Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
CAGL0L12188g8.259ON1398139864470.0
Skud_12.1548.259ON1417144130160.0
Suva_10.1708.259ON1416144330090.0
Smik_12.1458.259ON1418144029970.0
ZYRO0C01716g8.259ON1413137129940.0
NCAS0B050008.259ON1409141429840.0
TDEL0F038608.259ON1399141329760.0
KAFR0B027108.259ON1416142029620.0
SAKL0H17094g8.259ON1422143429480.0
KNAG0G020208.259ON1444139029260.0
AGR089C8.259ON1370140229180.0
Kpol_392.88.259ON1427139029070.0
NDAI0B019708.259ON1415144428930.0
KLTH0G13750g8.259ON1399142228220.0
Kwal_56.238258.259ON1396142927760.0
TBLA0E044108.259ON1422144627690.0
Ecym_43118.259ON1376139127400.0
KLLA0F19085g8.259ON1372143126270.0
YLR086W (SMC4)8.259ON141891320590.0
TPHA0J007208.259ON139391118270.0
NDAI0G033208.68ON12314103645e-34
Suva_6.528.68ON12642503637e-34
KLTH0A02706g8.68ON12281693592e-33
Kwal_23.50438.68ON12251623546e-33
Skud_6.648.68ON12301633546e-33
YFL008W (SMC1)8.68ON12254153521e-32
Smik_6.718.68ON12281703521e-32
TPHA0P003408.68ON12193723502e-32
Kpol_1011.58.68ON12211543502e-32
NCAS0C040008.68ON12232643502e-32
KAFR0C032008.68ON12231633483e-32
KNAG0G009108.68ON12263873441e-31
CAGL0F02079g8.68ON12233773431e-31
TDEL0C009608.68ON12221583422e-31
KLLA0D07502g8.68ON12431603342e-30
SAKL0B02288g8.68ON12281953332e-30
AGL023W8.68ON12222283323e-30
ZYRO0F03828g8.68ON12171633233e-29
Ecym_73038.68ON12224062957e-26
Kwal_55.204217.186ON11707402885e-25
AGR236W7.186ON11701902492e-20
NDAI0G020707.186ON11711882393e-19
TBLA0G035308.68ON12322012393e-19
SAKL0F07282g7.186ON11701892383e-19
KAFR0G029307.186ON11701882375e-19
KLLA0D16005g7.186ON11701892366e-19
TPHA0I010901.295ON12167172366e-19
TBLA0D046107.186ON11741882357e-19
KLTH0E04774g7.186ON11701892349e-19
Ecym_43907.186ON11701892341e-18
KLTH0H09966g1.295ON12247032341e-18
Kwal_14.24351.295ON12477002341e-18
TPHA0C044407.186ON11701892332e-18
Kpol_1063.207.186ON11711892322e-18
ZYRO0D15642g7.186ON11701852322e-18
Suva_6.1047.186ON11701892312e-18
CAGL0D05258g7.186ON11701892312e-18
Skud_6.1197.186ON11701892285e-18
NCAS0E019207.186ON11701882276e-18
Smik_7.3467.186ON11701882276e-18
AAL182W1.295ON12317062232e-17
Suva_6.1491.295ON12302192116e-16
Kpol_1018.21.295ON12111892107e-16
Smik_10.1671.295ON12292182081e-15
YJL074C (SMC3)1.295ON12302192072e-15
SAKL0D06116g1.295ON12292132062e-15
KAFR0A016101.295ON12271152062e-15
KNAG0B052301.295ON12252022053e-15
TDEL0H026107.186ON1170862053e-15
ZYRO0G21296g1.295ON12271072044e-15
KNAG0L011607.186ON1170731982e-14
YFR031C (SMC2)7.186ON1170731982e-14
NCAS0A093301.295ON12271111929e-14
Skud_10.1701.295ON12302191921e-13
TDEL0D016201.295ON12231001911e-13
NDAI0G056301.295ON12291061883e-13
CAGL0H02805g1.295ON12192091848e-13
Ecym_63221.295ON1232981812e-12
TBLA0C027401.295ON11191481776e-12
KLLA0A00286g1.295ON1224691623e-10
KLTH0D02816g7.101ON10941621256e-06
ZYRO0G01584g7.101ON10882131193e-05
SAKL0B09526g7.101ON10991621177e-05
Skud_15.1217.101ON1093831132e-04
TDEL0H034907.101ON1103851132e-04
TDEL0E013404.237ON1106851122e-04
KNAG0L006307.101ON11081561095e-04
TPHA0L006007.101ON1117831096e-04
KLLA0F07997g7.101ON11192061087e-04
NCAS0I005707.101ON10952101087e-04
Smik_15.1317.101ON1093831087e-04
YOL034W (SMC5)7.101ON1093831078e-04
Kwal_26.72047.101ON11171801070.001
Suva_15.1337.101ON1092831050.002
Kpol_1044.137.101ON1103831050.002
KAFR0D013307.101ON1080831040.002
ZYRO0B12122g4.237ON1109781040.002
NDAI0A084507.101ON1119831000.006
Kwal_26.93804.237ON11023131000.007
CAGL0H05071g4.237ON111076990.007
TBLA0E021907.101ON108983990.009
NCAS0J013904.237ON109668980.009
NDAI0J021804.237ON1108173980.011
TPHA0B008404.237ON111968980.011
Skud_12.4684.237ON112068970.013
Smik_12.4704.237ON111468970.013
Suva_10.5004.237ON111568970.013
YLR383W (SMC6)4.237ON111468970.013
AEL337C7.101ON1097159970.014
KNAG0B060104.237ON111768960.017
CAGL0F01155g7.101ON110585950.022
KLLA0E05303g4.237ON109892920.045
TBLA0I028904.237ON109871920.057
TBLA0A053001.67ON70763900.092
ZYRO0F16038g1.110ON1304159870.19
Kpol_483.104.237ON1118118870.19
SAKL0H03322g4.237ON111152870.21
KAFR0A060404.237ON110268840.51
KLTH0D14080g4.237ON1102110830.53
TDEL0G028102.351ON109471830.55
Ecym_26257.101ON1097164830.66
NCAS0B087001.67ON71572801.2
AER044W4.237ON110352791.6
Ecym_53444.237ON110268792.0
TPHA0H014205.696ON703100772.9
TPHA0O019302.16ON1081110773.0
KLTH0C09966g3.106ON76067764.1
ZYRO0F17050g1.67ON71456746.1
Kwal_33.155611.527ON129779738.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0L12188g
         (1398 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0L12188g Chr12 (1310968..1315164) [4197 bp, 1398 aa] {ON} si...  2487   0.0  
Skud_12.154 Chr12 (285613..289866) [4254 bp, 1417 aa] {ON} YLR08...  1166   0.0  
Suva_10.170 Chr10 (307316..311566) [4251 bp, 1416 aa] {ON} YLR08...  1163   0.0  
Smik_12.145 Chr12 (282081..286337) [4257 bp, 1418 aa] {ON} YLR08...  1159   0.0  
ZYRO0C01716g Chr3 complement(130331..134572) [4242 bp, 1413 aa] ...  1157   0.0  
NCAS0B05000 Chr2 (917841..922070) [4230 bp, 1409 aa] {ON} Anc_8....  1154   0.0  
TDEL0F03860 Chr6 (709579..713778) [4200 bp, 1399 aa] {ON} Anc_8....  1150   0.0  
KAFR0B02710 Chr2 (545337..549587) [4251 bp, 1416 aa] {ON} Anc_8....  1145   0.0  
SAKL0H17094g Chr8 complement(1508021..1512289) [4269 bp, 1422 aa...  1140   0.0  
KNAG0G02020 Chr7 (449115..453449) [4335 bp, 1444 aa] {ON} Anc_8....  1131   0.0  
AGR089C Chr7 complement(901437..905549) [4113 bp, 1370 aa] {ON} ...  1128   0.0  
Kpol_392.8 s392 complement(19392..23675) [4284 bp, 1427 aa] {ON}...  1124   0.0  
NDAI0B01970 Chr2 (479208..483455) [4248 bp, 1415 aa] {ON} Anc_8....  1118   0.0  
KLTH0G13750g Chr7 complement(1184169..1188368) [4200 bp, 1399 aa...  1091   0.0  
Kwal_56.23825 s56 complement(721498..725688) [4191 bp, 1396 aa] ...  1073   0.0  
TBLA0E04410 Chr5 (1122005..1126273) [4269 bp, 1422 aa] {ON} Anc_...  1071   0.0  
Ecym_4311 Chr4 complement(666871..671001) [4131 bp, 1376 aa] {ON...  1060   0.0  
KLLA0F19085g Chr6 (1758111..1762229) [4119 bp, 1372 aa] {ON} sim...  1016   0.0  
YLR086W Chr12 (302243..306499) [4257 bp, 1418 aa] {ON}  SMC4Subu...   797   0.0  
TPHA0J00720 Chr10 (161017..165198) [4182 bp, 1393 aa] {ON} Anc_8...   708   0.0  
NDAI0G03320 Chr7 (781468..785163) [3696 bp, 1231 aa] {ON}             144   5e-34
Suva_6.52 Chr6 (91156..94950) [3795 bp, 1264 aa] {ON} YFL008W (R...   144   7e-34
KLTH0A02706g Chr1 complement(234723..238409) [3687 bp, 1228 aa] ...   142   2e-33
Kwal_23.5043 s23 (978758..982435) [3678 bp, 1225 aa] {ON} YFL008...   140   6e-33
Skud_6.64 Chr6 (121616..125308) [3693 bp, 1230 aa] {ON} YFL008W ...   140   6e-33
YFL008W Chr6 (119429..123106) [3678 bp, 1225 aa] {ON}  SMC1Subun...   140   1e-32
Smik_6.71 Chr6 (132627..136313) [3687 bp, 1228 aa] {ON} YFL008W ...   140   1e-32
TPHA0P00340 Chr16 (65711..69370) [3660 bp, 1219 aa] {ON} Anc_8.6...   139   2e-32
Kpol_1011.5 s1011 complement(13399..17064) [3666 bp, 1221 aa] {O...   139   2e-32
NCAS0C04000 Chr3 (807106..810777) [3672 bp, 1223 aa] {ON} Anc_8....   139   2e-32
KAFR0C03200 Chr3 (643231..646902) [3672 bp, 1223 aa] {ON} Anc_8....   138   3e-32
KNAG0G00910 Chr7 (172759..176439) [3681 bp, 1226 aa] {ON} Anc_8....   137   1e-31
CAGL0F02079g Chr6 (201002..204673) [3672 bp, 1223 aa] {ON} simil...   136   1e-31
TDEL0C00960 Chr3 (153572..157240) [3669 bp, 1222 aa] {ON} Anc_8....   136   2e-31
KLLA0D07502g Chr4 complement(642751..646482) [3732 bp, 1243 aa] ...   133   2e-30
SAKL0B02288g Chr2 (215750..219436) [3687 bp, 1228 aa] {ON} simil...   132   2e-30
AGL023W Chr7 (670877..674545) [3669 bp, 1222 aa] {ON} Syntenic h...   132   3e-30
