQ S IY +L+G                 +T E++++D L +Y            S  
Sbjct: 1127 ASYQNSVIYQKLYGSIVPSSSLPPLPLPLLEETFEFIIQDFLHEYN---------TTSDC 1177

Query: 1189 ENLELSAIEATRAITGIGAERTHSNPITLSDYAV--------ESDNYVVKVESIVIDINP 1240
              L L   ++T   +        + P TLSD  +        E DNYV+    I I I+P
Sbjct: 1178 IILNLPYPDSTNLNSDSFNSYPDTAPHTLSDTIIRKSPLPEDERDNYVIDFRYISISIDP 1237

Query: 1241 ALYTTIEKLLKHIYDQDAVQIIDGIEIGIVKRLSSIHDGVTTMTNVKVQIKHFNLFWGEK 1300
             L+  IEKLL H Y  D  Q+ID IEIG+VKRLS+  +G++++ N K++I  F++FWG++
Sbjct: 1238 ELFFYIEKLLNHFYGDDDTQVIDSIEIGLVKRLSNFQEGISSINNFKIRILFFDVFWGQR 1297

Query: 1301 ESDNVSMFFDKMDFALTEKTLEQNSEKNLLEMTVLAKIKAVRLTVVQQPGLIPTQERPPA 1360
            ++  + ++ D +DF + EK++E+N EK+L E+T L K+ ++R +V  +     T+ +PPA
Sbjct: 1298 DTGGIELYLDTLDFEMNEKSIEKNREKSLTEVTTLMKLNSIRASVNAKYSRGKTEGQPPA 1357

Query: 1361 ITVGVEGFEFWSTAIEKQVNSISVSSADITVDDAQVEWFFKYIVRQKYFFLDMLQSYNRI 1420
            +++ VEG +FWST  +K +NSI ++S D T+D+ QV W F +   QK     +++++ ++
Sbjct: 1358 LSLMVEGVKFWSTTAKKVINSIILTSIDATIDETQVVWLFNFFGDQKELIGSVVKTFEKV 1417

Query: 1421 QNNRIESQKELISRLTAASEYYQISHDPYVITKPAFIMRLSRGHVRENKSWKIITRLRHI 1480
            Q  R +S+KELISRLT ASEYYQISHDPYVITKPAFI RLSRGHVREN+SWKIITRLRHI
Sbjct: 1418 QKLRTQSRKELISRLTVASEYYQISHDPYVITKPAFITRLSRGHVRENRSWKIITRLRHI 1477

Query: 1481 LTYLPKDWYLNVGQPLRDRKFDPSQDARSIFMSIFSNWRSWEFSDVARSYIYGKLFLNDH 1540
            +TYLP DW   V + L++RK++ S+DA+SIFMS+FS+WR+WEFSDVARSYIY K+FL + 
Sbjct: 1478 MTYLPDDWNETVAKQLKERKYNASKDAKSIFMSVFSSWRNWEFSDVARSYIYNKVFLANQ 1537

Query: 1541 AEXXXXXXXXXXXXNIGNFFMTVYSTNYDVDHSIVVSNAKLLLELTPSSTEPKENSLQRE 1600
            AE               + ++TVY+    VDHS +V+ + L+ E TP +TE   N   +E
Sbjct: 1538 AEKQQKTVNKGWKAAFVSVYITVYTAGLGVDHSFIVTKSNLVFEETPDTTESGYN---QE 1594

Query: 1601 ELIDISGTVDVIXXXXXXXXXXXXXXIPILTEGSEKQPVKPPQDTIPKPFKMNAAFMVNS 1660
            ++I+++G +  I              + ++ +  ++ P      +  + FK+N A + +S
Sbjct: 1595 KVINVTGNLGSIKGKISDKMFKLHNLMNLVQQ--QEDPALKSISSFSRSFKLNIALLFDS 1652

Query: 1661 CDIQLVMDATKLNMNVNDGRISVLWENLQDSTAQAGSVVLFSKHTELVLKHINSVLAEGR 1720
             D+  V   T L   ++ G+ S LWEN +  T +  S+VL++K  E  +KH NS+L E +
Sbjct: 1653 SDLLFVFGETSLTNTIHSGKASFLWENPKGPTKETASLVLYAKRCETSMKHRNSMLFENQ 1712

Query: 1721 VSNFYATFTTDTWAQRPTYLIHSKSSSIHFRTMAKTERLVEAIKDIKLKIDQISEQLELE 1780
            ++    +   D+    P+ + + +   I+ R M +TE +V  +++   K + + E  E +
Sbjct: 1713 ITGIALSAAADSIISHPSIVANFQCDDINLRVMPQTEVIVTFLQEFIAKFNLVKESFETD 1772

Query: 1781 RRLTQHPTVYDPNKS----------NVIASCLFSNVSMDIMPVSPFALKNSAKQIDFFYN 1830
                  PT   P  +          ++  +C FSNVS+DIMP+ PF  +   K+++F ++
Sbjct: 1773 DLPKPTPTNDSPKPTPTKINPFLLVDLDFTCFFSNVSLDIMPIVPFQFRQETKKMEFKFS 1832

Query: 1831 KFDSDSWLIKLKDTDFFLTSDQTKEQYMRLSMKKLQIRVNVSSSKPKLVDINLSTNLVKL 1890
               + ++   + D+D +L S  TK+QY RLS+  + +          + ++++S ++VKL
Sbjct: 1833 SQRTQNFQFNIWDSDLYLGSHLTKQQYFRLSLGNIIVGYTNGRLVNTIHNLDVSASIVKL 1892

Query: 1891 TFSEPKNIVYSFLKDERVASESVHLLQTLKPLFSISDDKESTPQSYQEKTEYLWSLDSSI 1950
            TFSEP  +++SFL+DER  S SV  LQ L  LFS   +  + P       +  W L++ I
Sbjct: 1893 TFSEPHRMLFSFLQDEREVSRSVKKLQVLGNLFSSEPEINTIPAG----AKIDWRLNADI 1948

Query: 1951 DYFGILIPMTSTYYVMEFHSYVSSISNAN-GAPSGNLD-ITGHMSVENILFLIKESSLPD 2008
             Y GILIP+++T++V E H+ ++S+++ + G      D  +G +SV+NILFLIK+ ++P 
Sbjct: 1949 KYLGILIPVSTTFFVFEMHTLLASLADVDYGEIYREADEASGQVSVDNILFLIKDRTIPS 2008

Query: 2009 GLSKVIDIAVNVSTLQRVDDNSRSIQVESSHARICLSPDSLLRLLWGFNQGHKLSEHYLK 2068
             LS++ID++  +S +Q++ ++  S Q+ES H R C SP SL+R+LWG +Q   L  HY +
Sbjct: 2009 TLSRIIDLSFKISAIQKIMESHHSYQIESPHLRFCFSPYSLVRILWGGHQLLALHSHYRR 2068

Query: 2069 YHSKSLWQSFAKSDDKQQDTNSIKSNETSFFSSI--NSIHFLSYNLCVGWLFEYELGPPK 2126
            +HSK+LW    K + K ++  +     TSFFS++   S H LSYN CVGWLF+       
Sbjct: 2069 HHSKNLWDFLPKKEKKVEEDKT-----TSFFSTLTFGSCHILSYNFCVGWLFQNNGDTDA 2123

Query: 2127 GLITGYSRLFSAYENCMGKLTVIDSYFAAAQGNTSSTFYPETNVKELFNRFYLPNMQILF 2186
            GLI GY+RLFSAYE   GKLT++D++F+ + G TS TFY + N ++ +NR +LPN+QI++
Sbjct: 2124 GLILGYNRLFSAYEKGCGKLTLVDAFFSVSNGRTSDTFYSDGNEEDKYNRSFLPNLQIIY 2183

Query: 2187 WWKVIEGMKDVYVRFTGETLDVKYLSDFMLTIESTLHSIKMFQKLKKELI---------- 2236
            W K    MKDV++R  GETLDV +LS F+  IE+TL SI++FQ+LKK L+          
Sbjct: 2184 WLKAAAEMKDVFIRLHGETLDVNFLSSFVKIIEATLQSIQVFQELKKVLVNPLTQSEARS 2243

Query: 2237 -------------VETPKREVVHIKEDKPXXXXXXXXXXXXXXXCHFKYDGGTYSVFNIS 2283
                            P +E    KED P               C FKYDGG + V++  
Sbjct: 2244 EEEEEESEEHNRRETVPGKEK---KEDAPRKDIAPFLSDIRKVNCQFKYDGGIFKVYSFE 2300

Query: 2284 DGSLNPTPAIEIKSPVISVDVLYKHEKQNTKHHSIRCLVNIDPTHNVLYATCAPLVKNFV 2343
            D   N  P+ EI+SP +++D+ YK+   + K H IR L+ ++ THNVL+A CAPL+    
Sbjct: 2301 DIESNLDPSFEIRSPGVTIDLDYKNNIGDVKPHLIRTLITVNSTHNVLFARCAPLLMALS 2360

Query: 2344 EDVRSIFGRYESENKHSETTPTS--VQNIDYEKLLEDYDLAITVTSAKQQLSLSCEPKAK 2401
            +D++ +  ++ S+ K       S   QNIDY++LL  +D+   + S++Q+LSLSCEPKAK
Sbjct: 2361 QDIQHMVKKHSSKKKPEPKQRVSRPSQNIDYKRLLNSFDILFKIISSEQKLSLSCEPKAK 2420

Query: 2402 VQADVGFEALTVSMTTNPFDIDEPLAFSFSIKDTKASIKHLFSRETSTSFGVGYLDLTLL 2461
            VQA+VGF++   ++ TN  D  EPL+F+  +K+T+++I+H+FSRE S SFG+  +D+T +
Sbjct: 2421 VQANVGFDSFMFAILTNDLDTSEPLSFALVVKNTRSAIRHIFSREPSASFGLDLIDVTFM 2480

Query: 2462 FTHTNRINTYGTSLISDIDLYFNVKQLQNLYLFLDIWQLSELL--NPVTSSQEQVIRKDK 2519
            FTH N IN +G  LISD+++YFNVKQLQNLYLFLDIW+LS LL   P+   ++  +  D 
Sbjct: 2481 FTHPNIINMFGACLISDVEVYFNVKQLQNLYLFLDIWKLSNLLRPKPMKKPEDHHVAIDA 2540

Query: 2520 KKSVDKPIHNESQLPWCFTLIFTNVKGDIDLGPSLGLISLRLSRTWLATDHFSGKRQILH 2579
              S   P+   + +PWCFTLIF N+ G +DLGPSLGL+SL + + W A+DH+  KRQ+LH
Sbjct: 2541 PPS--SPMDVGNIIPWCFTLIFANINGKVDLGPSLGLLSLSMRKAWFASDHYESKRQLLH 2598

Query: 2580 AFVDDLLLISEGRLSGVVNIDGASWVSEVIWLQDSKRDNIPLVALSLNTDKIEIKAAFDY 2639
            A++D + L ++GRLSG+V +DGA W +EV W +    D  PLVALS     I +K AFDY
Sbjct: 2599 AYIDQIKLTAKGRLSGIVELDGALWAAEVNWPK--YDDPYPLVALSFVISNISLKVAFDY 2656

Query: 2640 HMFLIGTVNNILFQLHSERDMVGVAPDLLKVSFSCEEIKLCSTALVAANILDIYNTIIRM 2699
            HMFLIGTV N +F LHSERD  G  PDLLKV  +CE+I +CSTALVAAN+LD+YNTI+RM
Sbjct: 2657 HMFLIGTVLNTVFHLHSERDTSGFMPDLLKVMLTCEQIDMCSTALVAANLLDLYNTIMRM 2716

Query: 2700 RQDTKISYIETLKDSNMETNKQTLAYRDILKSLQLLRTDLTVSICSLQLQISPISLFDXX 2759
            RQDT +SY+ETL++SN    K+T+ Y+DILK L L++TD+ V I +L +QISPISLFD  
Sbjct: 2717 RQDTNVSYLETLRESNTTDTKETVDYKDILKVLNLIQTDVVVDINTLNVQISPISLFDVE 2776

Query: 2760 XXXXXXXXXSARSETHSEAKLTTSLNMEVYDATLSLSTAKQELDEDALSKITVADYMTYA 2819
                      A  +TH+  KL T L++++Y+A  SLS++K E+DED +SKI+V DYM YA
Sbjct: 2777 VLVVNIANVCANVKTHAGEKLETYLHLQLYNAHGSLSSSKGEMDEDMVSKISVEDYMVYA 2836

Query: 2820 SKIRGGTIIEIPRMGVQMTTWQEEKSDILEYLYSCKFHDKVAVRWNLGPVNFMKEMWTTH 2879
            SKI GGTI +IP++ + M T+Q+  SDILEY Y   F DK+AVRWNLGPVNF+KEMWTTH
Sbjct: 2837 SKIVGGTIFDIPKLEISMHTFQKSNSDILEYGYRSTFGDKIAVRWNLGPVNFIKEMWTTH 2896

Query: 2880 VKAIAVRRSQVLTGSFNVSEKDVEKRIKEEENITKLNYVPVEEPQIDMPQIKDLGDATPP 2939
            +KA+AVRRSQ L G+    E DVEKR+++EE ++KL Y+ +EEPQID PQIKDLGDATP 
Sbjct: 2897 IKALAVRRSQSLVGTTGDEEGDVEKRMRDEETLSKLTYIAIEEPQIDTPQIKDLGDATPS 2956

Query: 2940 VEWFGVNRKRFPAFTHQTAVVPVQNLVYLAQKQYAKTLGRSK 2981
            +EWFG+NRK+FP FTHQT +VPVQ L++ A+K+YA  +G S+
Sbjct: 2957 LEWFGLNRKKFPIFTHQTVIVPVQKLIHSAEKEYANIVGHSQ 2998

>TDEL0F03870 Chr6 complement(713797..722625) [8829 bp, 2942 aa] {ON}
            Anc_8.260 YLR087C
          Length = 2942

 Score = 2625 bits (6804), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1343/3008 (44%), Positives = 1929/3008 (64%), Gaps = 100/3008 (3%)

Query: 4    FQSSAGFRGESLGFKRNFSWVFLVDWILTVILTLATLFYLSRAFAYGVTFILEWLLWKQA 63
             +  + F   SL  +RNFSWVFLVDW+L  ++TL  +FYL R FAY +T +LEW LWK  
Sbjct: 1    MEGQSQFERVSLSNERNFSWVFLVDWVLLCVVTLTVIFYLGRLFAYAITLVLEWFLWKHW 60

Query: 64   KVKVSIGALRISLLAGRVFFKNLTIIDKDRTITILEGSITWRYWLIRTRKSEYRVAQMAH 123
            KVK+S+ +LRI+ L+G + F+NL II KD+TI+IL+GS+ WRY L+ TR+S+Y   + A 
Sbjct: 61   KVKISVESLRIAPLSGSILFRNLCIIGKDQTISILKGSLRWRYRLLATRRSQY---EEAS 117

Query: 124  ASAGSSGNSEDDTKFDIANYMEKQLKLPCRFLFECEGFEMFIYNRTYAYDNIVNVLSKVE 183
            +     G  E+D      N M K + LPCRF+  CEGFE+FIYNRT AY+NI+ + S+ E
Sbjct: 118  SQKDGLGVGEED-----VNSM-KNITLPCRFVLFCEGFEIFIYNRTVAYENIIQMFSREE 171

Query: 184  REKFEKFMAENDF--LDPSSDGSSDDKIEETSSATNSTDEETIANDRTFQNDTRKTLPRY 241
            R +FEKFM++ +   L       SDDK    S  ++S  +    NDR F     +    +
Sbjct: 172  RVQFEKFMSKQEMSELFHCHSERSDDKGSTDSVLSSSVSDVPNINDRVFDEVHNQKKSIF 231

Query: 242  LEALPIEALLNKGSILIGNKFTPCVLILSFESAVALQDVGEAPSKLDLYRMKYEVRLKNL 301
            +  LP+E  L++GSI++GNKFTP +LI S  S   + D+ +   KLDLY+M ++V   ++
Sbjct: 232  MRFLPMELQLSRGSIVLGNKFTPSLLIASCTSGRGVVDLCQPKEKLDLYKMHFQVDFIDI 291

Query: 302  EIMMKQNIDYDNEKSRNFEFDKGKLSRLWHRFTRIFKLVPFPFKSNRRKEQPHDNFMQKW 361
            +I ++QNI+Y+ +K+    F  GKLSR+W  F ++   +PF  KS+  K    + FM KW
Sbjct: 292  DISIRQNIEYNRKKA---TFKNGKLSRMWATFVKVLH-IPFYNKSHNNKGTESEPFMTKW 347

Query: 362  KGLSMYRNDMFGXXXXXXXXXXXX-SSHEYAKFTSLLKSPRVTIHHDYDMPGWVPHGAHP 420
            KGL +Y+   F              ++HEYAK ++++KSPR  + + YD+PG VPHGAHP
Sbjct: 348  KGLGLYKGLTFDRDGEDYDEVHFDFANHEYAKVSNIIKSPRTVLTYSYDIPGVVPHGAHP 407

Query: 421  PSSYADGPDVGNNMAPPQYIFEINIFGGTVCYGPWAQRQTNHLQSLLSPSVSRTAKPIKK 480
                 +GP+VGNN APP++  ++  +G T+CYGPWAQR+  HL  ++SP+V+R++ PIK 
Sbjct: 408  T---LEGPEVGNNGAPPEFGIDLQFYGVTICYGPWAQREIQHLLRMISPTVARSSVPIKT 464

Query: 481  LKPGSKRIYTVLKLTINAMEDVTWRIPTRESSKDVEFLMHYKETNDDYRPFGWIDIKVSR 540
            L PGS+RIYTV K T   ++  +WRIPTRE SKD EFL  +K T+++YRPFGW+D+K + 
Sbjct: 465  LSPGSRRIYTVFKTTFRVLDGSSWRIPTRERSKDQEFLKKFKATSEEYRPFGWLDLKFAM 524

Query: 541  DSCGIFDLAMCPTSKGFKNTIDVQLVDTEIRSSVNHDIFLKSKSFSFNCDIGYPLGWNAE 600
            DS G     +CP  +GF N + +   + E  SSVNHD+ LK   F    D+GYPLGWN+ 
Sbjct: 525  DSYGSVTTVLCPKEEGFPNKMYIHFAEMEATSSVNHDVMLKCNCFDVAGDVGYPLGWNSS 584

Query: 601  ANWTIIMDSNQLELFLLREHVTLIADTLTDFSSGEPVPYELFRPFVYHIKWNMKGYSFYL 660
            A WTI + S QLE FLLREHVTL+AD  TDFSSGEP PYELFRPF+Y I W + GYS YL
Sbjct: 585  ATWTINLHSTQLETFLLREHVTLVADIFTDFSSGEPTPYELFRPFIYQINWIIDGYSIYL 644

Query: 661  NVNDHNIVNNPLDFNENCYLSIHGDDLTMNVMVPKKTITSRFTNMTYDIYTPMFRXXXXX 720
            NVNDHNIVNNPLDFNENCYLS+HG++L ++V  P  +IT  + ++ Y I TPMFR     
Sbjct: 645  NVNDHNIVNNPLDFNENCYLSLHGEELLIDVTAPNDSITGAYMDVPYKISTPMFRLLLNT 704

Query: 721  XXXXXXXEFMRNKEVGRSHDFRLKGSYLIYSELDIDNVDTLTVECSSRGTALHIYGFVIR 780
                   EFM+NKEVGRS+ F + G Y +YSELDIDNVDTL+VEC+S GT LH YGFV+R
Sbjct: 705  PPWNTLNEFMKNKEVGRSYSFAVCGLYTVYSELDIDNVDTLSVECTSTGTTLHCYGFVMR 764

Query: 781  YLINVKMNYFGEFFHFVTSEEYTGNTRPTDLENII---SEDRRDDDFSSYESVSRISSNS 837
            YL+NVKMNYFG+FFHF+TSEEYTG  R  + E++     E  RD+      ++S  S   
Sbjct: 765  YLMNVKMNYFGDFFHFITSEEYTGVIRAKEKESVGKTEEESLRDNS----TNLSTDSGGL 820

Query: 838  SDXXXXXXXXXXXXXXXXXRTSNETDIWFTFSVWDGALILPETIYNADPCIALHFAELIV 897
            SD                 RT+NETDIWFTFSVW+GAL+LPETIYN DPC+ALHF ELIV
Sbjct: 821  SDPYVRLRADPPVSRSDVKRTTNETDIWFTFSVWEGALVLPETIYNCDPCVALHFGELIV 880

Query: 898  DLRSCNYYMDILATACDINLKRYVGKRADEIYEYVHLNNGKDHEVHGTLSDIYIHGHRMY 957
            DLRSCNYYMD+LAT    ++KRYV +++ E++E +  +NG+  + HG+L+ + IHGHRMY
Sbjct: 881  DLRSCNYYMDLLATMSSTSIKRYVSRQSHELFESIRRDNGRTEKEHGSLAALTIHGHRMY 940

Query: 958  GLPPTEPTYFCQWDMDFGHLNIDSNMFFLQGLFGAFYKIGFGYKDLENILLYETEIIDDM 1017
            GLPP EPTYFCQW +D   L I+S+  F +G F  F  IGFGY +LEN LLY+ E  DDM
Sbjct: 941  GLPPIEPTYFCQWGIDLDGLTINSDAEFAKGFFTLFAGIGFGYTNLENTLLYDVETPDDM 1000

Query: 1018 TSLTIFINTIDIRLNDVDTTAHADLKLERFCFTLIDFENERYSKRMDIKIPSLEFNIFSN 1077
            TS+T+ +  +++ + +  + A  D+      FT IDFENERYS+R+D+K+PSL   + ++
Sbjct: 1001 TSVTVRVRDMNVVVENDSSRAVVDVP--NLTFTSIDFENERYSQRIDLKVPSLSILLLTS 1058

Query: 1078 EDND--LSLLNFKVDMNFTNFVQNQDFNKHRKIQRDYIVLNDAPYHRCAFLLPESYQKSR 1135
            ED+   + L++    +  T+F+Q +DF KHR  QRDYI LND+P++RC+FLLP   Q+S 
Sbjct: 1059 EDDSEPIRLMDLTTKVYLTDFIQKRDFAKHRSKQRDYITLNDSPFYRCSFLLPCYLQESP 1118

Query: 1136 IYNELFGXXXXXXXXXXXXXXXTADTIEYVLEDLLEDYMGLFEGNYDIK------ESSVE 1189
            +Y  L G                A+TI++++EDLL ++    + +YD +      +S  E
Sbjct: 1119 LYKSLLGSISPSSSLPPLPMPLLAETIDFIIEDLLGEFAAGLKCDYDTQRTVDDPDSPSE 1178

Query: 1190 NLELSAIEATRAITGIGAERTHSNPITLSDYAVES-DNYVVKVESIVIDINPALYTTIEK 1248
            + + S  +       +  +R    P  LS   +E  DN ++ V+ + +D++P + + ++ 
Sbjct: 1179 SFDTS--QEHEGPDDVRYDRFAQLPKILSPNPLEQYDNVIIDVKFLAVDLDPLICSYVDG 1236

Query: 1249 LLKHIYDQDAVQIIDGIEIGIVKRLSSIHDGVTTMTNVKVQIKHFNLFWGEKESDNVSMF 1308
            LL   +  + V IID IE+ IVKRL  + +  T + N+K+ +   N FWG+K +  V ++
Sbjct: 1237 LLGEFWKVNTVDIIDEIEMSIVKRLGQLWNN-TCVLNLKLYVVDINFFWGDKNAKVVDLY 1295

Query: 1309 FDKMDFALTEKTLEQNSEKNLLEMTVLAKIKAVRLTVVQQPGLIPTQERPPAITVGVEGF 1368
            FDK+DF L ++T + + E  + E   L+K+++VR TV  +      +ERPPA+++ VEG+
Sbjct: 1296 FDKLDFDLGQRTRDLDGETIVSEKITLSKLRSVRATVFDRSITEGVEERPPALSLAVEGW 1355

Query: 1369 EFWSTAIEKQVNSISVSSADITVDDAQVEWFFKYIVRQKYFFLDMLQSYNRIQNNRIESQ 1428
            E +S   EK V S+S+ S DITVD++Q+EW   YI  Q+    +ML S+ ++      ++
Sbjct: 1356 EAYSWMREKIVGSVSLLSTDITVDESQLEWLSVYIAEQRDLIKNMLTSFTKLHEYWQGTR 1415

Query: 1429 KELISRLTAASEYYQISHDPYVITKPAFIMRLSRGHVRENKSWKIITRLRHILTYLPKDW 1488
            ++L+  +T ASE+YQISH+PYVITKPAFIMRLS GHVREN SW+IITRLRHILTYLP +W
Sbjct: 1416 RDLLRDITTASEHYQISHEPYVITKPAFIMRLSNGHVRENPSWRIITRLRHILTYLPNEW 1475

Query: 1489 YLNVGQPLRDRKFDPSQDARSIFMSIFSNWRSWEFSDVARSYIYGKLFLNDHAEXXXXXX 1548
              N        +  P+ D+     S+ S+WR WE SD+ RSYIY  +FL+D ++      
Sbjct: 1476 RNNSAI-----QVSPTVDSTD--ASVASHWRRWEISDITRSYIYRTIFLSDQSKTQCQSL 1528

Query: 1549 XXXXXXNIGNFFMTVYSTNYDVDHSIVVSNAKLLLELTPSSTEPK-ENSLQREELIDISG 1607
                  +  +FF T+YS  Y V H+ V++ A ++ E  P++   K + +L  + +++++ 
Sbjct: 1529 KKMLKVDFHSFFFTIYSEGYRVAHNFVITRANIVGEEIPAAELSKVQQALDYDNVMNLTV 1588

Query: 1608 TVDVIXXXXXXXXXXXXXXIPILTEGSEKQPVKPPQDTIPKPFKMNAAFMVNSCDIQLVM 1667
            ++  I                     + K+        I K +K+N     +  ++Q V+
Sbjct: 1589 SLGAIKGELNDQLLKLRNIFSKAQTPALKR--SKTSINISKSYKVNVLLAFDRSELQFVL 1646

Query: 1668 DATKLNMNVNDGRISVLWENLQDSTAQAGSVVLFSKHTELVLKHINSVLAEGRVSNFYAT 1727
              T+L   + +G+ ++L E L++S A A S V F+K +E  LKH + VLAE        T
Sbjct: 1647 GQTRLTNRILNGKAALLLEKLKNSAAPALSFVFFAKRSESWLKHADLVLAEALSRELSLT 1706

Query: 1728 FTTDTWAQRPTYLIHSKSSSIHFRTMAKTERLVEAIKDIKLKIDQISEQLELERRLTQHP 1787
             T + W+  P+  I+ + S+ H R M  TE LV +IK I   I ++     +E+     P
Sbjct: 1707 MTAELWSYMPSLSINIQCSNSHIRAMTSTELLVNSIKQIMESISELKRHFAMEK---TTP 1763

Query: 1788 TVYDPNKS------NVIASCLFSNVSMDIMPVSPFALKNSAKQIDFFYNKFDSDSWLIKL 1841
             V   + +      N   +  FS+V+ ++MP++PF +++  KQ+  + N+  S+  LI +
Sbjct: 1764 NVQGTSTNLSIPLQNTALTVSFSDVTAELMPLTPFVVRHEMKQLGLYLNRVQSNEILISI 1823

Query: 1842 KDTDFFLTSDQTKEQYMRLSMKKLQIRVNVSSSKPKLVDINLSTNLVKLTFSEPKNIVYS 1901
             D +  L S QT EQY   ++  LQ++ N+ +    ++++ LST+L+KLT SEP+ I+ S
Sbjct: 1824 WDANIILKSHQTTEQYFNFALGDLQVKCNLPTESSAILNVGLSTSLMKLTLSEPRRILSS 1883

Query: 1902 FLKDERVASESVHLLQTLKPLFSISDDKESTPQSYQEKTEYLWSLDSSIDYFGILIPMTS 1961
            FL+DE++  ES+  ++ L  LFS         ++  + +   WSLD++++YFGIL+PM S
Sbjct: 1884 FLQDEKLIGESLGYIKGLLQLFS------PLARNKTQSSALRWSLDANLNYFGILVPMAS 1937

Query: 1962 TYYVMEFHSYVSSISNA-NGAPSGNLDITGHMSVENILFLIKESSLPDGLSKVIDIAVNV 2020
            T++V E H  +++++NA +G   G+  +TG +S+EN L LIKE SLP  LSK++D ++ V
Sbjct: 1938 TFFVFEIHMLLAAMNNASDGQDEGDHHVTGQVSIENCLLLIKEPSLPADLSKLLDFSIRV 1997

Query: 2021 STLQRVDDNSRSIQVESSHARICLSPDSLLRLLWGFNQGHKLSEHYLKYHSK-------S 2073
             + Q+V ++ +S Q+ESSH R+CLSP SL+++LWG +Q   L E++ K+  +       S
Sbjct: 1998 MSSQKVPNSPQSYQIESSHFRVCLSPGSLVQVLWGTHQLQSLLEYFRKHRKQDKAISPFS 2057

Query: 2074 LWQSFAKSDDKQQDTNSIKSNETSFFSSINSIHFLSYNLCVGWLFEYELGPPKGLITGYS 2133
            L+   A S D+Q D                SIH LSYNLC+GW+F+       GLI G+ 
Sbjct: 2058 LFDGSA-SADRQID--------------FRSIHILSYNLCIGWMFQLGDDVKTGLIIGFD 2102

Query: 2134 RLFSAYENCMGKLTVIDSYFAAAQGNTSSTFYPETNVKELFNRFYLPNMQILFWWKVIEG 2193
            RLFSAYE   GKLT+ID YF+ A G ++ TFY + + K+ +NR +L N+QI +W K I+ 
Sbjct: 2103 RLFSAYEKHYGKLTLIDGYFSVANGQSTDTFYSQGSEKQRYNRSFLSNVQITYWLKEIDS 2162

Query: 2194 MKDVYVRFTGETLDVKYLSDFMLTIESTLHSIKMFQKLKKELIVETPKREVVHIKEDKPX 2253
            MKD+++R  GE L+V  LS+    IESTL SI+ FQ LKKE + +        +  +   
Sbjct: 2163 MKDLFIRVNGEALEVSLLSNSFDIIESTLASIQKFQTLKKERMHKRDSGPRNKLNLENTS 2222

Query: 2254 XXXXXXXXXXXXXXCHFKYDGGTYSVFNISDGSLNPTPAIEIKSPVISVDVLYKHEKQNT 2313
                          C FKY GG   ++++ D +    P++EIKSP + + + Y H +   
Sbjct: 2223 NNISPFLSHIRTIDCQFKYVGGVLKIYSLDDLNRAEGPSLEIKSPGVVIALKYNHNEAER 2282

Query: 2314 KHHSIRCLVNIDPTHNVLYATCAPLVKNFVEDVRSIFGRYESENKHSETTPTSVQNIDYE 2373
            + H IRCLV+IDPTHN+LY+ C P++ + VE  + +  ++  +    ET   S Q+IDY+
Sbjct: 2283 RPHRIRCLVSIDPTHNILYSQCVPILNDIVEASQRMVQKHSPD----ETPLESSQSIDYK 2338

Query: 2374 KLLEDYDLAITVTSAKQQLSLSCEPKAKVQADVGFEALTVSMTTNPFDIDEPLAFSFSIK 2433
             LL+ +D+A  VTS +QQLSLSCEP+AKVQADVGF++ T  +TTN      P   S S++
Sbjct: 2339 SLLDSFDIAFKVTSGRQQLSLSCEPRAKVQADVGFDSFTFGVTTNDLVDGNPTGVSLSVE 2398

Query: 2434 DTKASIKHLFSRETSTSFGVGYLDLTLLFTHTNRINTYGTSLISDIDLYFNVKQLQNLYL 2493
              ++S++H+FSRETS SF V ++D T +FTH    + +G +L+SDI+++FN+KQLQNL L
Sbjct: 2399 KIQSSVRHIFSRETSASFSVDFVDFTSIFTHP---DVFGVALVSDINVFFNMKQLQNLNL 2455

Query: 2494 FLDIWQLSELLNPVTSSQEQVIRKDKKK-SVDKPIHNESQLPWCFTLIFTNVKGDIDLGP 2552
            FLDIWQL+  LN    +++   +K  K  ++ K     + + W FTLIFTNVKGD+DLGP
Sbjct: 2456 FLDIWQLNGKLNNKGRAKDDDRKKQTKSMTLSKRTSTPTSICWSFTLIFTNVKGDVDLGP 2515

Query: 2553 SLGLISLRLSRTWLATDHFSGKRQILHAFVDDLLLISEGRLSGVVNIDGASWVSEVIWLQ 2612
            SLG++SLRLSRTW ATDH+  +R++LHAF D+L + SEGRLSGV ++  A+W+SEV +  
Sbjct: 2516 SLGVLSLRLSRTWFATDHYGAQRRVLHAFADELSIKSEGRLSGVFDLKNATWISEVNYPA 2575

Query: 2613 DSKRDNIPLVALSLNTDKIEIKAAFDYHMFLIGTVNNILFQLHSERDMVGVAPDLLKVSF 2672
                     ++LSL+  ++ IK AFDYHMFLIGT++ + F L SE D+ G+ PDLL V+ 
Sbjct: 2576 AGSIKGSSEMSLSLSVGRVAIKTAFDYHMFLIGTIDEMKFHLRSESDLYGILPDLLVVAL 2635

Query: 2673 SCEEIKLCSTALVAANILDIYNTIIRMRQDTKISYIETLKDSNMETNKQTLAYRDILKSL 2732
            SC+E+  C+TAL AANILDIYNTI RMRQD +ISYIETL++SN    + TL Y DIL+SL
Sbjct: 2636 SCKEMDFCATALTAANILDIYNTITRMRQDNRISYIETLRESNSTEARVTLLYDDILQSL 2695

Query: 2733 QLLRTDLTVSICSLQLQISPISLFDXXXXXXXXXXXSARSETHSEAKLTTSLNMEVYDAT 2792
             LLRTDL+  I + + QISPISLFD           SARSET S  KL T L+++V +A 
Sbjct: 2696 NLLRTDLSFDITTFKAQISPISLFDVEVLVLNIDNVSARSETQSGEKLKTELHLQVSNAK 2755