ZYRO0F03828g Chr6 (318190..321843) [3654 bp, 1217 aa] {ON} simil...   129   3e-29
Ecym_7303 Chr7 (638719..642387) [3669 bp, 1222 aa] {ON} similar ...   118   7e-26
Kwal_55.20421 s55 (391382..394894) [3513 bp, 1170 aa] {ON} YFR03...   115   5e-25
AGR236W Chr7 (1189845..1193357) [3513 bp, 1170 aa] {ON} Syntenic...   100   2e-20
NDAI0G02070 Chr7 (461697..465212) [3516 bp, 1171 aa] {ON} Anc_7....    97   3e-19
TBLA0G03530 Chr7 complement(941941..945639) [3699 bp, 1232 aa] {...    97   3e-19
SAKL0F07282g Chr6 complement(554459..557971) [3513 bp, 1170 aa] ...    96   3e-19
KAFR0G02930 Chr7 complement(609210..612722) [3513 bp, 1170 aa] {...    96   5e-19
KLLA0D16005g Chr4 complement(1346492..1350004) [3513 bp, 1170 aa...    96   6e-19
TPHA0I01090 Chr9 complement(252902..256552) [3651 bp, 1216 aa] {...    96   6e-19
TBLA0D04610 Chr4 complement(1139885..1143409) [3525 bp, 1174 aa]...    95   7e-19
KLTH0E04774g Chr5 (426535..430047) [3513 bp, 1170 aa] {ON} simil...    95   9e-19
Ecym_4390 Chr4 (816076..819588) [3513 bp, 1170 aa] {ON} similar ...    95   1e-18
KLTH0H09966g Chr8 complement(859362..863036) [3675 bp, 1224 aa] ...    95   1e-18
Kwal_14.2435 s14 complement(756213..759956) [3744 bp, 1247 aa] {...    95   1e-18
TPHA0C04440 Chr3 complement(958279..961791) [3513 bp, 1170 aa] {...    94   2e-18
Kpol_1063.20 s1063 (46233..49748) [3516 bp, 1171 aa] {ON} (46233...    94   2e-18
ZYRO0D15642g Chr4 complement(1307703..1311215) [3513 bp, 1170 aa...    94   2e-18
Suva_6.104 Chr6 complement(183396..186908) [3513 bp, 1170 aa] {O...    94   2e-18
CAGL0D05258g Chr4 (500858..504370) [3513 bp, 1170 aa] {ON} simil...    94   2e-18
Skud_6.119 Chr6 complement(211918..215430) [3513 bp, 1170 aa] {O...    92   5e-18
NCAS0E01920 Chr5 (368382..371894) [3513 bp, 1170 aa] {ON} Anc_7....    92   6e-18
Smik_7.346 Chr7 complement(577634..581146) [3513 bp, 1170 aa] {O...    92   6e-18
AAL182W Chr1 (16155..19850) [3696 bp, 1231 aa] {ON} Syntenic hom...    91   2e-17
Suva_6.149 Chr6 (248275..251967) [3693 bp, 1230 aa] {ON} YJL074C...    86   6e-16
Kpol_1018.2 s1018 complement(5901..9536) [3636 bp, 1211 aa] {ON}...    86   7e-16
Smik_10.167 Chr10 complement(290936..294625) [3690 bp, 1229 aa] ...    85   1e-15
YJL074C Chr10 complement(299157..302849) [3693 bp, 1230 aa] {ON}...    84   2e-15
SAKL0D06116g Chr4 complement(503196..506885) [3690 bp, 1229 aa] ...    84   2e-15
KAFR0A01610 Chr1 complement(326620..330303) [3684 bp, 1227 aa] {...    84   2e-15
KNAG0B05230 Chr2 complement(1005244..1008921) [3678 bp, 1225 aa]...    84   3e-15
TDEL0H02610 Chr8 (434116..437628) [3513 bp, 1170 aa] {ON} Anc_7....    84   3e-15
ZYRO0G21296g Chr7 (1747217..1750900) [3684 bp, 1227 aa] {ON} sim...    83   4e-15
KNAG0L01160 Chr12 complement(206434..209946) [3513 bp, 1170 aa] ...    81   2e-14
YFR031C Chr6 complement(216594..220106) [3513 bp, 1170 aa] {ON} ...    81   2e-14
NCAS0A09330 Chr1 (1844122..1847805) [3684 bp, 1227 aa] {ON} Anc_...    79   9e-14
Skud_10.170 Chr10 (316063..319755) [3693 bp, 1230 aa] {ON} YJL07...    79   1e-13
TDEL0D01620 Chr4 complement(321963..325634) [3672 bp, 1223 aa] {...    78   1e-13
NDAI0G05630 Chr7 complement(1393671..1397360) [3690 bp, 1229 aa]...    77   3e-13
CAGL0H02805g Chr8 complement(256682..260341) [3660 bp, 1219 aa] ...    75   8e-13
Ecym_6322 Chr6 (611978..615676) [3699 bp, 1232 aa] {ON} similar ...    74   2e-12
TBLA0C02740 Chr3 (656941..660300) [3360 bp, 1119 aa] {ON} Anc_1....    73   6e-12
KLLA0A00286g Chr1 complement(22024..25698) [3675 bp, 1224 aa] {O...    67   3e-10
KLTH0D02816g Chr4 complement(272310..275594) [3285 bp, 1094 aa] ...    53   6e-06
ZYRO0G01584g Chr7 (120582..123848) [3267 bp, 1088 aa] {ON} simil...    50   3e-05
SAKL0B09526g Chr2 (805816..809115) [3300 bp, 1099 aa] {ON} simil...    50   7e-05
Skud_15.121 Chr15 (218825..222106) [3282 bp, 1093 aa] {ON} YOL03...    48   2e-04
TDEL0H03490 Chr8 (578645..581956) [3312 bp, 1103 aa] {ON} Anc_7....    48   2e-04
TDEL0E01340 Chr5 complement(265681..269001) [3321 bp, 1106 aa] {...    48   2e-04
KNAG0L00630 Chr12 complement(93928..97254) [3327 bp, 1108 aa] {O...    47   5e-04
TPHA0L00600 Chr12 complement(102317..105670) [3354 bp, 1117 aa] ...    47   6e-04
KLLA0F07997g Chr6 complement(748561..751920) [3360 bp, 1119 aa] ...    46   7e-04
NCAS0I00570 Chr9 complement(90806..94093) [3288 bp, 1095 aa] {ON...    46   7e-04
Smik_15.131 Chr15 (226115..229396) [3282 bp, 1093 aa] {ON} YOL03...    46   7e-04
YOL034W Chr15 (259923..263204) [3282 bp, 1093 aa] {ON}  SMC5Comp...    46   8e-04
Kwal_26.7204 s26 complement(263266..266619) [3354 bp, 1117 aa] {...    46   0.001
Suva_15.133 Chr15 (232441..235719) [3279 bp, 1092 aa] {ON} YOL03...    45   0.002
Kpol_1044.13 s1044 complement(23616..26927) [3312 bp, 1103 aa] {...    45   0.002
KAFR0D01330 Chr4 complement(263879..267121) [3243 bp, 1080 aa] {...    45   0.002
ZYRO0B12122g Chr2 (972611..975940) [3330 bp, 1109 aa] {ON} simil...    45   0.002
NDAI0A08450 Chr1 (1947452..1950811) [3360 bp, 1119 aa] {ON} Anc_...    43   0.006
Kwal_26.9380 s26 (1189521..1192829) [3309 bp, 1102 aa] {ON} YLR3...    43   0.007
CAGL0H05071g Chr8 (486899..490231) [3333 bp, 1110 aa] {ON} simil...    43   0.007
TBLA0E02190 Chr5 complement(534078..537347) [3270 bp, 1089 aa] {...    43   0.009
NCAS0J01390 Chr10 (242118..245408) [3291 bp, 1096 aa] {ON} Anc_4...    42   0.009
NDAI0J02180 Chr10 (529566..532892) [3327 bp, 1108 aa] {ON} Anc_4...    42   0.011
TPHA0B00840 Chr2 complement(194812..198171) [3360 bp, 1119 aa] {...    42   0.011
Skud_12.468 Chr12 (825378..828740) [3363 bp, 1120 aa] {ON} YLR38...    42   0.013
Smik_12.470 Chr12 (824001..827345) [3345 bp, 1114 aa] {ON} YLR38...    42   0.013
Suva_10.500 Chr10 (850833..854180) [3348 bp, 1115 aa] {ON} YLR38...    42   0.013
YLR383W Chr12 (885288..888632) [3345 bp, 1114 aa] {ON}  SMC6Comp...    42   0.013
AEL337C Chr5 complement(14613..17906) [3294 bp, 1097 aa] {ON} Sy...    42   0.014
KNAG0B06010 Chr2 (1178430..1181783) [3354 bp, 1117 aa] {ON} Anc_...    42   0.017
CAGL0F01155g Chr6 complement(116762..120079) [3318 bp, 1105 aa] ...    41   0.022
KLLA0E05303g Chr5 complement(472583..475879) [3297 bp, 1098 aa] ...    40   0.045
TBLA0I02890 Chr9 (683688..686984) [3297 bp, 1098 aa] {ON} Anc_4....    40   0.057
TBLA0A05300 Chr1 (1297764..1299887) [2124 bp, 707 aa] {ON} Anc_1...    39   0.092
ZYRO0F16038g Chr6 complement(1315669..1319583) [3915 bp, 1304 aa...    38   0.19 
Kpol_483.10 s483 (21646..25002) [3357 bp, 1118 aa] {ON} (21646.....    38   0.19 
SAKL0H03322g Chr8 complement(314365..317700) [3336 bp, 1111 aa] ...    38   0.21 
KAFR0A06040 Chr1 complement(1222239..1225547) [3309 bp, 1102 aa]...    37   0.51 
KLTH0D14080g Chr4 (1149555..1152863) [3309 bp, 1102 aa] {ON} sim...    37   0.53 
TDEL0G02810 Chr7 (540540..543824) [3285 bp, 1094 aa] {ON} Anc_2....    37   0.55 
Ecym_2625 Chr2 (1208550..1211843) [3294 bp, 1097 aa] {ON} simila...    37   0.66 
NCAS0B08700 Chr2 (1674262..1676409) [2148 bp, 715 aa] {ON} Anc_1...    35   1.2  
AER044W Chr5 (714355..717666) [3312 bp, 1103 aa] {ON} Syntenic h...    35   1.6  
Ecym_5344 Chr5 (696147..699455) [3309 bp, 1102 aa] {ON} similar ...    35   2.0  
TPHA0H01420 Chr8 complement(318539..320650) [2112 bp, 703 aa] {O...    34   2.9  
TPHA0O01930 Chr15 (382854..386099) [3246 bp, 1081 aa] {ON} Anc_2...    34   3.0  
KLTH0C09966g Chr3 (823260..825542) [2283 bp, 760 aa] {ON} conser...    34   4.1  
ZYRO0F17050g Chr6 complement(1417445..1419589) [2145 bp, 714 aa]...    33   6.1  
Kwal_33.15561 s33 (1157299..1161192) [3894 bp, 1297 aa] {ON} YKL...    33   8.5  

>CAGL0L12188g Chr12 (1310968..1315164) [4197 bp, 1398 aa] {ON} similar
            to uniprot|Q12267 Saccharomyces cerevisiae YLR086w Stable
            Maintenance of Chromosomes
          Length = 1398

 Score = 2487 bits (6447), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1262/1398 (90%), Positives = 1262/1398 (90%)

Query: 1    MSDRPVSKRQKVTEEDEEEDVIHTPKAVTFEQSPRAITPRNLLGSENRNVLPTGGSQNLQ 60
            MSDRPVSKRQKVTEEDEEEDVIHTPKAVTFEQSPRAITPRNLLGSENRNVLPTGGSQNLQ
Sbjct: 1    MSDRPVSKRQKVTEEDEEEDVIHTPKAVTFEQSPRAITPRNLLGSENRNVLPTGGSQNLQ 60

Query: 61   IPSLLPPESLGSARGRDFKSYXXXXXXXXXXXXXXXLKLIELSPIKNSRAELQKLYESKK 120
            IPSLLPPESLGSARGRDFKSY               LKLIELSPIKNSRAELQKLYESKK
Sbjct: 61   IPSLLPPESLGSARGRDFKSYSQSPPRSPGRSPTRRLKLIELSPIKNSRAELQKLYESKK 120

Query: 121  LDVKKERLFIHQLVLNDFKSYAGRQVIGPFHTSFSAIVGPNGSGKSNVIDSMLFVFGFRA 180
            LDVKKERLFIHQLVLNDFKSYAGRQVIGPFHTSFSAIVGPNGSGKSNVIDSMLFVFGFRA
Sbjct: 121  LDVKKERLFIHQLVLNDFKSYAGRQVIGPFHTSFSAIVGPNGSGKSNVIDSMLFVFGFRA 180

Query: 181  NKMRQDRLSDLIHKSETFPDLKSCSVEVHFKYVIDKDDGSTTIDETKGNLVVTRKAFKNN 240
            NKMRQDRLSDLIHKSETFPDLKSCSVEVHFKYVIDKDDGSTTIDETKGNLVVTRKAFKNN
Sbjct: 181  NKMRQDRLSDLIHKSETFPDLKSCSVEVHFKYVIDKDDGSTTIDETKGNLVVTRKAFKNN 240

Query: 241  ASKYFVNGKESNYTEVTTLLKKEGIDLDHKRFLILQGEVENIAQMKAKAEKENDDGLLEY 300
            ASKYFVNGKESNYTEVTTLLKKEGIDLDHKRFLILQGEVENIAQMKAKAEKENDDGLLEY
Sbjct: 241  ASKYFVNGKESNYTEVTTLLKKEGIDLDHKRFLILQGEVENIAQMKAKAEKENDDGLLEY 300

Query: 301  LEDIIGTSKYKESIEKLSMEIESLNEICVEKENRFSIVEREKNSLESGKEEALQFXXXXX 360
            LEDIIGTSKYKESIEKLSMEIESLNEICVEKENRFSIVEREKNSLESGKEEALQF     
Sbjct: 301  LEDIIGTSKYKESIEKLSMEIESLNEICVEKENRFSIVEREKNSLESGKEEALQFLNKEK 360

Query: 361  XXXXXXXXXYQYNLMQXXXXXXXXXXXXTNVQQEQTKQEDEFRKANSHISDITASLNVLK 420
                     YQYNLMQ            TNVQQEQTKQEDEFRKANSHISDITASLNVLK
Sbjct: 361  ELVLEKSKLYQYNLMQDNKKLDDVLNKKTNVQQEQTKQEDEFRKANSHISDITASLNVLK 420

Query: 421  ADLEKVHTEEVNLSKTKRTLENKKVENEQIVNNLDSKRKEFEEQSKILQDKINSTDQEIQ 480
            ADLEKVHTEEVNLSKTKRTLENKKVENEQIVNNLDSKRKEFEEQSKILQDKINSTDQEIQ
Sbjct: 421  ADLEKVHTEEVNLSKTKRTLENKKVENEQIVNNLDSKRKEFEEQSKILQDKINSTDQEIQ 480

Query: 481  TIIEEQSSLAEGTTVLSTNXXXXXXXXXXXXXXXXXXTEHLTIQIAEYEKELSPWNEQSQ 540
            TIIEEQSSLAEGTTVLSTN                  TEHLTIQIAEYEKELSPWNEQSQ
Sbjct: 481  TIIEEQSSLAEGTTVLSTNLDIEKEKLENIKLKLREKTEHLTIQIAEYEKELSPWNEQSQ 540

Query: 541  QLKKEIKITESELSIIEENRKGLENDIAGLENAILSQKRDLEVQEQEIKSLLEQKTKVIQ 600
            QLKKEIKITESELSIIEENRKGLENDIAGLENAILSQKRDLEVQEQEIKSLLEQKTKVIQ
Sbjct: 541  QLKKEIKITESELSIIEENRKGLENDIAGLENAILSQKRDLEVQEQEIKSLLEQKTKVIQ 600