Query: 2793 LSLSTAKQELDEDALSKITVADYMTYASKIRGGTIIEIPRMGVQMTTWQEEKSDILEYLY 2852
            +SLST+K+ELDE+ ++KI++ DYM YASKI GGTI+++PR+ V MTTWQ+ KSD++EYL+
Sbjct: 2756 VSLSTSKEELDEERVAKISIEDYMLYASKISGGTIVKVPRLLVSMTTWQKPKSDLIEYLF 2815

Query: 2853 SCKFHDKVAVRWNLGPVNFMKEMWTTHVKAIAVRRSQVLTGSFNVSEKDVEKRIKEEENI 2912
            +C+F D+VAV+WNLGP+NF+KEMW+TH+K++AVR++Q    +  +SEKD +  +  EE I
Sbjct: 2816 TCRFFDRVAVKWNLGPINFIKEMWSTHIKSLAVRQTQ---SNKTMSEKDKQADLDPEEEI 2872

Query: 2913 -TKLNYVPVEEPQIDMPQIKDLGDATPPVEWFGVNRKRFPAFTHQTAVVPVQNLVYLAQK 2971
              KL YVP++EP I+MPQIKDLGDATPP+EWFGV+RKR PA THQ A+V +Q LV+ A+K
Sbjct: 2873 KAKLQYVPLDEPYIEMPQIKDLGDATPPMEWFGVHRKRLPAATHQLAIVLIQKLVHAAEK 2932

Query: 2972 QYAKTLGR 2979
            +YAK  GR
Sbjct: 2933 EYAKVQGR 2940

>Kpol_392.7 s392 (10369..19356) [8988 bp, 2995 aa] {ON} (10369..19356)
            [8988 nt, 2996 aa]
          Length = 2995

 Score = 2459 bits (6374), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1287/3042 (42%), Positives = 1899/3042 (62%), Gaps = 120/3042 (3%)

Query: 8    AGFRGESLGFKRNFSWVFLVDWILTVILTLATLFYLSRAFAYGVTFILEWLLWKQAKVKV 67
            + F   SLG ++ FSWVFL  W+LT I +L  +FYL R F    TFIL W +WK+ KVK+
Sbjct: 5    SQFASISLGREKYFSWVFLAYWVLTCIASLTVIFYLPRVFGAIFTFILHWSIWKKYKVKI 64

Query: 68   SIGALRISLLAGRVFFKNLTIIDKDRTITILEGSITWRYWLIRTRKSEYRVAQMAHASAG 127
            +I ++R+S L G VF KN++II++D T++ LE  I WRYWL+ +R+ EY+V Q   +S  
Sbjct: 65   NIESIRVSFLGGTVFIKNMSIINQDFTLSFLECRIKWRYWLLNSREVEYKV-QANLSSEQ 123

Query: 128  SSGNSEDDTKFDIANYM--EKQLKLPCRFLFECEGFEMFIYNRTYAYDNIVNVLSKVERE 185
            S G+       D +N M  EK  KLPC  L EC+GFE+F+YNR  AY+N++ + +K ERE
Sbjct: 124  SQGS-------DASNSMTIEKNSKLPCTILIECKGFEVFVYNRKAAYENVLRLFTKEERE 176

Query: 186  KFEKFMAENDFLDPSSDGS---SDDKIEETSSATNSTDEETIANDRTFQN--DTRKTLPR 240
            KF  F+ E+D  D  S+ +   S DK    S  T ++ E T+ NDRT++   D RK++  
Sbjct: 177  KFSSFLNEHDLGDIVSEDTNVNSMDKDYFESVTTENSSESTVINDRTYKKNKDERKSI-- 234

Query: 241  YLEALPIEALLNKGSILIGNKFTPCVLILSFESAVALQDVGEAPSKLDLYRMKYEVRLKN 300
                LPI+  L  G++ +GN+FTP +++ S+E+   + DV  A  K+DLY+ K  ++ ++
Sbjct: 235  LFNFLPIQLRLIHGAVTLGNRFTPSLVVASYENCNGVLDVSHANEKIDLYKSKVTMKFQD 294

Query: 301  LEIMMKQNIDYDNEKSRNFEFDKGKLSRLWHRFTRIFKLVPFPFKS---NRRKEQPHD-- 355
            + I +K N+ YD+E +   + DKGKLSR+W+ F  I  ++P PF        K++ HD  
Sbjct: 295  VNISVKPNLAYDSEFTNELDIDKGKLSRIWNTFIDIMDMIPNPFTKIYHKHMKKKEHDVE 354

Query: 356  -NFMQKWKGLSMYRNDMF-GXXXXXXXXXXXXSSHEYAKFTSLLKSPRVTIHHDYDMPGW 413
              F+ KW+GLS+Y++++                + EYAKF+S+LK P  T+ +  D PG 
Sbjct: 355  SMFVNKWRGLSLYKDNLRDAGRYGLDEASYDFLNREYAKFSSILKCPNFTLSYYLDSPGI 414

Query: 414  VPHGAHPPSSYADGPDVGNNMAPPQYIFEINIFGGTVCYGPWAQRQTNHLQSLLSPSVSR 473
            VPHGAH  +   DGPD+GN+ +PP+++ ++ +   ++ YGPW  RQ ++L  +LSP VS+
Sbjct: 415  VPHGAHQTNVKKDGPDIGNSGSPPEFLVDLQVSKASIYYGPWTNRQVSYLIRMLSPVVSK 474

Query: 474  TAKPIKKLKPGSKRIYTVLKLTINAMEDVTWRIPTRESSKDVEFLMHYKETNDDYRPFGW 533
               PIKKL+PGS+RI+TV K++++ +++ +WRIPTRE SKD EF+  + +TNDD+RPFGW
Sbjct: 475  NQIPIKKLEPGSRRIHTVFKMSVHIIDESSWRIPTREPSKDKEFIKQFVKTNDDFRPFGW 534

Query: 534  IDIKVSRDSCGIFDLAMCPTSKGFKNTIDVQLVDTEIRSSVNHDIFLKSKSFSFNCDIGY 593
            +D  +++ +   F+ ++ PT  G  N  D+  +D E+ +SVNHDI LKSK F    DIGY
Sbjct: 535  LDFNLNKGTQATFNFSLIPTIDGLGNNFDIHFLDMEVTTSVNHDILLKSKEFDVVADIGY 594

Query: 594  PLGWNAEANWTIIMDSNQLELFLLREHVTLIADTLTDFSSGEPVPYELFRPFVYHIKWNM 653
            PLGWN++A+W   + + QLE FLL+EH++L +D  +DF+S +P PYELFRPF Y + W++
Sbjct: 595  PLGWNSQADWKFDIIAKQLETFLLKEHISLFSDMFSDFASEDPTPYELFRPFTYSLNWDI 654

Query: 654  KGYSFYLNVNDHNIVNNPLDFNENCYLSIHGDDLTMNVMVPKKTITSRFTNMTYDIYTPM 713
            +GYS YLNVND NIVNNPLDFNENCYLS+HGD+L ++ ++P   I+  +T + ++IYTPM
Sbjct: 655  EGYSIYLNVNDRNIVNNPLDFNENCYLSLHGDELHIDSLIPNLLISQPYTEIAFNIYTPM 714

Query: 714  FRXXXXXXXXXXXXEFMRNKEVGRSHDFRLKGSYLIYSELDIDNVDTLTVECSSRGTALH 773
            FR            EFM++KEVGR+ DF ++GSYLIYS+LDIDNVDT+T+EC+SR T L 
Sbjct: 715  FRLLLNTPPWNTLSEFMKDKEVGRAFDFGIEGSYLIYSDLDIDNVDTITMECTSRSTTLF 774

Query: 774  IYGFVIRYLINVKMNYFGEFFHFVTSEEYTGNTRPTDLENIISEDRRDDDFS---SYESV 830
             YG VIRYL+NV+ NYFG+F HF+TSEEY+        E +   ++R +D     +Y + 
Sbjct: 775  CYGVVIRYLMNVQANYFGDFVHFITSEEYS--------EILQKNNKRSNDEQGSFTYSTT 826

Query: 831  SRISSNSSDXXXXXXXXXXXXX-----XXXXRTSNETDIWFTFSVWDGALILPETIYNAD 885
            S + ++SSD                      RT NE DIWFTF VWDGALILPE +YN +
Sbjct: 827  SSVQNSSSDDTVLYTKEQDLSKPHVRRADVLRTENELDIWFTFRVWDGALILPEGLYNGN 886

Query: 886  PCIALHFAELIVDLRSCNYYMDILATACDINLKRYVGKRADEIYEYVHLNNGKDHEVHGT 945
             C +L F+EL++  R  NYYMD L    D+ + R++    DEI+ YV   +   + VHGT
Sbjct: 887  LCSSLLFSELMISFRGSNYYMDFLTNLYDMKINRFLNFSPDEIFRYVRDPDHNLNIVHGT 946

Query: 946  LSDIYIHGHRMYGLPPTEPTYFCQWDMDFGHLNIDSNMFFLQGLFGAFYKIGFGYKDLEN 1005
            LSD+ IH HRM+GLPP + TYFCQW +DFG L IDSN+ FL   FG F K+GFGY +LEN
Sbjct: 947  LSDVTIHAHRMFGLPPNKLTYFCQWSIDFGSLIIDSNIEFLSSFFGLFTKLGFGYSNLEN 1006

Query: 1006 ILLYETEIIDDMTSLTIFINTIDIRLNDVDTTAHADLKLERFCFTLIDFENERYSKRMDI 1065
             L+Y+ E  DDMT LT++   + I ++D  +   A L++ +     IDF+NERYSKR+++
Sbjct: 1007 KLVYKVESSDDMTLLTLYGEKVLILVSDDVSQKQASLEILKLKLNSIDFQNERYSKRINL 1066

Query: 1066 KIPSLEFNIFSNEDNDLS--LLNFKVDMNFTNFVQNQDFNKHRKIQRDYIVLNDAPYHRC 1123
            KIP    +IF   +  +   LL FK  ++FTNFV  +DF      QR YI L+D+PYHRC
Sbjct: 1067 KIPEFSISIFDVRNPTIKPILLGFKTKIDFTNFVIKEDFRNSLNGQRTYITLHDSPYHRC 1126

Query: 1124 AFLLPESYQKSRIYNELFGXXXXXXXXXXXXXXXTADTIEYVLEDLLEDYMGLFEGNYDI 1183
             F+LP  YQ+S +YNEL+G                 +TI++++ED L++Y  L E  + +
Sbjct: 1127 FFILPTMYQESFLYNELYGGITPSFSIPILPIPMLPNTIDFLVEDFLKEYSDLLENPF-L 1185

Query: 1184 KESSVENLELSAIEATRAITGIGAERT-----HSNPITLSDYAVESDNYVVKVESIVIDI 1238
               S+ NL+ S++     +    +E+        N +   D   E DNY++ VE I +DI
Sbjct: 1186 NIRSINNLDTSSLFNEYRVDTYISEKAIFKAEEKNTVNY-DPKYEYDNYILNVEYIRVDI 1244

Query: 1239 NPALYTTIEKLLKHIYDQDAVQIIDGIEIGIVKRLSSIHDGVTTMTNVKVQIKHFNLFWG 1298
            NP     I+ +   +Y ++ V IID IE+ IV+RL S    +   TN+K++I + ++FWG
Sbjct: 1245 NPLFSDFIDSMSTKLYSENMVDIIDEIEMIIVRRLGSPKKVLLRETNLKLKISYVDIFWG 1304

Query: 1299 EKESDNVSMFFDKMDFALTEKTLEQNSEKNLLEMTVLAKIKAVRLTVVQQPGLIPTQERP 1358
             + S+ + ++ DK+DF + ++  +  ++++L E T+L+K+K++R +  +        ERP
Sbjct: 1305 SRNSEGIEIYLDKLDFEMRQRIFDDFNQRSLEERTILSKLKSLRCSFSETQYEEIEYERP 1364

Query: 1359 PAITVGVEGFEFWSTAIEKQVNSISVSSADITVDDAQVEWFFKYIVRQKYFFLDMLQSYN 1418
            PA+++ VEG E WS     Q NSI++ S DITVD +Q  W  KY+ +Q  FF ++  S +
Sbjct: 1365 PALSLTVEGLEVWSCTNTAQSNSINILSTDITVDGSQTSWLIKYLNKQVEFFYNLKGSVD 1424

Query: 1419 RIQNNRIESQKELISRLTAASEYYQISHDPYVITKPAFIMRLSRGHVRENKSWKIITRLR 1478
             +Q   +  QK LIS+LT ASEYYQI HDPYVITKPA IMRLS  HVREN+SW+I+TRLR
Sbjct: 1425 LLQKRDVTLQKSLISKLTTASEYYQIDHDPYVITKPALIMRLSNSHVRENRSWRIVTRLR 1484

Query: 1479 HILTYLPKDWYLNVGQPLRDRKFDPSQDARSIFMSIFSNWRSWEFSDVARSYIYGKLFLN 1538
            HIL YLP+ W  +    +  R      D +++F+S+FSNWR+WE SDVARSYIY ++FL 
Sbjct: 1485 HILNYLPEGWEKSSIAFVEARHVYSDSDPKNVFLSVFSNWRNWEVSDVARSYIYRRVFLP 1544

Query: 1539 DHAEXXXXXXXXXXXXNIGNFFMTVYSTNYDVDHSIVVSNAKLLLELTPSSTEPKENSLQ 1598
            D                + +F+ T+YS  Y VDH+IVV+   ++++   S  EPK  +  
Sbjct: 1545 D---IEKNLINNTTKIGMESFYFTIYSQRYAVDHNIVVTRINVIIDQMLSDEEPKAATAN 1601

Query: 1599 REELI-DISGTVDVIXXXXXXXXXXXXXXIPILTEGSEKQPVKPPQD-TIPKPFKMNAAF 1656
            + + I DI+GTV                   + +E   K   +   D +IPK FK+N   
Sbjct: 1602 KNDKIYDITGTVGTFKGELGDQLIRLKK---LYSEDKAKIRSEKSTDFSIPKFFKINIVL 1658

Query: 1657 MVNSCDIQLVMDATKLNMNVNDGRISVLWENLQDSTAQAGSVVLFSKHTELVLKHINSVL 1716
            +V   ++ L    TKL   + +G+IS  +EN +D    +GS+V ++  TEL LKH   +L
Sbjct: 1659 IVEKGELTLAAANTKLISRIKNGKISGFFENARDVANASGSIVYYATRTELWLKHNELIL 1718

Query: 1717 AEGRVSNFYATFTTDTWAQRPTYLIHSKSSSIHFRTMAKTERLVEAIKDIKLKIDQISEQ 1776
             +  + + + +   +   ++PT L++ KSS + F+ +  T+ LV  +++ + +I +I+ +
Sbjct: 1719 LDAHLDDLFISVIAELLVKKPTILVNVKSSHLRFKALPNTKNLVVFLREFEREISKITGR 1778

Query: 1777 L---ELERRLTQHPTVYDPNKSNVIASCLFSNVSMDIMPVSPFALKNSAKQIDFFYNKFD 1833
            L   + ++R T    ++   K ++       ++S +I+ +SPF +K+S K++   +N+  
Sbjct: 1779 LTDKDNKKRHTSTSPIFSTKKIDISFDINIFDISSEIVILSPFTVKHSMKELKIVFNREG 1838

Query: 1834 SDSWLIKLKDTDFFLTSDQTKEQYMRLSMKKLQIRVNVSSSKPKLVDINLSTNLVKLTFS 1893
             +  +  + D D +LTS Q   QY RLS + + +   ++ SK KL+ IN+ T+L+KLT +
Sbjct: 1839 DNDTIFSILDADLYLTSYQNGVQYFRLSYQDINLEAMLTDSKSKLITINIVTSLIKLTLA 1898

Query: 1894 EPKNIVYSFLKDERVASESVHLLQTLKPLFSISDDKESTPQSYQEKTEYLWSLDSSIDYF 1953
            +PK I  S L+DE+   +S+  ++TL  LF  S ++E    +     +++ + D  + YF
Sbjct: 1899 DPKKITNSLLQDEKTFEQSLESIKTLNTLF--SSNREVRTSAVDNPYKFMVNFD--LTYF 1954

Query: 1954 GILIPMTSTYYVMEFHSYVSSISNANGAPSG-NLDITGHMSVENILFLIKESSLPDGLSK 2012
            G+L P+ ++Y+++E HS +++ SN    P      IT +++++N LF+IK   + + +SK
Sbjct: 1955 GLLFPVDTSYFILELHSLLATFSNVYMNPQQLKEKITCNLALQNTLFMIKSPEVNNQVSK 2014

Query: 2013 VIDIAVNVSTLQRVDDNSRSIQVESSHARICLSPDSLLRLLWGFNQGHKLSEHYLKYHSK 2072
            V+D +VN+ST  ++ ++ RS +VESSH R+CL+P+SLL++L G  Q     ++Y ++   
Sbjct: 2015 VLDFSVNLSTETKILNSKRSFEVESSHFRVCLNPESLLKILQGVFQTSSSFKYYKEHTRL 2074

Query: 2073 SLWQSFAKSDDKQQDTNSIKSNETSFFSSINSIHFLSYNLCVGWLFEYELGPPKGLITGY 2132
             ++++  K+    +  N I +    +     SIHFLSYN C+GW+FE       GLI GY
Sbjct: 2075 QIFKTKKKASVVSE--NLIGAPLIEY-----SIHFLSYNFCIGWIFENSQSSYPGLIMGY 2127

Query: 2133 SRLFSAYENCMGKLTVIDSYFAAAQGNTSSTFYPETNVKELFNRFYLPNMQILFWWKVIE 2192
             RLFSAYE+  GKLTV+D +F+ A G +S TFY + N KE +NR YLPN+QIL+W K ++
Sbjct: 2128 DRLFSAYEDSYGKLTVVDGFFSIANGFSSDTFYSQGNEKEKYNRSYLPNLQILYWLKEVD 2187

Query: 2193 GMKDVYVRFTGETLDVKYLSDFMLTIESTLHSIKMFQKLKKELIVETPKREVVHIKEDKP 2252
             MK ++VRF GET+DV++LS+F   I  T+ S++ FQ +KKE + E        + ED  
Sbjct: 2188 AMKQLFVRFYGETIDVRFLSNFATIINLTIESVQHFQMIKKETVREMNVEAEKKVGEDDI 2247

Query: 2253 XXXXXXXXXXXXXXXCHFKYDGGTYSVFNISDGSLNPTPAIEIKSPVISVDVLYKHEKQN 2312
                           C   YDGG ++V+ +    ++   AIEI +P + +DV YK+    
Sbjct: 2248 STKFSLFFSKVQRINCQCIYDGGVFTVYPVRGNHIDTEHAIEITTPKVIIDVDYKYRIDM 2307

Query: 2313 TKHHSIRCLVNIDPTHNVLYATCAPLVKNFVEDVRSIFGRYESENKHSETTPTSVQ-NID 2371
             K H IR  +NI+PT+N L +  A  +  F E V  +  ++    K     P +V   ID
Sbjct: 2308 KKPHWIRSFINIEPTYNTLLSQFASFLTEFGESVHEMVAKFSP--KEQPPAPKTVSPPID 2365

Query: 2372 YEKLLEDYDLAITVTSAKQQLSLSCEPKAKVQADVGFEALTVSMTTNPFDIDEPLAFSFS 2431
            Y+++LED+D++ ++++ KQ++SLSCEP AKV A+VGFE+   S+ TN  D  EPL+ S +
Sbjct: 2366 YKRILEDFDVSFSISAGKQKVSLSCEPVAKVHANVGFESFVFSIITNDDDPTEPLSCSLT 2425

Query: 2432 IKDTKASIKHLFSRETSTSFGVGYLDLTLLFTHTNRINTYGTSLISDIDLYFNVKQLQNL 2491
            + D K SI H FS E + SF V ++D+T LFTH    + YGT+LISD+ LYFN+KQLQNL
Sbjct: 2426 VNDIKTSINHEFSTEPTASFSVDFVDITTLFTHP---DIYGTTLISDVSLYFNIKQLQNL 2482

Query: 2492 YLFLDIWQLSELLNPVTSSQEQVIRKDKKKSVDKP----------IHNESQLPWCFTLIF 2541
             +FLDIW L  L+          +R  K   V KP            N + +PW FT+I 
Sbjct: 2483 MVFLDIWNLKRLIK---------LRPQKSVPVKKPESRVSSSTKSSSNTTIIPWSFTVII 2533

Query: 2542 TNVKGDIDLGPSLGLISLRLSRTWLATDHFSGKRQILHAFVDDLLLISEGRLSGVVNIDG 2601
            T++ GDI LGPSLG +SL+L + W++T+HF  +R+ L  F D L L S GRL G++++  
Sbjct: 2534 TDINGDIHLGPSLGNLSLKLKKNWISTNHFQDRRKALRFFTDSLSLTSVGRLGGLIDVAN 2593

Query: 2602 ASWVSEVIWLQDSKRDNIPLVALSLNTDKIEIKAAFDYHMFLIGTVNNILFQLHSERDMV 2661
             SW+  V ++++ K D  PLV ++LN + + +KAAFDYHMFLIG V+NILF L SE+D++
Sbjct: 2594 ISWILNVRYVENEKLDQSPLVDITLNVENVAVKAAFDYHMFLIGRVHNILFNLESEKDLI 2653

Query: 2662 GVAPDLLKVSFSCEEIKLCSTALVAANILDIYNTIIRMRQDTKISYIETLKDSNMETNKQ 2721
            G  PDLLK+   C+EI +CSTALVA+NILDI NTI R RQD++ SYIETL +SN    K 
Sbjct: 2654 GNLPDLLKLHLVCDEIDICSTALVASNILDISNTISRTRQDSRNSYIETLLESNPPPQKS 2713

Query: 2722 TLAYRDILKSLQLLRTDLTVSICSLQLQISPISLFDXXXXXXXXXXXSARSETHSEAKLT 2781
            +++Y DILKSL LLRTD+ + I  +Q+QISPISLFD           SARS T S  KL 
Sbjct: 2714 SISYTDILKSLNLLRTDVGIEIHKMQVQISPISLFDVEVIVTTVENVSARSVTQSGEKLM 2773

Query: 2782 TSLNMEVYDATLSLSTAKQELDEDALSKITVADYMTYASKIRGGTIIEIPRMGVQMTTWQ 2841
            T L M++Y ATLSLS + +ELDE+A+S+I+V DYM YA K+ GG I+ IP++ V MTTWQ
Sbjct: 2774 TDLQMKIYKATLSLSKSNEELDEEAVSEISVDDYMIYAMKLSGGKILSIPKLFVGMTTWQ 2833

Query: 2842 EEKSDILEYLYSCKFHDKVAVRWNLGPVNFMKEMWTTHVKAIAVRRSQV----------- 2890
             E S I+EYL++CKFHDK++VRWNLGPVNF+KE+W THVK++AVRR+Q+           
Sbjct: 2834 LENSKIIEYLFACKFHDKISVRWNLGPVNFIKEVWATHVKSLAVRRAQLKGDKEPQLVPG 2893

Query: 2891 LTG--SFNVSEKDVEKRIKEEENI----------TKLNYVPVEEPQIDMPQIKDLGDATP 2938
            + G  S  VS +++E    E  N            K  YVP++EPQI+MP+IKDL DATP
Sbjct: 2894 IIGEPSPLVSSEELEMLRSESSNADNDNNEYSEEDKFIYVPLKEPQIEMPKIKDLEDATP 2953

Query: 2939 PVEWFGVNRKRFPAFTHQTAVVPVQNLVYLAQKQYAKTLGRS 2980
            P+EWFGVNRK+FP  THQTA++ +Q +V++AQK+YAK LG S
Sbjct: 2954 PLEWFGVNRKKFPRVTHQTAIILIQKIVHVAQKEYAKVLGDS 2995

>ZYRO0C01694g Chr3 (121250..130270) [9021 bp, 3006 aa] {ON} similar to
            uniprot|Q12150 Saccharomyces cerevisiae YLR087C CSF1
            Protein required for fermentation at low temperature
          Length = 3006

 Score = 2407 bits (6237), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1276/3063 (41%), Positives = 1875/3063 (61%), Gaps = 155/3063 (5%)

Query: 10   FRGESLGFKRNFSWVFLVDWILTVILTLATLFYLSRAFAYGVTFILEWLLWKQAKVKVSI 69
            F+  SL   RNFSWVFLVDW+LT I+TL  +FYL R F + +TFILEW++WK+ KVK++I
Sbjct: 7    FQKVSLDRTRNFSWVFLVDWVLTCIVTLTVIFYLGRIFGFLLTFILEWVVWKRCKVKINI 66

Query: 70   GALRISLLAGRVFFKNLTIIDKDRTITILEGSITWRYWLIRTRKSEYRVAQMAHASAGSS 129
             +LRI+ L G + F+NL II +D TI+ LEG+I WRYWL  +RKS+Y+            
Sbjct: 67   ESLRIAPLGGNIMFRNLCIIHRDYTISCLEGTINWRYWLFNSRKSQYQ------------ 114

Query: 130  GNSEDDTKFDIANYMEKQ----LKLPCRFLFECEGFEMFIYNRTYAYDNIVNVLSKVERE 185
              + D+ +  + N  E +     K PCRFL  CEG E+F+YN+T +Y+NI+++ SK ER 
Sbjct: 115  -ENLDNEEERLENGQEPKSNSGRKHPCRFLLACEGLEIFVYNKTSSYENIIHMFSKEERA 173

Query: 186  KFEKFMAENDFLDPSSDGSSDDKIEETSSATNSTDEETIANDRTF-------------QN 232
            +FEKF+ +    +  ++   ++K+   S+ ++ T E   +NDR               QN
Sbjct: 174  QFEKFVDDQTMTELFNESEQENKVLSESTPSSVTMETVGSNDRNNNEDSNEEEDAGRNQN 233

Query: 233  D------------------TRKTLPRYLEALPIEALLNKGSILIGNKFTPCVLILSFESA 274
            D                   RK++  Y+  LPI+    + S+++GN+FTP +L++S +++
Sbjct: 234  DGQAPNNLENDELFEQQCSNRKSM--YMRFLPIQISTRRFSLVLGNRFTPSILVVSAKNS 291

Query: 275  VALQDVGEAPSKLDLYRMKYEVRLKNLEIMMKQNIDYDNEKSRNFEFDKGKLSRLWHRFT 334
              + D+     KLDL+++K E  L +++  +KQNI +D++ S +F++ +G+LS+LW +F 
Sbjct: 292  KGIIDLCPPKEKLDLFKIKLEKELYDVDASVKQNIGFDDDISTSFKWTRGRLSKLWQKFA 351

Query: 335  RIFKLVPFPFKSNRRKEQPHDNFMQKWKGLSMYRNDMFGXXXXXXXXXXXXSSHEYAKFT 394
            RIF L+P        + Q    F + WKGLS+YR +M              ++HEYA+  
Sbjct: 352  RIF-LLP-TLGPKHLQTQEDITFRENWKGLSLYRQNM--EEDELENVDFDFANHEYARVI 407

Query: 395  SLLKSPRVTIHHDYDMPGWVPHGAHPPSSYADGPDVGNNMAPPQYIFEINIFGGTVCYGP 454
            S+LKS ++   ++YD+PG VP     P     GP+VGN+ APP++  +I ++G  +CYGP
Sbjct: 408  SILKSAKIVFTYEYDIPGLVPK---EPEETLQGPEVGNSGAPPEFGVDIQLYGANICYGP 464

Query: 455  WAQRQTNHLQSLLSPSVSRTAKPIKKLKPGSKRIYTVLKLTINAMEDVTWRIPTRESSKD 514
            WA+RQ ++L++LLSP VSRT KPIK L PGS+RIYT+ K +I+ ME+ TWRIPTRE SKD
Sbjct: 465  WAERQLSYLRALLSPVVSRTPKPIKTLTPGSQRIYTIFKTSISIMEESTWRIPTREKSKD 524

Query: 515  VEFLMHYKETNDDYRPFGWIDIKVSRDSCGIFDLAMCPTSKGFKNTIDVQLVDTEIRSSV 574
             EFL HY ET +++RPFGWID+K  +DS GI D  +CPT +G  N ++    + EIR+SV
Sbjct: 525  QEFLRHYVETKEEFRPFGWIDLKFMKDSYGILDTVICPTEEGSPNNVNFHFSNMEIRTSV 584

Query: 575  NHDIFLKSKSFSFNCDIGYPLGWNAEANWTIIMDSNQLELFLLREHVTLIADTLTDFSSG 634
            NH++ L++KSF F  D+GYPLGWN +ANW I + S QLE+F+LREH+TLI+D   DFSSG
Sbjct: 585  NHELLLRAKSFDFEADMGYPLGWNDQANWNINLSSTQLEIFILREHITLISDVFADFSSG 644

Query: 635  EPVPYELFRPFVYHIKWNMKGYSFYLNVNDHNIVNNPLDFNENCYLSIHGDDLTMNVMVP 694
            +P PYELFRPF+Y I WN+ GYS YLNVNDHNIVNNPLDFNENCYLS+HGD L  +V +P
Sbjct: 645  DPTPYELFRPFIYRINWNLDGYSIYLNVNDHNIVNNPLDFNENCYLSLHGDHLIFDVKIP 704

Query: 695  KKTITSRFTNMTYDIYTPMFRXXXXXXXXXXXXEFMRNKEVGRSHDFRLKGSYLIYSELD 754
            ++T+ +R T +TY I TPMFR            EFM+NKEVGRS++F++ G Y ++SELD
Sbjct: 705  RQTVANRCTEITYHISTPMFRLLLNTPPWNTLNEFMKNKEVGRSYNFQVNGLYTVFSELD 764

Query: 755  IDNVDTLTVECSSRGTALHIYGFVIRYLINVKMNYFGEFFHFVTSEEYTGNTRPTDLENI 814
            IDNVDT++VECSS GT LH YGFV+RYL+NVKMNYFG+F HFVT+EEYT      + +N 
Sbjct: 765  IDNVDTISVECSSFGTTLHCYGFVVRYLMNVKMNYFGDFSHFVTAEEYTNANHTEEPKNE 824

Query: 815  -ISEDRRDDDFSSYESVSRISSNSSDXXXXXXXXXXXXXXXXXRTSNETDIWFTFSVWDG 873
             + ++    + SS E V    +N  +                 RT NE DIWF FSVW+G
Sbjct: 825  NLGDEHSGFNISSTEDVETDRTN-PEGRPANKGIPMPKRSELKRTENEMDIWFVFSVWEG 883

Query: 874  ALILPETIYNADPCIALHFAELIVDLRSCNYYMDILATACDINLKRYVGKRADEIYEYVH 933
            ALILPETIYN+DPCIALHF EL VDLRS NYYMD+LAT  +  LKRYV +   +++E V 
Sbjct: 884  ALILPETIYNSDPCIALHFNELEVDLRSTNYYMDLLATMNNTELKRYVSRHPHDLFECVR 943

Query: 934  LNNGKDHEVHGTLSDIYIHGHRMYGLPPTEPTYFCQWDMDFGHLNIDSNMFFLQGLFGAF 993
             +NG+  + HG LS + IHGHRMYGLPPTEPTYFCQW +D   L I+S++ F +G    F
Sbjct: 944  KDNGRQEKSHGYLSSLTIHGHRMYGLPPTEPTYFCQWGVDIDRLEINSDLEFAKGFLTCF 1003

Query: 994  YKIGFGYKDLENILLYETEIIDDMTSLTIFINTIDIRLNDVDTTAHADLKLERFCFTLID 1053
             KIGFG+K+LENILLYET  + DMTS+T+ +  +   +ND DT++ + L  ++  FT ID
Sbjct: 1004 SKIGFGFKNLENILLYETNTLFDMTSVTVRVKELKFMMNDADTSSRSVLHAKKITFTAID 1063

Query: 1054 FENERYSKRMDIKIPSLEFNIFSNEDNDLS---LLNFKVDMNFTNFVQNQDFNKHRKIQR 1110
            FENE YS+R+D K P + F IF  ++N      LL+ K  +NFT+F+QNQ F  HR  QR
Sbjct: 1064 FENEAYSQRVDFKFPDINFLIFELDENQKEGRFLLHLKTQLNFTDFIQNQAFADHRYRQR 1123

Query: 1111 DYIVLNDAPYHRCAFLLPESYQKSRIYNELFGXXXXXXXXXXXXXXXTADTIEYVLEDLL 1170
            +YI L+D+ Y+RC+FLLP  +Q+S +Y EL G                A+TI+Y++ED L
Sbjct: 1124 EYITLHDSAYYRCSFLLPCFFQESVLYKELLGSISPSATLPPLPLPVLAETIDYIIEDCL 1183

Query: 1171 EDYMGLFEGNYDIKESSVENLELSAI-EATR--AITGIGAERTHSNPITLSDYAVESDNY 1227
             +Y    + +      + E        E TR  A +G  +     NP    D     +NY
Sbjct: 1184 GEYAPTVKPDDSSSSDTSEGQRTPLTNEDTRFQANSGFFSPHMPHNPPNNRD---RYNNY 1240

Query: 1228 VVKVESIVIDINPALYTTIEKLLKHIYDQDAVQIIDGIEIGIVKRLSSIHDGVTTMTNVK 1287
            V+ VE + +++ P++   +   LK  Y +D   IID  EI IVK+L ++  G + +T  +
Sbjct: 1241 VLDVEYVNLEVKPSVTGVLLNYLKKFYTEDTTDIIDKNEIAIVKKLGNLQYGASFVTTSR 1300

Query: 1288 VQIKHFNLFWGEKESDNVSMFFDKMDFALTEKTLEQNSEKNLLEMTVLAKIKAVRLTVVQ 1347
            + +K  +  +  +E   V +  +  DF L  KT+E   EK +LE T+ + I  +R+++++
Sbjct: 1301 LHVKDLHFLYDFEEGSGVELALNSFDFDLRRKTIENEDEKVILEKTMFSNIHTLRISLLE 1360

Query: 1348 -QPGLIPTQERPPAITVGVEGFEFWSTAIEKQVNSISVSSADITVDDAQVEWFFKYIVRQ 1406
              P  I    +P A+ + +E  E WS+ +++ VNS++V+S   T+D++Q+E    Y+  Q
Sbjct: 1361 AHPSSISM--KPAALQLSIEDLELWSSTVDENVNSVNVTSFGFTLDESQLERISGYLFGQ 1418

Query: 1407 KYFFLDMLQSYNRIQNNRIESQKELISRLTAASEYYQISHDPYVITKPAFIMRLSRGHVR 1466
                 D + S   ++N R ++QK+LI  LT+ASEYYQISHDPYVITKPAFIMRLS GHVR
Sbjct: 1419 IKVLRDTITSAKELENLRKKTQKDLICDLTSASEYYQISHDPYVITKPAFIMRLSEGHVR 1478