Query: 601  ERELGERECKNAQATLANVREKVEALRQKAIEIRSTYSATENNNKVLSALLRLQKSGRLN 660
            ERELGERECKNAQATLANVREKVEALRQKAIEIRSTYSATENNNKVLSALLRLQKSGRLN
Sbjct: 601  ERELGERECKNAQATLANVREKVEALRQKAIEIRSTYSATENNNKVLSALLRLQKSGRLN 660

Query: 661  GFHGRLGDLAVIDPKYDVAISTACPRLNDLVVDTVESGQQCIEYLRKNKLGYARFILLDK 720
            GFHGRLGDLAVIDPKYDVAISTACPRLNDLVVDTVESGQQCIEYLRKNKLGYARFILLDK
Sbjct: 661  GFHGRLGDLAVIDPKYDVAISTACPRLNDLVVDTVESGQQCIEYLRKNKLGYARFILLDK 720

Query: 721  LNTFNTNRIDTPDQSQRLFDLITVKEKRFNNAFYSVLRDTLVCQNMEQANRVAYGKKRYR 780
            LNTFNTNRIDTPDQSQRLFDLITVKEKRFNNAFYSVLRDTLVCQNMEQANRVAYGKKRYR
Sbjct: 721  LNTFNTNRIDTPDQSQRLFDLITVKEKRFNNAFYSVLRDTLVCQNMEQANRVAYGKKRYR 780

Query: 781  VVTLDGNLIDLSGTMTGGGRNVXXXXXXXXXXXXXXXAFFSPEEVQAIENELNQKENQYK 840
            VVTLDGNLIDLSGTMTGGGRNV               AFFSPEEVQAIENELNQKENQYK
Sbjct: 781  VVTLDGNLIDLSGTMTGGGRNVSKGLMKLSKSSSKGSAFFSPEEVQAIENELNQKENQYK 840

Query: 841  SALDAYHXXXXXXXXXXXXAPEIDNLVSKKEMDIETAHNDINSNINVLEEKRKKLESMKN 900
            SALDAYH            APEIDNLVSKKEMDIETAHNDINSNINVLEEKRKKLESMKN
Sbjct: 841  SALDAYHEMEEELRRLRDRAPEIDNLVSKKEMDIETAHNDINSNINVLEEKRKKLESMKN 900

Query: 901  QNDPSITXXXXXXXXXXXXDDIDVQXXXXXXXXXXXXXXXXELGGDELKNQSLLVTDITN 960
            QNDPSIT            DDIDVQ                ELGGDELKNQSLLVTDITN
Sbjct: 901  QNDPSITLLAKLKELKSKLDDIDVQTKSTKDKIKTIKDKIIELGGDELKNQSLLVTDITN 960

Query: 961  KISENSRRXXXXXXXXXXXXXXXXXXXXXXTEANEELTNFSKNAENADIESKEIESKLLD 1020
            KISENSRR                      TEANEELTNFSKNAENADIESKEIESKLLD
Sbjct: 961  KISENSRRLKKIKSNKLKKESLLKKFNKELTEANEELTNFSKNAENADIESKEIESKLLD 1020

Query: 1021 IKESIENLKENEVKLEHEIEMKHNELESHQKVVSDYKSISLEYNNKLEKLEASEASLKKS 1080
            IKESIENLKENEVKLEHEIEMKHNELESHQKVVSDYKSISLEYNNKLEKLEASEASLKKS
Sbjct: 1021 IKESIENLKENEVKLEHEIEMKHNELESHQKVVSDYKSISLEYNNKLEKLEASEASLKKS 1080

Query: 1081 IKRYNDLLSELTIRDVTQVLNTIMTEENASVDKSDPKLENTSAVINADDDGISAVSENQS 1140
            IKRYNDLLSELTIRDVTQVLNTIMTEENASVDKSDPKLENTSAVINADDDGISAVSENQS
Sbjct: 1081 IKRYNDLLSELTIRDVTQVLNTIMTEENASVDKSDPKLENTSAVINADDDGISAVSENQS 1140

Query: 1141 FNHNDENDDIDSNKMEIDSQGGFINPGIPVLSASELAKVDPQEVELLITSLDDFITSSEA 1200
            FNHNDENDDIDSNKMEIDSQGGFINPGIPVLSASELAKVDPQEVELLITSLDDFITSSEA
Sbjct: 1141 FNHNDENDDIDSNKMEIDSQGGFINPGIPVLSASELAKVDPQEVELLITSLDDFITSSEA 1200

Query: 1201 NVDVLEEYALRFVEFNKRKNDLNSAVQSRDSVKDRLEGIKRKRYDEFMEGFKIISMTLKE 1260
            NVDVLEEYALRFVEFNKRKNDLNSAVQSRDSVKDRLEGIKRKRYDEFMEGFKIISMTLKE
Sbjct: 1201 NVDVLEEYALRFVEFNKRKNDLNSAVQSRDSVKDRLEGIKRKRYDEFMEGFKIISMTLKE 1260

Query: 1261 MYQMITLGGNAELELVDSLDPFSEGVTFSVMPPKKSWRNISNLSGGEKTLSSLALVFALH 1320
            MYQMITLGGNAELELVDSLDPFSEGVTFSVMPPKKSWRNISNLSGGEKTLSSLALVFALH
Sbjct: 1261 MYQMITLGGNAELELVDSLDPFSEGVTFSVMPPKKSWRNISNLSGGEKTLSSLALVFALH 1320

Query: 1321 KYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELTKQLVGIYKH 1380
            KYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELTKQLVGIYKH
Sbjct: 1321 KYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELTKQLVGIYKH 1380

Query: 1381 ENMTKSAALVNEDLVGRA 1398
            ENMTKSAALVNEDLVGRA
Sbjct: 1381 ENMTKSAALVNEDLVGRA 1398

>Skud_12.154 Chr12 (285613..289866) [4254 bp, 1417 aa] {ON} YLR086W
            (REAL)
          Length = 1417

 Score = 1166 bits (3016), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 669/1441 (46%), Positives = 904/1441 (62%), Gaps = 69/1441 (4%)

Query: 1    MSDRPVSKRQK--VTEEDE--------------EEDVIHT-----PKAVTFEQS-PRAIT 38
            M D P+SK+QK   TEE E              E  V  T     P + + E S  R+ T
Sbjct: 1    MCDSPLSKKQKRKATEEPELSLNDTDAERESRVENRVNRTEKTPDPNSPSLESSYARSHT 60

Query: 39   PRNLLGS--ENRNVL--PT-GGSQNLQIPSLLPPESLGSARGRDFKSYXXXXXXXXXXXX 93
            PR L+ S  ENR     PT   + +L +P+L PP+   S+RGRD+K+Y            
Sbjct: 61   PRKLVLSSGENRYAFSQPTNSATTSLHVPNLQPPKV--SSRGRDYKAYSQSPPRSPGRSP 118

Query: 94   XXXLKLIELSPIKNSRAELQKLYESKKLDVKKE-RLFIHQLVLNDFKSYAGRQVIGPFHT 152
               L+L++LSP+KNSR ELQKLY+S K   K++ RLFI++LVL++FKSYAGRQV+GPFHT
Sbjct: 119  ARRLELLQLSPVKNSRIELQKLYDSHKSSGKQQGRLFINKLVLDNFKSYAGRQVVGPFHT 178

Query: 153  SFSAIVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSETFPDLKSCSVEVHFKY 212
            SFSA+VGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSE FPDL++CSV VHF+Y
Sbjct: 179  SFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSEAFPDLQACSVAVHFEY 238

Query: 213  VIDKDDGSTTIDETKGNLVVTRKAFKNNASKYFVNGKESNYTEVTTLLKKEGIDLDHKRF 272
            +ID+  G++ IDE K  LV+TR+AFKNN+SKY++N KES+YTEVT LLKKEGIDLDHKRF
Sbjct: 239  IIDEPSGTSRIDEEKPGLVITRRAFKNNSSKYYINEKESSYTEVTKLLKKEGIDLDHKRF 298

Query: 273  LILQGEVENIAQMKAKAEKENDDGLLEYLEDIIGTSKYKESIEKLSMEIESLNEICVEKE 332
            LILQGEVENIAQMK KAEKE+DDGLLEYLEDIIGT+ YK  IE+   +IESLNEIC+EK 
Sbjct: 299  LILQGEVENIAQMKPKAEKESDDGLLEYLEDIIGTANYKPLIEERLSQIESLNEICLEKA 358

Query: 333  NRFSIVEREKNSLESGKEEALQFXXXXXXXXXXXXXXYQYNLMQXXXXXXXXXXXXTNVQ 392
            NRF IV+REKNSLESGKE AL+F               Q+ ++Q            +++ 
Sbjct: 359  NRFEIVDREKNSLESGKETALEFLKKEKQLTLLKSKLLQFKMLQSNSKLASTLEKISSLN 418