Query: 1467 ENKSWKIITRLRHILTYLPKDW----YLNVGQPLRDRKFDPSQDARSIFMSIFSNWRSWE 1522
            EN+SW+IITRLRHILTYLP DW    +L   Q   +    P +D   IF+S+FSNWR+W+
Sbjct: 1479 ENRSWRIITRLRHILTYLPNDWRTADHLVTVQDSENPNV-PQRD-EDIFVSVFSNWRNWD 1536

Query: 1523 FSDVARSYIYGKLFLNDHAEXXXXXXXXXXXXNIGNFFMTVYSTNYDVDHSIVVSNAKLL 1582
             SD+ RSYIY K+FL  + +            N  +FF TV  + Y+V  S + +   ++
Sbjct: 1537 LSDITRSYIYKKIFLPQNEDSFKKELRTVLKINFQSFFFTVLISGYEVARSTIFTRTNII 1596

Query: 1583 LE-LTPSSTEPKENSLQREELIDISGTVDVIXXXXXXXXXXXXXXIPILTE--------- 1632
            ++ L PS     EN  ++E++I ++  +  I                  +E         
Sbjct: 1597 VDVLPPSVNTSSENLFKQEKVITLTANMGAIKGEWGEEVFKLKELFSKFSENELDDLSNL 1656

Query: 1633 ------------GSEKQPVKPPQDTIP----KPFKMNAAFMVNSCDIQLVMDATKLNMNV 1676
                        GS+   ++  + + P    +  K+ A  +   CD+  V+  T+L   +
Sbjct: 1657 GSISRSASISGFGSQMDRLESSRASGPGDRFRNLKIFATMIFERCDLHFVVGDTRLTNRI 1716

Query: 1677 NDGRISVLWENLQDSTAQAGSVVLFSKHTELVLKHINSVLAEGRVSNFYATFTTDTWAQR 1736
             +G+ S+L EN +++T  A S V F++  E+ LKH  +VLAE  +   +   T       
Sbjct: 1717 INGKNSMLLENSKENTPPALSAVFFAQRHEIWLKHSTNVLAEVLLKQLHVAATAQL-GVI 1775

Query: 1737 PTYLIHSKSSSIHFRTMAKTERLVEAIKDIKLKIDQISEQLE---------LERRLTQHP 1787
            P   ++ ++++   R M  T  L  +++ IK +++ +  Q +         + ++  + P
Sbjct: 1776 PFVSLNCQATNSFIRAMPSTVVLRNSVEKIKRQVEVLIPQFKSHEVKNSSAVTKKTPRIP 1835

Query: 1788 TVYDPNKSNVIASCLFSNVSMDIMPVSPFALKNSAKQIDFFYNKFDSDSWLIKLKDTDFF 1847
              +D   +       F+++S +IM +SPF L    KQ+  + +  ++   ++   + D +
Sbjct: 1836 IKFDIRFN-------FTDMSSEIMLLSPFYLLQDVKQLHIYASGHENMELVLGFLEYDVY 1888

Query: 1848 LTSDQTKEQYMRLSMKKLQIRVNVSSSKPKLVDINLSTNLVKLTFSEPKNIVYSFLKDER 1907
            L S  + EQ+ + S   LQ +  V+     +V++ +ST+L+KLT  EP+  +++ L+DE+
Sbjct: 1889 LKSQLSSEQFFKFSSTDLQFKCEVADEVVPVVEVQISTSLMKLTLCEPRRALHNLLQDEQ 1948

Query: 1908 VASESVHLLQTL-KPLFSISDDKESTPQSYQEKTEYLWSLDSSIDYFGILIPMTSTYYVM 1966
               ESV  +Q L   L S S   + +P          W+LD+++ YFG+L+P++S  Y+ 
Sbjct: 1949 TLVESVDHIQKLWNFLRSASGGNDRSPSRNTR-----WALDANLKYFGLLVPVSSICYIF 2003

Query: 1967 EFHSYVSSISNANGA-PSGNLDITGHMSVENILFLIKESSLPDGLSKVIDIAVNVSTLQR 2025
            E HS  +S++NAN      +   +G + VE+   L+KE SLP  LSKV+D ++   T Q+
Sbjct: 2004 ELHSLFASLTNANEQYEEYDRHFSGQIVVESCYLLVKELSLPANLSKVLDFSIRFLTSQK 2063

Query: 2026 VDDNSRSIQVESSHARICLSPDSLLRLLWGFNQGHKLSEHYLKYHSKSLWQSFAKSDDKQ 2085
            V ++ +S Q+ESS+ R+CL P+ L+ +LW  +    L  H+ K+H+   W  ++ +    
Sbjct: 2064 VPNSLQSYQIESSYFRLCLFPELLVDILWSVHYLQSLLNHFKKHHTP--WLPYSSN---- 2117

Query: 2086 QDTNSIKSNETSFFSSINSIHFLSYNLCVGWLFEYELGPPKGLITGYSRLFSAYENCMGK 2145
                + KS E++      SIH LSYN CVGWLFE       GLI GY RLFSAYE   GK
Sbjct: 2118 ---KTAKSGESTL--DFRSIHILSYNFCVGWLFEVGDNSEPGLILGYDRLFSAYEKHFGK 2172

Query: 2146 LTVIDSYFAAAQGNTSSTFYPETNVKELFNRFYLPNMQILFWWKVIEGMKDVYVRFTGET 2205
            LT+ID Y + A GNTS TFY + + K+ + R YL NMQI +W K    +KD++VRF GE 
Sbjct: 2173 LTLIDGYLSVANGNTSDTFYSQKSEKDSYTRTYLSNMQIFYWLKGENLLKDLFVRFHGEV 2232

Query: 2206 LDVKYLSDFMLTIESTLHSIKMFQKLKKELIVETPKREVVHIKEDKPXXXXXXXXXXXXX 2265
            +DV++LS     +E TLHSIK F ++KK  I +T       +  +               
Sbjct: 2233 IDVRFLSTSFKLVEKTLHSIKRFNEMKKAKIKQTGSSTKSKLNMEAASNTLAPFLAHIRT 2292

Query: 2266 XXCHFKYDGGTYSVFNISDGSLNPTPAIEIKSPVISVDVLYKHEKQNTKHHSIRCLVNID 2325
                  + GG + V++ ++      P +EIKSP + + + Y+  +   K H IR    I+
Sbjct: 2293 INSQLNFAGGVFKVYSPTELDSKAEPLLEIKSPGVQMAINYEFNETREKSHCIRFFTTIE 2352

Query: 2326 PTHNVLYATCAPLVKNFVEDVRSIFGRYESENKHSETTPTSVQNIDYEKLLEDYDLAITV 2385
            PTHN+L+A CAPL+ +F  +++++     SE+K   + P +  +IDY+ LL  YD+A  +
Sbjct: 2353 PTHNMLFAKCAPLLSDFNHNIKNMIRNLSSEDKSHPSKPVT-DSIDYKSLLNPYDIAFEI 2411

Query: 2386 TSAKQQLSLSCEPKAKVQADVGFEALTVSMTTNPFDIDEPLAFSFSIKDTKASIKHLFSR 2445
             S KQ+LS SCEPKAKVQ D GF +    +TT+  D  EP   SFS+   ++S++H+FSR
Sbjct: 2412 ASGKQKLSFSCEPKAKVQLDAGFNSFLFRVTTDKVDSVEPFNVSFSMDKIESSVRHIFSR 2471

Query: 2446 ETSTSFGVGYLDLTLLFTHTNRINTYGTSLISDIDLYFNVKQLQNLYLFLDIWQLSELLN 2505
            ++S +F + Y+D+ ++FT+    N YG +L+SD+++Y N+KQ QNL +FLDIW+LS    
Sbjct: 2472 DSSAAFMLDYIDIVMMFTYP---NVYGVALVSDMNIYCNMKQRQNLNIFLDIWRLSNRGR 2528

Query: 2506 PVTSSQEQVIRKDKKKSVDKPIHNESQ-----LPWCFTLIFTNVKGDIDLGPSLGLISLR 2560
               S  +   + D KKS+  P    S       PW FT+IFTN+ G +DLGPSLG+++L 
Sbjct: 2529 TKPSENKAEDKSDAKKSLSPPFSPSSNDSRKVFPWSFTIIFTNMGGVVDLGPSLGVLTLG 2588

Query: 2561 LSRTWLATDHFSGKRQILHAFVDDLLLISEGRLSGVVNIDGASWVSEVIWLQDSKRDNIP 2620
            L + W+ T H   +++  H F   + + SEGRLSG+  +D AS VSE+ W ++      P
Sbjct: 2589 LEQVWITTKHQGDQKRTWHTFAHGITVNSEGRLSGMFELDQASSVSEISWPEEDLLRVGP 2648

Query: 2621 LVALSLNTDKIEIKAAFDYHMFLIGTVNNILFQLHSERDMVGVAPDLLKVSFSCEEIKLC 2680
            L+++S+  +++ IK+AFDYHMFLIG++ ++   LH+E D   + PDLL+VS   E I LC
Sbjct: 2649 LISVSMAINRMSIKSAFDYHMFLIGSMKSVKVHLHNESDTYAILPDLLQVSLEFESIVLC 2708

Query: 2681 STALVAANILDIYNTIIRMRQDTKISYIETLKDSNMETNKQTLAYRDILKSLQLLRTDLT 2740
            +TAL AAN LDIYNTI+RM+QD +ISYIETLK+SN+  +  ++AY ++L SL LLRTD++
Sbjct: 2709 ATALTAANALDIYNTIMRMQQDNRISYIETLKESNISASSTSVAYEEVLNSLNLLRTDMS 2768

Query: 2741 VSICSLQLQISPISLFDXXXXXXXXXXXSARSETHSEAKLTTSLNMEVYDATLSLSTAKQ 2800
            V +  L++ ISP+SLFD           +ARSET S  KL T L +++ D   SLS++K+
Sbjct: 2769 VIVKELKVHISPMSLFDAEVLVVSVRDVNARSETQSGEKLKTELQLQISDVNASLSSSKE 2828

Query: 2801 ELDEDALSKITVADYMTYASKIRGGTIIEIPRMGVQMTTWQEEKSDILEYLYSCKFHDKV 2860
            ELDE+ +SKI V DYM YASK  GGTII++P++ V MTTWQ++ S +LEYL++CKF DK+
Sbjct: 2829 ELDEETVSKIAVDDYMLYASKFSGGTIIKLPQLLVSMTTWQQQSSPVLEYLFTCKFFDKI 2888

Query: 2861 AVRWNLGPVNFMKEMWTTHVKAIAVRRSQVLTGSFNV---SEKDVEKRIKEEENITKLNY 2917
            +++WNLGPVNF+KEMW THV+++AVRR+Q+   S  +   +E D E  +K     +K  Y
Sbjct: 2889 SMKWNLGPVNFIKEMWATHVRSLAVRRTQLGNSSPELEVANESDKEDTVK-----SKFIY 2943

Query: 2918 VPVEEPQIDMPQIKDLGDATPPVEWFGVNRKRFPAFTHQTAVVPVQNLVYLAQKQYAKTL 2977
            VP++EP I+MPQIKDLGDATPP+EWFGV+RK  PA THQTAV+ +Q LV+ A+K+YAK  
Sbjct: 2944 VPLDEPYIEMPQIKDLGDATPPLEWFGVHRKNLPAATHQTAVLLIQKLVHTAEKEYAKLQ 3003

Query: 2978 GRS 2980
             R+
Sbjct: 3004 QRA 3006

>TPHA0J00730 Chr10 complement(165253..174393) [9141 bp, 3046 aa] {ON}
            Anc_8.260 YLR087C
          Length = 3046

 Score = 2165 bits (5611), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1163/3079 (37%), Positives = 1796/3079 (58%), Gaps = 148/3079 (4%)

Query: 10   FRGESLGFKRNFSWVFLVDWILTVILTLATLFYLSRAFAYGVTFILEWLLWKQAKVKVSI 69
            F   SL  +R FSWVFLV WIL V+ T   +FY+++ + +G+TF  EWLLWK   +KV+I
Sbjct: 8    FANVSLSQERYFSWVFLVYWILVVVATSTFVFYVAKLWGFGLTFACEWLLWKTMNIKVTI 67

Query: 70   GALRISLLAGRVFFKNLTIIDKDRTITILEGSITWRYWLIRTRKSEYRVAQMAHASAGSS 129
             ++R+S L G +FFKN+ +ID+D+TI+ILE S+TWRYWL+ TRKSEY +   A  S  + 
Sbjct: 68   ESIRLSFLTGTIFFKNVCLIDQDKTISILECSVTWRYWLLNTRKSEYELNAKADTSKPNG 127

Query: 130  GNSEDDTKFD------------------------------------IANYMEKQLKLPCR 153
             +  D+                                        I     K  KL   
Sbjct: 128  DDMLDNNTIHDRSNNDNNDNNDNNDNNDNNNNNDNNDNNETNNYNDIDYDYNKNKKLDSL 187

Query: 154  FLFECEGFEMFIYNRTYAYDNIVNVLSKVEREKFEKFMAENDFLDPSSDGSSDDK----- 208
            F   C GFE+F+YNR  AY+ I+   SK E+ +F  F+ ++D  D   + SS+ K     
Sbjct: 188  FAINCTGFEIFLYNRKRAYETIIQNFSKEEKIQFIDFLRQHDLDDIFEEVSSEIKNCNEY 247

Query: 209  -------------------IEETSSATNSTDEETIANDRTFQNDTRKTLPR-----YLEA 244
                                E  S+ + S D +   +DR+  ++  K         +L+ 
Sbjct: 248  CNHKEGNNSAHFGSSCKSDKESASNISISGDSQENDSDRSNIDNRNKISAHIMRKLHLDI 307

Query: 245  LPIEALLNKGSILIGNKFTPCVLILSFESAVALQDVGEAPSKLDLYRMKYEVRLKNLEIM 304
            LP++  +NKG+I IGNKFT  +L+++F  A  L D     SKLD+++ K    + ++++ 
Sbjct: 308  LPLDININKGAITIGNKFTRSLLVINFTEAHGLLDYALPDSKLDVFKNKVTFEINDIDMS 367

Query: 305  MKQNIDYDNEKSRNFEFDKGKLSRLWHRFTRIFKLVPFP-----FKSNRRKEQPHDNFMQ 359
            +K+NI Y+ E +  F F  G L+R+W     +  L+P       ++S R KE     F++
Sbjct: 368  IKRNIGYNPELASRFNFRAGVLTRIWSYLQLVLNLIPTGRLKTWYESLRYKEDT--TFVK 425

Query: 360  KWKGLSMYRNDMFGXXXXXXXXXXXX-SSHEYAKFTSLLKSPRVTIHHDYDMPGWVPHGA 418
            KW GL +Y++ +               ++HEYAK ++  K+P++    + D+PG VPHG+
Sbjct: 426  KWDGLVLYKDSVKSSTKLGADDVDFDFANHEYAKVSNFFKAPQIIFSIESDIPGIVPHGS 485

Query: 419  HPPSSYADGPDVGNNMAPPQYIFEINIFGGTVCYGPWAQRQTNHLQSLLSPSVSRTAKPI 478
            HPP S A GPD+GN+ +PP ++ ++ +   ++ +G W  R    L+ L+ P +S+  KP+
Sbjct: 486  HPPLSKAHGPDIGNHESPPTFLIDLQLSHASIYFGSWVNRNIVDLRDLMFPVISKDQKPL 545

Query: 479  KKLKPGSKRIYTVLKLTINAMEDVTWRIPTRESSKDVEFLMHYKETNDDYRPFGWIDIKV 538
             KLKPG  R++++   +++ ++D + R+PTRE SKD +FL  Y ET DD+R FGWID+  
Sbjct: 546  NKLKPGLTRVHSMFNFSVSVLDDSSIRLPTREPSKDSDFLKQYLETKDDFRAFGWIDLSF 605

Query: 539  SRDSCGIFDLAMCPTSKGFKNTIDVQLVDTEIRSSVNHDIFLKSKSFSFNCDIGYPLGWN 598
             + S  + ++ M PTS GF+NT+  +  + E+ +SVNH++  KS S +   +IGYPLGWN
Sbjct: 606  KKGSEFMLNIPMIPTSGGFENTLFSKFSELEVTTSVNHNLLFKSNSLNIAANIGYPLGWN 665

Query: 599  AEANWTIIMDSNQLELFLLREHVTLIADTLTDFSSGEPVPYELFRPFVYHIKWNMKGYSF 658
               NW   ++S QL++FLLREH+TL++D + DFS+ EP PYELFR F Y++   + GYSF
Sbjct: 666  DPVNWIFNINSKQLDIFLLREHITLLSDMIIDFSTQEPTPYELFRSFTYNLNLKIGGYSF 725

Query: 659  YLNVNDHNIVNNPLDFNENCYLSIHGDDLTMNVMVPKKTITSRFTNMTYDIYTPMFRXXX 718
            Y NVND NI+NNPLDFNENCYLS HGD  T  + +P  ++  ++  ++Y+I+TPMFR   
Sbjct: 726  YFNVNDRNIINNPLDFNENCYLSFHGDLFTSEITIPIISLAQQYVTISYEIFTPMFRLFL 785

Query: 719  XXXXXXXXXEFMRNKEVGRSHDFRLKGSYLIYSELDIDNVDTLTVECSSRGTALHIYGFV 778
                     EFMRNKE+GRSHDFR+ G+YLIYSELDIDNVD+LT++  S  T L+ +GFV
Sbjct: 786  NTPSWNTLSEFMRNKEIGRSHDFRVSGTYLIYSELDIDNVDSLTIDFESNSTVLYCFGFV 845

Query: 779  IRYLINVKMNYFGEFFHFVTSEEYTGNTRPTDLENIISEDRRDDDFSSYESVSRISSNSS 838
            I+Y++N + NYFG F  F+T+EEY+   R    +N+ S +   +D +S E + ++ S ++
Sbjct: 846  IKYMMNFQANYFGSFIKFITTEEYSELIRNNVNDNLGSINT--NDLTSIEGLQKMDSITN 903

Query: 839  DXXXXXXXXXXXXXXXXXRTSNETDIWFTFSVWDGALILPETIYNADPCIALHFAELIVD 898
            D                 RT NETDIW  F V DGALILPE +YN D C++L F EL ++
Sbjct: 904  D--VEDINQKTIKRSDLLRTENETDIWLNFKVNDGALILPEELYNGDSCVSLSFGELFIN 961

Query: 899  LRSCNYYMDILATACDINLKRYVGKRADEIYEYVHLNNGKDHEVHGTLSDIYIHGHRMYG 958
            +R+CNYYMD+  T  D NL R+      E++EY+   N +   V G +SDI IHGHRMYG
Sbjct: 962  MRTCNYYMDVYITLYDNNLNRFEKIDPHELFEYIQTRN-RSSSVEGNISDITIHGHRMYG 1020

Query: 959  LPPTEPTYFCQWDMDFGHLNIDSNMFFLQGLFGAFYKIGFGYKDLENILLYETEIIDDMT 1018
            LPP E TYFCQW ++ G   IDS+M FL     +  KIGF   + EN LLYE++ ++DMT
Sbjct: 1021 LPPKELTYFCQWSINIGTFLIDSDMIFLLSFIQSLNKIGFFLSNKENSLLYESDTVNDMT 1080

Query: 1019 SLTIFINTIDIRLNDVDTTAHADLKLERFCFTLIDFENERYSKRMDIKIPSLEFNI--FS 1076
             L++ + ++ + L+D    A A++         IDFENE+Y+KR+D+      F++    
Sbjct: 1081 LLSVDVESLKVILSDPLLEARAEIGASSIIIRNIDFENEKYTKRLDVNASEFYFSLDSLK 1140

Query: 1077 NEDNDLSLLNFKVDMNFTNFVQNQDFNKHRKIQRDYIVLNDAPYHRCAFLLPESYQKSRI 1136
             +    ++L+ +  +N TNF +  +   H   QR +I L+D+PYHRC FLLPE +Q+S  
Sbjct: 1141 IDSGKKNILDVRTKLNITNFFKTDNHINHLDTQRKFIGLHDSPYHRCFFLLPEKFQESSS 1200

Query: 1137 YNELFGXXXXXXXXXXXXXXXTADTIEYVLEDLLEDYMGLFEGNYDIKESSVENLELSAI 1196
            Y EL+G                  T  +++E +L+DY      ++  + S   N EL+++
Sbjct: 1201 YKELYGSITPSFSLPMLPIPHIYSTTNFIVEGILDDYSEFLLSDHHNQMSI--NAELNSV 1258

Query: 1197 EATRAITGIGAERTHSNPITLSDYAVESDNYVVKVESIVIDINPALYTTIEKLLKHIYDQ 1256
            + T        + T+   I  ++   E+DN+VV V+ + + +NP +  TIEK       +
Sbjct: 1259 DTTPLKDSFDMQITNFQNILTTEDPYETDNFVVNVKYLTVTVNPDIVFTIEKFSTEFNKK 1318

Query: 1257 DAV-QIIDGIEIGIVKRLSSIHDGVTTMTNVKVQIKHFNLFWGEKESDNVSMFFDKMDFA 1315
             ++   IDGIE+ IV RLS + + +++  NV + ++  +  WG ++   +  + + + F 
Sbjct: 1319 FSMNNQIDGIEMAIVNRLSDLKENISSKINVNLNVEKIDAAWGHRDVCFIGTYINMLKFE 1378

Query: 1316 LTEKTLEQNSEKNLLEMTVLAKIKAVRLTVVQQPGLIPTQERPPAITVGVEGFEFWSTAI 1375
            L++++   N+     ++T+L K ++VR+ +        + +RPP +++ +EGFE WS+  
Sbjct: 1379 LSQESTYNNNGGLQKDLTLLGKFRSVRIIIQNHSYNSFSDDRPPGLSLMLEGFEAWSSTT 1438

Query: 1376 EKQVNSISVSSADITVDDAQVEWFFKYIVRQKYFFLDMLQSYNRIQNNRIESQKELISRL 1435
             KQ+ +++++S DITVD+ Q+ W   Y+  Q   F  +  S   I + +   QK  I+ L
Sbjct: 1439 TKQLTTLNLTSFDITVDEYQIHWLIPYVKSQILLFTKIQDSVKLIYDEQASYQKTFITSL 1498

Query: 1436 TAASEYYQISHDPYVITKPAFIMRLSRGHVRENKSWKIITRLRHILTYLPKDWYLNVGQP 1495
              A E YQI HDPYVITKPA ++RLS  H+REN+SW+I+T+LRHILTYLP+DW   + + 
Sbjct: 1499 IWAGEKYQIDHDPYVITKPATVLRLSAWHIRENRSWRIVTKLRHILTYLPEDWEDRLDEE 1558

Query: 1496 LRDRKFDPSQDARSIFMSIFSNWRSWEFSDVARSYIYGKLFLNDHAEXXXXXXXXXXXXN 1555
               ++    ++A S F+++FSNWR+WE SD+ +SYIY  +F+    E             
Sbjct: 1559 DLIKRSGLEKEAASTFLNVFSNWRNWEVSDIEKSYIYRMIFV---EEVSKRILQNSIKVF 1615

Query: 1556 IGNFFMTVYSTNYDVDHSIVVSNAKLLLELTPSSTEPKENSLQREELIDISGTVDVIXXX 1615
            +  F+ T+YS NY  D + +++ A +L+          +   ++EE++D+   +  I   
Sbjct: 1616 LETFYFTIYSRNYSADQNFLITKANILINNEADQVNEVDLIRKQEEIVDVVTKIGSIKFE 1675

Query: 1616 XXXXXXXXXXXIPILTEGSEKQPVKPPQDTIPKPFKMNAAFMVNSCDIQLVMDATKLNMN 1675
                       I  + + S     +  + +I K FK+N +F+ +  D       + L   
Sbjct: 1676 FTEAILKLKRDIEQIIKTSVDSKSEGDKLSITKFFKVNLSFIFDHIDFNGQFYNSSLKSR 1735

Query: 1676 VNDGRISVLWENLQDSTAQAGSVVLFSKHTELVLKHINSVLAEGRVSNFYATFTTDTWAQ 1735
            +++  I   +EN  +S+  +GS V ++  T + LKH+N++L + +V N +A+ T +  + 
Sbjct: 1736 MSNVNILSYFENNIESSTPSGSFVYYADRTGIALKHLNNILIDCQVRNLFASTTAELHSA 1795

Query: 1736 RPTYLIHSKSSSIHFRTMAKTERLVEAIKDIKLKIDQISEQLELERRLTQH------PTV 1789
              + +I+ + S++HF+++ KTE  V AIK I+  ++ +S ++   +  T +      P+V
Sbjct: 1796 VNSLMINFRCSNLHFKSVPKTEIFVNAIKAIQRDVETLSAEISKAQGTTDNINTEHTPSV 1855

Query: 1790 YDPN---------KSNVIASCLFSNVSMDIMPVSPFALKNSAKQIDFFYNKFDSDSWLIK 1840
            ++ N         K+N+  S  F+NVS +I  + P  LK+    ++  YN  + D  L++
Sbjct: 1856 HEKNKMQKAKPNSKNNITLSATFTNVSSEITLLHPIYLKHETNSVNISYNTINIDELLVQ 1915

Query: 1841 LKDTDFFLTSDQTKEQYMRLSMKKLQIRVNVSSSKPKLVDINLSTNLVKLTFSEPKNIVY 1900
            + DTD +L S  TKEQY RLS  KL++   +     KL+D+ +S++++KLT S+P+ +++
Sbjct: 1916 VLDTDLYLNSSHTKEQYARLSYDKLELTTFLPDLNEKLIDLEISSSILKLTTSDPRRMLF 1975

Query: 1901 SFLKDERVASESVHLLQTLKPLF--SISDDKESTPQSYQEKTEYLWSLDSSIDYFGILIP 1958
            SFL+DE+    S+  L++L+ L   + S+D E+   SY+      W ++    Y G+L+P
Sbjct: 1976 SFLQDEKELKNSLTFLRSLESLNRKANSEDSETLFSSYE------WIVNFKSKYMGVLLP 2029

Query: 1959 MTSTYYVMEFHSYVSSISNANGAPSG-NLDITGHMSVENILFLIKESSLPDGLSKVIDIA 2017
            + +TYYV E H  +S++SN     S  +    G +S ++I+FLIK+ S+P   SK++D +
Sbjct: 2030 IQATYYVFELHDALSTVSNKEEPSSAVHKKFHGDLSFDHIIFLIKDQSIPHKFSKILDFS 2089

Query: 2018 VNVSTLQRVDDNSRSIQVESSHARICLSPDSLLRLLWGFNQGHKLSEHYLKYHSKSLWQS 2077
            + +ST + V++  RS ++ESS  R+CL+P SL++ +WG+ Q   L      Y+ +S    
Sbjct: 2090 IKLSTHRTVNNFDRSFEIESSFFRVCLTPFSLIQTMWGYYQLLYLLN---SYYDQSTVNF 2146

Query: 2078 FAKSDDK-QQDTNSIKSNETSFFSSINSIHFLSYNLCVGWLFEYELGPPKGLITGYSRLF 2136
            F  +D+     TNS K N      S+ S H LSYN  +GWL++       GLI GY+RLF
Sbjct: 2147 FVFNDNNIDGATNSEKEN----VFSVRSFHILSYNFSIGWLYQDSDNTIPGLILGYNRLF 2202

Query: 2137 SAYENCMGKLTVIDSYFAAAQGNTSSTFYPETNVKELFNRFYLPNMQILFWWKVIEGMKD 2196
            S YE+  GKLT++D +F+ A G++  TFY   +    FNR YLPN+QIL+W K IE MK 
Sbjct: 2203 STYEDNHGKLTLVDGFFSLANGSSGDTFYSSGDESSKFNRSYLPNIQILYWIKEIEKMKH 2262

Query: 2197 VYVRFTGETLDVKYLSDFMLTIESTLHSIKMFQKLKKE----LIVETPKREVVHIKEDKP 2252
            ++++F GETLDV +  +F+  IEST+ SI +FQ LK+E    L+   P+R+         
Sbjct: 2263 LFIKFHGETLDVNFFENFVNIIESTVRSIDLFQTLKREKINPLVKAKPERD--EKSNSAL 2320

Query: 2253 XXXXXXXXXXXXXXXCHFKYDGGTYSVFNISDGSLNPTPAIEIKSPVISVDVLYKHEKQN 2312
                           C F YDGG + +F+ +  +    P + IKSP + + + Y + ++ 
Sbjct: 2321 TNIKGPIFGKLKQVNCEFIYDGGLFRLFSNASMTNKLEPTLMIKSPKVKIMLSYDYFEKE 2380

Query: 2313 TKHHSIRCLVNIDPTHNVLYATCAPLVKNFVEDVRSIFGRYESENKHSETTPTSVQNIDY 2372
             K H I CL++I+PT NVL + C P + +F+  ++ I    +  N            I+ 
Sbjct: 2381 LKKHWINCLIDIEPTQNVLKSGCVPFLSDFISQIKDIV-ELQDVNMEENMDNNVKDPINI 2439

Query: 2373 EKLLEDYDLAITVTSAKQQLSLSCEPKAKVQADVGFEALTVSMTTNPFDIDEPLAFSFSI 2432
              LLE++D+   + S  Q ++L CEPKAK+  DVGF +   S+ T   +  +PL  S  I
Sbjct: 2440 TSLLENFDICFKLISGTQHVTLDCEPKAKINTDVGFGSFEFSILTPHLNPIDPLDISLKI 2499

Query: 2433 KDTKASIKHLFSRETSTSFGVGYLDLTLLFTHTNRINTYGTSLISDIDLYFNVKQLQNLY 2492
             D K S+KH FS E S SF V  LD+ L+FTH      +GT L+ D+ L+FN+KQ QN+ 
Sbjct: 2500 NDIKTSVKHQFSNEASASFEVSKLDVILIFTHP---EVFGTGLVDDVKLHFNLKQFQNIS 2556

Query: 2493 LFLDIWQLSELLNPVTSSQEQVIRKDKKKSVD-------KPIHNESQLPWCFTLIFTNVK 2545
            +FLDIW +S+      S+++++ +KD    VD       + I N S LPW F  I TN+ 
Sbjct: 2557 IFLDIWDVSK------STEKKLFKKDSNTLVDAKSSPIAQTIVNSSTLPWSFVFIATNIN 2610

Query: 2546 GDIDLGPSLGLISLRLSRTWLATDHFSGKRQILHAFVDDLLLISEGRLSGVVNIDGASWV 2605
            GDI++G +LG ++L L RTW++TDHF  KRQ+LH F D++ + SEGRL G V ID  +W 
Sbjct: 2611 GDINMGSTLGNLALNLQRTWISTDHFHNKRQLLHLFTDNVKISSEGRLGGFVEIDDITWK 2670

Query: 2606 SEVIWLQDSKRDNIPLVALSLNTDKIEIKAAFDYHMFLIGTVNNILFQLHSERDMVGVAP 2665
             +V ++   K    PLV L  +  K+ +K AFDYHMFLI TV ++ F + SE+D+  + P
Sbjct: 2671 LDVNYVDKYKFVVSPLVDLLFDVGKVSMKVAFDYHMFLISTVKDLKFHVLSEKDIDDILP 2730

Query: 2666 DLLKVSFSCEEIKLCSTALVAANILDIYNTIIRMRQDTKISYIETLKDSNMETNKQTLAY 2725
            DLL V+ +C+EIK+C+TALVA+NILDIYNTI+R RQD K SYIETL +SN    K+   Y
Sbjct: 2731 DLLTVNLTCDEIKVCTTALVASNILDIYNTIMRTRQDNKNSYIETLLESNNNVLKRKPLY 2790

Query: 2726 RDILKSLQLLRTDLTVSICSLQLQISPISLFDXXXXXXXXXXXSARSETHSEAKLTTSLN 2785
             DILKSL LL+T L+ +I  L LQISP SL+D            + +ET +  K+ T L 
Sbjct: 2791 EDILKSLNLLQTSLSANIHELNLQISPSSLYDAEVIIIRVQDVFSSTETRTGEKIKTDLE 2850

Query: 2786 MEVYDATLSLSTAKQELDEDALSKITVADYMTYASKIRGGTIIEIPRMGVQMTTWQEEKS 2845
            M VY+ATLSL++  +EL E+ +++++   Y++YAS +  G I EIP++ + MTT+Q   +
Sbjct: 2851 MRVYNATLSLTSFGKELTEEDIAEMSAETYISYASTLTSGRIFEIPQLTINMTTFQNADN 2910

Query: 2846 DILEYLYSCKFHDKVAVRWNLGPVNFMKEMWTTHVKAIAVRRSQVLTGSFNVS---EKDV 2902
             IL+Y YSC F  KV V WNLGP+NF+KE+W THV+++ VR  Q + G+ ++S   E D 
Sbjct: 2911 MILQYTYSCSFDGKVDVTWNLGPINFIKEVWATHVRSLEVRTVQFM-GNHDISLENEGDT 2969

Query: 2903 EKRIKEEENITKLNYVPVEEPQIDMPQIKDLGDATPPVEWFGVNRKRFPAFTHQTAVVPV 2962
            ++ +K   NI    Y+ +EEP I+MPQIKDL DATPP+EWFG+NRK FP+ THQ+ +VP+
Sbjct: 2970 DESVKVLSNI---EYIALEEPYIEMPQIKDLKDATPPLEWFGLNRKYFPSATHQSVIVPI 3026

Query: 2963 QNLVYLAQKQYAKTLGRSK 2981
            Q LV +AQK+YAK LG SK
Sbjct: 3027 QKLVNVAQKEYAKVLGSSK 3045

>TBLA0E04420 Chr5 complement(1126342..1135788) [9447 bp, 3148 aa] {ON}
            Anc_8.260 YLR087C
          Length = 3148

 Score = 2132 bits (5524), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1116/2617 (42%), Positives = 1615/2617 (61%), Gaps = 82/2617 (3%)

Query: 417  GAHPPSSYADGPDVGNNM--------------APPQYIFEINIFGGTVCYGPWAQRQTNH 462
            GA P +   +  D  NN               APP+   E  +F  ++ YGPWA R   +
Sbjct: 561  GASPDTDRNNESDASNNQQRNTYSRSTTDNISAPPESNMEFQLFDASINYGPWAHRNIMN 620

Query: 463  LQSLLSPSVSRTAKPIKKLKPGSKRIYTVLKLTINAMEDVTWRIPTRESSKDVEFLMHYK 522
            +Q + SP VSRT +     +PG  R YT+ K++++ MED +WR+PTRE SKD +FL  Y 
Sbjct: 621  IQRIFSPIVSRTPELQPDPEPGFLRRYTMTKISVSIMEDSSWRVPTREPSKDQDFLKRYM 680

Query: 523  ETNDDYRPFGWIDIKVSRDSCGIFDLAMCPTSKGFKNTIDVQLVDTEIRSSVNHDIFLKS 582
            +TND  R FGW D+  SR+S   F ++  P   G+ N +++   D E+RSSVNHDIF +S
Sbjct: 681  KTNDSSRSFGWFDLNFSRNSEATFCISSIPDVNGYANKLNLDFKDLEVRSSVNHDIFFRS 740

Query: 583  KSFSFNCDIGYPLGWNAEANWTIIMDSNQLELFLLREHVTLIADTLTDFSSGEPVPYELF 642
            KS+  + DIGYPLGWN E  W+ + DS QLE F LREH+ LIADT +DFSSGEP PYE F
Sbjct: 741  KSYRVDSDIGYPLGWNDEVTWSFVFDSYQLETFFLREHLVLIADTFSDFSSGEPTPYEFF 800

Query: 643  RPFVYHIKWNMKGYSFYLNVNDHNIVNNPLDFNENCYLSIHGDDLTMNVMVPKKTITSRF 702
            RP +Y + WN  GYS YLNVNDHNI+NNPLDFNENCY+S+HGDD  + V +P+  IT+ +
Sbjct: 801  RPSIYKVDWNFHGYSAYLNVNDHNIINNPLDFNENCYISVHGDDAHIGVEIPRLGITATY 860

Query: 703  TNMTYDIYTPMFRXXXXXXXXXXXXEFMRNKEVGRSHDFRLKGSYLIYSELDIDNVDTLT 762
            T++ + I TPMFR            EFMRNKE+GR +DF  +GSY+IYS+LDIDNVD+LT
Sbjct: 861  TDIIFQISTPMFRLLLNTPPWNTLNEFMRNKEIGRGYDFTAEGSYIIYSDLDIDNVDSLT 920

Query: 763  VECSSRGTALHIYGFVIRYLINVKMNYFGEFFHFVTSEEYTGNTRPTDLENIISEDRRDD 822
            +ECS+R   L  YGFVI YL+NV+MNYFGEF HF+T+EEYT   R  D  +I+S      
Sbjct: 921  IECSTRRMTLLTYGFVIGYLLNVQMNYFGEFSHFITAEEYTDIVRGND-NDIVSTLADFS 979

Query: 823  DFSSYESVSRIS-------SNSSDXXXXXXXXXXXXXXXXXRTSNETDIWFTFSVWDGAL 875
              S   SVS +S       ++S                   R  NETDIWFTFSVW+GAL
Sbjct: 980  VMSETNSVSNVSNSQHNPDNSSKSNIIDPLYNPPLRKDDIKRKVNETDIWFTFSVWEGAL 1039

Query: 876  ILPETIYNADPCIALHFAELIVDLRSCNYYMDILATACDINLKRYVGKRADEIYEYVHLN 935
            +LPE +YN+DPCIAL F ELI+D R+C+YY+D+LAT    + KR + K  ++I+E VH N
Sbjct: 1040 LLPEVLYNSDPCIALSFKELIIDFRNCDYYLDLLATLNGTSFKRCIRKNQNDIFELVHNN 1099

Query: 936  NGKDHEVHGTLSDIYIHGHRMYGLPPTEPTYFCQWDMDFGHLNIDSNMFFLQGLFGAFYK 995
              K+ E HG++S+I IHGHRMYG PPT P+YF  W +D  +L+I+S+++F++G      K
Sbjct: 1100 AIKNLEEHGSVSNISIHGHRMYGAPPTSPSYFSDWAVDVNNLSINSDIYFIRGFISYITK 1159

Query: 996  IGFGYKDLENILLYETEIIDDMTSLTIFINTIDIRLNDVDTTAHADLKLERFCFTLIDFE 1055
            +GF + +L+NILLY+  ++D+MTS+T+    IDI + D  T+A   L ++   F  I+F 
Sbjct: 1160 VGFEFSNLQNILLYDESVLDNMTSVTVHGTGIDILVADKSTSAQVLLNMDGITFNRINFA 1219

Query: 1056 NERYSKRMDIKIPSLEFNIFSNED--NDLSLLNFKVDMNFTNFVQNQDFNKHRKIQRDYI 1113
            N+RYS R+D+++P L F  F N    +   L  FK  +NFTNF Q +D   H K Q+++I
Sbjct: 1220 NDRYSSRIDLQVPGLHFAFFDNGSSMDKTCLFEFKTKINFTNFTQMKDGELHSKKQQEFI 1279

Query: 1114 VLNDAPYHRCAFLLPESYQKSRIYNELFGXXXXXXXXXXXXXXXTADTIEYVLEDLLEDY 1173
             LND+ +HRC+FLL    Q+S +Y+EL+G                A+TI ++++D L  +
Sbjct: 1280 ALNDSAFHRCSFLLLPHIQESLLYHELYGGITPSSSVPPLPIPVQAETIAFIIDDFLGPF 1339

Query: 1174 -------MGLFEGNYDIKESSVENLELSAIEATRAITGIGAERTHSNPITLSDYAVESDN 1226
                   +G    +  I  S   N  L    ++  I  I + ++H  P      +V   N
Sbjct: 1340 GINSTELLGSISTSTPIHSS---NKPLKP-PSSSVIHPIESMQSHLVP----SQSVTHGN 1391

Query: 1227 YVVKVESIVIDINPALYTTIEKLLKHIYDQDAVQIIDGIEIGIVKRLSSIHDGVTTMTNV 1286
            Y++ +  I +DINP  +T     L   Y ++ ++ IDGIE+ IV RL +  + + ++TN+
Sbjct: 1392 YIIDISYITLDINPLFFTYASNFLDEFYSENIIETIDGIEMAIVNRLGTKSEELDSVTNI 1451

Query: 1287 KVQIKHFNLFWGEKESDNVSMFFDKMDFALTEKTLEQNSEKNLLEMTVLAKIKAVRLTVV 1346
            K+QIK+ + F+G++ ++ + ++ D++D  +++KT ++ S   L E+ +L++  ++R ++ 
Sbjct: 1452 KLQIKYLDFFFGQRNTEGLELYVDQIDLEVSQKTFQKKSTVVLDEIAILSRFLSLRASIN 1511

Query: 1347 QQPGLIPTQERPPAITVGVEGFEFWSTAIEKQVNSISVSSADITVDDAQVEWFFKYIVRQ 1406
            ++  L    ERPPA+++ +EG+E WS+    QVNS+++SS DITVD++Q+EW   Y+ R 
Sbjct: 1512 EKKVLEDFDERPPALSLALEGWEGWSSTASSQVNSLNISSTDITVDESQIEWLIDYLNRL 1571

Query: 1407 KYFFLDMLQSYNRIQNNRIESQKELISRLTAASEYYQISHDPYVITKPAFIMRLSRGHVR 1466
              F  +++ S + IQ      QK+L+S LT ASEYYQISHDPYVITKPA++MR+S+GHVR
Sbjct: 1572 VVFVHELVNSLDSIQKKSNGIQKKLVSDLTLASEYYQISHDPYVITKPAYVMRVSKGHVR 1631

Query: 1467 ENKSWKIITRLRHILTYLPKDWYLNVGQPLRDRKFDPSQDARSIFMSIFSNWRSWEFSDV 1526
            +N+SW+I+TRLRHI TYLP DW ++V + +R +  +   D+  IF+++FSNWR+WE SDV
Sbjct: 1632 QNRSWRIVTRLRHIYTYLPDDWEIHVQEEMRGKDMNDVSDSSDIFLTVFSNWRNWEVSDV 1691

Query: 1527 ARSYIYGKLFLNDHAEXXXXXXXXXXXXNIGNFFMTVYSTNYDVDHSIVVSNAKLLLELT 1586
            ARSYIY K+FL++               N+ + F T+YST Y +DH+I+++ A +LLELT
Sbjct: 1692 ARSYIYKKIFLSNDETTSEKKLQTTVKLNLNSIFFTIYSTGYAIDHNIILTKAVILLELT 1751

Query: 1587 PSSTEPKENSLQREELIDISGTVDVIXXXXXXXXXXXXXXIP---------ILTEGSEKQ 1637
               TE   +    + +++++G++  I              IP          LTE S   
Sbjct: 1752 ---TETAVSPPIEKSILNMTGSLGSIKGEFSDKFLRLLELIPDFSKEEDIKSLTENSSIV 1808

Query: 1638 PVKPPQDTIPKPFKMNAAFMVNSCDIQLVMDATKLNMNVNDGRISVLWENLQDSTAQAGS 1697
              K P       F ++   +  +  +QL M  T L+ NV DG+IS L E    S   + S
Sbjct: 1809 SEKSPY------FTIHLFLLFENGGLQLTMGDTTLSNNVTDGKISALLEKSSYSKEFSYS 1862

Query: 1698 VVLFSKHTELVLKHINSVLAEGRVSNFYATFTTDTWAQRPTYLIHSKSSSIHFRTMAKTE 1757
               + K +E+ LKH   ++AE ++ +     T       P  LI+ +S+ +HF+++A TE
Sbjct: 1863 GAYYMKKSEMCLKHNKDIIAEFQLHHLGLISTGIYTPICPVILINLRSADLHFKSLASTE 1922

Query: 1758 RLVEAIKDIKLKIDQISEQLELERRLTQHPTVYD--PNKSN--VIASCLFSNVSMDIMPV 1813
            ++V+ I+DI      + +  +L R+ T  PT  D  P K N  V  +C  S VS ++  +
Sbjct: 1923 KIVKTIEDITEYSVHLYKHYDL-RKYTTKPTKVDQKPEKINFDVRVACNLSKVSAELTLI 1981

Query: 1814 SPFALKNSAKQIDFFYNKFDSDSWLIKLKDTDFFLTSDQTKEQYMRLSMKKLQIRVNVSS 1873
            SPF L+   KQ+D ++N+      L+ L DTD F+TS  TKEQY R S   +QI  N  S
Sbjct: 1982 SPFYLRYETKQLDLYFNQNGDGEILLSLWDTDIFVTSHHTKEQYFRFSYDDIQINCNPMS 2041

Query: 1874 SKPKLVDINLSTNLVKLTFSEPKNIVYSFLKDERVASESVHLLQTLKPLF--SISDDKES 1931
             K K++ ++LS +LVKLTFSEP+ I  SFL+DER+  ES   L+ LK +F  +  + K+ 
Sbjct: 2042 EKNKVLVVSLSASLVKLTFSEPRRIFASFLQDERITIESFQELKKLKKIFFSNAKNVKKL 2101

Query: 1932 TPQSYQEKTEYLWSLDSSIDYFGILIPMTSTYYVMEFHSYVSSISNANGA-PSGNLDITG 1990
                 +E T   W+L+ +I+YFGIL+P+ ST++V+E H  + S++N        N  I+G
Sbjct: 2102 NNDVPKEDTPTKWALELNINYFGILLPIASTFFVLELHMLLGSLTNTTEEIQEVNNQISG 2161

Query: 1991 HMSVENILFLIKESSLPDGLSKVIDIAVNVSTLQRVDDNSRSIQVESSHARICLSPDSLL 2050
             +S+ENILFLI + SLP  LSK++D ++ +STLQ+   +  S+Q+ESSH R+C SP+SL+
Sbjct: 2162 QISLENILFLINDRSLPLRLSKLVDFSIRISTLQKTTSSYESLQIESSHFRMCFSPESLV 2221

Query: 2051 RLLWGFNQGHKLSEHYLKYHSKSLWQSFAKSDDKQQDTNSIKSNETSFFSSINSIHFLSY 2110
             +LWG  Q     E+Y  + +K  W      +     T +  S   S  +   SIH LSY
Sbjct: 2222 FVLWGVKQLQNELEYYKDHKTKRQW------NLSSHKTGTKSSTSESPLNYFRSIHILSY 2275

Query: 2111 NLCVGWLFEYELGPPKGLITGYSRLFSAYENCMGKLTVIDSYFAAAQGNTSSTFYPETNV 2170
            N C+GW+         G + GY RLFSAYE   GKLT+I+ Y +    N+S+ F+ +   
Sbjct: 2276 NFCIGWMLPENQKDIPGWMFGYDRLFSAYEKNYGKLTLIEGYMSVTNSNSSNDFFSQGEE 2335

Query: 2171 KELFNRFYLPNMQILFWWKVIEGMKDVYVRFTGETLDVKYLSDFMLTIESTLHSIKMFQK 2230
            K   NR +LP+MQIL+W K     KD+++R  G+ LDV  LS+F+  IE    S ++F+ 
Sbjct: 2336 KNRHNRSFLPSMQILYWLKEFNSKKDLFIRLHGDALDVDILSNFVNIIELIFKSYQIFED 2395

Query: 2231 LKKELIVETPKREV--VHIKEDKPXXXXXXXXXXXXXXXCHFKYDGGTYSVFNISDGSLN 2288
             +K  IV+  +++    HIK +                 C FKY+GGT  VF++ D  ++
Sbjct: 2396 FRKSKIVQNIEKQKHHEHIKSENATEFVPTFLSDINSINCEFKYEGGTLRVFSVDDVEID 2455

Query: 2289 PTPAIEIKSPVISVDVLYKHEKQNTKHHSIRCLVNIDPTHNVLYATCAPLVKNFVEDVRS 2348
             TP++E+ +P +S+ + YKH   + K H +RC+++I  +HN+LY+ CAP V  FVE ++ 
Sbjct: 2456 STPSLELNAPKVSIYLNYKHFDDSPKPHWLRCVIDIHSSHNILYSKCAPFVIEFVESIQE 2515

Query: 2349 IFGRYESENKHSETTPTSVQNIDYEKLLEDYDLAITVTSAKQQLSLSCEPKAKVQADVGF 2408
            I      E K S  +  +  N  Y+++L  +D+A  + +AKQ LS SCEP AKVQA+VG 
Sbjct: 2516 ILENRPVEPKQS-VSKIATPNRTYKRILAPFDIAFRIKAAKQMLSFSCEPSAKVQANVGL 2574

Query: 2409 EALTVSMTTNPFDIDEPLAFSFSIKDTKASIKHLFSRETSTSFGVGYLDLTLLFTHTNRI 2468
            ++    ++T    +++PL+ +  I     S++H+FS+E S SF + ++DLT +FT     
Sbjct: 2575 DSFLFGISTGGSSVEDPLSLTLCINKISTSVQHIFSKEASASFSLNFIDLTFIFTQP--- 2631

Query: 2469 NTYGTSLISDIDLYFNVKQLQNLYLFLDIWQLSELLN--PVTSSQEQVIRKDKKKSVDKP 2526
              Y   LISDID++FN+KQ QNL LFLDIW LSE +   P    ++    K   +  + P
Sbjct: 2632 TLYCVGLISDIDIFFNMKQQQNLLLFLDIWHLSESIGIRPNRKKRKHKKHKGHTQIPETP 2691

Query: 2527 IHNESQLPWCFTLIFTNVKGDIDLGPSLGLISLRLSRTWLATDHFSGKRQILHAFVDDLL 2586
                  +PW F +IFTNV  DI LGP+LG++S +L +TW  +D +  KRQIL  F D ++
Sbjct: 2692 -QPGKIIPWNFNIIFTNVNADIHLGPALGIVSAKLEKTWFISDRYLDKRQILQLFTDGMV 2750

Query: 2587 LISEGRLSGVVNIDGASWVSEVIWLQDSKRDNIPLVALSLNTDKIEIKAAFDYHMFLIGT 2646
            L S GRLSG+++I  A W  EV +  +    N P+VA+ ++   + +K AFDYHMF+I  
Sbjct: 2751 LKSRGRLSGMLDISNAGWRLEVNYADNELNYNSPIVAIGIDIGCVALKTAFDYHMFMISK 2810

Query: 2647 VNNILFQLHSERDMVGVAPDLLKVSFSCEEIKLCSTALVAANILDIYNTIIRMRQDTKIS 2706
            VNNI F+LHSERD  G  PDLL  +  CEEI +CST LVA+NILDIYNTIIR RQDTK S
Sbjct: 2811 VNNIHFRLHSERDPEGKLPDLLLTTLLCEEISICSTTLVASNILDIYNTIIRTRQDTKNS 2870

Query: 2707 YIETLKDSNMETNKQTLAYRDILKSLQLLRTDLTVSICSLQLQISPISLFDXXXXXXXXX 2766
            Y ETL +SN +  +  + Y DILKSL LLRTD+ + +  LQLQISPISLFD         
Sbjct: 2871 YFETLMESNNQDTRTNIPYSDILKSLNLLRTDVQIDVSKLQLQISPISLFDFEVLVINID 2930

Query: 2767 XXSARSETHSEAKLTTSLNMEVYDATLSLSTAKQELDEDALSKITVADYMTYASKIRGGT 2826
              SARSET S  KL T L ++V +A+++LSTAK+ELDE++++KI+VADYMTYASKI+GGT
Sbjct: 2931 NMSARSETTSTDKLKTRLELQVCNASVALSTAKEELDEESVNKISVADYMTYASKIKGGT 2990

Query: 2827 IIEIPRMGVQMTTWQEEKSDILEYLYSCKFHDKVAVRWNLGPVNFMKEMWTTHVKAIAVR 2886
            I+ IP++ V MTTWQ+  S+ +EY ++CKF  KV+VRWNLGPVNF+KEMW THVK++AVR
Sbjct: 2991 ILIIPKLLVGMTTWQKVTSNTIEYTFTCKFDGKVSVRWNLGPVNFIKEMWATHVKSLAVR 3050

Query: 2887 RSQV--LTGSFNVSEKDVEKRIKEEENITKLNYVPVEEPQIDMPQIKDLGDATPPVEWFG 2944
            ++++       +   +   + I  E    K  YV + EP I+MPQIKDL DATPP+EWFG
Sbjct: 3051 QARIEEPVEYSSEELESSPESIYLEPAQPKFTYVALVEPSIEMPQIKDLEDATPPMEWFG 3110

Query: 2945 VNRKRFPAFTHQTAVVPVQNLVYLAQKQYAKTLGRSK 2981
            +NRK+FP+FTHQTAV+ VQ LV+  +K+YAK +G S+
Sbjct: 3111 LNRKKFPSFTHQTAVIVVQKLVHAVEKEYAKIIGHSE 3147

 Score =  180 bits (456), Expect = 5e-44,   Method: Compositional matrix adjust.
 Identities = 86/182 (47%), Positives = 120/182 (65%), Gaps = 11/182 (6%)

Query: 10  FRGESLGFKRNFSWVFLVDWILTVILTLATLFYLSRAFAYGVTFILEWLLWKQAKVKVSI 69
           F   SL  ++ FSWVFLV WILT IL L   FY+ R FAY +TFIL+WLLW+  KVK+  
Sbjct: 7   FVSVSLSREKYFSWVFLVTWILTCILCLLMFFYIDRVFAYSLTFILDWLLWRPYKVKIHC 66

Query: 70  GALRISLLAGRVFFKNLTIIDKDRTITILEGSITWRYWLIRTRKSEYRVAQMAHASAGSS 129
            ++R+SLL+ R+ FKNL II ++ TI+ILEG I W+YWL+ TR S Y +    H      
Sbjct: 67  ESIRLSLLSARISFKNLCIITENSTISILEGKIIWQYWLLNTRVSAYEL----HQQQKEH 122

Query: 130 GNSEDDTKFDIANYMEKQLKLPCRFLFECEGFEMFIYNRTYAYDNIVNVLSKVEREKFEK 189
           G     + F       K ++LPC+FLF+CEG E+F+YN+T AY+NI++  S  E+ K+++
Sbjct: 123 GYITPGSGF-------KNIQLPCKFLFQCEGAEIFVYNKTSAYENIIDSFSPDEKIKYKE 175

Query: 190 FM 191
           F+
Sbjct: 176 FL 177

 Score =  123 bits (308), Expect = 9e-27,   Method: Compositional matrix adjust.
 Identities = 70/190 (36%), Positives = 107/190 (56%), Gaps = 16/190 (8%)

Query: 242 LEALPIEALLNKGSILIGNKFTPCVLILSFESAVALQDVGEAPS-KLDLYRMKYEVRLKN 300
           L   P    L KGSI+ GNKFTP +LI+S++SA  + DV  A + ++DLY+MK ++  +N
Sbjct: 298 LNFYPFGLKLTKGSIIFGNKFTPSLLIISYKSAEGIVDVLPATNPRVDLYKMKMKLDFQN 357

Query: 301 LEIMMKQNIDY-DNEKSRNFEFDKGKLSRLWHRFTRIFKLVPFPFKSNRRKEQPHDN--- 356
            EI +K NI Y D+ K + F  D   LSRLW +F+ +F ++P P        + H N   
Sbjct: 358 FEIEVKPNISYEDDSKPKAFYCD-SMLSRLWTKFSTLFDIMPNPLSRYIHFSRLHKNSLF 416

Query: 357 ----------FMQKWKGLSMYRNDMFGXXXXXXXXXXXXSSHEYAKFTSLLKSPRVTIHH 406
                     F +KWKGLS+Y++                 +HEYA++ S++K+PR+   +
Sbjct: 417 LEDNIFEDEDFEKKWKGLSLYKDAALNRGNPEEHIEFDFLNHEYARYCSIVKAPRLIFTN 476

Query: 407 DYDMPGWVPH 416
           +YD+PG VP+
Sbjct: 477 EYDIPGIVPY 486

>SAKL0H17072g Chr8 (1498942..1507935) [8994 bp, 2997 aa] {ON} similar
            to uniprot|Q12150 Saccharomyces cerevisiae YLR087C CSF1
            Protein required for fermentation at low temperature
          Length = 2997

 Score = 2095 bits (5428), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1182/3042 (38%), Positives = 1755/3042 (57%), Gaps = 118/3042 (3%)

Query: 6    SSAGFRGESLGFKRNFSWVFLVDWILTVILTLATLFYLSRAFAYGVTFILEWLLWKQAKV 65
            + + F+   +  + NFSWVFLVDW+L V+L+L+ +FY  RA AY +T +++W+LW++ KV
Sbjct: 3    AGSQFKAIPISKENNFSWVFLVDWVLVVVLSLSVVFYFGRALAYCITILMKWVLWRRYKV 62

Query: 66   KVSIGALRISLLAGRVFFKNLTIIDKDRTITILEGSITWRYWLIRTRKSEYRVAQMAHAS 125
            K++I +L+IS L GRVFFKNLT+I KD+TI+ L+GS TWRYWL+ +RK+     +     
Sbjct: 63   KINIQSLKISFLGGRVFFKNLTVITKDQTISFLQGSFTWRYWLLNSRKTLLEELE----- 117

Query: 126  AGSSGNSEDDTKFDIANYMEKQLKLPCRFLFECEGFEMFIYNRTYAYDNIVNVLSKVERE 185
               SG  +D          +K   L CRF  E +GFE+FIYNRT AYD I+  ++K ++E
Sbjct: 118  --KSGEEKD----------QKSRMLQCRFFLESDGFELFIYNRTVAYDGILRSVAKDDKE 165

Query: 186  KFEKFMAENDFLDPSSDGSSDDKIE-ETSSATNSTDEETIANDRTFQ-NDTRKTLPRYLE 243
             F+KF    +     S  SS++K+E ET ++ +S       NDR FQ  D+R  L   L+
Sbjct: 166  SFKKFFEGGE----DSLHSSEEKLEDETLASDSSVSNVDSTNDRNFQEQDSRSML---LQ 218

Query: 244  ALPIEALLNKGSILIGNKFTPCVLILSFESAVALQDVGEAPSKLDLYRMKYEVRLKNLEI 303
             LPI   +N+G++L+GN  TP V+I+ +ESA  + DV ++  KLDLY+++Y++   N+++
Sbjct: 219  FLPIHLKVNRGAVLLGNTTTPSVMIIGYESAEGVVDVCQSNEKLDLYKIRYDLDFNNVDL 278

Query: 304  MMKQNIDYDNEKSRNFEFDKGKLSRLWHRFTRIF--KLVPFPFKSNRRKEQ--PHDNFMQ 359
             +K NI + +E          ++SR+W +F +IF  ++  +   S+ +K     H  F +
Sbjct: 279  KIKPNISFGDENPIKSYIVHSRMSRVWKKFKKIFFERMSHYLAHSDNQKIMFVKHQQFFE 338

Query: 360  KWKGLSMYR-------NDMFGXXXXXXXXXXXX--SSHEYAKFTSLLKSPRVTIHHDYDM 410
            KW+GL++Y        +   G               +HEYAK+T +LKS +V + + YD+
Sbjct: 339  KWRGLALYSEYNVTTSDHSVGDEEEEEDENMMSDVGNHEYAKYTQILKSTKVAVTYAYDI 398

Query: 411  PGWVPHGAHPPSSYADGPDVGNNMAPPQYIFEINIFGGTVCYGPWAQRQTNHLQSLLSPS 470
            PG VPHGA       DGPDVGN+ APP++  +  ++G T+CYGPWA RQ  +LQ +L P 
Sbjct: 399  PGMVPHGALHTMEQRDGPDVGNSGAPPEFSLDFKLYGATICYGPWAHRQIQYLQRMLCPI 458

Query: 471  VSRTAKPIKKLKPGSKRIYTVLKLTINAMEDVTWRIPTRESSKDVEFLMHYKETNDDYRP 530
            VSR A P+KKL PGS+RIYT   L++  MED  WRIPTRESSKD +FL  Y+E+ +  RP
Sbjct: 459  VSRDAIPLKKLTPGSRRIYTRFNLSVLMMEDALWRIPTRESSKDQDFLKQYRESKNKERP 518

Query: 531  FGWIDIKVSRDSCGIFDLAMCPTSKGFKNTIDVQLVDTEIRSSVNHDIFLKSKSFSFNCD 590
            FGW+DIK+++++     + MCPT  GF+N +   LV  EIRSSVNHDIF K+ + + + D
Sbjct: 519  FGWLDIKLTKETDLFMTVGMCPTITGFENKLGFHLVKPEIRSSVNHDIFFKADAQTISAD 578

Query: 591  IGYPLGWNAEANWTIIMDSNQLELFLLREHVTLIADTLTDFSSGEPVPYELFRPFVYHIK 650
            +GYPLGWN+EA W    +S Q+  F LR+H+ L++D   DF SG P PYELFRPFVY  +
Sbjct: 579  LGYPLGWNSEAQWVFQFNSKQVHTFFLRDHINLLSDIFMDFGSGIPTPYELFRPFVYRFE 638

Query: 651  WNMKGYSFYLNVNDHNIVNNPLDFNENCYLSIHGDDLTMNVMVPKKTITSRFTNMTYDIY 710
            W++  YS YLNVND NI+NNPLDFNENCYLS+HGD L ++  V  KTIT   T + Y I 
Sbjct: 639  WSIDNYSIYLNVNDANIINNPLDFNENCYLSLHGDTLKIDFSVDLKTITGNSTTVNYSIR 698

Query: 711  TPMFRXXXXXXXXXXXXEFMRNKEVGRSHDFRLKGSYLIYSELDIDNVDTLTVECSSRGT 770
            TP F             EFM+NKEVGRS+DF + GSY  +S++D+ N+DT+ +EC S+ T
Sbjct: 699  TPEFHLQLDTPSWSTLHEFMKNKEVGRSYDFCMNGSYQFHSDVDVGNMDTILIECQSKYT 758

Query: 771  ALHIYGFVIRYLINVKMNYFGEFFHFVTSEEYTGNTRPT--DLENIISEDRRDDDFSSYE 828
             L   GFVIRYL+N+ MNYFG+F HF T+EEYT   +      E  +  D   D+ S   
Sbjct: 759  TLQCCGFVIRYLMNINMNYFGDFIHFKTTEEYTRELQEKLETREAEVIADNVSDESSQMS 818

Query: 829  SVSRISSNSSDXXXXXXXXX---XXXXXXXXRTSNETDIWFTFSVWDGALILPETIYNAD 885
            S S ++++                       R  NE D+WFTF V DG L+ PE IY+  
Sbjct: 819  STSFVTNDKETTEYDLHEFNEDPKVKRADLKRKENEKDVWFTFCVEDGCLVFPENIYDCT 878

Query: 886  PCIALHFAELIVDLRSCNYYMDILATACDINLKRYVGKRADEIYEYVHLNNGKDHEVHGT 945
             CI LHF  L VDLR  NYYMD+ A+     +KR+       I++ V    G      G 
Sbjct: 879  SCIGLHFDSLDVDLRYLNYYMDLQASLSPTYIKRHSDFNPRNIFDVVRACEGLVDGHQGF 938

Query: 946  LSDIYIHGHRMYGLPPTEPTYFCQWDMDFGHLNIDSNMFFLQGLFGAFYKIGFGYKDLEN 1005
            LS++ IH HRM+GLP  E TYFC+WD   G L+IDS++ F +GL GAF KIGFGYKD EN
Sbjct: 939  LSELNIHAHRMFGLPIIEETYFCKWDFQIGSLDIDSDIDFAKGLIGAFSKIGFGYKDYEN 998

Query: 1006 ILLYETEIIDDMTSLTIFINTIDIRLNDVDTTAHADLKLERFCFTLIDFENERYSKRMDI 1065
            +L+YE     DMTSLT+  ++I  ++ D +T     L L++   ++IDFENERYS +M  
Sbjct: 999  MLIYEIIKPIDMTSLTLVTDSISFKVTDGNTNCVVALDLDKISASMIDFENERYSNKMSA 1058

Query: 1066 KIPSLEFNIFSNEDNDLSLLNFKVDMNFTNFVQNQDFNKHRKIQRDYIVLNDAPYHRCAF 1125
            KIP+++  +      +     F+  ++   F QN+DF+ HR +QR++I L+D+PYHRCAF
Sbjct: 1059 KIPNIKLLVSEKSSKNEVQGLFETSLDLAYFGQNRDFDNHRNLQRNHITLHDSPYHRCAF 1118

Query: 1126 LLPESYQKSRIYNELFGXXXXXXXXXXXXXXXTADTIEYVLEDLL----EDYMGLFEGNY 1181
            LLP  YQK+ +YN+LFG                 +TI+ + E LL    +DY    + NY
Sbjct: 1119 LLPMQYQKTVLYNKLFGAITPGVSIPPLTQPVIPNTIDSIFESLLGKHYQDYECCSDANY 1178

Query: 1182 DIKESSVENLELSAIEATRAITGIGAERTHSN--PITLSDYAVESDNYVVKVESIVIDIN 1239
              KE+++     S I+ + + + +    ++S   P    +   E D++++ +   +I IN
Sbjct: 1179 S-KETAITEENSSFIQGSGSTSALKELSSYSQNCPSYKLEPKFEYDSFIINLGKTIIAIN 1237

Query: 1240 PALYTTIEKLLKHIYDQDAV----QIIDGIEIGIVKRLSSIHDGVTTMTNVKVQIKHFNL 1295
            P    + EK L  IY Q  V     IID  EI IV++ S      + +TN++V       
Sbjct: 1238 P----SSEKCLLSIYLQFCVGSIDDIIDANEIDIVEKFSKYFVEKSAVTNLRVLAPKICF 1293

Query: 1296 FWGEKES-------DNVSMFFDKMDFALTEKTLEQNSEKNLLEMT--VLAKIKAVRLT-V 1345
             +G  +        D++ +  +     L +K +   +  + LE T  V + +KA  +   
Sbjct: 1294 TFGSPKGKFEVSDYDHLYVEVNHPSLDLCQKKIFGQTNSSKLEYTEEVTSSLKASSINFF 1353

Query: 1346 VQQPGLIPTQ--ERPPAITVGVEGFEFWSTAIEKQVNSISVSSADITVDDAQVEWFFKYI 1403
            + Q  L P    +  P  ++  E  EFWS + E   NS++  + D  V+ +Q+EW   Y+
Sbjct: 1354 INQQQLKPKTLLKARPVFSIVFEELEFWSDSSESSKNSLNARAVDFFVNHSQLEWLSDYL 1413

Query: 1404 VRQKYFFLDMLQSYNRIQNNRIESQKELISRLTAASEYYQISHDPYVITKPAFIMRLSRG 1463
                     +  S+++ +      QKELI R   AS  Y I HD  VITKPA+I RLS+ 
Sbjct: 1414 RAVILCATKLFASFSKSKTLIQARQKELIFRTALASVEYNIIHDSPVITKPAYITRLSKN 1473

Query: 1464 HVRENKSWKIITRLRHILTYLPKDWYLNVGQPLRDRKFDPSQDARSIFMSIFSNWRSWEF 1523
            H+REN+SW+IITRLRHIL YLPK WY    + L+  +F    DAR  F+ IFSNWRSWEF
Sbjct: 1474 HIRENRSWRIITRLRHILNYLPKSWYKRTEESLKKEEFKIPDDARDQFLKIFSNWRSWEF 1533

Query: 1524 SDVARSYIYGKLFLNDHAEXXXXXXXXXXXXNIGNFFMTVYSTNYDVDHSIVVSNAKLLL 1583
            SDV + YIY ++FL+  +             N+     ++ S+ ++ +  +VV N K ++
Sbjct: 1534 SDVQKCYIYKRVFLS-RSMKKNRITGADFKVNLERISFSLSSSTHEDEDFMVVKNLKSVI 1592

Query: 1584 --ELTPSSTEPK----ENSLQREELIDISGTVDVIXXXXXXXXXXXXXXIPILTEGSEKQ 1637
              EL  SS  P     E+S   E++I IS  +  I                 L+  S+  
Sbjct: 1593 SNELIESSLPPSAKNTEDSASTEKMI-ISCNIKSIRGDLGDNIVKLVRMYDGLSNLSDTN 1651

Query: 1638 PVKPPQDTIPKPFKMNAAFMVNSCDIQLVMDATKLNMNVNDGRISVLWENLQDSTAQAGS 1697
                      KP  +    +V+  D  + +D  +L +     R S   E +   +    S
Sbjct: 1652 LKTTSVKHDVKPKLIQGVLLVDRTDTNIHLDGKRLILRSFRNRFSTFMERVPSKSETKVS 1711