Query: 393  QEQTKQEDEFRKANSHISDITASLNVLKADLEKVHTEEVNLSKTKRTLENKKVENEQIVN 452
            +E   ++ +F+++   + ++ A    +K  +    + E  LS  KR LE  +V  E+   
Sbjct: 419  REFESEKKKFQESLREVDEVKAQHKDIKDRISSSTSREKTLSLEKRELEGSRVSLEERTK 478

Query: 453  NLDSKRKEFEEQSKILQDKINSTDQEIQTIIEEQSSLAEGTTVLSTNXXXXXXXXXXXXX 512
            NL +K  + E+  K  +  I+ ++   Q +  +Q+   +    L+ +             
Sbjct: 479  NLVNKMGKAEKALKSTKHSISESEHMFQELQRQQTEHEKEIKDLNQSLEEERIILDDIKL 538

Query: 513  XXXXXTEHLTIQIAEYEKELSPWNEQSQQLKKEIKITESELSIIEENRKGLENDIAGLEN 572
                 T+ ++ +I  +EKE  PW+ Q Q+ K +I++ ESELS++EE R  L+ +   LE 
Sbjct: 539  SLKDKTKDISAKIIRHEKESEPWDLQLQEKKSQIQLAESELSLLEETRAKLKKNAEALEE 598

Query: 573  AILSQKRDLEVQEQEIKSL---LEQKTK-VIQERELGERECKNAQATLANVREKVEALRQ 628
             I+S+K+    ++QE++ L   L Q+ K +I  R  GER+ ++A   L  ++  + A RQ
Sbjct: 599  KIISKKQ----RKQELQGLVLDLSQRLKSLIDGRSQGERDFRSAHLKLKEMQRILNAHRQ 654

Query: 629  KAIEIRSTYSATENNNKVLSALLRLQKSGRLNGFHGRLGDLAVIDPKYDVAISTACPRLN 688
            +A+E RS+ S  +N N VL+AL +LQKSGR+NGFHGRLGDL VID  +DVAISTACPRL+
Sbjct: 655  RAMEARSSLSKAQNKNMVLTALSKLQKSGRINGFHGRLGDLGVIDNSFDVAISTACPRLD 714

Query: 689  DLVVDTVESGQQCIEYLRKNKLGYARFILLDKLNTFNTNRIDTPDQSQRLFDLITVKEKR 748
            D+VVDTVE  Q CI+YLRKNKLGYARFILLD+L  FN   I TP+   RLFD++  K+ +
Sbjct: 715  DVVVDTVECAQHCIDYLRKNKLGYARFILLDRLRKFNLQPISTPENVPRLFDVVKPKDPK 774

Query: 749  FNNAFYSVLRDTLVCQNMEQANRVAYGKKRYRVVTLDGNLIDLSGTMTGGGRNVXXXXXX 808
            F+NAFYSVL+DTLV ++++QAN+VAYGK+R+RVVT+DG LID+SGTM+GGG +V      
Sbjct: 775  FSNAFYSVLKDTLVARDLKQANKVAYGKRRFRVVTVDGKLIDISGTMSGGGNHVMKGLMR 834

Query: 809  XXXXXXXXXAFFSPEEVQAIENELNQKENQYKSALDAYHXXXXXXXXXXXXAPEIDNLVS 868
                       ++PEEV  IE+EL ++E  ++ A D  H             P++++ +S
Sbjct: 835  LGTNQSDEIEDYTPEEVIKIEHELAEREKNFRVANDTVHEMEEELKKVRDQEPDLESQIS 894

Query: 869  KKEMDIETAHNDINSNINVLEEKRKKLESMKNQNDPSITXXXXXXXXXXXXDDIDVQXXX 928
            + EM+ ++  +++       +E +   +   N+                  +D+  +   
Sbjct: 895  RAEMEADSLTSELMLAEQQAKEAKMAYDKAVNEKTQVNEVMKNLEHLRGEYEDLQSETRT 954

Query: 929  XXXXXXXXXXXXXELGGDELKNQSLLVTDITNKISENSRRXXXXXXXXXXXXXXXXXXXX 988
                         ++GG +L  Q+       +K+    +R                    
Sbjct: 955  KKEQIKILQDQIMKIGGTKLHTQN-------SKVGSLCQRIDILVIKLKKVKSGIKKSEG 1007

Query: 989  XXTEANEELTNFSKNAENADIESKEIESKLLDIKES----------IENLKENEVKLEHE 1038
               +  ++L NF ++ E +  E K IE KL   K +          I NLK    +L+ +
Sbjct: 1008 DVLKYQKQLKNFEQDEELSSNELKVIEEKLKQTKLALTENDTNMTEISNLKS---ELKDQ 1064

Query: 1039 IEMKHNELESHQKVVSDYKSISLEYNNKLEKLEASEASLKKSIKRYNDLLSELTIRDVTQ 1098
             E     L   ++ + ++KS+ +E  NKLEKL +    +K  IK+ +  L++L+IRDVT 
Sbjct: 1065 GEQLKERLTEMEENIDEFKSLEIEMKNKLEKLNSLLIHIKNEIKQQDKELNDLSIRDVTH 1124

Query: 1099 VLNTIMTEENASVDKSDPKLENTSAVINADDDGISAVSENQSFNHNDENDDIDSN--KME 1156
             L  +   +N  +D  +  +++     +AD D  S + +++      E DD D+N   M 
Sbjct: 1125 TLQML---DNNQMDVVEDGIKDEQ---DADQDKPSGIPDDEKIQ---EKDDADNNHHSMN 1175

Query: 1157 IDSQGGFINPGIPVLSASELAKVDPQEVELLITSLDDFITSSEANVDVLEEYALRFVEFN 1216
            ID     I+ GIP L   EL  +D + +E  I+ L  +I  +  ++ VLEEY  R +EF 
Sbjct: 1176 IDEMSSEISRGIPKLCEEELKDLDIELLESDISGLTCYINETSVDIGVLEEYVRRLIEFK 1235

Query: 1217 KRKNDLNSAVQSRDSVKDRLEGIKRKRYDEFMEGFKIISMTLKEMYQMITLGGNAELELV 1276
            +RK DLN AVQ RD VK++LE +K+ R+DEFM GF IISMTLKEMYQMIT+GGNAELELV
Sbjct: 1236 RRKLDLNQAVQKRDEVKEQLEILKKNRFDEFMNGFNIISMTLKEMYQMITMGGNAELELV 1295

Query: 1277 DSLDPFSEGVTFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAA 1336
            DSLDPFSEGVTFSVMPPKKSWRNI+NLSGGEKTLSSLALVFALHKY+PTPLYVMDEIDAA
Sbjct: 1296 DSLDPFSEGVTFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYRPTPLYVMDEIDAA 1355

Query: 1337 LDFRNVSIVANYIKERTKNAQFIVISLRNNMFELTKQLVGIYKHENMTKSAALVNEDLVG 1396
            LDFRNVSIVANYIKERTKNAQFIVISLRNNMFEL +QL+GIYK +N TKS  + N D++ 
Sbjct: 1356 LDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQLIGIYKRDNRTKSTTVKNIDILK 1415

Query: 1397 R 1397
            R
Sbjct: 1416 R 1416

>Suva_10.170 Chr10 (307316..311566) [4251 bp, 1416 aa] {ON} YLR086W
            (REAL)
          Length = 1416

 Score = 1163 bits (3009), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 671/1443 (46%), Positives = 905/1443 (62%), Gaps = 74/1443 (5%)

Query: 1    MSDRPVSKRQKV-TEEDEEEDVIHT--------------------PKAVTFEQS-PRAIT 38
            M D P+SKRQK  T E+ E  + H                     P +++ E S  ++ T
Sbjct: 1    MYDSPLSKRQKRKTAEEPELSINHGNGEQEPKAEKQNDRTEKTPDPDSLSLESSYAKSHT 60

Query: 39   PRNLLGS--ENRNVL--PT-GGSQNLQIPSLLPPESLGSARGRDFKSYXXXXXXXXXXXX 93
            PR L+ S  ENR     PT   + +L +P+L PPE+   +RGRD+K+Y            
Sbjct: 61   PRKLVLSSGENRYAFSQPTNSATSSLHVPNLQPPEA--PSRGRDYKAYSQSPPRSPGRSP 118

Query: 94   XXXLKLIELSPIKNSRAELQKLYESKKLDVKKE-RLFIHQLVLNDFKSYAGRQVIGPFHT 152
               L+L++LSP+KNSR ELQKLY+S +   +++ RLFI +LVL +FKSYAG+QV+GPFHT
Sbjct: 119  TRRLELLQLSPVKNSRIELQKLYDSHQPSGEQQGRLFIDKLVLENFKSYAGKQVVGPFHT 178

Query: 153  SFSAIVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSETFPDLKSCSVEVHFKY 212
            SFSA+VGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSE FP+L+SCSV VHF+Y
Sbjct: 179  SFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSEEFPNLQSCSVAVHFEY 238

Query: 213  VIDKDDGSTTIDETKGNLVVTRKAFKNNASKYFVNGKESNYTEVTTLLKKEGIDLDHKRF 272
            V+D+  G++ IDE K  LV+TRKAF+NN+SKY++NGKESNYT+VT LLK EGIDLDHKRF
Sbjct: 239  VVDEPSGTSRIDEEKPGLVITRKAFRNNSSKYYINGKESNYTQVTKLLKNEGIDLDHKRF 298