Query: 1698 VVLFSKHTELVLKHINSVLAEGRVSNFYATFTTDTWAQRPTYLIHSKSSSIHFRTMAKTE 1757
            +      +E  ++H ++VL E  + +    F+   + +     +  +S  +    MA TE
Sbjct: 1712 LAATCASSEAWVRHGSAVLLESSLKDGALNFSQSLFHEHLITKVVLRSGGLSVSAMASTE 1771

Query: 1758 RLVEAIKDIKLKIDQISEQL--ELERRLTQHPTVYDPNKSN----VIASCLFSNVSMDIM 1811
            + +  I  IK  +D I ++L   + ++     +   P  S+    V      S  S++I 
Sbjct: 1772 QYIHFIWSIKASVDGIRKELASAIPKKNNTTISTTKPETSSRLNTVTLDATLSGFSLNIQ 1831

Query: 1812 PVSPFALKNSAKQIDFFYNKFDSDSWLIKLKDTDFFLTSDQTKEQYMRLSMKKLQIRV-N 1870
            P++PF +  S   I+    K    +  I ++D D  L S ++K++Y++ S   + + + N
Sbjct: 1832 PLTPFGIHQSTDSIEVHVEKHHQLNADITIRDIDIELLSTRSKQRYLKFSQSTVNLVISN 1891

Query: 1871 VSSSKPKLVDINLSTNLVKLTFSEPKNIVYSFLKDERVASESVHLLQTLKPLFSISDDKE 1930
                    +++ +++ + KLT S+P+  +YS ++DE +A ++   L++L   F  S ++E
Sbjct: 1892 TPEQNAMFLNVGVASGISKLTVSDPREFIYSLVEDETLAIKNFAQLKSLAEKFP-SKNQE 1950

Query: 1931 STPQSYQEKTEYLWSLDSSIDYFGILIPMTSTYYVMEFHSYVSSISNANGA----PSGNL 1986
             + Q  +++T  +W L  +++Y GI++ + S  YV+E ++ ++S+SN   A      G  
Sbjct: 1951 KSKQ--RKQTNIIWLLHVNVEYIGIIVLLGSAGYVLELNNVLTSLSNNISARKYLEQGLH 2008

Query: 1987 DITGHMSVENILFLIKESSLPDGLSKVIDIAVNVSTLQRVDDNSRSIQVESSHARICLSP 2046
             I G  S+EN+L LI  + L   LSK++D+AVN+   Q   D+ ++IQ+ESSH R+ L P
Sbjct: 2009 GIVGDFSIENVLLLIHANRLKGELSKLVDLAVNLKVSQEEGDDLQNIQIESSHFRVALCP 2068

Query: 2047 DSLLRLLWGFNQGHKLSEHYLKYHSKSLWQSFAKSDDKQQDTNSIKSNETSFFSSINSIH 2106
             SL ++LW  N+  ++SE Y K  S  L        D  + +N  +           SI 
Sbjct: 2069 MSLTKVLWAINEFTRVSEAY-KTRSSLLQHKKTAPTDISELSNKFR-----------SIQ 2116

Query: 2107 FLSYNLCVGWLFEYELGPPKGLITGYSRLFSAYENCMGKLTVIDSYFAAAQGNTSSTFYP 2166
             LSYN C+GW+F+       GLI GY RLF+AY+   GKLT++D+YF+ A G +S TF+ 
Sbjct: 2117 ILSYNFCIGWIFDAGSETDPGLIWGYERLFAAYQKPYGKLTLLDAYFSIAHGASSDTFFS 2176

Query: 2167 ETNVKELFNRFYLPNMQILFWWKVIEG-MKDVYVRFTGETLDVKYLSDFMLTIESTLHSI 2225
                K+ FNR YLP+MQI +W+ V EG   +++VR TGE LDV +LS  +      + SI
Sbjct: 2177 NGKEKDQFNRSYLPSMQIGYWF-VKEGDTSNLFVRITGERLDVNFLSSSIGIANGAVKSI 2235

Query: 2226 KMFQKLKKELIVETPKREVVHIKEDKPXXXXXXXXXXXXXXXCHFKYDGGTYSVFNISDG 2285
            + FQ+LKK ++      +      +                 C  KY GG + +F+  D 
Sbjct: 2236 QTFQELKKTMVDPFATNKTTEKPVNSEAAPLDPILSKIRAFNCIVKYAGGVFKLFSEEDI 2295

Query: 2286 SLNPTPAIEIKSPVISVDVLYKHEKQNTKHHSIRCLVNIDPTHNVLYATCAPLVKNFVED 2345
              N  P+ E++SP + V + YKH     K H IR LV +DP++N L+ TC P++    +D
Sbjct: 2296 QNNSKPSFEVESPSVEVAIDYKHLPDVIKSHWIRGLVTVDPSNNTLFPTCVPILSGMTKD 2355

Query: 2346 VRSIFGRYESENKHSETTPTSVQNIDYEKLLEDYDLAITVTSAKQQLSLSCEPKAKVQAD 2405
            VR++   + S+ K    +  S   ++Y+KLL  +D+A  V   KQ +SLSCEPKAKVQAD
Sbjct: 2356 VRNMLKSFNSKPKPDRNSTISSSGMNYKKLLRAFDIAFLVNIGKQGISLSCEPKAKVQAD 2415

Query: 2406 VGFEALTVSMTTNPFDIDEPLAFSFSIKDTKASIKHLFSRETSTSFGVGYLDLTLLFTHT 2465
            VGFE L V M TN  D  EPL+ S  I+  +A+ +H+FSRE STSF + ++D   + TH 
Sbjct: 2416 VGFEKLAVKMFTNNLDNSEPLSLSIDIEHLRATSRHIFSREVSTSFQIDHIDAVFVLTHP 2475

Query: 2466 NRINTYGTSLISDIDLYFNVKQLQNLYLFLDIW----QLSELLNPVTSSQEQVIRKDK-- 2519
              I TYGT+L+SD+ +YFN+KQLQ+L LFLDIW    Q+ E+     +    +   DK  
Sbjct: 2476 EIIQTYGTTLVSDVQIYFNMKQLQDLNLFLDIWKPDSQILEMPKGGNTRTRSLSSHDKLP 2535

Query: 2520 KKSVDKPIHNESQLPWCFTLIFTNVKGDIDLGPSLGLISLRLSRTWLATDHFSGKRQILH 2579
                 KP    +  PW +TLIF+N+KGDIDLGPSLG++S+R +R+W  +DHF   RQ L 
Sbjct: 2536 VSKFQKPAGTNA-FPWNYTLIFSNIKGDIDLGPSLGVLSVRNNRSWAISDHFVDWRQRLS 2594

Query: 2580 AFVDDLLLISEGRLSGVVNIDGASWVSEVIWLQDSKRDNIPLVALSLNTDKIEIKAAFDY 2639
             F++++LL S+GRL G + I+   W SE+ W         PL++LSL    + +K +FDY
Sbjct: 2595 VFLENILLSSDGRLGGFLGIERVCWSSEISWPVKGGFYETPLISLSLELGSLALKTSFDY 2654

Query: 2640 HMFLIGTVNNILFQLHSERDMVGVAPDLLKVSFSCEEIKLCSTALVAANILDIYNTIIRM 2699
            HMFLI  V ++L +L++ERD +G+  DLL VS +C +I L  TAL +AN +DIYNTIIRM
Sbjct: 2655 HMFLIANVEHLLLKLYNERDEMGILKDLLAVSVTCGKIHLFLTALASANAIDIYNTIIRM 2714

Query: 2700 RQDTKISYIETLKDSNMETNKQTLAYRDILKSLQLLRTDLTVSICSLQLQISPISLFDXX 2759
            RQD K SYIETLKDSN ++ K     +++L+SL LLRTDL+V I    LQ+ P +LFD  
Sbjct: 2715 RQDNKNSYIETLKDSNTQSTKSKRQNQNVLESLSLLRTDLSVGIDLFYLQVFPSTLFDME 2774

Query: 2760 XXXXXXXXXSARSETHSEAKLTTSLNMEVYDATLSLSTAKQELDEDALSKITVADYMTYA 2819
                     SA ++T  + K+ T LN ++++  +SLS  K + +E+ +S+I V +Y+ +A
Sbjct: 2775 VLVLKAEDMSAHTQTQGDHKVKTRLNWQLHNFKVSLSAFKNQFNEEIVSQIEVKEYIKHA 2834

Query: 2820 SKIRGGTIIEIPRMGVQMTTWQEEKSDILEYLYSCKFHDKVAVRWNLGPVNFMKEMWTTH 2879
            +K+RGGTI+  P + V MTTWQE  S+++E LY+  F  KV V+WNLGP+NF++EMW TH
Sbjct: 2835 TKVRGGTILAAPAILVDMTTWQEVSSNVIELLYTSSFGGKVDVKWNLGPINFIREMWATH 2894

Query: 2880 VKAIAVRRSQVL---TGSFNVSEKDVEKRIKEEENITKLNYVPVEEPQIDMPQIKDLGDA 2936
            V+A+A+RR   +     SF   ++ +E++IK+ +   K  Y+P+EEP+I+MPQIKDLGDA
Sbjct: 2895 VRALALRRVHDMRDKNKSF-FEDEHIEEKIKDVDLGNKYVYIPLEEPRIEMPQIKDLGDA 2953

Query: 2937 TPPVEWFGVNRKRFPAFTHQTAVVPVQNLVYLAQKQYAKTLG 2978
            TPPVEWFGVNR+RFP  THQ+ VVP+Q L ++A+++YA+ LG
Sbjct: 2954 TPPVEWFGVNRQRFPGLTHQSVVVPLQKLAHMAEEEYARVLG 2995

>KLTH0G13728g Chr7 (1175228..1184128) [8901 bp, 2966 aa] {ON} similar
            to uniprot|Q12150 Saccharomyces cerevisiae YLR087C CSF1
            Protein required for fermentation at low temperature
          Length = 2966

 Score = 1833 bits (4749), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1064/3063 (34%), Positives = 1662/3063 (54%), Gaps = 187/3063 (6%)

Query: 7    SAGFRGESLGFKRNFSWVFLVDWILTVILTLATLFYLSRAFAYGVTFILEWLLWKQAKVK 66
            ++ F+  SL    +FSWVFLVDW+L + ++L   FY  R F Y +TF+LEWL WK+ KVK
Sbjct: 2    ASQFKRVSLSTNEDFSWVFLVDWVLILSVSLLGAFYFGRVFGYTLTFLLEWLAWKRYKVK 61

Query: 67   VSIGALRISLLAGRVFFKNLTIIDKDRTITILEGSITWRYWLIRTRKSEYRVAQMAHASA 126
            +SI +L+IS L GR+FFKNLT++ +++T + L+GSITWRYWL+ +RK+ +     A AS 
Sbjct: 62   ISIQSLKISFLGGRIFFKNLTVVTQNQTFSFLQGSITWRYWLLNSRKTAF-----AKASE 116

Query: 127  GSSGNSEDDTKFDIANYMEKQLKLPCRFLFECEGFEMFIYNRTYAYDNIVNVLSKVEREK 186
                + E               KLPCRF  EC+G E FIYN+T A+DNI+N L + + E+
Sbjct: 117  NIDKSVE---------------KLPCRFRVECQGLEHFIYNKTQAFDNILNSLPREDLER 161

Query: 187  FEKFMAENDFLDPSSDGSSDD-KIEETSSATNSTDEETIA---------NDRTFQNDTRK 236
            F+ F  +N      SD ++D+  ++E S+   S  E + +         NDR+FQ  +  
Sbjct: 162  FKDFFQDN------SDKNTDECSVDEDSAGQRSHLETSTSSPSSKSKSLNDRSFQ--SPD 213

Query: 237  TLPRYLEALPIEALLNKGSILIGNKFTPCVLILSFESAVALQDVGEAPSKLDLYRMKYEV 296
            + P +L+ LP+E  + KG+++IGNK +  V++LS+E    + D     SK+DLY++K   
Sbjct: 214  STPPFLKLLPLEYSVQKGAVVIGNKTSSSVMVLSYEKLDGVLDTCLPDSKIDLYKIKVRN 273

Query: 297  RLKNLEIMMKQNIDYDNEKSRNFEFDKGKLSRLWHRFTRIFKLVPFPFKSN--RRKEQPH 354
              +   I +K N+  ++E        + KLS+LWHR  ++F     P   N     +   
Sbjct: 274  EFRKFHISLKPNLSLESENPLKSFVKRSKLSKLWHRSYQLFFKTDSPSSKNPANSAKDGT 333

Query: 355  DNFMQKWKGLSMYRNDMFGXXXXXXXXXXXXSSHEYAKFTSLLKSPRVTIHHDYDMPGWV 414
             N +++W+GL +Y  +               S HEYA++T ++K   + + + +D PG V
Sbjct: 334  RNPLKRWRGLGLYWKE--EDAAWDDRFQFDLSKHEYARYTKVMKCDNMLLEYAFDAPGIV 391

Query: 415  PHGAHPPSSYADGPDVGNNMAPPQYIFEINIFGGTVCYGPWAQRQTNHLQSLLSPSVSRT 474
            PHGA P     DGPDVGN+  PP Y  +I I G ++ YGPW+  +   LQ L SP VSR 
Sbjct: 392  PHGALPTFQTVDGPDVGNSGPPPDYSIDIQISGASLYYGPWSHHEIMPLQKLFSPVVSRD 451

Query: 475  AKPIKKLKPGSKRIYTVLKLTINAMEDVTWRIPTRESSKDVEFLMHYKETNDDYRPFGWI 534
            ++P+++L PGSKRIYT L+L+I  + +  WRIPTRE+SKD+EFL  ++ET D+ RPFGW+
Sbjct: 452  SQPVEQLTPGSKRIYTRLRLSILIVGESVWRIPTREASKDLEFLKRFRETEDETRPFGWL 511

Query: 535  DIKVSRDSCGIFDLAMCPTSKGFKNTIDVQLVDTEIRSSVNHDIFLKSKSFSFNCDIGYP 594
            ++ +S  S   F++AMCPT+ GF NT+D+  V  EIR+SVNHDI L +++ S +  +GYP
Sbjct: 512  EVSLSEGSEVRFNIAMCPTATGFDNTLDLHFVKPEIRTSVNHDILLSAQTHSMHATMGYP 571

Query: 595  LGWNAEANWTIIMDSNQLELFLLREHVTLIADTLTDFSSGEPVPYELFRPFVYHIKWNMK 654
            LGWN +A W     SNQ ++F+L++H+TL+ D ++DF SGEP PYELFRPF Y   WN  
Sbjct: 572  LGWNKKAEWVFDSVSNQCQIFILKDHITLLGDIISDFGSGEPTPYELFRPFSYTFNWNFT 631

Query: 655  GYSFYLNVNDHNIVNNPLDFNENCYLSIHGDDLTMNVMVPKKTITSRFTNMTYDIYTPMF 714
            GYS YLNVND NIVNNP++FNENCYLS HGDDL +N  VP++ I    T + Y+++TP+F
Sbjct: 632  GYSIYLNVNDANIVNNPVNFNENCYLSFHGDDLRLNFEVPQENIAGNSTKINYELFTPLF 691

Query: 715  RXXXXXXXXXXXXEFMRNKEVGRSHDFRLKGSYLIYSELDIDNVDTLTVECSSRGTALHI 774
            R            EFM++KEVGRS +F L GSYL +S+LD+DN+DT+ +EC S+ T L  
Sbjct: 692  RLNMNTPSWNTLHEFMKDKEVGRSANFSLSGSYLFHSKLDVDNIDTIIIECCSKSTTLKC 751

Query: 775  YGFVIRYLINVKMNYFGEFFHFVTSEEYTGNTRPTDLENIISEDRRDDDFSSYESVSRIS 834
            YG+V+RY + VKMNYFG+F HF T+EEY    R T   N +++   D +    E+  ++ 
Sbjct: 752  YGYVLRYFLGVKMNYFGDFVHFKTTEEYMEELRGT---NAVTKTTHDSETEIQEAPKQMD 808

Query: 835  SNSSDXXXXXXXXXXXXXXXXXRTSNETDIWFTFSVWDGALILPETIYNADPCIALHFAE 894
             +SS                  R  NE D+WFTF V DG  ILPE +Y+ D C AL F  
Sbjct: 809  EDSSQREQHIKDPLTAKKTSLKRMVNEKDVWFTFVVEDGCFILPENLYDCDSCYALEFDS 868

Query: 895  LIVDLRSCNYYMDILATACDINLKRYVGKRADEIYEYVHLNNGK---DHEVHGTLSDIYI 951
            L +DLR  NYYMD+ A    + ++R +    +E++E      G+      V G LS ++I
Sbjct: 869  LDIDLRHINYYMDMQAALSPLRIRRLIDCGCEEVFE----QKGRALCGELVAGRLSRLHI 924

Query: 952  HGHRMYGLPPTEPTYFCQWDMDFGHLNIDSNMFFLQGLFGAFYKIGFGYKDLENILLYET 1011
            H HRM+GLPP E TYFC+WD   G L++ S++ F  G   A+ K+GFG++D ENI+ Y+ 
Sbjct: 925  HTHRMFGLPPAEETYFCKWDFSLGTLDLSSDLPFTLGFINAWKKLGFGFRDYENIMNYKV 984

Query: 1012 EIIDDMTSLTIFINTIDIRLNDVDTTAHADLKLERFCFTLIDFENERYSKRMDIKIPSLE 1071
              I DMTS+T+ I+ I    + +       L  +       D EN  YS R+D+ + +L 
Sbjct: 985  APILDMTSVTLAIDAIVFCTDKIKDETAIQLNAQDISAKFADLENSLYSSRVDLDVANLT 1044

Query: 1072 FNIFSNEDNDLSLLNFKVDMNFTNFVQNQDFNKHRKIQRDYIVLNDAPYHRCAFLLPESY 1131
             +I     ++ ++ +F   +  +NF Q QD   H + Q+ +I  NDAP+HRC FL+P + 
Sbjct: 1045 ASIIDKNKSNKAIASFMTSIKISNFCQLQDLLAHSQQQKVHIASNDAPFHRCPFLIPLTL 1104

Query: 1132 QKSRIYNELFGXXXXXXXXXXXXXXXTADTIEYVLEDLL------EDYMGLFEGNYDIKE 1185
            Q S  Y  LFG                 + ++ V +  L      +D++  +   + + E
Sbjct: 1105 QNSSDYKGLFGCIPPGVSIPSLAVPLQTENVKAVFQGYLKAENASKDFVDRW---FPVNE 1161

Query: 1186 SSVENLELSAIEATRAITGIGAERTHSNPITLSDYAVESDNYVVKVESIVIDINPALYTT 1245
              V+N   S+++  +       +   S   + SD   E +  VV +E+  + I+P  Y  
Sbjct: 1162 --VKNKNSSSLKDFKGQLQPILDDNTSLSSSFSDPTFEHNTLVVNLENSRLSISPECYEV 1219

Query: 1246 IEKLLKHIYDQDAVQIIDGIEIGIVKRLSSIHDGVTTMTNVKVQIKHFNLFWGEKESDN- 1304
            I   ++  + +   Q ID IE+ +V     +        N++V +   ++ +     +N 
Sbjct: 1220 IGNAVEQCHKKLIEQFIDNIELDVVLHFIKMASRQKNYKNIRVLMPTLDVLFETYNKENT 1279

Query: 1305 --------VSMFFDKMDFALTEKTLEQNSEKNLLEMTVLAKIKAVRLTV---VQQPGLIP 1353
                    V+     +D++L +      S+ +  + T L KI+++ L V   + +     
Sbjct: 1280 YDVEGQVKVTANQVSLDWSLKKGLKLPGSDNDPEDTTSLLKIESLDLEVFNKLDKKTKFA 1339

Query: 1354 TQERPPAITVGVEGFEFWSTAIEKQVNSISVSSADITVDDAQVEWFFKYIVRQKYFFLDM 1413
              +   A    V+  E WS       +S+ + S + +V   +  W   ++ +    F D 
Sbjct: 1340 EMDENIAFGCSVKELEAWSYLNGIADSSLYLKSINASVALDKFNWLIDFMRKA---FNDS 1396

Query: 1414 LQSYNRIQ---NNRIESQKELISRLTAASEYYQISHDPYVITKPAFIMRLSRGHVRENKS 1470
             Q  NR+        ++++E   R++ AS+ YQI+HDP VITKPA+I RL   HVRE++S
Sbjct: 1397 KQLINRLSYCTGQFRKAEQEFFYRISKASDEYQITHDPPVITKPAYITRLPSQHVRESRS 1456

Query: 1471 WKIITRLRHILTYLPKDWYLNVGQPLRDRKFDPSQDARSIFMSIFSNWRSWEFSDVARSY 1530
            WKI+TRLRHIL YLP     ++   L++ ++ P   A   F+ IFSNW +W++SDV + Y
Sbjct: 1457 WKIVTRLRHILNYLPTTLISDIFNDLKNSEYPPRSTAEETFLEIFSNWGNWDYSDVEKCY 1516

Query: 1531 IYGKLFLNDHAEXXXXXXXXXXXXNIGNFFMTVYSTNYDVDHSIVVSN--AKLLLELTPS 1588
            +Y ++F N   +              G F +  + +      S+++ N  A+  LE    
Sbjct: 1517 MYRRVFTNTLDD--TVAHESSTKIETGTFMLNFFDSINTGSDSVILKNLKAQRTLEACKD 1574

Query: 1589 STEPKENSLQREELIDISGTVDVIXXXXXXXXX-----XXXXXIPILTEGSEKQPVKPPQ 1643
                K +++   E  D+   +  I                     + T  +E   VK   
Sbjct: 1575 EAAEKRSNMSNAE-DDLEERLSCIINKAQISLSDGTLIKLLSVRELFTFEAEHAAVK-EN 1632

Query: 1644 DTIPKPFKMNAAFMVNSCDIQLVMDATKLNMNVNDGRISVLWENLQDSTAQAGSVVLFSK 1703
            + +P  F+   A +V+ CDIQL+  A + N+      ++++ EN +   A A S      
Sbjct: 1633 EKLPA-FQQYTA-LVDRCDIQLLCGANRANLKSFGNTLTIVREN-KSEDADAFSTAFAWS 1689

Query: 1704 HTELVLKHINSVL--AEGRVSNFYATFTTDTWAQRPTYLIHSK------SSSIHFRTMAK 1755
              E  ++H N++L  A  R S   A   +   ++R   L   K      S S H+ T   
Sbjct: 1690 WFEFGIRHRNTILLDAFSRSSAVGAHGFSGKNSRRKLDLRAKKFRLKLPSESKHYCTF-- 1747

Query: 1756 TERLVEAIKDIKLKIDQISEQLELERRLTQHPTVYDPNKSNVIASCLFSNVSMDIMPVSP 1815
             + L E+  +++L +   +  LE       H    +        +   S+++ DI  +S 
Sbjct: 1748 IDSLEESWNNLRLALGPNTGFLE-----KPHSAATEKVAPQFALNIDISDLTTDISLLSS 1802

Query: 1816 FALKNSAKQIDFFYNKFDSDSWLIKLKDTDFFLTSDQTKEQYMRLSMKKLQIRVNVSSSK 1875
             A+  + K++   Y +  S +  +  +  D  + S +T +QY+++S    Q  ++ S  +
Sbjct: 1803 LAITKNFKKLTLAYEQSASSALKLAFETLDIDVFSTRTTQQYLKIS----QSNISFSLHR 1858

Query: 1876 PKLVD-----INLSTNLVKLTFSEPKNIVYSFLKDERVASESVHLLQTLKPLFSISDDKE 1930
            PK  +     + L +N+ KL   +P++I     KD    +++   L +LK  F   + K 
Sbjct: 1859 PKKNNASPPTVKLDSNITKLKLYDPRDITLPLGKD---IAQAKACLASLKSCFGKLNTKN 1915

Query: 1931 STPQSYQEKTEY----LWSLDSSIDYFGILIPMTSTYYVMEFHSYVSSIS---------- 1976
                  Q  T++     W     ++Y G+LIP+ ST Y+ E +   + I+          
Sbjct: 1916 DKDIMSQGNTKFNFSASWIFQVRLNYVGLLIPLGSTSYITELNEISAFITADEFTNKASE 1975

Query: 1977 NANGAPSGNLDITGHMSVENILFLIKESSLPDGLSKVIDIAVNVSTLQRVDDNSRSIQVE 2036
            N+ GA      + G +S  +I FLI +  LP+ LS+V+D AV++   +  ++  RS+Q+E
Sbjct: 1976 NSQGA------LRGDLSAASIAFLINDRMLPEALSRVVDFAVSIKIAKESEEVIRSLQIE 2029

Query: 2037 SSHARICLSPDSLLRLLWGFNQGHKLSEHYLKYHSKSLWQSFAKSDDKQQDTNSIKSNET 2096
            S + RI LSP SL+R+L+  N+  +LSE               K     +   S++  ET
Sbjct: 2030 SPYFRIALSPFSLVRILFLVNELSRLSE-------------LQKRQTVGKLPESVEVRET 2076

Query: 2097 -SFFSSINSIHFLSYNLCVGWLFEYELGPPKGLITGYSRLFSAYENCMGKLTVIDSYFAA 2155
              F  +  S+  LSYN C+GW+F+    P  GLI GY RLF+A+E   GKLT++D+YF+ 
Sbjct: 2077 FRFRRAFRSVQVLSYNFCLGWIFDVNDSPEPGLIWGYQRLFAAHEKPYGKLTLLDAYFSI 2136

Query: 2156 AQGNTSSTFYPETNVKELFNRFYLPNMQILFWWKVIEGMKDVYVRFTGETLDVKYLSDFM 2215
            A+G+TS  FY   N  E  NR +LP+MQI +W +      ++++R  GE LDV++LS  +
Sbjct: 2137 AEGSTSDDFYAHKNSFENPNRSFLPSMQIRYWIESKGLTDELFIRINGERLDVRFLSKSI 2196

Query: 2216 LTIESTLHSIKMFQKLKKELI-----VETPKREVVHIKEDKPXXXXXXXXXXXXXXXCHF 2270
                  + S+ MF +LKK+ +     V  PKR        K                C  
Sbjct: 2197 DVAGGLMKSLNMFDELKKQYVDPFKSVANPKRPSATSTFSK-----FPGLSTIQRVDCKV 2251

Query: 2271 KYDGGTYSVFNISDGSLNPTPAIEIKSPVISVDVLYKHEKQ-NTKH-HSIRCLVNIDPTH 2328
            +Y GG + ++++ D      P+ +++SP  SV++L+ + +  + KH H +R  + +  +H
Sbjct: 2252 QYAGGVFRLYSLDDVQNEAGPSFQLESP--SVEILFDYRRMVHGKHSHILRAWMIVYSSH 2309

Query: 2329 NVLYATCAPLVKNFVEDVRSIFGRYESENKHSETTPTSVQNIDYEKLLEDYDLAITVTSA 2388
            N ++ TC P++     D+R +   +    + +     S +++DY   L   D++  +   
Sbjct: 2310 NTIFPTCVPVLNEMARDIRQLLKGFNRSPQEASHKSVSQESLDYRSFLRGTDISFLIDIG 2369

Query: 2389 KQQLSLSCEPKAKVQADVGFEALTVSMTTNPFDIDEPLAFSFSIKDTKASIKHLFSRETS 2448
            KQQ+S SCEPKAKVQAD+GFE L V + TN  D+ EPL+ S  I +  A  +H+FSRE S
Sbjct: 2370 KQQISFSCEPKAKVQADLGFEKLAVKVFTNDLDMSEPLSLSIDIYEITAKSRHIFSREVS 2429

Query: 2449 TSFGVGYLDLTLLFTHTNRINTYGTSLISDIDLYFNVKQLQNLYLFLDIWQL-------- 2500
            TS  +  L    + TH + I+TYG   I +ID+YFN+KQLQ+L +F++IW+         
Sbjct: 2430 TSIKIDQLSWIFILTHPDTIHTYGIMHIPNIDVYFNIKQLQDLNIFVNIWKPDSYVFTQP 2489

Query: 2501 ---SELLNPVTSSQEQVIRKDKKKSVDKPIHNESQLPWCFTLIFTNVKGDIDLGPSLGLI 2557
               SE    +TS ++ ++ K KK      + + +  PW F LI + +KGDIDLG SLG++
Sbjct: 2490 ELDSEHSRALTSEEKPLVAKFKK------VSSTTSFPWNFILIISKIKGDIDLGISLGVL 2543

Query: 2558 SLRLSRTWLATDHFSGKRQILHAFVDDLLLISEGRLSGVVNIDGASWVSEVIWLQDSKRD 2617
            SL   R W  TDH+S   Q L   ++ +LL S+GRL G + +   SW+S + W       
Sbjct: 2544 SLTTDRIWAITDHYSDWTQKLSLQMEKILLSSDGRLGGTLLLRNFSWMSRIRWPVREGVF 2603

Query: 2618 NIPLVALSLNTDKIEIKAAFDYHMFLIGTVNNILFQLHSERDMVGVAPDLLKVSFSCEEI 2677
              PLV L +  D+ ++K +FDYH+ LI +V  +  +L ++RD  G++ +LL V+ S    
Sbjct: 2604 ESPLVTLDVLLDEFDLKLSFDYHLILIASVEVLKLKLFNKRDPRGISRNLLSVAISSNST 2663

Query: 2678 KLCSTALVAANILDIYNTIIRMRQDTKISYIETLKDSNMETNKQTLAYRDILKSLQLLRT 2737
            +L  TAL  ANILD+YNTI+RMR+D + SY ETL DSN +  +     +DIL SL  LRT
Sbjct: 2664 QLFLTALAPANILDVYNTILRMRKDNRKSYFETLGDSNTKDTRSASTSKDILNSLSFLRT 2723

Query: 2738 DLTVSICSLQLQISPISLFDXXXXXXXXXXXSARSETHSEAKLTTSLNMEVYDATLSLST 2797
            +L VS+  + +QI P  LFD             +S+   + KL T L  +++   ++LS 
Sbjct: 2724 ELEVSLKFVHIQIYPSKLFDMEVLTFKAKDFLTQSQIEGDEKLKTHLKWQIHGVKIALSR 2783

Query: 2798 AKQELDEDALSKITVADYMTYASKIRGGTIIEIPRMGVQMTTWQEEKSDILEYLYSCKFH 2857
             K +L E A S+I V +Y+ +A K  GGTI+ IP + + MTTW +  ++ +E LYS  F 
Sbjct: 2784 FKNQLHEKAASQIGVKEYIEHARKADGGTILVIPAILIGMTTWHDVATNTVELLYSNSFG 2843

Query: 2858 DKVAVRWNLGPVNFMKEMWTTHVKAIAVRRSQVLTGSFNVSEKDVEKRIKEEENITKLNY 2917
             K+ +RWNLG +NF++EMW THV+A+A+RRS          ++ +E+++++ +   +  Y
Sbjct: 2844 GKIGIRWNLGSINFLREMWATHVRAMALRRSHNGQPRGFFEDEHLEEKLRDVDLGDEYEY 2903

Query: 2918 VPVEEPQIDMPQIKDLGDATPPVEWFGVNRKRFPAFTHQTAVVPVQNLVYLAQKQYAKTL 2977
            VP+EEP I++PQ KDLG+ATPPVEWFGVNRK+FP  THQ  +VP+Q L ++A+ ++A+ L
Sbjct: 2904 VPLEEPHIEIPQTKDLGEATPPVEWFGVNRKQFPGLTHQAMIVPLQKLAHIAETEWARIL 2963

Query: 2978 GRS 2980
            GR+
Sbjct: 2964 GRA 2966

>Kwal_YGOB_56.23808 s56 (712095..712280,712384..721023) [8826 bp, 2941
            aa] {ON} ANNOTATED BY YGOB -
          Length = 2941

 Score = 1040 bits (2690), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 574/1572 (36%), Positives = 856/1572 (54%), Gaps = 108/1572 (6%)

Query: 7    SAGFRGESLGFKRNFSWVFLVDWILTVILTLATLFYLSRAFAYGVTFILEWLLWKQAKVK 66
            S+ FR   +   ++FSWVFL DW+L + ++L + FY  R   Y +T ILE+L WK+  VK
Sbjct: 2    SSEFRRVPISTAQDFSWVFLTDWVLILSVSLLSAFYFGRVLGYTITTILEYLAWKRYGVK 61

Query: 67   VSIGALRISLLAGRVFFKNLTIIDKDRTITILEGSITWRYWLIRTRKSEYRVAQMAHASA 126
            V           GRVFFKNLT+I +D+T +IL GSITWRYWL+ +RK+            
Sbjct: 62   V-----------GRVFFKNLTVITQDQTYSILHGSITWRYWLLSSRKTS----------- 99

Query: 127  GSSGNSEDDTKFDIANYMEKQLKLPCRFLFECEGFEMFIYNRTYAYDNIVNVLSKVEREK 186
                         + +  EK  KLPCRF  EC+G E FIYNRT A+DNI++ L + ++E 
Sbjct: 100  -------------LESQSEKAAKLPCRFRIECQGLEHFIYNRTQAFDNILSSLPREDQEN 146

Query: 187  FEKFMAENDFLDPSSDGSSDDKIEETSSATNSTDEETIA---------NDRTFQNDTRKT 237
             +KF     F DPS   + +   E  S+A  S  E +++         NDRT+Q     +
Sbjct: 147  VKKF-----FSDPSPRATEETSTENDSAAQKSHLETSMSSPSASTESLNDRTYQ--LPNS 199

Query: 238  LPRYLEALPIEALLNKGSILIGNKFTPCVLILSFESAVALQDVGEAPSKLDLYRMKYEVR 297
            +P +L  LP+E  + KG+++IGNK T  V++ SFE      D     +K+DLY++K +  
Sbjct: 200  MPSFLRLLPLEYSVQKGALIIGNKKTSSVMVSSFEKLKGHLDACAPDTKIDLYKIKLQSD 259

Query: 298  LKNLEIMMKQNIDYDNEKSRNFEFDKGKLSRLWHRFTRIFKLVPFPFKSNRRKEQPHD-- 355
            +   ++ ++ N+ YDN++         +L +L H++   F  V   + S   K +     
Sbjct: 260  ITKFQMSLRPNLCYDNDEPLKNLPKANRLPKLLHKYYETFLRVRKRYLSRGSKTESTRKD 319

Query: 356  --NFMQKWKGLSMY--RNDMFGXXXXXXXXXXXXSSHEYAKFTSLLKSPRVTIHHDYDMP 411
              N +++W+GL +Y   ND                 HEYA+++ ++K   + I + +D P
Sbjct: 320  LRNPLERWRGLGLYWKEND----PAWDDVFHFELPKHEYARYSKVMKCEHMLIEYSHDTP 375

Query: 412  GWVPHGAHPPSSYADGPDVGNNMAPPQYIFEINIFGGTVCYGPWAQRQTNHLQSLLSPSV 471
            G VPHGA P     DGPDVGN  APP +  +I +FG  + YGPWA  +   +Q + SP V
Sbjct: 376  GVVPHGAFPTLEPLDGPDVGNGGAPPDFSLDIQVFGANIHYGPWAHHEIMPIQKVFSPVV 435

Query: 472  SRTAKPIKKLKPGSKRIYTVLKLTINAMEDVTWRIPTRESSKDVEFLMHYKETNDDYRPF 531
            SR + P ++L  GS R++T L+++I  M D  WRIPTRE SKD++FL  YKET DD RPF
Sbjct: 436  SRDSHPTERLSAGSTRVFTRLRISIMIMSDSIWRIPTREPSKDLDFLKRYKETEDDTRPF 495

Query: 532  GWIDIKVSRDSCGIFDLAMCPTSKGFKNTIDVQLVDTEIRSSVNHDIFLKSKSFSFNCDI 591
            GW+++ ++  S    ++AMCPTS GF N +D+  +  EIR+SVNHDI L +++      I
Sbjct: 496  GWLELSLAEGSEVRLNIAMCPTSTGFDNKLDLHFIKPEIRTSVNHDILLSAETHDIEAQI 555

Query: 592  GYPLGWNAEANWTIIMDSNQLELFLLREHVTLIADTLTDFSSGEPVPYELFRPFVYHIKW 651
            GYPLGWNA+A W   + S+Q  +F+L++H+TL+ D L+DF +G+P PY+LFRPF+Y   W
Sbjct: 556  GYPLGWNAKAKWNFDLKSHQARMFILKDHITLLGDILSDFGTGDPTPYDLFRPFIYEFNW 615

Query: 652  NMKGYSFYLNVNDHNIVNNPLDFNENCYLSIHGDDLTMNVMVPKKTITSRFTNMTYDIYT 711
             + GYS YLNVND NIVNNP+DFNENCYLS HGDDL ++  VP+ +I    T + Y++YT
Sbjct: 616  ELTGYSMYLNVNDANIVNNPVDFNENCYLSFHGDDLRISFRVPQDSIAGNSTTIDYNLYT 675

Query: 712  PMFRXXXXXXXXXXXXEFMRNKEVGRSHDFRLKGSYLIYSELDIDNVDTLTVECSSRGTA 771
            P+FR            EFM++KEVGR+ DF L GSYL +S+LD++N+DT+ +EC SR T 
Sbjct: 676  PLFRLNMNTPSWNTLHEFMKDKEVGRACDFSLAGSYLFHSKLDVENIDTIIIECKSRMTT 735

Query: 772  LHIYGFVIRYLINVKMNYFGEFFHFVTSEEYTGNTRPTDLENIISEDRRDDDFSSYESVS 831
            L  YG+V+R+L+ VKMNYFG+F HF T+EEY       +L +   E + + + S+  + +
Sbjct: 736  LKCYGYVVRFLVGVKMNYFGDFVHFKTTEEYM-----EELRDAYVEPKANSEQSANSTET 790

Query: 832  RISSNSSDXXXX----XXXXXXXXXXXXXRTSNETDIWFTFSVWDGALILPETIYNADPC 887
              +    D                     R  NE D+WFTF V DG LILP+ +Y+ + C
Sbjct: 791  TTAGEGEDKQNAPKNHTTDPVMAKKLSLKRMVNEKDVWFTFIVEDGCLILPKNLYDCNAC 850

Query: 888  IALHFAELIVDLRSCNYYMDILATACDINLKRYVGKRADEIYEYVHLNNGKDHEV----- 942
             A  F  L +DLR  NYYMD+ A    + ++           +  HL +G +        
Sbjct: 851  FAFEFDSLDIDLRYINYYMDLQAALSPVIVRNLSD------CDPAHLFSGSEGRCPSRAN 904

Query: 943  HGTLSDIYIHGHRMYGLPPTEPTYFCQWDMDFGHLNIDSNMFFLQGLFGAFYKIGFGYKD 1002
             G++SD++IH HRM+GLPP E TYFC+WD   G L+I S++  +     A+ K+ F +KD
Sbjct: 905  FGSISDLHIHAHRMFGLPPDEETYFCKWDFSMGVLDISSDLSCILSFGDAWSKLAFSFKD 964

Query: 1003 LENILLYETEIIDDMTSLTIFINTIDIRLNDVDTTAHADLKLERFCFTLIDFENERYSKR 1062
             ENI+ Y+   I DMTS+      I +++NDV    +  +++E      +DFENERYS R
Sbjct: 965  YENIMNYKIVPILDMTSIIFHAGEIRVKINDVAVDYYIIVEVENVTARGVDFENERYSSR 1024

Query: 1063 MDIKIPSLEFNIFSNEDNDLSLLNFKVDMNFTNFVQNQDFNKHRKIQRDYIVLNDAPYHR 1122
             D+ I S+   +     +   + +F   +  T F Q ++F  H   Q+ +I  NDAP+HR
Sbjct: 1025 ADVDIHSITVQVKEGGKDGSLIGDFSSSLKITKFCQLKNFLVHSMQQKSHIATNDAPFHR 1084

Query: 1123 CAFLLPESYQKSRIYNELFGXXXXXXXXXXXXXXXTADTIEYVLEDLLE-DYMGLFEGNY 1181
            C+FLLP + Q+S  Y +L G               T + +  +L++ L+ +   L  GN 
Sbjct: 1085 CSFLLPLAIQRSDNYRKLLGSIVPGVSIPGMVEPITPENVTMILDEFLKGEKNSLQMGNE 1144

Query: 1182 DIKESSVENLELSAIEATRAITGIGAERTHSNPITLSDYAVESDNYVVKVESIVIDINPA 1241
                   E+       A    +G+ +        T +D  VES++ VVK+      I+  
Sbjct: 1145 HFCSKKEED-----GYAFNFASGLMSS-------TENDSNVESESLVVKLIKPQASISAC 1192

Query: 1242 LYTTIEKLLKHIYDQDAVQIIDGIEIGIVKRLSSIHDGVTTMTNVKVQIKHFNLFWGEKE 1301
                        Y     Q+ID  EI +V              NVKV    F +      
Sbjct: 1193 CIKPFRSFSDQAYSNFVEQLIDSNEIEVVLHFIETTLKRKQCKNVKVFSPTFEMTLSNFG 1252

Query: 1302 SDNVSMFFDKMDFALTEKTLE---------QNSEKNLLE-MTVLAKIKAVRLTV--VQQP 1349
            SDN+S   D +D  + E +++          +SEK+ ++ +T L K++++ L V    + 
Sbjct: 1253 SDNISQTSDTVDIVIKEISVDISMREEPSPNSSEKSTVQDITALVKVESLALCVSNTSRN 1312

Query: 1350 GLIPTQERPPAITVGVEGFEFWSTAIEKQVNSISVSSADITVDDAQVEWFFKYIVRQKYF 1409
            G +         +  ++  EFW T+ + + +S + +S D  V   + E    ++ +    
Sbjct: 1313 GPLENIHEDQLCSTSIKDLEFWMTSEDIRKSSFNATSIDTWVHSDKTELCCIFL-KNTAA 1371

Query: 1410 FLDMLQSYNRIQNNRIE-SQKELISRLTAASEYYQISHDPYVITKPAFIMRLSRGHVREN 1468
             +D +     +   R++ +Q++   R++ AS+ YQI HDP VITKPA+I RL   HVREN
Sbjct: 1372 NIDTITEVVSVHKERLQKAQRDFFYRISTASDEYQIIHDPPVITKPAYITRLPNQHVREN 1431

Query: 1469 KSWKIITRLRHILTYLPKDWYLNVGQPLRDRKFDPSQDARSIFMSIFSNWRSWEFSDVAR 1528
            KSWKIITRLRHIL YLP      +   L+   F+   +A  IF++IFS WRSWE SDV +
Sbjct: 1432 KSWKIITRLRHILNYLPPSLLAEIYGALKSASFEAPTNAGEIFLNIFSKWRSWESSDVEQ 1491

Query: 1529 SYIYGKLFLNDH 1540
             Y+Y K F + +
Sbjct: 1492 CYMYRKAFYSQY 1503

 Score =  748 bits (1930), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 449/1351 (33%), Positives = 739/1351 (54%), Gaps = 49/1351 (3%)

Query: 1652 MNAAFMVNSCDIQLVMDATKLNMNVNDGRISVLWENLQDSTAQAGSVVLFSKHTELVLKH 1711
            M  A +++ C+I++ +D+   N+      IS    + + +     S+ L     E  ++H
Sbjct: 1618 MELALLIDRCEIKISLDSKTANLKSFGNSISFALVDTESARDTGSSMALAWSWFEFDVRH 1677

Query: 1712 INSVLAE-----GRVSNFYATFTTDTWAQRPTYLIHSKSSSIHFRTMAKTERLVEAIKDI 1766
             N+++ +     G + +F +   + T      + +H  S  +  +  + T+     I  +
Sbjct: 1678 NNAIIVDAFARRGSLGSFISQSESTT-----LHRVHLGSQKLRLKVPSSTKDYCNFINSL 1732

Query: 1767 KLKIDQISEQLELERRLTQHPTVYDPNKSNVIASCLFSNVSMDIMPVSPFALKNSAKQID 1826
                  ++ +L+   R ++  +    N S V       + + +I  +SP ++    K + 
Sbjct: 1733 SESWSSLAPKLKFNTR-SKDLSPEMKNFSKVAFEAHVDDFTSEISALSPLSISKRFKGLT 1791

Query: 1827 FFYNKFDSDSWLIKLKDTDFFLTSDQTKEQYMRLSMKKLQIRVNVSSSKPKLVD-INLST 1885
              + K  + S  +K+++ D  L S+ T +QY+++S  ++++   +     K+   + L +
Sbjct: 1792 VQFEKEANSSLRLKVENFDLDLLSEMTAQQYLKVSQSQVELTAKIHDKIEKVASKMQLES 1851

Query: 1886 NLVKLTFSEPKNIVYSFLKDERVASES-----VHLLQTLKPLFSISDDKESTPQSYQEKT 1940
             L K    +P+ I+ +  +D   A ++     +HLL  L  LF      E          
Sbjct: 1852 ALTKFKLCDPREIIETLTQDLVNAKQNLEQLKIHLL-ALGALFGTDSTDEEVFAGALWPR 1910

Query: 1941 EYLWSLDSSIDYFGILIPMTSTYYVMEFHSYVSSISNANGAPSGNLDITGHMSVENILFL 2000
            E+LW LD  + Y G+L+P+ +T Y+ E +   SS+S    A      + G +SV  I FL
Sbjct: 1911 EWLWQLD--MKYVGLLVPLGTTSYISEINELSSSLSCDEAAEFSFPLVHGELSVAGISFL 1968

Query: 2001 IKESSLPDGLSKVIDIAVNVSTLQRVDDNSRSIQVESSHARICLSPDSLLRLL-WGFNQG 2059
            I +  LP+ LSKV++ A  +   +  +++ +S+Q+ES+H RI L P SL+R+L   +   
Sbjct: 1969 INDKELPEDLSKVLEFAFRIKLAKVAENSMKSLQIESTHFRIALCPFSLIRILSLAYEAT 2028

Query: 2060 HKLSEHYLKYHSKSLWQSFAKSDDKQQDTNSIKSNETSFFSSINSIHFLSYNLCVGWLFE 2119
            H      LK ++        KS D  +D  +I         + +SI  LSY+ C+GW+F 
Sbjct: 2029 HLSGLQALKDNAG------VKSSDDAKDFFNISQ-------TFHSIQILSYDFCLGWIFN 2075

Query: 2120 YELGPPKGLITGYSRLFSAYENCMGKLTVIDSYFAAAQGNTSSTFYPETNVKELFNRFYL 2179
             +     GL  GY RLF+A+E   GKLT++D+YF  A+G+TS+ FY + +  +  NR  L
Sbjct: 2076 NDGASNSGLTWGYQRLFAAHEKPYGKLTLLDAYFFIARGSTSNDFYIQPDEVDRPNRSSL 2135

Query: 2180 PNMQILFWWKVIEGMKDVYVRFTGETLDVKYLSDFMLTIESTLHSIKMFQKLKKELIVET 2239
            P+MQI +W++      +++VR  GE LDV +LS  +        S+ +FQ+LK++ +   
Sbjct: 2136 PSMQICYWFETNGSEDELFVRINGERLDVSFLSKSIGIAGGFARSLHLFQELKRQYLDPF 2195

Query: 2240 PKREVVHIKEDKPXXXXXXXXXXXXXXXCHFKYDGGTYSVFNISDGSLNPTPAIEIKSPV 2299
               E V                      C  +Y GG + ++++ D      P+ +++SP 
Sbjct: 2196 KPEEPVKRVPAGSAFSKLPILSSISHVNCKVRYAGGVFKLYSLDDIKRKTGPSFQLESP- 2254

Query: 2300 ISVDVLYKHEKQNT--KHHSIRCLVNIDPTHNVLYATCAPLVKNFVEDVRSIFGRYESEN 2357
             SVDV++++ K  T  + H +R L+++D +HN L+ TC P++     D+R +       +
Sbjct: 2255 -SVDVIFEYTKMLTGKRKHLLRALMSVDSSHNTLFPTCVPIISEMALDIRQLLKDLNKSS 2313

Query: 2358 KHSETTPTSVQNIDYEKLLEDYDLAITVTSAKQQLSLSCEPKAKVQADVGFEALTVSMTT 2417
              +  T    + I+Y  LL+D D++  +   KQQ+SLSCEPKAKVQADVGFE   + + T
Sbjct: 2314 VETPRTSNMQEGINYRSLLQDVDISFMMNIDKQQISLSCEPKAKVQADVGFEKFAMKLFT 2373

Query: 2418 NPFDIDEPLAFSFSIKDTKASIKHLFSRETSTSFGVGYLDLTLLFTHTNRINTYGTSLIS 2477
            N FD+ EPL+ S  I +  A+ +H+FSRE STS  +  L    + TH + I+TYG + I 
Sbjct: 2374 NDFDVLEPLSLSLDIHNITATSRHIFSREVSTSLNIECLSFVFMLTHPDTIHTYGIANIP 2433

Query: 2478 DIDLYFNVKQLQNLYLFLDIWQL-SELLNPVTSSQEQVIRKDKKKSVDKPIHNE------ 2530
             ID+YFN+KQLQ+L +F++IW+L S++L+      + VI      +++KP+ ++      
Sbjct: 2434 TIDVYFNIKQLQDLNVFINIWKLDSKILSQPELDNKFVI---GPTNLEKPLTSKYKKVIS 2490

Query: 2531 -SQLPWCFTLIFTNVKGDIDLGPSLGLISLRLSRTWLATDHFSGKRQILHAFVDDLLLIS 2589
             S  PW F +I + ++G+IDLG SLG++SL   + W  TDH+S   Q L   +D L L S
Sbjct: 2491 NSSFPWNFVVILSRIRGEIDLGISLGVLSLTTEKIWAVTDHYSDWTQTLSLQLDKLSLSS 2550

Query: 2590 EGRLSGVVNIDGASWVSEVIWLQDSKRDNIPLVALSLNTDKIEIKAAFDYHMFLIGTVNN 2649
            +GRL G   +    W+S++ W  +      PLV L++  D+  +K  FDYH+ LI +V  
Sbjct: 2551 DGRLGGTFLLQNFRWMSQIKWPLNEGSFESPLVVLNIFLDETAVKLTFDYHLVLIASVEK 2610

Query: 2650 ILFQLHSERDMVGVAPDLLKVSFSCEEIKLCSTALVAANILDIYNTIIRMRQDTKISYIE 2709
            +   L ++RD  GV  +LL VS S +  ++  TAL  ANI D+YNTI+RMR+D + SY+E
Sbjct: 2611 LSLSLFNKRDPRGVIRNLLSVSLSSDSTQVFLTALAPANIFDVYNTILRMRKDNRKSYLE 2670

Query: 2710 TLKDSNMETNKQTLAYRDILKSLQLLRTDLTVSICSLQLQISPISLFDXXXXXXXXXXXS 2769
            TL DSN    K + +  +IL SL  LRT+L+V +  + +Q+ P +LFD           S
Sbjct: 2671 TLGDSNTRDTKGSSSSHEILSSLSFLRTELSVMLKFVHIQVYPSTLFDMEVMTFKARDFS 2730

Query: 2770 ARSETHSEAKLTTSLNMEVYDATLSLSTAKQELDEDALSKITVADYMTYASKIRGGTIIE 2829
              S+T    KL T L ++V++  L+LST K +L E   S+I V +Y+ +ASK+ GGTI+ 
Sbjct: 2731 TFSQTEGSKKLKTQLKLKVHNVKLALSTYKSQLHERVASQIGVKEYIEHASKVDGGTILS 2790

Query: 2830 IPRMGVQMTTWQEEKSDILEYLYSCKFHDKVAVRWNLGPVNFMKEMWTTHVKAIAVRRSQ 2889
             P + + MTTW +  ++ +E LYS  F  K+ VRWNLG +NF++EMW TH +A+A+RRS 
Sbjct: 2791 TPAILIGMTTWHDVATNKVELLYSNSFGGKIGVRWNLGSINFLREMWATHARAMALRRSH 2850

Query: 2890 VLTGSFNVSEKDVEKRIKEEENITKLNYVPVEEPQIDMPQIKDLGDATPPVEWFGVNRKR 2949
                     ++ +  ++K+ +   +  Y+P+EEP I++PQ KDLG+ATPPVEWFGVNRK+
Sbjct: 2851 NGQSKSFFEDEHLGDKLKDVDLGDEYTYIPLEEPHIEIPQTKDLGEATPPVEWFGVNRKQ 2910

Query: 2950 FPAFTHQTAVVPVQNLVYLAQKQYAKTLGRS 2980
            FP  THQ  +VP+Q L +LA+ ++A+ LGR+
Sbjct: 2911 FPGLTHQGVIVPLQKLAHLAESEWARILGRA 2941

>Kwal_56.23810 s56 (712732..721023) [8292 bp, 2763 aa] {OFF} YLR087C
            (CSF1) -  [contig 172] PARTIAL
          Length = 2763

 Score =  892 bits (2306), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 491/1353 (36%), Positives = 738/1353 (54%), Gaps = 62/1353 (4%)

Query: 213  SSATNSTDEETIANDRTFQNDTRKTLPRYLEALPIEALLNKGSILIGNKFTPCVLILSFE 272
            SS + ST+     NDRT+Q     ++P +L  LP+E  + KG+++IGNK T  V++ SFE
Sbjct: 2    SSPSASTES---LNDRTYQ--LPNSMPSFLRLLPLEYSVQKGALIIGNKKTSSVMVSSFE 56

Query: 273  SAVALQDVGEAPSKLDLYRMKYEVRLKNLEIMMKQNIDYDNEKSRNFEFDKGKLSRLWHR 332
                  D     +K+DLY++K +  +   ++ ++ N+ YDN++         +L +L H+
Sbjct: 57   KLKGHLDACAPDTKIDLYKIKLQSDITKFQMSLRPNLCYDNDEPLKNLPKANRLPKLLHK 116

Query: 333  FTRIFKLVPFPFKSNRRKEQPHD----NFMQKWKGLSMY--RNDMFGXXXXXXXXXXXXS 386
            +   F  V   + S   K +       N +++W+GL +Y   ND                
Sbjct: 117  YYETFLRVRKRYLSRGSKTESTRKDLRNPLERWRGLGLYWKEND----PAWDDVFHFELP 172

Query: 387  SHEYAKFTSLLKSPRVTIHHDYDMPGWVPHGAHPPSSYADGPDVGNNMAPPQYIFEINIF 446
             HEYA+++ ++K   + I + +D PG VPHGA P     DGPDVGN  APP +  +I +F
Sbjct: 173  KHEYARYSKVMKCEHMLIEYSHDTPGVVPHGAFPTLEPLDGPDVGNGGAPPDFSLDIQVF 232

Query: 447  GGTVCYGPWAQRQTNHLQSLLSPSVSRTAKPIKKLKPGSKRIYTVLKLTINAMEDVTWRI 506
            G  + YGPWA  +   +Q + SP VSR + P ++L  GS R++T L+++I  M D  WRI
Sbjct: 233  GANIHYGPWAHHEIMPIQKVFSPVVSRDSHPTERLSAGSTRVFTRLRISIMIMSDSIWRI 292

Query: 507  PTRESSKDVEFLMHYKETNDDYRPFGWIDIKVSRDSCGIFDLAMCPTSKGFKNTIDVQLV 566
            PTRE SKD++FL  YKET DD RPFGW+++ ++  S    ++AMCPTS GF N +D+  +
Sbjct: 293  PTREPSKDLDFLKRYKETEDDTRPFGWLELSLAEGSEVRLNIAMCPTSTGFDNKLDLHFI 352

Query: 567  DTEIRSSVNHDIFLKSKSFSFNCDIGYPLGWNAEANWTIIMDSNQLELFLLREHVTLIAD 626
              EIR+SVNHDI L +++      IGYPLGWNA+A W   + S+Q  +F+L++H+TL+ D
Sbjct: 353  KPEIRTSVNHDILLSAETHDIEAQIGYPLGWNAKAKWNFDLKSHQARMFILKDHITLLGD 412

Query: 627  TLTDFSSGEPVPYELFRPFVYHIKWNMKGYSFYLNVNDHNIVNNPLDFNENCYLSIHGDD 686
             L+DF +G+P PY+LFRPF+Y   W + GYS YLNVND NIVNNP+DFNENCYLS HGDD
Sbjct: 413  ILSDFGTGDPTPYDLFRPFIYEFNWELTGYSMYLNVNDANIVNNPVDFNENCYLSFHGDD 472

Query: 687  LTMNVMVPKKTITSRFTNMTYDIYTPMFRXXXXXXXXXXXXEFMRNKEVGRSHDFRLKGS 746
            L ++  VP+ +I    T + Y++YTP+FR            EFM++KEVGR+ DF L GS
Sbjct: 473  LRISFRVPQDSIAGNSTTIDYNLYTPLFRLNMNTPSWNTLHEFMKDKEVGRACDFSLAGS 532

Query: 747  YLIYSELDIDNVDTLTVECSSRGTALHIYGFVIRYLINVKMNYFGEFFHFVTSEEYTGNT 806
            YL +S+LD++N+DT+ +EC SR T L  YG+V+R+L+ VKMNYFG+F HF T+EEY    
Sbjct: 533  YLFHSKLDVENIDTIIIECKSRMTTLKCYGYVVRFLVGVKMNYFGDFVHFKTTEEYM--- 589

Query: 807  RPTDLENIISEDRRDDDFSSYESVSRISSNSSDXXXX----XXXXXXXXXXXXXRTSNET 862
               +L +   E + + + S+  + +  +    D                     R  NE 
Sbjct: 590  --EELRDAYVEPKANSEQSANSTETTTAGEGEDKQNAPKNHTTDPVMAKKLSLKRMVNEK 647

Query: 863  DIWFTFSVWDGALILPETIYNADPCIALHFAELIVDLRSCNYYMDILATACDINLKRYVG 922
            D+WFTF V DG LILP+ +Y+ + C A  F  L +DLR  NYYMD+ A    + ++    
Sbjct: 648  DVWFTFIVEDGCLILPKNLYDCNACFAFEFDSLDIDLRYINYYMDLQAALSPVIVRNLSD 707

Query: 923  KRADEIYEYVHLNNGKDHEV-----HGTLSDIYIHGHRMYGLPPTEPTYFCQWDMDFGHL 977
                   +  HL +G +         G++SD++IH HRM+GLPP E TYFC+WD   G L
Sbjct: 708  ------CDPAHLFSGSEGRCPSRANFGSISDLHIHAHRMFGLPPDEETYFCKWDFSMGVL 761

Query: 978  NIDSNMFFLQGLFGAFYKIGFGYKDLENILLYETEIIDDMTSLTIFINTIDIRLNDVDTT 1037
            +I S++  +     A+ K+ F +KD ENI+ Y+   I DMTS+      I +++NDV   
Sbjct: 762  DISSDLSCILSFGDAWSKLAFSFKDYENIMNYKIVPILDMTSIIFHAGEIRVKINDVAVD 821

Query: 1038 AHADLKLERFCFTLIDFENERYSKRMDIKIPSLEFNIFSNEDNDLSLLNFKVDMNFTNFV 1097
             +  +++E      +DFENERYS R D+ I S+   +     +   + +F   +  T F 
Sbjct: 822  YYIIVEVENVTARGVDFENERYSSRADVDIHSITVQVKEGGKDGSLIGDFSSSLKITKFC 881

Query: 1098 QNQDFNKHRKIQRDYIVLNDAPYHRCAFLLPESYQKSRIYNELFGXXXXXXXXXXXXXXX 1157
            Q ++F  H   Q+ +I  NDAP+HRC+FLLP + Q+S  Y +L G               
Sbjct: 882  QLKNFLVHSMQQKSHIATNDAPFHRCSFLLPLAIQRSDNYRKLLGSIVPGVSIPGMVEPI 941

Query: 1158 TADTIEYVLEDLLE-DYMGLFEGNYDIKESSVENLELSAIEATRAITGIGAERTHSNPIT 1216
            T + +  +L++ L+ +   L  GN        E+       A    +G+ +        T
Sbjct: 942  TPENVTMILDEFLKGEKNSLQMGNEHFCSKKEED-----GYAFNFASGLMSS-------T 989

Query: 1217 LSDYAVESDNYVVKVESIVIDINPALYTTIEKLLKHIYDQDAVQIIDGIEIGIVKRLSSI 1276
             +D  VES++ VVK+      I+              Y     Q+ID  EI +V      
Sbjct: 990  ENDSNVESESLVVKLIKPQASISACCIKPFRSFSDQAYSNFVEQLIDSNEIEVVLHFIET 1049

Query: 1277 HDGVTTMTNVKVQIKHFNLFWGEKESDNVSMFFDKMDFALTEKTLE---------QNSEK 1327
                    NVKV    F +      SDN+S   D +D  + E +++          +SEK
Sbjct: 1050 TLKRKQCKNVKVFSPTFEMTLSNFGSDNISQTSDTVDIVIKEISVDISMREEPSPNSSEK 1109

Query: 1328 NLLE-MTVLAKIKAVRLTV--VQQPGLIPTQERPPAITVGVEGFEFWSTAIEKQVNSISV 1384
            + ++ +T L K++++ L V    + G +         +  ++  EFW T+ + + +S + 
Sbjct: 1110 STVQDITALVKVESLALCVSNTSRNGPLENIHEDQLCSTSIKDLEFWMTSEDIRKSSFNA 1169

Query: 1385 SSADITVDDAQVEWFFKYIVRQKYFFLDMLQSYNRIQNNRIE-SQKELISRLTAASEYYQ 1443
            +S D  V   + E    ++ +     +D +     +   R++ +Q++   R++ AS+ YQ
Sbjct: 1170 TSIDTWVHSDKTELCCIFL-KNTAANIDTITEVVSVHKERLQKAQRDFFYRISTASDEYQ 1228

Query: 1444 ISHDPYVITKPAFIMRLSRGHVRENKSWKIITRLRHILTYLPKDWYLNVGQPLRDRKFDP 1503
            I HDP VITKPA+I RL   HVRENKSWKIITRLRHIL YLP      +   L+   F+ 
Sbjct: 1229 IIHDPPVITKPAYITRLPNQHVRENKSWKIITRLRHILNYLPPSLLAEIYGALKSASFEA 1288

Query: 1504 SQDARSIFMSIFSNWRSWEFSDVARSYIYGKLF 1536
              +A  IF++IFS WRSWE SDV + Y+Y K F
Sbjct: 1289 PTNAGEIFLNIFSKWRSWESSDVEQCYMYRKAF 1321

 Score =  748 bits (1931), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 449/1351 (33%), Positives = 739/1351 (54%), Gaps = 49/1351 (3%)

Query: 1652 MNAAFMVNSCDIQLVMDATKLNMNVNDGRISVLWENLQDSTAQAGSVVLFSKHTELVLKH 1711
            M  A +++ C+I++ +D+   N+      IS    + + +     S+ L     E  ++H
Sbjct: 1440 MELALLIDRCEIKISLDSKTANLKSFGNSISFALVDTESARDTGSSMALAWSWFEFDVRH 1499

Query: 1712 INSVLAE-----GRVSNFYATFTTDTWAQRPTYLIHSKSSSIHFRTMAKTERLVEAIKDI 1766
             N+++ +     G + +F +   + T      + +H  S  +  +  + T+     I  +
Sbjct: 1500 NNAIIVDAFARRGSLGSFISQSESTT-----LHRVHLGSQKLRLKVPSSTKDYCNFINSL 1554

Query: 1767 KLKIDQISEQLELERRLTQHPTVYDPNKSNVIASCLFSNVSMDIMPVSPFALKNSAKQID 1826
                  ++ +L+   R ++  +    N S V       + + +I  +SP ++    K + 
Sbjct: 1555 SESWSSLAPKLKFNTR-SKDLSPEMKNFSKVAFEAHVDDFTSEISALSPLSISKRFKGLT 1613

Query: 1827 FFYNKFDSDSWLIKLKDTDFFLTSDQTKEQYMRLSMKKLQIRVNVSSSKPKLVD-INLST 1885
              + K  + S  +K+++ D  L S+ T +QY+++S  ++++   +     K+   + L +
Sbjct: 1614 VQFEKEANSSLRLKVENFDLDLLSEMTAQQYLKVSQSQVELTAKIHDKIEKVASKMQLES 1673

Query: 1886 NLVKLTFSEPKNIVYSFLKDERVASES-----VHLLQTLKPLFSISDDKESTPQSYQEKT 1940
             L K    +P+ I+ +  +D   A ++     +HLL  L  LF      E          
Sbjct: 1674 ALTKFKLCDPREIIETLTQDLVNAKQNLEQLKIHLL-ALGALFGTDSTDEEVFAGALWPR 1732

Query: 1941 EYLWSLDSSIDYFGILIPMTSTYYVMEFHSYVSSISNANGAPSGNLDITGHMSVENILFL 2000
            E+LW LD  + Y G+L+P+ +T Y+ E +   SS+S    A      + G +SV  I FL
Sbjct: 1733 EWLWQLD--MKYVGLLVPLGTTSYISEINELSSSLSCDEAAEFSFPLVHGELSVAGISFL 1790

Query: 2001 IKESSLPDGLSKVIDIAVNVSTLQRVDDNSRSIQVESSHARICLSPDSLLRLL-WGFNQG 2059
            I +  LP+ LSKV++ A  +   +  +++ +S+Q+ES+H RI L P SL+R+L   +   
Sbjct: 1791 INDKELPEDLSKVLEFAFRIKLAKVAENSMKSLQIESTHFRIALCPFSLIRILSLAYEAT 1850

Query: 2060 HKLSEHYLKYHSKSLWQSFAKSDDKQQDTNSIKSNETSFFSSINSIHFLSYNLCVGWLFE 2119
            H      LK ++        KS D  +D  +I         + +SI  LSY+ C+GW+F 
Sbjct: 1851 HLSGLQALKDNAG------VKSSDDAKDFFNISQ-------TFHSIQILSYDFCLGWIFN 1897

Query: 2120 YELGPPKGLITGYSRLFSAYENCMGKLTVIDSYFAAAQGNTSSTFYPETNVKELFNRFYL 2179
             +     GL  GY RLF+A+E   GKLT++D+YF  A+G+TS+ FY + +  +  NR  L
Sbjct: 1898 NDGASNSGLTWGYQRLFAAHEKPYGKLTLLDAYFFIARGSTSNDFYIQPDEVDRPNRSSL 1957

Query: 2180 PNMQILFWWKVIEGMKDVYVRFTGETLDVKYLSDFMLTIESTLHSIKMFQKLKKELIVET 2239
            P+MQI +W++      +++VR  GE LDV +LS  +        S+ +FQ+LK++ +   
Sbjct: 1958 PSMQICYWFETNGSEDELFVRINGERLDVSFLSKSIGIAGGFARSLHLFQELKRQYLDPF 2017

Query: 2240 PKREVVHIKEDKPXXXXXXXXXXXXXXXCHFKYDGGTYSVFNISDGSLNPTPAIEIKSPV 2299
               E V                      C  +Y GG + ++++ D      P+ +++SP 
Sbjct: 2018 KPEEPVKRVPAGSAFSKLPILSSISHVNCKVRYAGGVFKLYSLDDIKRKTGPSFQLESP- 2076

Query: 2300 ISVDVLYKHEKQNT--KHHSIRCLVNIDPTHNVLYATCAPLVKNFVEDVRSIFGRYESEN 2357
             SVDV++++ K  T  + H +R L+++D +HN L+ TC P++     D+R +       +
Sbjct: 2077 -SVDVIFEYTKMLTGKRKHLLRALMSVDSSHNTLFPTCVPIISEMALDIRQLLKDLNKSS 2135

Query: 2358 KHSETTPTSVQNIDYEKLLEDYDLAITVTSAKQQLSLSCEPKAKVQADVGFEALTVSMTT 2417
              +  T    + I+Y  LL+D D++  +   KQQ+SLSCEPKAKVQADVGFE   + + T
Sbjct: 2136 VETPRTSNMQEGINYRSLLQDVDISFMMNIDKQQISLSCEPKAKVQADVGFEKFAMKLFT 2195

Query: 2418 NPFDIDEPLAFSFSIKDTKASIKHLFSRETSTSFGVGYLDLTLLFTHTNRINTYGTSLIS 2477
            N FD+ EPL+ S  I +  A+ +H+FSRE STS  +  L    + TH + I+TYG + I 
Sbjct: 2196 NDFDVLEPLSLSLDIHNITATSRHIFSREVSTSLNIECLSFVFMLTHPDTIHTYGIANIP 2255

Query: 2478 DIDLYFNVKQLQNLYLFLDIWQL-SELLNPVTSSQEQVIRKDKKKSVDKPIHNE------ 2530
             ID+YFN+KQLQ+L +F++IW+L S++L+      + VI      +++KP+ ++      
Sbjct: 2256 TIDVYFNIKQLQDLNVFINIWKLDSKILSQPELDNKFVI---GPTNLEKPLTSKYKKVIS 2312