Query: 273  LILQGEVENIAQMKAKAEKENDDGLLEYLEDIIGTSKYKESIEKLSMEIESLNEICVEKE 332
            LILQGEVENIAQMK+KAEKE+DDGLLEYLEDIIGT+ YK  IE    +IE+LNEIC+EKE
Sbjct: 299  LILQGEVENIAQMKSKAEKESDDGLLEYLEDIIGTANYKPLIEDRLSQIETLNEICLEKE 358

Query: 333  NRFSIVEREKNSLESGKEEALQFXXXXXXXXXXXXXXYQYNLMQXXXXXXXXXXXXTNVQ 392
            NRF IV REKNSLESGKE AL+F              +Q+ L+Q            +++ 
Sbjct: 359  NRFEIVNREKNSLESGKETALEFLEKEKQLTLLKSKLFQFKLLQSNSKLASTLEKTSSLN 418

Query: 393  QEQTKQEDEFRKANSHISDITASLNVLKADLEKVHTEEVNLSKTKRTLENKKVENEQIVN 452
            ++   ++ +F+++   + ++ +    +K  +    ++E  L+  KR LE+ +V  E+   
Sbjct: 419  KDFESEKKKFQESLKEVDEVESQRKEIKDRMSSCASQEKTLALEKRELESTRVSLEERTK 478

Query: 453  NLDSKRKEFEEQSKILQDKINSTDQEIQTIIEEQSSLAEGTTVLSTNXXXXXXXXXXXXX 512
            NL +K  + E+  K     I+  +  ++ +  EQ+        L+ +             
Sbjct: 479  NLVNKMGKAEKILKSTNHSISEAEHLLEELHGEQTEHETEVKDLNQSLEEERRILDDIKL 538

Query: 513  XXXXXTEHLTIQIAEYEKELSPWNEQSQQLKKEIKITESELSIIEENRKGLENDIAGLEN 572
                 T+ ++ +I ++EK+L PW+ Q Q+ K +I++ ESELS++EE +  L+ +   LE 
Sbjct: 539  SLKDKTKDISAEIIQHEKDLEPWDLQLQEKKSQIQLAESELSLLEETQVKLKKNAEALEE 598

Query: 573  AILSQKRDLEVQEQEIKSLLEQKTK----VIQERELGERECKNAQATLANVREKVEALRQ 628
             I ++K     ++QE++  +    K    +I  R  GE++   A   L  ++  + A RQ
Sbjct: 599  NIAAKK----ARKQELQGFILDLKKNLKSLIDGRSQGEKDFSTAHLKLKEMQTILNAHRQ 654

Query: 629  KAIEIRSTYSATENNNKVLSALLRLQKSGRLNGFHGRLGDLAVIDPKYDVAISTACPRLN 688
            +A+E RS+ S  EN +KVL+AL RLQKSGR+NGFHGRLGDL VID  +DVAISTACPRL+
Sbjct: 655  RAMEARSSLSKAENKSKVLTALSRLQKSGRINGFHGRLGDLGVIDDNFDVAISTACPRLD 714

Query: 689  DLVVDTVESGQQCIEYLRKNKLGYARFILLDKLNTFNTNRIDTPDQSQRLFDLITVKEKR 748
            D+VVDTVE  Q CI+YLRKNKLGYARFILLD+L  FN   +DTP+   RLFDL+  K+ +
Sbjct: 715  DVVVDTVECAQHCIDYLRKNKLGYARFILLDRLRQFNLQPVDTPENVPRLFDLVKPKDPK 774

Query: 749  FNNAFYSVLRDTLVCQNMEQANRVAYGKKRYRVVTLDGNLIDLSGTMTGGGRNVXXXXXX 808
            F+NAFYSVLRDTLV ++++QAN VAYGK+R+RVVT+DG LID+SGTM+GGG +V      
Sbjct: 775  FSNAFYSVLRDTLVARDLKQANNVAYGKRRFRVVTIDGKLIDISGTMSGGGNHVVKGLMR 834

Query: 809  XXXXXXXXXAFFSPEEVQAIENELNQKENQYKSALDAYHXXXXXXXXXXXXAPEIDNLVS 868
                       ++PEEV  IENEL+++E  ++ A D  H             P++++ + 
Sbjct: 835  IGKNQSDRMDDYTPEEVNKIENELSEREKNFRVANDTVHEMEQELKKVRDQEPDMESQIL 894

Query: 869  KKEMDIETAHNDINSNINVLEE--KRKKLESMKNQNDPSITXXXXX--XXXXXXXDDIDV 924
            + EM+ ++    + S + + EE  K  K+   K+ ND +                DD+  
Sbjct: 895  RAEMEADS----LASELALAEEQVKEAKMAYDKSVNDTAQLNKIMKILEHLRGEYDDLQA 950

Query: 925  QXXXXXXXXXXXXXXXXELGGDELKNQSLLVTDITNKISENSRRXXXXXXXXXXXXXXXX 984
            +                ++GG  L+ Q+       +K+   S+R                
Sbjct: 951  ETKTKKERIKALQDQIMKIGGTNLQIQN-------SKVESLSQRIDILVAKLKKVKSGIK 1003

Query: 985  XXXXXXTEANEELTNFSKNAENADIESKEIESKLLDIK----------ESIENLKENEVK 1034
                  T+  ++L N  ++ E +  E K IE K   IK            I NLK +   
Sbjct: 1004 KSVGDVTKFQKQLKNVERDIELSSNELKVIEEKSEQIKLDLIKNDTDVTGILNLKSD--- 1060

Query: 1035 LEHEIEMKHNELESHQKVVSDYKSISLEYNNKLEKLEASEASLKKSIKRYNDLLSELTIR 1094
            LE + E    ++   +  + ++KS+ +E  NKLEKL +    +K  IK+    L+EL+IR
Sbjct: 1061 LEEQSEQLKEKVAEMEGKIDEFKSLEMEMKNKLEKLNSLLTYIKSDIKQQEKELNELSIR 1120

Query: 1095 DVTQVLNTIMTEENASVDKSDPKLENTSAVINADDDGISAVSENQSFNHNDENDDIDSNK 1154
            DVT   +T++  +N  +D  D + E+     N +D    A  E Q     +E D+ D + 
Sbjct: 1121 DVT---HTLLILDNNQMDILDKEGEDRQET-NQEDISGEAKGETQG----EEGDNDDRHC 1172

Query: 1155 MEIDSQGGFINPGIPVLSASELAKVDPQEVELLITSLDDFITSSEANVDVLEEYALRFVE 1214
            M ID     ++ GIP LS  EL +++ + +E  I  L  +I ++  ++ VLEEYA R  E
Sbjct: 1173 MNIDETSDEVSRGIPRLSEDELKELNIELLEGDIGELTCYIDATNVDIGVLEEYARRLAE 1232

Query: 1215 FNKRKNDLNSAVQSRDSVKDRLEGIKRKRYDEFMEGFKIISMTLKEMYQMITLGGNAELE 1274
            F +RK DLN AVQ RD VK++LE +K+KR+DEFM GF IISMTLKEMYQMIT+GGNAELE
Sbjct: 1233 FKRRKLDLNQAVQKRDEVKEQLEILKKKRFDEFMTGFNIISMTLKEMYQMITMGGNAELE 1292

Query: 1275 LVDSLDPFSEGVTFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEID 1334
            LVDSLDPFSEGVTFSVMPPKKSWRNI+NLSGGEKTLSSLALVFALHKYKPTPLYVMDEID
Sbjct: 1293 LVDSLDPFSEGVTFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEID 1352

Query: 1335 AALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELTKQLVGIYKHENMTKSAALVNEDL 1394
            AALDFRNVSIVANYIKERTKNAQFIVISLRNNMFEL +QLVG+YK +N TKS  + N D+
Sbjct: 1353 AALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQLVGVYKRDNRTKSTTVKNIDI 1412

Query: 1395 VGR 1397
            + R
Sbjct: 1413 LNR 1415

>Smik_12.145 Chr12 (282081..286337) [4257 bp, 1418 aa] {ON} YLR086W
            (REAL)
          Length = 1418

 Score = 1159 bits (2997), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 658/1440 (45%), Positives = 904/1440 (62%), Gaps = 64/1440 (4%)

Query: 1    MSDRPVSKRQK----------VTEEDEEEDVIHTPKAVTFEQSP------------RAIT 38
            M D P+SKRQK          + + D  +++    +A   E++P            ++ T
Sbjct: 1    MCDSPLSKRQKRKAVEEPELSLDDSDATQELQAEKQADRSEKTPDPNSPALETSYAKSHT 60

Query: 39   PRNLLGS--ENRNVL--PT-GGSQNLQIPSLLPPESLGSARGRDFKSYXXXXXXXXXXXX 93
            PR L+ S  ENR     PT   + +L +P+L PP +  S+RGRD+K+Y            
Sbjct: 61   PRKLVLSSGENRYAFSQPTNSATTSLHVPNLQPPGT--SSRGRDYKAYSQSPPRSPGRSP 118