Query: 2531 -SQLPWCFTLIFTNVKGDIDLGPSLGLISLRLSRTWLATDHFSGKRQILHAFVDDLLLIS 2589
             S  PW F +I + ++G+IDLG SLG++SL   + W  TDH+S   Q L   +D L L S
Sbjct: 2313 NSSFPWNFVVILSRIRGEIDLGISLGVLSLTTEKIWAVTDHYSDWTQTLSLQLDKLSLSS 2372

Query: 2590 EGRLSGVVNIDGASWVSEVIWLQDSKRDNIPLVALSLNTDKIEIKAAFDYHMFLIGTVNN 2649
            +GRL G   +    W+S++ W  +      PLV L++  D+  +K  FDYH+ LI +V  
Sbjct: 2373 DGRLGGTFLLQNFRWMSQIKWPLNEGSFESPLVVLNIFLDETAVKLTFDYHLVLIASVEK 2432

Query: 2650 ILFQLHSERDMVGVAPDLLKVSFSCEEIKLCSTALVAANILDIYNTIIRMRQDTKISYIE 2709
            +   L ++RD  GV  +LL VS S +  ++  TAL  ANI D+YNTI+RMR+D + SY+E
Sbjct: 2433 LSLSLFNKRDPRGVIRNLLSVSLSSDSTQVFLTALAPANIFDVYNTILRMRKDNRKSYLE 2492

Query: 2710 TLKDSNMETNKQTLAYRDILKSLQLLRTDLTVSICSLQLQISPISLFDXXXXXXXXXXXS 2769
            TL DSN    K + +  +IL SL  LRT+L+V +  + +Q+ P +LFD           S
Sbjct: 2493 TLGDSNTRDTKGSSSSHEILSSLSFLRTELSVMLKFVHIQVYPSTLFDMEVMTFKARDFS 2552

Query: 2770 ARSETHSEAKLTTSLNMEVYDATLSLSTAKQELDEDALSKITVADYMTYASKIRGGTIIE 2829
              S+T    KL T L ++V++  L+LST K +L E   S+I V +Y+ +ASK+ GGTI+ 
Sbjct: 2553 TFSQTEGSKKLKTQLKLKVHNVKLALSTYKSQLHERVASQIGVKEYIEHASKVDGGTILS 2612

Query: 2830 IPRMGVQMTTWQEEKSDILEYLYSCKFHDKVAVRWNLGPVNFMKEMWTTHVKAIAVRRSQ 2889
             P + + MTTW +  ++ +E LYS  F  K+ VRWNLG +NF++EMW TH +A+A+RRS 
Sbjct: 2613 TPAILIGMTTWHDVATNKVELLYSNSFGGKIGVRWNLGSINFLREMWATHARAMALRRSH 2672

Query: 2890 VLTGSFNVSEKDVEKRIKEEENITKLNYVPVEEPQIDMPQIKDLGDATPPVEWFGVNRKR 2949
                     ++ +  ++K+ +   +  Y+P+EEP I++PQ KDLG+ATPPVEWFGVNRK+
Sbjct: 2673 NGQSKSFFEDEHLGDKLKDVDLGDEYTYIPLEEPHIEIPQTKDLGEATPPVEWFGVNRKQ 2732

Query: 2950 FPAFTHQTAVVPVQNLVYLAQKQYAKTLGRS 2980
            FP  THQ  +VP+Q L +LA+ ++A+ LGR+
Sbjct: 2733 FPGLTHQGVIVPLQKLAHLAESEWARILGRA 2763

>Ecym_4310 Chr4 (657929..666760) [8832 bp, 2943 aa] {ON} similar to
            Ashbya gossypii AGR088W
          Length = 2943

 Score =  894 bits (2309), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 518/1557 (33%), Positives = 814/1557 (52%), Gaps = 79/1557 (5%)

Query: 10   FRGESLGFKRNFSWVFLVDWILTVILTLATLFYLSRAFAYGVTFILEWLLWKQAKVKVSI 69
            F    + ++R F WVFLV+W   +++ + T FYL RA  Y VT IL W++WK+ KV ++I
Sbjct: 7    FEAIQVPYERRFGWVFLVNWAQLILINVFTTFYLWRAIGYIVTKILNWVIWKRYKVVINI 66

Query: 70   GALRISLLAGRVFFKNLTIIDKDRTITILEGSITWRYWLIRTRKSEYRVAQMAHASAGSS 129
             +L  S++ G+V+FKN++I D+D+TI+IL+G+ TWRYWL+  R ++ +          +S
Sbjct: 67   QSLGFSIIGGKVYFKNISITDRDQTISILKGTFTWRYWLLNPRPTQLK----------NS 116

Query: 130  GNSEDDTKFDIANYMEKQLKLPCRFLFECEGFEMFIYNRTYAYDNIVNVLSKVEREKFEK 189
              +++++K              CRF  EC+G E+FIYN+   Y++I+N L+K +++   K
Sbjct: 117  NINDENSK--------------CRFKLECDGVELFIYNKIAVYEDILNELAKSDKDSSRK 162

Query: 190  FMAEND--FLDPSSDGSSD-DKIEETSSATNSTDEETIANDRTFQNDTRKTLPRYLEALP 246
            F  +++  F    +D S   D ++E+S    S   +TI N  + Q+     +P YL+ LP
Sbjct: 163  FATDDESIFGRVKTDSSVMFDPLDESSE--QSKVGQTILNSVSNQS----AVPLYLDFLP 216

Query: 247  IEALLNKGSILIGNKFTPCVLILSFESAVALQDVGEAPSKLDLYRMKYEVRLKNLEIMMK 306
             E +L+ G++++GNK TP V I+ +     + DV    S LD Y+++ E  L +  + +K
Sbjct: 217  AEVILSSGAVVVGNKHTPSVAIIQYARIEGIIDVAGPTSNLDQYKLRSEFELSSTRVSVK 276

Query: 307  QNIDYDNEKSRNFEFDKGKLSRLWHRFTRIFKLVP---FPFKSNRRKEQPHDNFMQKWKG 363
             NI + N  S       GK   LW +              F  N++     + F+  WKG
Sbjct: 277  PNISFGNGSSSKKHKIDGKPFNLWQKLKDCLLFTISHILAFTGNKKGLTGQEEFLTSWKG 336

Query: 364  LSMYRNDMFGXXXXXXXXXXXXSSHEYAKFTSLLKSPRVTIHHDYDMPGWVPHGAHPPSS 423
            L+MY  D+               +HEYAK+T++L + R+ + + YD PG +        +
Sbjct: 337  LAMY--DVATSDTFSDEIPFDLQNHEYAKYTTILNADRIKLLYSYDTPGVITE------T 388

Query: 424  YADGPDVGNNMAPPQYIFEINIFGGTVCYGPWAQRQTNHLQSLLSPSVSRTAKPIKKLKP 483
               G + G+    P+Y  ++ ++     YGPWA RQ  +   + SP+VSR     +K   
Sbjct: 389  LIKGYENGDIPPSPEYSIDVQLYDANFYYGPWAHRQLQYFIKMFSPAVSRDFSAHRKPVL 448

Query: 484  GSKRIYTVLKLTINAMEDVTWRIPTRESSKDVEFLMHYKETNDDYRPFGWIDIKVSRDSC 543
            G  R +   +  I  MED  WRIPT+E SKD  FL  YK TND+ R FGWIDIK+++D+ 
Sbjct: 449  GKSREHANFRCEIVIMEDSVWRIPTKEPSKDAAFLDKYKSTNDESRAFGWIDIKLNKDTN 508

Query: 544  GIFDLAMCPTSKGFKNTIDVQLVDTEIRSSVNHDIFLKSKSFSFNCDIGYPLGWNAEANW 603
               +L +  +  GF+NT    LV+  I +SVNHD+   +K+        YP  WN+   W
Sbjct: 509  ISIELGLQASECGFENTFHANLVNPVIITSVNHDVLFNAKAHQIIARQSYPHQWNSAITW 568

Query: 604  TIIMDSNQLELFLLREHVTLIADTLTDFSSGEPVPYELFRPFVYHIKWNMKGYSFYLNVN 663
             +   S+ LELF+LR+H  L+ D  TDF+SG+ VPYELFRP +Y   W++  YS YLN N
Sbjct: 569  ALHFISSDLELFILRDHFNLLVDLFTDFASGDAVPYELFRPVLYQFSWDISNYSLYLNAN 628

Query: 664  DHNIVNNPLDFNENCYLSIHGDDLTMNVMVPKKTITSRFTNMTYDIYTPMFRXXXXXXXX 723
            D NIVNNPLDFNENCY+SIHG+   + V +P +TI+     ++Y+IYTP F         
Sbjct: 629  DANIVNNPLDFNENCYISIHGNSARIGVKLPIETISEESITISYEIYTPKFDIQLKTPPW 688

Query: 724  XXXXEFMRNKEVGRSHDFRLKGSYLIYSELDIDNVDTLTVECSSRGTALHIYGFVIRYLI 783
                EFM  + VGRSH+F   GSYL Y+++DIDNVDT+ +EC +       YGF++RY++
Sbjct: 689  HTLHEFMAQRFVGRSHEFSASGSYLSYNDVDIDNVDTINLECKTNHATFLAYGFLLRYVM 748

Query: 784  NVKMNYFGEFFHFVTSEEYT-----GNTRPTDLENIISEDRRDDDFSSYESVSRISSNS- 837
            N+K+NYFGEF  F T+EEY+      N   TD+ N       DDD    ++   +  NS 
Sbjct: 749  NLKLNYFGEFAQFRTTEEYSEELAQRNDVATDIFN-----NNDDD----QTTELVEPNSY 799

Query: 838  SDXXXXXXXXXXXXXXXXXRTSNETDIWFTFSVWDGALILPETIYNADPCIALHFAELIV 897
             +                 RT NE DIW TF   DG  +LPE+ Y+   C  LHF  +  
Sbjct: 800  GESGFDILHGKKIDKASLKRTVNEKDIWVTFFFEDGCFVLPESFYDFKSCFGLHFDNITF 859

Query: 898  DLRSCNYYMDILATACDINLKRYVGKRADEIYEYVHLNNGKDHEVHGTLSDIYIHGHRMY 957
            D+R  +YY D+  +     +KRY    ++ +++    N        G LS+  IH HRM+
Sbjct: 860  DMRYLSYYADLAFSMNSTYIKRYPDVSSNSVFDVCGSNPFITSNYDGYLSEFNIHIHRMF 919

Query: 958  GLPPTEPTYFCQWDMDFGHLNIDSNMFFLQGLFGAFYKIGFGYKDLENILLYETEIIDDM 1017
            GLPP E TY  + D+  G+L+ +S++  L+G      K  FG+ + E++L YE     D+
Sbjct: 920  GLPPAEETYLFKIDVSLGYLSFESDIEALKGFIQFITKFSFGFDNFEDVLHYEMARSFDI 979

Query: 1018 TSLTIFINTIDIRLNDVDTTAHADLKLERFCFTLIDFENERYSKRMDIKIPSLEFNIFSN 1077
            + L+ F + I IRLN++DT     L +      L+DF   +YS R +I IP+ +F + S 
Sbjct: 980  SCLSFFADDISIRLNNIDTNKFISLSIPNVSLKLLDFGTSKYSLRANIDIPNFDFLVSSM 1039

Query: 1078 EDNDLSLLNFKVDMNFTNFVQNQDFNKHRKIQRDYIVLNDAPYHRCAFLLPESYQKSRIY 1137
            +D+++ L      ++F  F +N DF     +Q  +I+L+DAP+ RC+FL P+ YQ S +Y
Sbjct: 1040 DDHNIVLGTISTSISFAIFSRNPDFKTTNNLQTQHILLSDAPFCRCSFLHPQEYQTSDLY 1099

Query: 1138 NELFGXXXXXXXXXXXXXXXTADTIEYVLEDLL----EDYMGLFEGNYDIKESSVENLEL 1193
              L+                  +  + + E+LL    +DY+   EG +DI   +   L +
Sbjct: 1100 KLLYASIPPSSSIPLLPEPIGPNNFDTIFENLLGDIYQDYIS--EGTFDISNDTKLQLNI 1157

Query: 1194 SAIEATRAITGIGAERTHSNPITLSDYAVESDNYVVKVESIVIDINPALYTTIEKLLKHI 1253
               +   +       +T +  I + D   E  ++V ++  I IDI+  +      L + +
Sbjct: 1158 DEFKK-HSENSFSKHKTKNLTIDIVDELHEVRSFVFELPHINIDIHIDVLEVFADLYRQL 1216

Query: 1254 YDQDAVQIIDGIEIGIVKRLSSIHDGVTTMTNVKVQIKHFNL---FWGEKESDNVSMFF- 1309
                    IDG+ + IV   S    G +++T  KV     +     +     ++V  +F 
Sbjct: 1217 TTFTISDTIDGLGVDIVNNFSKTFFGASSVTEAKVVCPRIDFRLRMYEYYALEDVKHYFV 1276

Query: 1310 ---DKMDFALTEKT----LEQNSEKNLL-EMTVLAKIKAVRLTVVQQPGLI-PTQERPPA 1360
               +K+D  L  +        NSE N   +++V  K   +   ++ +   I P++    +
Sbjct: 1277 SDINKLDLNLRLRQEYDKESANSEMNSKNKLSVYYKTALINGKMLSKENFIYPSESSEFS 1336

Query: 1361 ITVGVEGFEFWSTAIEKQVNSISVSSADITVDDAQVEWFFKYIVRQKYFFLDMLQSYNRI 1420
                 E  E ++   +  V   ++    + ++    +   ++I      F   ++S    
Sbjct: 1337 YKSTFEELEGYAFYDDDLVTDANLQRGCVFINQEHSDSISEFIKTLYLKFNTFIKSVTIS 1396

Query: 1421 QNNRIESQKELISRLTAASEYYQISHDPYVITKPAFIMRLSRGHVRENKSWKIITRLRHI 1480
            +N     ++EL+ R+  A + Y I HDP VITKPA I RLSR HVRE++SW+I+TRLRH+
Sbjct: 1397 KNFNKSMKRELLIRIAQAGQDYGIQHDPPVITKPAVITRLSRHHVRESRSWRIVTRLRHV 1456

Query: 1481 LTYLPKDWYLNVGQPLRDRKFDPSQDARSIFMSIFSNWRSWEFSDVARSYIYGKLFL 1537
            L YLP+ WY      L+  KF   +DA+  F+ IF+ WRSWEF+DV R ++Y K ++
Sbjct: 1457 LNYLPQYWYETTSLELQKGKFRSEEDAKLQFLDIFTRWRSWEFADVERCFLYKKTYI 1513

 Score =  667 bits (1722), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 432/1254 (34%), Positives = 681/1254 (54%), Gaps = 72/1254 (5%)

Query: 1759 LVEAIKDIKLKIDQISEQLELERRLTQHPTVYDPNKSNVIASCLF--SNVSMDIMPVSPF 1816
            ++EA  +I+L I++I +      + T+ P + D      IA      + +++ +  + PF
Sbjct: 1728 IIEANNEIRLHINEIGQDFASNIQYTELPVLPDSQVLKPIAMVKMNIAAINIQLQLLLPF 1787

Query: 1817 ALKNSAKQ--IDFFYNKFDSDSWLIKLKDTDFFLTSDQTKEQYMRLSMKKLQIRVNVSSS 1874
             L+ S K+  I+  + +    S  + L+DT   L S + +E YM+ S   L++      +
Sbjct: 1788 ILRYSCKEFEINVDFGRILQSS--LSLQDTSVELLSLEFQEPYMKYSHSYLKLIGMDLGN 1845

Query: 1875 KPKLVDINLSTNLVKLTFSEPKNIVYSFLKDERVASESVHLLQTLKPLFSISDDKESTPQ 1934
               L  I+L ++  KL+  EPK  +  FL D   A +++ +L++     ++ + K ST Q
Sbjct: 1846 TDNLGRISLDSSFSKLSIFEPKKNMRLFLSDIEQAVKNIEILRS-----TMLETKSSTVQ 1900

Query: 1935 SYQEKTEYLWS------LDSSIDYFGILIPMTSTYYVMEFHSYVSSISNANGAPSGNL-D 1987
            +     E+ +S      L+ +++Y G+L+   +T YV+EF++   S S    + +  +  
Sbjct: 1901 N-----EFPFSRLIPIQLNLNVEYIGLLLDFGTTLYVLEFNNLEFSFSKDKTSSNPVVPT 1955

Query: 1988 ITGHMSVENILFLIKESSLPDGLSKVIDIAVNVSTLQRVDDNSRSIQVESSHARICLSPD 2047
             +   S E+I FLIK+  + + LSKV+D ++ +  ++      +S+Q+ESS+    LSP 
Sbjct: 1956 FSSDYSSESICFLIKDRRVKETLSKVLDFSLRIKVIRSSLLAIQSLQIESSYLHAVLSPM 2015

Query: 2048 SLLRLLWGFNQGHKLSEHYLKYHSKSLWQSFAKSDDKQQDTNSIKSNETSFFSSINSIHF 2107
            SL+RLL   N+   +         KS++      D K + T+S  S  +    SI S H 
Sbjct: 2016 SLVRLLSFVNEFSIM---------KSIYH-----DIKPRSTSS-NSTLSILPISIKSAHI 2060

Query: 2108 LSYNLCVGWLFEYELGPPKGLITGYSRLFSAYENCMGKLTVIDSYFAAAQGNTSSTFYPE 2167
            LSYNLC+GWLF+      +GLI GY RLF+ Y+   GKLT++D+YF+ A G +SST+YP+
Sbjct: 2061 LSYNLCIGWLFDLGYNANEGLIWGYERLFAVYDKPYGKLTLLDAYFSVAHGFSSSTYYPD 2120

Query: 2168 TNVKELFNRFYLPNMQILFWWKVIEGMKDVYVRFTGETLDVKYLSDFMLTIESTLHSIKM 2227
             N K   NR YLP+MQI +W +   G KD+++R  GE LDV  L+ +   ++    S+  
Sbjct: 2121 GNEKGAMNRSYLPSMQINYWLEEENGTKDLFIRVNGEELDVSLLAWWFTIVDEATQSLHK 2180

Query: 2228 FQKLKKELIVETPKREVVHIKEDKPXXXX-----XXXXXXXXXXXCHFKYDGGTYSVFNI 2282
            F+KLK+ ++      + + +  + P                    C   Y G +  +++ 
Sbjct: 2181 FKKLKETIL------DPLKVTSNDPILGEWNYLDNPLASSVRSINCIINYAGSSMKLYS- 2233

Query: 2283 SDGSLNPTPAIEIKSPVISVDVLYKHEKQNTKHHSIRCLVNIDPTHNVLYATCAPLVKNF 2342
             D   + T + EI+SP  +V + YK+     K H IR L  ++ THN L+  C PL+   
Sbjct: 2234 RDDIQHGTCSFEIRSPAHTVTIDYKYYPSKKKSHWIRTLATVNTTHNTLFPVCVPLLNEM 2293

Query: 2343 VEDVRSIFGRYESENKHSETTPTSVQ-NIDYEKLLEDYDLAITVTSAKQQLSLSCEPKAK 2401
                 ++     S+  +      S +  I+Y  LLE +D+A+ +   KQ++SL+CEP AK
Sbjct: 2294 WLTFNTMLKNSCSQFSNGAPNLASAKAEINYRDLLEAFDIAVIINVGKQEISLTCEPTAK 2353

Query: 2402 VQADVGFEALTVSMTTNPFDIDEPLAFSFSIKDTKASIKHLFSRETSTSFGVGYLDLTLL 2461
            +QA +GFE   + + TN    DEPL  S  + +  AS +H+FSRE S+S  +  + +   
Sbjct: 2354 IQATIGFEKFDIKIFTNSMVPDEPLCLSVDLHNLMASSRHVFSREISSSLSLQQISMVFS 2413

Query: 2462 FTHTNRINTYGTSLISDIDLYFNVKQLQNLYLFLDIWQLSE-------LLNPVTSSQ-EQ 2513
             TH+  I+TYG++LIS    YFNVKQ+++L LFL+IW + +       +L PVT+S  E 
Sbjct: 2414 LTHSEYIHTYGSTLISKPLFYFNVKQIEDLNLFLEIWSIEKQKSVNDIILAPVTASSFES 2473

Query: 2514 VIRKDKKKSVDKPIHNESQLPWCFTLIFTNVKGDIDLGPSLGLISLRLSRTWLATDHFSG 2573
            V    K + V  PI+  +   W + LI + +  +IDLGPSLGL+ ++    W  + H   
Sbjct: 2474 VPSMPKLQRV--PIN--ATFSWDYLLIISEIGAEIDLGPSLGLVKVKSDNLWGLSSHNID 2529

Query: 2574 KRQILHAFVDDLLLISEGRLSGVVNIDGASWVSEVIWLQDSKRDNIPLVALSLNTDKIEI 2633
              Q L   + ++ + S GRL G V I    W S++ W   +    +PLV LSL       
Sbjct: 2530 WTQKLLISMKEICMSSSGRLGGYVFIKDIVWKSKITWPIINNFHGVPLVELSLALGAFNT 2589

Query: 2634 KAAFDYHMFLIGTVNNILFQLHSERDMVGVAPDLLKVSFSCEEIKLCSTALVAANILDIY 2693
            K +FDYHMF I T+ N   +L +++D  G   DLL VS S + I++  T+L  AN+ DIY
Sbjct: 2590 KLSFDYHMFFISTIQNAAIELFNQQDERGFLADLLSVSVSVDNIQVFITSLAYANLFDIY 2649

Query: 2694 NTIIRMRQDTKISYIETLKDSNMETNKQTLAYRDILKSLQLLRTDLTVSICSLQLQISPI 2753
            +TI RMR D+  + ++ L +SN      +     +L SL  LRT+L+V+   L L I   
Sbjct: 2650 STIRRMRNDSGRTNLDLL-ESNELKKISSFDNSKMLASLLSLRTELSVNAQLLNLHIFST 2708

Query: 2754 SLFDX------XXXXXXXXXXSARSETHSEAKLTTSLNMEVYDATLSLSTAKQELDEDAL 2807
            +L                    A S+T S+AK+ T L  ++ D +LSLS+ K +LDE+ L
Sbjct: 2709 TLIGTEVVVLRTRKVIANTKNEASSKTTSDAKVQTELTWQLQDMSLSLSSFKHQLDENQL 2768

Query: 2808 SKITVADYMTYASKIRGGTIIEIPRMGVQMTTWQEEKSDILEYLYSCKFHDKVAVRWNLG 2867
             KI V DY+  AS I GG I+E P + V M TWQ + S+++E LYS  F + V++ WNL 
Sbjct: 2769 DKIDVIDYVKLASIIHGGIILEAPSIFVTMNTWQSQYSNVIELLYSSSFGNGVSITWNLR 2828

Query: 2868 PVNFMKEMWTTHVKAIAVRRSQVLTGS--FNVSEKDVEKRIKEEENITKLNYVPVEEPQI 2925
            P+NF+K+MW+ H+ A+ +R  Q    S      ++D+E ++ + +  TK  Y P+EEP I
Sbjct: 2829 PINFIKDMWSIHINAMKLRHMQKGNSSEIHIPKDEDIEAKLAKVDLGTKYIYKPLEEPNI 2888

Query: 2926 DMPQIKDLGDATPPVEWFGVNRKRFPAFTHQTAVVPVQNLVYLAQKQYAKTLGR 2979
            +MP+IKDLGDATPPVEWFG+NR RFP  THQ  VVP+Q L  +A+K+Y + LG+
Sbjct: 2889 EMPKIKDLGDATPPVEWFGLNRSRFPGLTHQIVVVPLQKLSAVAEKEYVRILGK 2942

>AGR088W Chr7 (892680..901343) [8664 bp, 2887 aa] {ON} Syntenic
            homolog of Saccharomyces cerevisiae YLR087C (CSF1)
          Length = 2887

 Score =  786 bits (2029), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 494/1547 (31%), Positives = 767/1547 (49%), Gaps = 148/1547 (9%)

Query: 35   LTLATLFYLSRAFAYGVTFILEWLLWKQAKVKVSIGALRISLLAGRVFFKNLTIIDKDRT 94
            + +  +FY+ R   Y V+     +LWKQ +V VSI +L  S LAG+V FKN+++  +D+ 
Sbjct: 1    MVIFAIFYVGRVLGYIVSKAANLVLWKQYRVTVSIQSLVFSPLAGKVHFKNVSVTSQDQL 60

Query: 95   ITILEGSITWRYWLIRTRKSEYRVAQMAHASAGSSGNSEDDTKFDIANYMEKQLKLPCRF 154
            I++L+G+ITWRYWLI      YR           SG ++   +              CRF
Sbjct: 61   ISVLKGTITWRYWLI----GRYR----------RSGTADGARR--------------CRF 92

Query: 155  LFECEGFEMFIYNRTYAYDNIVNVLSKVEREKFEKFMAENDFLDPSSDGSSDDKIEETSS 214
              + EGFE F+YNR   YD I   L                      DG  D   E T S
Sbjct: 93   ALKFEGFEYFVYNRNGVYDRIAREL----------------------DGE-DTSAEPTVS 129

Query: 215  ATNSTDEETIANDRTFQNDTRKTLPRYLEALPIEALLNKGSILIGNKFTPCVLILSFES- 273
              +   EE IA     Q+D     P     LP+E L NKG+I++GNK T  V I+++E  
Sbjct: 130  VPSV--EEVIAE---LQDD-----PLIRRFLPVEFLHNKGAIVLGNKQTHSVAIMNYEKL 179

Query: 274  ----AVALQDVGEAPSKLDLYRMKYEVRLKNLEIMMKQNIDYDNEKSRNFEFDKGKLSRL 329
                ++ + D   APS       + E ++ N  + +K NI Y+ +       +  + +RL
Sbjct: 180  AGTVSIEVPDDTRAPSSF-----RTEAKISNCTVAIKPNISYEVDNPVKIYVEPKRTARL 234

Query: 330  WHRFTRIFKLVPFPFKSNRRKEQPHDN--FMQKWKGLSMYRNDMFGXXXXXXXXXXXXSS 387
            W ++  +   V       +RK++ H    +   W+GLSMY  D+                
Sbjct: 235  WKKYKTLLGTVLEATLHAKRKKEQHQTPKWYDNWRGLSMY--DVNLDEELDEEVKFDIEH 292

Query: 388  HEYAKFTSLLKSPRVTIHHDYDMPGW--VPHGAHPPSSYADGPDVGNNMAPPQYIFEINI 445
            HEYAK T++LK+ ++ + + Y MPG   V    +  +   + P++ +++       +I +
Sbjct: 293  HEYAKCTTVLKADQMDVTYSYGMPGTARVTDSDNAENPLLERPELDHSV-------DILV 345

Query: 446  FGGTVCYGPWAQRQTNHLQSLLSPSVSRTAKPIKKLKPGSKRIYTVLKLTINAMEDVTWR 505
            +     YGPWA RQ      + SP+V R  K     +   +      KL++  MED   R
Sbjct: 346  YDANCTYGPWANRQVQQCLRVFSPTVCRNFKLRTPEEIAQQTEPAAFKLSVTIMEDSVLR 405

Query: 506  IPTRESSKDVEFLMHYKETNDDYRPFGWIDIKVSRDSCGIFDLAMCPTSKGFKNTIDVQL 565
            +P +ESSKD  FL  YK+T D+ RPFGWIDI+++++S     +A  PT  GF+N +   L
Sbjct: 406  VPMKESSKDAAFLEKYKQTRDETRPFGWIDIRIAKESNITVRMAAYPTENGFENILHANL 465

Query: 566  VDTEIRSSVNHDIFLKSKSFSFNCDIGYPLGWNAEANWTIIMDSNQLELFLLREHVTLIA 625
            VDT I +SVNHD  LK+KS     D  YP GW  +A W   + S Q ELF+LR+HV LI+
Sbjct: 466  VDTTISTSVNHDTLLKAKSHDITVDFSYPYGWQDKAEWNFNVCSTQAELFVLRDHVYLIS 525

Query: 626  DTLTDFSSGEPVPYELFRPFVYHIKWNMKGYSFYLNVNDHNIVNNPLDFNENCYLSIHGD 685
            D +TDFS GE V YE FRPF Y  +W+++GYS YLNVND NI+NNP+DF ENCYLS+HGD
Sbjct: 526  DLVTDFSGGEEVLYEQFRPFDYRFRWDIRGYSAYLNVNDANIINNPIDFGENCYLSVHGD 585

Query: 686  DLTMNVMVPKKTITSRFTNMTYDIYTPMFRXXXXXXXXXXXXEFMRNKEVGRSHDFRLKG 745
            D  +   +P  +I  ++  + ++I+TP F             E +  KE+GRS +F +KG
Sbjct: 586  DAEITFSLPITSIIQKYVTVDFNIFTPHFSLFLNAPPWHTFSELLHYKEIGRSKNFNIKG 645

Query: 746  SYLIYSELDIDNVDTLTVECSSRGTALHIYGFVIRYLINVKMNYFGEFFHFVTSEEYT-- 803
            SY  YSE+D+DNVD L + C +    +  YG +++ ++NVK+NYFGE  HF T+EEY   
Sbjct: 646  SYTSYSEVDVDNVDALNIACETDYIVVLCYGVILKCMLNVKVNYFGEMVHFRTTEEYVEE 705

Query: 804  ------------------GNTRPTDLENIISEDRRDDDFSSYESVSRISSNSSDXXXXXX 845
                              GN   +D+    S +  D  F ++     I  ++        
Sbjct: 706  LQRRNKQNPSTCRPFNSDGNVHDSDVVATESNEIIDASFDAFGGPPTIKKSA-------- 757

Query: 846  XXXXXXXXXXXRTSNETDIWFTFSVWDGALILPETIYNADPCIALHFAELIVDLRSCNYY 905
                       R+ NE D+WFTF    G    PE IY  D C+  +F  L   LR  NYY
Sbjct: 758  ---------LKRSINELDVWFTFISKGGCFFFPENIYKFDACLGFYFDNLEASLRFLNYY 808

Query: 906  MDILATACDINLKRYVGKRADEIYEYVHLNNGKDHEVHGTLSDIYIHGHRMYGLPPTEPT 965
            +D   +   I  KR+    A  +++ +             LS      H+M G+ P+E +
Sbjct: 809  VDAAVSLDSIYFKRHTDIDARTLFKVIEDIGIPIDASDAYLSQFSFRLHKMLGIMPSEES 868

Query: 966  YFCQWDMDFGHLNIDSNMFFLQGLFGAFYKIGFGYKDLENILLYETEIIDDMTSLTIFIN 1025
            Y C++D+    L++  ++  L+        + FG+KD+EN L YE E + D+  ++  I 
Sbjct: 869  YACEFDVRVDTLDVHCDLAVLKAFVNTLRNLAFGFKDVENSLQYEREQVFDLNKISCVIE 928

Query: 1026 TIDIRLNDVDTTAHADLKLERFCFTLIDFE--NERYSKRMDIKIPSLEFNIFSNEDNDLS 1083
             + ++L +VD      L L     TL  F+  NERYS+R D+ IP L F I+  +     
Sbjct: 929  NVTVKLQNVDKDEDIWLSLNLPVTTLTSFDLANERYSRRSDLSIPELLFGIYRGDSESTC 988

Query: 1084 LLNFKVDMNFTNFVQNQDFNKHRKIQRDYIVLNDAPYHRCAFLLPESYQKSRIYNELFGX 1143
            L  F   +  T F + + F + R +QR +I++NDAP+HRC+F+LP  Y+K  IY  L+G 
Sbjct: 989  LGAFSTGVTVTLFERFEQFARCRVLQRKHILVNDAPFHRCSFMLPPEYKKMPIYRSLYGC 1048

Query: 1144 XXXXXXXXXXXXXXTADTIEYVLEDLLEDYMGLF--EGNYDIKESSVENLELSAIEAT-R 1200
                          +AD  E + E LL +    +  + +Y I + S+ + E      T  
Sbjct: 1049 IPPSSSLPLFPEPISADNFEVIFEKLLGEIYQEYASDSSYQITDDSISSTEHDYHNQTVN 1108

Query: 1201 AITGIGAE---RTHSNPITLSDYAVESDNYVVKVESIVIDINPALYTT--IEKLLKHIYD 1255
            A  G  +    R+ ++  TLS + VE D          ID    L  T  + ++ K++ +
Sbjct: 1109 AAIGTSSSLFIRSQNHQQTLSSFIVEFDP---------IDGYLDLSATEFMLEIYKYLTE 1159

Query: 1256 QDAVQIIDGIEIGIVKRLSSIHDGVTTMTNVKVQIKHFNLFWGEKESDNVSMF-----FD 1310
                + ID +EIGI+ +          ++ V+V   + +L    K+S   SMF       
Sbjct: 1160 VSLDEAIDSLEIGIINQFIQTFGEDNGISEVRVLCPNISLSATNKQS-KFSMFKLSSKIK 1218

Query: 1311 KMDFALTEKTLEQNSEKNLLEMTVLAKIKAVRLTVVQQPGLIPTQERPPAITVGVEGFEF 1370
             +D     K+ + N + +  + T+  KI  +R  +VQ   ++P ++     +  +E  E 
Sbjct: 1219 NLDITSRIKSSDPNLKPDPEKTTLCYKIDYIRANIVQDGIVVPPKQPSQLFSCSIELLEG 1278

Query: 1371 WSTAIEKQVNSISVSSADITVDDAQVEWFFKYIVRQKYFFLDMLQ-SYNRIQNNRIESQK 1429
            + +  +  +   +V S  +T+     +  F+++      F D+LQ   +  ++  + S++
Sbjct: 1279 YLSYDKLSLLDNNVQSCSVTLSPGTDKLLFEFLNPFISTF-DLLQRELSSFEDTLLASKR 1337

Query: 1430 ELISRLTAASEYYQISHDPYVITKPAFIMRLSRGHVRENKSWKIITRLRHILTYLPKDWY 1489
            E +  +      Y+I HDP VITKPA I R S  H+R  +SW+II RLRHIL YLP++W+
Sbjct: 1338 EFLLNILRGGRDYEIQHDPPVITKPANITRFSNRHIRSAESWRIIMRLRHILNYLPQEWH 1397

Query: 1490 LNVGQPLRDRKFDPSQDARSIFMSIFSNWRSWEFSDVARSYIYGKLF 1536
             +  + L  + F   ++A   F+SIFS+WRSWE +DV  S+++ K+F
Sbjct: 1398 QSFTRHLGTQDFTSPEEAGKEFLSIFSDWRSWEPTDVQGSFVHEKVF 1444

 Score =  577 bits (1488), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 393/1275 (30%), Positives = 644/1275 (50%), Gaps = 64/1275 (5%)

Query: 1739 YLIHSKSSSIHF-RTMAKTERLVEAIKDIKLKIDQISEQLELERRLTQHPTVYDPNKSNV 1797
            Y I  K+   H   + A T+ L E++  ++ +I  + E L  E  L   P +   +  N 
Sbjct: 1643 YSIDWKARKFHIDSSSATTKDLTESLPYVRDEIKYLVEALVPE--LFAEPPIERESSGNK 1700

Query: 1798 IASCLF----SNVSMDIMPVSPFALKNSAKQIDFFYNKFDSDSWLIKLKDTDFFLTSDQT 1853
            I + LF    +N+++ +  +SPF +   A+  +F      +DS +  L   + ++     
Sbjct: 1701 IHAVLFQGQVANITLKLQILSPFIILYCAE--NFELQAESTDSVIFDLNSGESYMEISSA 1758

Query: 1854 KEQYMRLSMKKLQIRVNVSSSKPKLVD-INLSTNLVKLTFSEPKNIVYSFLKDERVASES 1912
            K++          ++++ +SS  +L + I+    ++KL+  + K  +   L+D + A   
Sbjct: 1759 KQKLDYFKYTHTCLKLSGTSSSARLFEHISCDIGILKLSVFDLKTRITDLLQDIKAA--- 1815

Query: 1913 VHLLQTLKPLFSISDDKESTPQSYQEKTEYLW---SLDSSIDYFGILIPMTSTYYVMEFH 1969
               L ++K L  I +  +S+P +    + +     +L     Y G+L+    T Y++EF+
Sbjct: 1816 ---LFSMKSLSDILNISQSSPTASAFGSWFSILPDNLSLQATYAGLLLGFGHTLYILEFN 1872

Query: 1970 SYVSSISNANGAPSGNLDITGH------MSVENILFLIKESSLPDGLSKVIDIAVNVSTL 2023
            ++ +     +G P     IT         S+E+  FLIK+  + D L+KV+D AVN + +
Sbjct: 1873 NFEAK-HTRDGLPDA---ITPRPCFKVDHSIESASFLIKDRRIDDRLAKVVDFAVNFNMV 1928

Query: 2024 QRVDDNSRSIQVESSHARICLSPDSLLRLLWGFNQGHKLSEHYLKYHSKSLWQSFAKSDD 2083
               D   +S+Q+ES+H +I L+P +++RLL   N+   + + + +       +S      
Sbjct: 1929 HDTDLCIQSVQIESTHLKITLAPMTVVRLLSLINEFGIIRKQFTE-------ESIYTPSS 1981

Query: 2084 KQQDTNSIKSNETSFFS-SINSIHFLSYNLCVGWLFEYELGPPKGLITGYSRLFSAYENC 2142
               ++ + +  E S +   I S H LS++  + WLF+       GLI GY RLFS YE  
Sbjct: 1982 AHNNSTATECLEPSVWRLIIKSGHILSHDFSIVWLFDIPNSSADGLICGYDRLFSVYEKP 2041

Query: 2143 MGKLTVIDSYFAAAQGNTS-STFYPETNVKELFNRFYLPNMQILFWWKVIEGMKDVYVRF 2201
             GKLT++++YF+AA+   S + FY     K+  N  YL +MQ+ +W+       D+++R 
Sbjct: 2042 YGKLTLLNAYFSAAKILASEADFYSSVVRKQRINTSYLSDMQLRYWFTEDSENTDLFIRI 2101

Query: 2202 TGETLDVKYLSDFMLTIESTLHSIKMFQKLKKELI--VETPKREVVHIKEDKPXXXXXXX 2259
             G  L V   ++ +  +E T+ SI+ F  LKK L+    T K++    KE  P       
Sbjct: 2102 HGAKLAVDISAEIVTLLEETIQSIQTFNNLKKALVDPFRTKKQDSDISKE--PYNWNNQL 2159

Query: 2260 XXXXXXXXCHFKYDGGTYSVFNISDGSLNPTPAIEIKSPVISVDVLYKHEKQNTKHHSIR 2319
                    C   Y G T  + +  DG  + +P +E+ SP   V + YK+     K H  R
Sbjct: 2160 ATGVRSLNCIINYAGVTLKLHS-HDGRGDASP-LELTSPSYKVAIDYKYFPNLEKTHRFR 2217

Query: 2320 CLVNIDPTHNVLYATCAPLVKNFVEDVRSIFGRYESENKHSETTPT---SVQNIDYEKLL 2376
             L+   PTHN  Y+T A L+ +       +     +ENK S  + +    V+  D   LL
Sbjct: 2218 TLITATPTHNTFYSTSAFLIHDLCYRFSKLLKTSSTENKSSSASTSSSIKVEGSDNSTLL 2277

Query: 2377 EDYDLAITVTSAKQQLSLSCEPKAKVQADVGFEALTVSMTTNPFDIDEPLAFSFSIKDTK 2436
               DL I +   KQ+++ SCEPKAKVQA VGFE   + +  N  + +E L  +  I++  
Sbjct: 2278 GSIDLVIILNVGKQEVTFSCEPKAKVQATVGFEKFDIKIFNNNINDEESLCLAIEIENLM 2337

Query: 2437 ASIKHLFSRETSTSFGVGYLDLTLLFTHTNRINTYGTSLISDIDLYFNVKQLQNLYLFLD 2496
             + +H++SRE   S  + ++ +      +     YG++LIS    YFN+KQLQ+L LF+D
Sbjct: 2338 TNSRHIYSREVCASLKLRHISMVFDIMGSQVRRIYGSTLISSPLFYFNMKQLQDLKLFID 2397

Query: 2497 IWQLSELLNPVTSSQEQVIRKDKKKSVDKPIH---NESQLPWCFTLIFTNVKGDIDLGPS 2553
             W   +      S  E V+  D  +S+    +   + S   W +++I      +I+LGPS
Sbjct: 2398 QWFPQKTPMNTGSYPEGVLVDDISRSIGSKFYKGSSSSSFTWGYSVIVAGSCAEIELGPS 2457

Query: 2554 LGLISLRLSRTWLATDHFSGKRQILHAFVDDLLLISEGRLSGVVNIDGASWVSEVIWLQD 2613
            LG++++     W  +       Q L   +  L + S GRL G   +  A    E+ W   
Sbjct: 2458 LGVLNVTSEDVWAISKQQVDWSQQLDLNMGKLDVTSSGRLGGNFLVRNAHLSLELKWPNP 2517

Query: 2614 SKRDNIPLVALSLNTDKIEIKAAFDYHMFLIGTVNNILFQLHSERDMVGVAPDLLKVSFS 2673
                 +PLV + L +D ++ K +FDYH F I ++      L +ERD  G   DLL V+ S
Sbjct: 2518 KDFFQVPLVCVKLGSDTVDTKLSFDYHTFFISSLKQGYASLFNERDEDGSLADLLSVTVS 2577

Query: 2674 CEEIKLCSTALVAANILDIYNTIIRMRQDTKISYIETLKDSNMETNKQTLAYRDILKSLQ 2733
             E + +  TAL AANI DI N+I R+++D ++SY+ +   S+  +++       I  +L 
Sbjct: 2578 FESVNIFLTALAAANISDIKNSITRLKKDNELSYLSSFLASDQPSDEPE-EDGGIFDTLS 2636

Query: 2734 LLRTDLTVSICSLQLQISPISLFDXXXXXXXXXXXSARSETHSEAKLTTSLNMEVYDATL 2793
            LLRT L++++   +LQISP SLFD            A +   ++ K+ T L+ ++ D +L
Sbjct: 2637 LLRTQLSLNLGVFRLQISPTSLFDSDVLILTATKMMANTGIQADIKIKTDLHWQLDDVSL 2696

Query: 2794 SLSTAKQELDEDALSKITVADYMTYASKIRGGTIIEIPRMGVQMTTWQEEKSDILEYLYS 2853
            +L      LDE  L+ + V  Y+  +S I+GG I   P + V MTTWQE +S+++E LYS
Sbjct: 2697 ALLPFNNSLDESYLATMEVGKYIELSSTIQGGAIFSAPSIVVNMTTWQEPQSNVIELLYS 2756

Query: 2854 CKFHDKVAVRWNLGPVNFMKEMWTTHVKAIAVR--------RSQVLTGSFNVSEKDVEKR 2905
              F   V +RWNLGP++F+K+MW  H+ A+ +R         S V     N     +E  
Sbjct: 2757 TSFGGTVKIRWNLGPISFIKDMWQAHMNAMQLREGYYHGLAESGVAVTPLNSKAVPLEMH 2816

Query: 2906 IKEEENITKLNYVPVEEPQIDMPQIKDLGDATPPVEWFGVNRKRFPAFTHQTAVVPVQNL 2965
            +  +       Y+P++EP I+MP+IKDLGDATPP+EWFGVNR +FP FTHQ  +VP+Q L
Sbjct: 2817 LGSD-----YQYLPLQEPDIEMPRIKDLGDATPPIEWFGVNRTKFPGFTHQFVIVPLQKL 2871

Query: 2966 VYLAQKQYAKTLGRS 2980
               A+K+Y K LGR+
Sbjct: 2872 ARTAEKEYEKILGRA 2886

>KLLA0F19096g Chr6 complement(1762215..1770986) [8772 bp, 2923 aa]
            {ON} similar to uniprot|Q12150 Saccharomyces cerevisiae
            YLR087C CSF1 Protein required for fermentation at low
            temperature
          Length = 2923

 Score =  758 bits (1958), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 492/1578 (31%), Positives = 791/1578 (50%), Gaps = 116/1578 (7%)

Query: 6    SSAGFRGESLGFKRNFSWVFLVDWILTVILTLATLFYLSRAFAYGVTFILEWLLWKQAKV 65
            SS+ FR  S+  +++ S  FLVDWIL VIL +   FYL R  A+ +T  L++ +W+Q K+
Sbjct: 3    SSSTFRPISISDEKDLSVPFLVDWILAVILCILAPFYLGRILAWVLTKGLDFWVWRQYKI 62

Query: 66   KVSIGALRISLLAGRVFFKNLTIIDKDRTITILEGSITWRYWLIRTRKSEYRVAQMAHAS 125
            K+++ ++++S L GR+FFKNLT++  D TI+ LEGS TWRYWL+ TR    R        
Sbjct: 63   KINLQSIKVSFLGGRIFFKNLTVVSNDFTISFLEGSFTWRYWLLHTR---IRGIDFESED 119

Query: 126  AGSSGNSEDDTKFDIANYMEKQLKLPCRFLFECEGFEMFIYNRTYAYDNIVNVLSKVERE 185
              +S N+                KLPCRFL +C+G E+F+YN+   Y++++       R+
Sbjct: 120  GDASENA----------------KLPCRFLLQCDGLEVFVYNKIDVYESVL-------RD 156

Query: 186  KFEKFMAENDFLDPSSDGSSDDKIEETSSATNS--TDEETIANDRTFQNDTRKTLPRYLE 243
             F     +       ++ + D  I    +A NS  ++    +     ++     L    +
Sbjct: 157  HFTNVTKDGQ----ETESNDDITINTEKAAANSKLSNSSRYSYSGRSKSTDAPKLSAKTK 212

Query: 244  ALPIEALLNKGSILIGNKFTPCVLILSFESAVALQDVGEAPSKLDLYRMKYEVRLKNLEI 303
              PI+   N+ +I++GN+ T  V +  FE A  + D+  + S LD YR K  + L +   
Sbjct: 213  LFPIQLEANRAAIVLGNRNTRHVGVFKFEQAKGVYDIFSSISDLDYYRTKISLDLYDALF 272

Query: 304  MMKQNIDYDNEKS-RNFEFDKGKLSRLWHRFTR----IFKLVPFPFKSNRRKEQPHDNFM 358
             ++ N+ Y N+   + F  +K  + ++W    +    I KL+  P +      Q    ++
Sbjct: 273  ELRTNLGYQNDNPIKTFVVEK-TMDKIWQTVKKQCISISKLL-LPNQGKTINNQ--QAYI 328

Query: 359  QKWKGLSMYRNDMFGXXXXXXXXXXXXSSHEYAKFTSLLKSPRVTIHHDYDMPGWVPHGA 418
              WKGL +Y +                   EYA+++ ++K+ RV++ + +D+PG VP  +
Sbjct: 329  DSWKGLDLYHHT--KAVQEENVDTTVLHEQEYARYSRVMKAERVSLTYYFDIPGIVPANS 386

Query: 419  HPPSSYADGPDVGN---NMAPPQYIFEINIFGGTVCYGPWAQRQTNHLQSLLSPSVSRTA 475
               +S +D  +  N   +   P +  +I+I+   V YGPWA +    +  L SP VSR  
Sbjct: 387  SSINSQSDRDESLNCNQDDDTPAFGTDIHIYTAAVYYGPWAHKHMQDIIRLFSPIVSRDQ 446

Query: 476  KPIKKLKPGSKRIYTVLKLTINAMEDVTWRIPTRESSKDVEFLMHYKETNDDYRPFGWID 535
                K +PGS RIY   KL+++  +     IPTRESSKD EF+  YK T D +R FGW++
Sbjct: 447  MKATKPEPGSLRIYENFKLSVDFRDKSVLHIPTRESSKDEEFIKRYKTTGDTHRAFGWLN 506

Query: 536  IKVSRDSCGIFDLAMCPTSKGFKNTIDVQLVDTEIRSSVNHDIFLKSKSFSFNCDIGYPL 595
            + ++     +F+LA+C  +    N + V L++ EI+SSVNH++  +  + +   +IGYP 
Sbjct: 507  VSLNEGGEILFNLALCSQADRLPNELYVLLLNPEIKSSVNHEVLFRCNTQTIKANIGYPT 566

Query: 596  GWNAEANWTIIMDSNQLELFLLREHVTLIADTLTDFSSGEPVPYELFRPFVYHIKWNMKG 655
            GWN +A+W   +DS   ELFLLR+H++LI+D  TDFS+ + + YELFRPF Y IKW    
Sbjct: 567  GWNKQADWLFELDSRTAELFLLRDHISLISDLFTDFSANDALRYELFRPFTYEIKWVFTE 626

Query: 656  YSFYLNVNDHNIVNNPLDFNENCYLSIHGDDLTMNVMVPKKTITSRFTNMTYDIYTPMFR 715
            Y  +LNVND NI+NN LD NENC+LS+ GD L  ++ +P  +I       T+ + +P+ +
Sbjct: 627  YKLFLNVNDANIINNLLDLNENCFLSLSGDILNTSINLPFTSIVKEPHETTFLLKSPLVK 686

Query: 716  XXXXXXXXXXXXEFMRNKEVGRSHDFRLKGSYLIYSELDIDNVDTLTVECSSRGTALHIY 775
                        EF+     G   DF + G+Y+ +  +D+DN DT+ ++  S  T    +
Sbjct: 687  LSIHPPCWNTLHEFLSETTFGECPDFSMTGTYISFPSVDVDNTDTILIDFRSSSTKFLSF 746

Query: 776  GFVIRYLINVKMNYFGEFFHFVTSEEYTGNTRPTDLENIISEDRRDDDFSSYESVSRISS 835
            GFV+RYL+N+K+NYFG+F HF T+EEY+ +    +     +++ ++   +  ES++  SS
Sbjct: 747  GFVLRYLMNIKLNYFGDFNHFKTTEEYSNDLSMEEDTKTKTKNFQEQPTNDVESLTSSSS 806

Query: 836  NSSDXXXXXXXXXXXXXXXXXRTSNETDIWFTFSVWDGALILPETIYNADPCIALHFAEL 895
            + S                  RT NETD+W TF V DG +I+PE +Y+      L F  L
Sbjct: 807  DGSYQVADTINENTIHKSSLLRTKNETDVWITFFVNDGCIIIPENLYDCQRSFLLSFRRL 866

Query: 896  IVDLRSCNYYMDILATACDINLKRYVGKRADEIYEYVHLNNGKDHEVHGTLSDIYIHGHR 955
              D+R  NY+MD+ A    I    Y+    +  +  V        E  G L D+ +HGHR
Sbjct: 867  EFDMRYTNYFMDLTAFFSRI----YLNHSNEFSFNRVVAIEESHSENTGYLDDLNLHGHR 922

Query: 956  MYGLPPTEPTYFCQWDMDFGHLNIDSNMFFLQGLFGAFYKIGFGYKDLENILLYETEIID 1015
            M+G+PP E TY C+WD+  G L+ DS+  FL     A  K+GF YKD ENIL+Y     +
Sbjct: 923  MFGVPPVEETYLCKWDISIGSLSTDSDGQFLFSFLEAIQKVGFTYKDAENILIYSIHKPE 982

Query: 1016 DMTSLTIFINTIDIRLNDVDTTAH---ADLKLERFCFTLIDFENERYSKRMDIKIPSLEF 1072
            D+TSLTI I     R++ +  T H   A L L        D  N RYSKR+D+ + ++  
Sbjct: 983  DVTSLTISIG----RVSSIVRTNHGGSATLSLNDITINSWDLSNSRYSKRVDLLVAAI-- 1036

Query: 1073 NIFSNEDNDLSLLNFKVDMNFTNFVQNQDFNKHRKIQRDYIVLNDAPYHRCAFLLP-ESY 1131
            ++ + ++    L      +  T FV   +   HR  Q++ ++LND+P+HRC FLL  +  
Sbjct: 1037 SVCAIDEKKTVLFTCDTAVELTKFVVRSNMKNHRVTQQNCVLLNDSPFHRCKFLLAFDQL 1096

Query: 1132 QKSRIYNELFGXXXXXXXXXXXXXXXTADTIEYVLEDLLEDYMGLFEGNYDIKESSVENL 1191
              S +Y++L G               T  T + + E LL  Y+ L   N+D      +NL
Sbjct: 1097 NHSTLYDDLLGSITPSISLPTLSEPLTFQTFDNIYERLLGSYINLI--NFDTDIIDTKNL 1154

Query: 1192 ELSAIEATRAITGIGAERTHSNPIT--LSDYAVESDNYVVKVESIVIDINPALYTTIEKL 1249
                 +  R +       T SN ++  L++   ES+N  V + ++ + + P  +T  E  
Sbjct: 1155 TDDRPDDKRLLP---LSNTVSNDLSGQLAE-EFESENTTVNISTLSVFVTPKAFTFAENA 1210

Query: 1250 LKHIYDQDAVQIIDGIEIGIVKRLSSIH-------DGVTTMTNVKVQIKHFNLFWGEKES 1302
               +       I+D  E+ IV   S  H       +    + NVKV I        E   
Sbjct: 1211 AHFMLTMSTESIMDYFEMNIVNIFSVGHITNGKFFNSSVMLKNVKVNIS------DETAL 1264

Query: 1303 DNVSM-FFDKMDFALTE-----------KTLEQNSEKNLL--EMTVLAKIKAVRLTVVQQ 1348
            D   +   D+++ +++            + LEQ++E   +  + T+     +++  + + 
Sbjct: 1265 DKTQLEALDRLELSVSNISVISKILKYPQNLEQSNESTGITDDSTISCNFDSLQFNIFKS 1324

Query: 1349 PGLIPTQERPPAITVGVEGFE--FWSTAIEKQVNSIS---VSSADITVDDAQVEWFFKYI 1403
                 T+  P A       FE   ++T +   V  +S     S    + DA VEW  +Y+
Sbjct: 1325 SKNRLTKVLPIA------WFEILMFNTVLFSDVGKVSKLIFGSIKSAILDADVEWTVEYL 1378

Query: 1404 VRQKYFFLDMLQSYNRIQNNRIESQKELISRLTAASEYYQISHDPYVITKPAFIMRLSRG 1463
            ++    F    +S   +   R    KE I R+    +   I   PY+ITKPA+I RLS+ 
Sbjct: 1379 LKLAKAFCKEGKSCIELGKLRSIDMKETIIRVAELGKISGIDSVPYIITKPAYITRLSKF 1438

Query: 1464 HVRENKSWKIITRLRHILTYLPK-----DWYLNVGQPLRDRKFDPSQDARSIFMSIFSNW 1518
            HVR+  SWKIITRLRH+  +            ++ + +R+   D SQ     F+ IF +W
Sbjct: 1439 HVRDTASWKIITRLRHVSKHTSHVSETTSQCDDIPEEVRNICKDKSQ-----FLDIFVDW 1493

Query: 1519 RSWEFSDVARSYIYGKLF 1536
            ++W+  +V +S ++  LF
Sbjct: 1494 KNWDVYEVEQSSLFTLLF 1511

 Score =  633 bits (1632), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 405/1194 (33%), Positives = 630/1194 (52%), Gaps = 85/1194 (7%)

Query: 1815 PFALKNSAKQIDFFYNKFDSDSWLIKLKDT--DFFLTSDQTKEQYMRLSMKKLQIRVNVS 1872
            PF ++     +DF +      S ++   +   DF+   +Q K   +  S+ K+  R N  
Sbjct: 1779 PFIIRILISGLDFNFKNLSGISIIVNYTELLLDFYF--NQLKLLRISNSVTKVDYRSNT- 1835

Query: 1873 SSKPKLVDINLSTNLVKLTFSEPKNIVYSFLKDERVASESV--HLLQTLKPLFSISDDKE 1930
                 L DI L T++VKLT S           D RV  E +   L  T+  L  I  +K 
Sbjct: 1836 ----LLTDIGLDTDIVKLTLS-----------DNRVYIEELTDSLNGTVSELIKIFKNKN 1880

Query: 1931 STPQSYQEKTEYLWSLDSSIDYFGILIPMTSTYYVMEFH-SYVSSISNANGAPSGNL-DI 1988
            +  +    K +   S   +  Y G+L  + +T YV+EF+ +  S  S A      +  D 
Sbjct: 1881 ADNEPAAPKFKPC-SFKMNAIYIGLLTDLKTTNYVLEFNETAFSCASRAEALEETHANDN 1939

Query: 1989 TGHMS--VENILFLIKESSLPDGLSKVIDIAVNVSTLQRVDDNSRSIQVESSHARICLSP 2046
               MS  ++N+  L+    +   LSK+ DI   +  ++  DD  +++Q+E+ H+R+ L+P
Sbjct: 1940 LREMSLVIQNVCILVLNPEVLPTLSKIFDIGFALKLIE--DDIKKTLQIETPHSRVMLAP 1997

Query: 2047 DSLLRLLWGFNQGHKLSEHYLKYHSKSLWQSFAKSDDKQQDTNSIKSNETSFFSSINSIH 2106
             +L+ +++ F Q  K+S   +K   K     F  S      +N+I+     +F ++ S++
Sbjct: 1998 STLIAVIF-FIQEAKVSLQKVKQKGK-----FNSS------SNAIEI--PPYFETL-SVN 2042

Query: 2107 FLSYNLCVGWLFEYELGPPKGLITGYSRLFSAYENCMGKLTVIDSYFAAAQGNTSSTFYP 2166
             LS  LC+GW+FE E     G++ GY  LF+AYE   GKLT++D Y A AQG  S+ F+ 
Sbjct: 2043 ILSNKLCLGWIFE-EDTDENGIVIGYESLFAAYEKPYGKLTIVDGYVATAQGKESNNFFF 2101

Query: 2167 ETNVKELFNRFYLPNMQILFWWKVIEGMKDVYVRFTGETLDVKYLSDFMLTIESTLHSIK 2226
               V EL NR +L +MQI FW+      KD++VR   + LDV+ L+  +  +     SI+
Sbjct: 2102 ANGVPEL-NRSHLSSMQINFWFSGQFIEKDLFVRMNADKLDVRILTTSVEIVNVMRSSIE 2160

Query: 2227 MFQKLKKELIVETPKREVVHIKEDKPXXXXXXXXXXXXXXXCHFKYDGGTYSVFNISD-G 2285
             FQK  K   +   K+  +                      C  KY GG  +++   D  
Sbjct: 2161 SFQK--KLAKISNIKKSSISTHNVAENLSDKVSILSIRSINCIAKYGGGIINLYTPDDIA 2218

Query: 2286 SLNPTPAIEIKSPVISVDVLYKHEKQNTKHHSIRCLVNIDPTHNVLYATCAPLVKNFVED 2345
              +P  ++E+ SP I V + Y H   + K H IR LVN++ THN+L+++C P++ N   +
Sbjct: 2219 QDSPKSSLELTSPSIEVSLDYMHNFPSQKQHWIRSLVNVESTHNILFSSCVPVLVNLTTE 2278

Query: 2346 VRSIFGRYESENKH------SETTPTSVQNIDYEKLLEDYDLAITVTSAKQQLSLSCEPK 2399
            ++    R+ SE K        +TT T   + DY+ L +  D AI +    Q ++L+CEP+
Sbjct: 2279 IQKQMERFNSEKKQLVHKTQEQTTNTQRISFDYKNLFKKIDTAIVINVGAQNITLTCEPR 2338

Query: 2400 AKVQADVGFEALTVSMTTNPFDIDEPLAFSFSIKDTKASIKHLFSRETSTSFGVGYLDLT 2459
            AK+QAD+GF    +SM T+  D  EPL+ S    + + S +H+FSRE S+S G+  + L 
Sbjct: 2339 AKIQADLGFSNFRISMFTDSPDHSEPLSLSLQWSEIEISTRHIFSREISSSAGINEVYLD 2398

Query: 2460 LLFTHTNRINTYGTSLISDIDLYFNVKQLQNLYLFLDIWQLSELLNPVTSSQEQVIRKDK 2519
             + TH N I TYG +LISD+  Y N+KQLQ + LFLDIW      +P T   +++     
Sbjct: 2399 FMLTHENTIKTYGNTLISDMKFYVNMKQLQEITLFLDIW------SPKTKKAQKLGSGPH 2452

Query: 2520 KKSVDKPIH----NESQLPWCFTLIFTNVKGDIDLGPSLGLISLRLSRTWLATDHFSGKR 2575
                 +P         ++PW + +IF N    ID+ PSLG I+ ++   W+++ H     
Sbjct: 2453 SGQKCQPQALTEFTTPKIPWIYQIIFKNTSAVIDMDPSLGSINFKVPTFWISSHHRVDWS 2512

Query: 2576 QILHAFVDDLLLISEGRLSGVVNIDGASWVSEVIWLQDSKRDNIPLVALSLNTDKIEIKA 2635
              +  ++D+L   S+GRL G+  I    + S + W     +   PL+ L+     +  K 
Sbjct: 2513 HSVSFYLDELNSKSDGRLGGLFEIKNIFFDSSISWPVKDNKFEAPLINLAFKMSHLSSKI 2572

Query: 2636 AFDYHMFLIGTVNNILFQLHSERDMVGVAPDLLKVSFSCEEIKLCSTALVAANILDIYNT 2695
             FDYH FLI  V+++   + +ERD  G+  DLL VS S   + +  TAL +AN+ DIY T
Sbjct: 2573 GFDYHSFLIARVSDLQLAIRNERDESGLLKDLLIVSMSFGSVNIFLTALASANLYDIYAT 2632

Query: 2696 IIRMRQDTKISYIETLKDSNMETN-KQTLAYRDILKSLQLLRTDLTVSICSLQLQISPIS 2754
              RMR + K SY++TLK+SN E++ K   +  ++L  L+L RT+LT  I S +L + P +
Sbjct: 2633 FARMRIENKKSYVQTLKESNPESSGKIHFSNNELLAPLRL-RTNLTAEIGSFRLYVFPST 2691

Query: 2755 LFDXXXXXXXXXXXSARSETHSEAKLTTSLNMEVYDATLSLSTAKQELDEDALSKITVAD 2814
            LFD           +  + T +E K  T L  ++ D  +SL+  K EL E+  ++++V +
Sbjct: 2692 LFDSEVLVLKANKMNVEAATQTEQKTKTDLTWQIRDINISLAQFKNELTEEQFAELSVEE 2751

Query: 2815 YMTYASKIRGGTIIEIPRMGVQMTTWQEEKSDILEYLYSCKFHDKVAVRWNLGPVNFMKE 2874
            Y   A+ + G  I+  P + V +TTWQ+     +E+LYS  F DKV ++WNL P+NF++E
Sbjct: 2752 YNRQAALLEGDIILAAPSVFVGITTWQKIPDTDIEFLYSSSFGDKVDIKWNLDPINFIRE 2811

Query: 2875 MWTTHVKAIAVRRSQVLTGSFNVSEKDVEKRIKEEENI----------TKLNYVPVEEPQ 2924
            MW THV+A++VRR          +E    K   E+ENI          TK  Y+P+EEP 
Sbjct: 2812 MWATHVRALSVRRGH--------TEPSPSKPFFEDENIAEKIKIVNLGTKYKYIPLEEPH 2863

Query: 2925 IDMPQIKDLGDATPPVEWFGVNRKRFPAFTHQTAVVPVQNLVYLAQKQYAKTLG 2978
            I+MP ++DLG+ATPP+EWFGVNRKRFP   HQ  VVP+Q L+Y+A+ QY +TLG
Sbjct: 2864 IEMPLLRDLGNATPPIEWFGVNRKRFPGMAHQLIVVPLQKLIYVAEDQYNRTLG 2917

>Kwal_56.23808 s56 (712095..712280) [186 bp, 62 aa] {OFF} YLR087C
          (CSF1) -  [contig 173] PARTIAL
          Length = 62

 Score = 60.5 bits (145), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 27/61 (44%), Positives = 39/61 (63%)

Query: 7  SAGFRGESLGFKRNFSWVFLVDWILTVILTLATLFYLSRAFAYGVTFILEWLLWKQAKVK 66
          S+ FR   +   ++FSWVFL DW+L + ++L + FY  R   Y +T ILE+L WK+  VK
Sbjct: 2  SSEFRRVPISTAQDFSWVFLTDWVLILSVSLLSAFYFGRVLGYTITTILEYLAWKRYGVK 61

Query: 67 V 67
          V
Sbjct: 62 V 62

>Smik_15.287 Chr15 (486476..489802) [3327 bp, 1108 aa] {ON} YNL106C
            (REAL)
          Length = 1108

 Score = 35.8 bits (81), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 20/58 (34%), Positives = 31/58 (53%)

Query: 1246 IEKLLKHIYDQDAVQIIDGIEIGIVKRLSSIHDGVTTMTNVKVQIKHFNLFWGEKESD 1303
            I+ LL  +  Q AVQ+ D +   +  +L S+ D  TT TN+ + I  FN+    K+ D
Sbjct: 526  IDTLLGRLPYQKAVQLYDPVNEYVSTKLQSMSDNFTTTTNINLLIGSFNVNGATKKVD 583

>Skud_16.37 Chr16 complement(64157..68641) [4485 bp, 1494 aa] {ON}
            YPL242C (REAL)
          Length = 1494

 Score = 34.7 bits (78), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 32/133 (24%), Positives = 58/133 (43%), Gaps = 11/133 (8%)

Query: 1228 VVKVESIVIDINPALYTTIEKLLKHIYDQDAVQIIDGIEIGIVKRLSSIHDGVTTMTNVK 1287
            VV++++I   +N      I+K L  ++ QD V+   G+     ++LSS       +  VK
Sbjct: 419  VVQLQNICRGVNTRFNLYIQKRLLSLFGQDIVKFQAGLRGYKFRQLSS---NSLPIRRVK 475

Query: 1288 VQIKHFNLFWGEKESDNVSMFFDKMDFALTE-----KTLEQNSEKNLLEMTVLAKIKAVR 1342
              + H  L     +S+ +    D + FAL+      + L+      LL+  V  K+  + 
Sbjct: 476  TDVPHIELIQSRIKSNRIRYKHDNLKFALSRYSSIIEGLQAFCRSKLLKTDVRKKLNDIE 535

Query: 1343 LTVVQQPGLIPTQ 1355
            ++    P LI  Q
Sbjct: 536  IS---HPPLIKLQ 545

>YPL183C Chr16 complement(199495..202536) [3042 bp, 1013 aa] {ON}
            RTT10WD40 domain-containing protein involved in endosomal
            recycling; forms a complex with Rrt2p that functions in
            the retromer-mediated pathway for recycling internalized
            cell-surface proteins; has a role in regulation of Ty1
            transposition; human ortholog is WDR6
          Length = 1013

 Score = 34.3 bits (77), Expect = 6.3,   Method: Compositional matrix adjust.
 Identities = 26/96 (27%), Positives = 50/96 (52%), Gaps = 10/96 (10%)

Query: 1784 TQHPTVYDPNKSNVIASCLFSNVSMDIMPVSPFALKNSAKQIDFFYNKFDSDSWLIKLKD 1843
            TQ+  V+  NKS+++    FS  S DI+    F L   +K  +    ++D DS+L+ L+ 
Sbjct: 381  TQNIAVFSNNKSDILL-IKFSKDSADIIETEEFHLDELSKTNNCLVTEYDDDSFLLTLQ- 438

Query: 1844 TDFFLTSDQTKEQY--MRLSMKKLQIRVNVSSSKPK 1877
                  S   +E++  + +S++ L+I+     +KP+
Sbjct: 439  ------SPNPREKFVCLEISLQNLKIKSKHCFNKPE 468

>TDEL0D04450 Chr4 complement(811665..812924) [1260 bp, 419 aa] {ON}
            Anc_3.178 YAR018C
          Length = 419

 Score = 33.5 bits (75), Expect = 8.6,   Method: Compositional matrix adjust.
 Identities = 24/68 (35%), Positives = 34/68 (50%), Gaps = 4/68 (5%)

Query: 990  FGAFYKIGFGYKDLENILLYETEIIDDMTSLTIFINTIDIRLNDVDTTAHADLKLERFCF 1049
             G F KI   Y D  N+++     +D  T  + F    DI++     TA   L+LERF  
Sbjct: 286  LGKFDKIPDYYSDGLNLMIRSMIDVDLKTRPSTFELLQDIQIR----TARKSLQLERFER 341

Query: 1050 TLIDFENE 1057
             L+D+ENE
Sbjct: 342  NLLDYENE 349

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.319    0.135    0.397 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 316,335,804
Number of extensions: 14350831
Number of successful extensions: 46947
Number of sequences better than 10.0: 65
Number of HSP's gapped: 47480
Number of HSP's successfully gapped: 77
Length of query: 2981
Length of database: 53,481,399
Length adjustment: 128
Effective length of query: 2853
Effective length of database: 38,804,151
Effective search space: 110708242803
Effective search space used: 110708242803
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 75 (33.5 bits)