Query: 94   XXXLKLIELSPIKNSRAELQKLYESKKLDVKKE-RLFIHQLVLNDFKSYAGRQVIGPFHT 152
               L+L++LSP+KNSR ELQKLY S +   K++ RLFI++LVL +FKSYAGRQV+GPFHT
Sbjct: 119  TRRLELLQLSPVKNSRVELQKLYNSHQSSTKQQGRLFINELVLENFKSYAGRQVVGPFHT 178

Query: 153  SFSAIVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSETFPDLKSCSVEVHFKY 212
            SFSA+VGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSE FP+L+SCSV VHF+Y
Sbjct: 179  SFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSEAFPNLQSCSVAVHFEY 238

Query: 213  VIDKDDGSTTIDETKGNLVVTRKAFKNNASKYFVNGKESNYTEVTTLLKKEGIDLDHKRF 272
            VID+  G++ IDE K  LV+TRKAFKNN+SKY++NGKES+YTEVT LLK EGIDLDHKRF
Sbjct: 239  VIDESSGTSRIDEEKPGLVITRKAFKNNSSKYYINGKESSYTEVTKLLKNEGIDLDHKRF 298

Query: 273  LILQGEVENIAQMKAKAEKENDDGLLEYLEDIIGTSKYKESIEKLSMEIESLNEICVEKE 332
            LILQGEVENIAQMK KAEKE+DDGLLEYLEDIIGT+ YK  IE+   +IE+LNE+C+EKE
Sbjct: 299  LILQGEVENIAQMKPKAEKESDDGLLEYLEDIIGTANYKPLIEEQMNQIEALNEVCLEKE 358

Query: 333  NRFSIVEREKNSLESGKEEALQFXXXXXXXXXXXXXXYQYNLMQXXXXXXXXXXXXTNVQ 392
            NRF IV+REKNSLESGKE AL+F              +Q+ ++Q            +++ 
Sbjct: 359  NRFEIVDREKNSLESGKETALEFLAKEKQLTLLKSKLFQFKVLQSNSKLASTLEKISSLN 418

Query: 393  QEQTKQEDEFRKANSHISDITASLNVLKADLEKVHTEEVNLSKTKRTLENKKVENEQIVN 452
            ++   ++ +F+++   + ++      +K  +    + E +L   +R LE  +V  E+   
Sbjct: 419  KDFETEKVKFQESLKKVEEVKTQRKEIKDRISSNDSREKDLVLERRELEGTRVSLEERTK 478

Query: 453  NLDSKRKEFEEQSKILQDKINSTDQEIQTIIEEQSSLAEGTTVLSTNXXXXXXXXXXXXX 512
            NL +K ++ E  SK  +  I+  +  ++ +  +Q+        L+               
Sbjct: 479  NLANKIEKSERTSKCTKRSISEAEHTLKELHTQQTEHESEIKDLNQLLEEERSVLDEIKL 538

Query: 513  XXXXXTEHLTIQIAEYEKELSPWNEQSQQLKKEIKITESELSIIEENRKGLENDIAGLEN 572
                 T+ ++ +I ++EKEL PW+ Q Q+ + +I++ ESELS++EE +  L+ ++  +E 
Sbjct: 539  SLKDKTKDISTEIIQHEKELEPWDLQLQEKESQIQLAESELSLLEETQSKLKKNVETMEE 598

Query: 573  AILSQKRDLEVQEQEIKSL---LEQKTKVIQ-ERELGERECKNAQATLANVREKVEALRQ 628
             IL++K      +QE++ L   L++K   ++ ER  GE    +A   L  +++ +   RQ
Sbjct: 599  KILARK----AHKQELQDLILNLKKKLSSLRDERSQGEENFSSAHLKLEEMQKVLNTHRQ 654

Query: 629  KAIEIRSTYSATENNNKVLSALLRLQKSGRLNGFHGRLGDLAVIDPKYDVAISTACPRLN 688
            +A+E RS+ S  +N +KVL+AL +LQKSGR+NGFHGRLGDL +ID  +DVAISTACPRL+
Sbjct: 655  RAMEARSSLSEAQNKSKVLTALSKLQKSGRINGFHGRLGDLGIIDNSFDVAISTACPRLD 714

Query: 689  DLVVDTVESGQQCIEYLRKNKLGYARFILLDKLNTFNTNRIDTPDQSQRLFDLITVKEKR 748
            D+VVDTVE  QQCI+YLRKNKLGYARFILLD+L  FN   I TP+   RLFDL+  K+ +
Sbjct: 715  DVVVDTVECAQQCIDYLRKNKLGYARFILLDRLRQFNLQPISTPENVPRLFDLVKPKDPK 774

Query: 749  FNNAFYSVLRDTLVCQNMEQANRVAYGKKRYRVVTLDGNLIDLSGTMTGGGRNVXXXXXX 808
            F+NAFYSVLRDTLV ++++QAN VAYG+KR+RVVT+DG LID+SGT++GGG +V      
Sbjct: 775  FSNAFYSVLRDTLVARSLKQANNVAYGRKRFRVVTIDGKLIDISGTISGGGNHVSKGLMR 834

Query: 809  XXXXXXXXXAFFSPEEVQAIENELNQKENQYKSALDAYHXXXXXXXXXXXXAPEIDNLVS 868
                       ++PEEV  IE+EL+++EN ++ A D  H             P I++ +S
Sbjct: 835  LGTNQSNKIDDYTPEEVNKIEHELSERENNFRVANDTVHEMEAELKNLRDQEPAIESKIS 894

Query: 869  KKEMDIETAHNDINSNINVLEEKRKKLESMKNQNDPSITXXXXXXXXXXXXDDIDVQXXX 928
            K EM+ ++  +++      ++E R    +  +                   DD+  +   
Sbjct: 895  KTEMEADSITSELTLAEQQVKEARIAYHNALSDKAQVNMIMKNLERLKGEHDDLQSETKT 954

Query: 929  XXXXXXXXXXXXXELGGDELKNQSLLVTDITNKISENSRRXXXXXXXXXXXXXXXXXXXX 988
                         ++GG +L+ Q+       +K+    +R                    
Sbjct: 955  KKEKIKVLQGEIMKIGGTKLQMQN-------SKVGSLCQRLDILVAKLKKVKSGIKKSEG 1007

Query: 989  XXTEANEELTNFSKNAENADIESKEIESKLLDIKESIENLKENEVKLEHEIEMKHNELES 1048
               +  ++L N  ++ E +  E K IE KL   K +  +L EN++K+     ++    E 
Sbjct: 1008 DVLKFQKQLKNSERDVELSSNELKAIEEKL---KHTKLDLSENDIKMTETFNLRSELKEE 1064

Query: 1049 HQKV----------VSDYKSISLEYNNKLEKLEASEASLKKSIKRYNDLLSELTIRDVTQ 1098
             +++          + ++KS+ +E  NKLEKL +    +KK I +    LSEL+IRDVT 
Sbjct: 1065 SEQLKEMVAETEENIDEFKSLEIEMKNKLEKLNSLLMHIKKEINQQEKGLSELSIRDVTH 1124

Query: 1099 VLNTIMTEENASVDKSDPKLENTSAVINADDDGISAVSENQSFNHNDENDDIDSNKMEID 1158
             L  I+      + K+D K+E   AV+    +  S+ ++++     +E    D + M+ID
Sbjct: 1125 TLE-ILDNNTMDIVKTDNKIEQ--AVVK---EKRSSETQDEKNIQEEERTCDDHHSMDID 1178

Query: 1159 SQGGFINPGIPVLSASELAKVDPQEVELLITSLDDFITSSEANVDVLEEYALRFVEFNKR 1218
                 +  GIP  S  EL ++D + +E  I+ L  +I  +  ++ VLEEYA R  EF +R
Sbjct: 1179 ETSNEVIRGIPRFSEEELKELDIELLEKEISELSYYIDETNVDIGVLEEYARRLAEFKRR 1238

Query: 1219 KNDLNSAVQSRDSVKDRLEGIKRKRYDEFMEGFKIISMTLKEMYQMITLGGNAELELVDS 1278
            K DLN AVQ RD VK ++E +K+KR+DEFM GF IISMTLKEMYQMIT+GGNAELELVDS
Sbjct: 1239 KLDLNQAVQKRDEVKGQVEVLKKKRFDEFMTGFNIISMTLKEMYQMITMGGNAELELVDS 1298

Query: 1279 LDPFSEGVTFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALD 1338
            LDPFSEGVTFSVMPPKKSWRNI+NLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALD
Sbjct: 1299 LDPFSEGVTFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALD 1358

Query: 1339 FRNVSIVANYIKERTKNAQFIVISLRNNMFELTKQLVGIYKHENMTKSAALVNEDLVGRA 1398
            FRNVSIVANYIKERTKNAQFIVISLRNNMFEL +QLVGIYK +N T+S  + N D++ R 
Sbjct: 1359 FRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQLVGIYKRDNRTRSTTVKNIDILNRT 1418

>ZYRO0C01716g Chr3 complement(130331..134572) [4242 bp, 1413 aa] {ON}
            similar to uniprot|Q12267 Saccharomyces cerevisiae
            YLR086W SMC4 Subunit of the condensin complex which
            reorganizes chromosomes during cell division forms a
            stable complex with Smc2p that has ATP-hydrolyzing and
            DNA- binding activity and promotes knotting of circular
            DNA potential Cdc28p substrate
          Length = 1413

 Score = 1157 bits (2994), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 662/1371 (48%), Positives = 874/1371 (63%), Gaps = 20/1371 (1%)

Query: 36   AITPRNLL--GSENR--NVLPTGGSQNLQIPSLLPPESLGSARGRDFKSYXXXXXXXXXX 91
            A TPR L+    +NR  +   +  S +LQ+P L PP +  S+RGR  K+Y          
Sbjct: 49   AKTPRKLVVGNGDNRYAHSSQSISSSSLQVPPLQPPAT--SSRGRGSKTYSQSPPRSPGR 106

Query: 92   XXXXXLKLIELSPIKNSRAELQKLYESKKLDVKKERLFIHQLVLNDFKSYAGRQVIGPFH 151
                 L+LI++SP+KNSR ELQK+Y++++   +  RL I QL+L DFKSYAGRQV+GPF+
Sbjct: 107  SPTRKLELIQISPLKNSRLELQKIYDAQQNQARHTRLCIDQLILQDFKSYAGRQVVGPFN 166

Query: 152  TSFSAIVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSETFPDLKSCSVEVHFK 211
            TSFSA+VGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSE +P L SCSVEVHFK
Sbjct: 167  TSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSEEYPSLPSCSVEVHFK 226

Query: 212  YVIDKDDGSTTIDETKGNLVVTRKAFKNNASKYFVNGKESNYTEVTTLLKKEGIDLDHKR 271
            YVID+  G T IDE K NLVVTRKAF+NN SKY+VN +E+NY EVT LLKKEG+DLDHKR
Sbjct: 227  YVIDEPSGETRIDEEKPNLVVTRKAFRNNTSKYYVNDQETNYGEVTKLLKKEGVDLDHKR 286

Query: 272  FLILQGEVENIAQMKAKAEKENDDGLLEYLEDIIGTSKYKESIEKLSMEIESLNEICVEK 331
            FLILQGEVENIAQMK+KAE+E +DGLLEYLEDIIGT+KYK  IEK   ++ESLN+IC+EK
Sbjct: 287  FLILQGEVENIAQMKSKAEREGEDGLLEYLEDIIGTAKYKPLIEKNLADMESLNDICIEK 346

Query: 332  ENRFSIVEREKNSLESGKEEALQFXXXXXXXXXXXXXXYQYNLMQXXXXXXXXXXXXTNV 391
            ENRF IV+REKNSLE+GKEEAL F              YQY+++             TN+
Sbjct: 347  ENRFQIVDREKNSLENGKEEALLFLENERKLTVSKSKLYQYHILNSNMKLKNTLDKITNL 406

Query: 392  QQEQTKQEDEFRKANSHISDITASLNVLKADLEKVHTEEVNLSKTKRTLENKKVENEQIV 451
             Q+  K+ D+       +  + A  + L++ L+  + EE  L   KR L+ K V NE+ +
Sbjct: 407  NQKLEKESDKNASVKKELDKLRAFGDELESKLKNCNNEEKQLLGKKRELDGKNVLNEEKI 466

Query: 452  NNLDSKRKEFEEQSKILQDKINSTDQEIQTIIEEQSSLAEGTTVLSTNXXXXXXXXXXXX 511
             N + KR + E+    +   I+S++  +  + + Q         L+              
Sbjct: 467  KNFEKKRDKAEKTLSSMDRSISSSEARLSELKQLQVDYENSLKELNEQTEVEKMKLEKIK 526

Query: 512  XXXXXXTEHLTIQIAEYEKELSPWNEQSQQLKKEIKITESELSIIEENRKGLENDIAGLE 571
                  T  ++++IA+ EKEL PWN Q Q+ K +I++ ES++S+I+E    L  +I   +
Sbjct: 527  FSLKDKTNGISLEIAQLEKELEPWNAQLQEKKTQIQLAESQISLIKEAEAKLAQEIDQFK 586

Query: 572  NAILSQKRDLEVQEQEIKSLLEQKTKVIQERELGERECKNAQATLANVREKVEALRQKAI 631
              I ++K+ +    +E+ SL  Q   V +E   GE+EC NA+  L  ++  +   RQKA+
Sbjct: 587  QEIETRKQQILQGSKELDSLHSQHKSVKEEISTGEKECLNARIRLKEMQNILNTQRQKAL 646

Query: 632  EIRSTYSATENNNKVLSALLRLQKSGRLNGFHGRLGDLAVIDPKYDVAISTACPRLNDLV 691
            + RS  S  EN +KVL+AL RLQKSGR++GFHGRLGDL VID KYDVAISTACPRL D+V
Sbjct: 647  DARSALSNAENKSKVLTALSRLQKSGRISGFHGRLGDLGVIDEKYDVAISTACPRLEDIV 706

Query: 692  VDTVESGQQCIEYLRKNKLGYARFILLDKLNTFNTNRIDTPDQSQRLFDLITVKEKRFNN 751
            V+TVE GQQCIEYLRKNKLGYARFILLDKL  FN + I+TP+   RLFDLI  K+ +F++
Sbjct: 707  VETVECGQQCIEYLRKNKLGYARFILLDKLRKFNLDSINTPESVPRLFDLIHPKDPKFSS 766

Query: 752  AFYSVLRDTLVCQNMEQANRVAYGKKRYRVVTLDGNLIDLSGTMTGGGRNVXXXXXXXXX 811
            AF+SVL +TLV  +++QANRVAYGKKR+RVVTLDGNLID+SGTM+GGG  V         
Sbjct: 767  AFFSVLGNTLVANDLKQANRVAYGKKRFRVVTLDGNLIDISGTMSGGGSRVSRGLMQINR 826

Query: 812  XXXXXXAFFSPEEVQAIENELNQKENQYKSALDAYHXXXXXXXXXXXXAPEIDNLVSKKE 871
                    +S EEV  +E  L ++E  ++ A D  +             P I+N +S+  
Sbjct: 827  NKTEDIEIYSSEEVAQLEVNLVEREKNFQVASDTIYQMEEQLKDLKEKEPAIENNISQLT 886

Query: 872  MDIETAHNDIN-SNINVLEEKRKKLESMKNQNDPSITXXXXXXXXXXXXDD---IDVQXX 927
            M+IE+ +++I    I +LE +R    +     D ++             D+   I  Q  
Sbjct: 887  MEIESWNSEIKIKEIQMLESER----AYSATQDNNVELRETIQHVQSLKDEFKSIQNQTK 942

Query: 928  XXXXXXXXXXXXXXELGGDELKNQSLLVTDITNKISENSRRXXXXXXXXXXXXXXXXXXX 987
                          E+GG ELK QS  V  +  +I     +                   
Sbjct: 943  SKKHRIETLKNEIMEIGGAELKIQSSKVDSVIQRIDIVVSKQKKERSVIKKTENEINKSH 1002

Query: 988  XXXTEANEELTNFSKNAENADIESKEIESKLLDIKESIENLKENEVKLEHEIEMKHNELE 1047
                E + +L NF++  +      + ++  L  + ES+ +++  +  L  E     ++L 
Sbjct: 1003 KMKLETSRDLENFNQEIQTLKTTIEGLQDSLNKVHESVTSVQHTKEGLIEESRTLEDKLN 1062

Query: 1048 SHQKVVSDYKSISLEYNNKLEKLEASEASLKKSIKRYNDLLSELTIRDVTQVLNTIMTEE 1107
               + ++ +KS  +E  N+LEKL +    LKK IK Y + L +L IRDVTQ+L+ +  E 
Sbjct: 1063 DINEDIAIFKSFEMEMKNELEKLNSLSFHLKKEIKHYEEKLGDLKIRDVTQILHDLKDES 1122

Query: 1108 NASVDKSDPKLENTSAVINADDDGISAVSENQSFNHNDENDDIDS---NKMEIDSQGGFI 1164
            N   + SDP     S V  ++        EN+  +  D+  D +    N+M+++  G + 
Sbjct: 1123 N---NASDPSENPVSDVEESESSVGEGKDENKDLDAQDQVQDAEKQGDNQMDVEDGGEYS 1179

Query: 1165 NPGIPVLSASELAKVDPQEVELLITSLDDFITSSEANVDVLEEYALRFVEFNKRKNDLNS 1224
            + G+   S  EL +++ +E+E  I  L +F+ +S A++DVLEEYA R +EF  R+ DLN 
Sbjct: 1180 DRGLTQFSEDELHEIEIEELEKEIEDLQNFLDASNADIDVLEEYARRLIEFKSRRLDLNQ 1239

Query: 1225 AVQSRDSVKDRLEGIKRKRYDEFMEGFKIISMTLKEMYQMITLGGNAELELVDSLDPFSE 1284
            AV+ R+ VK++L+ +K+KR+DEFM+GF IISMTLKEMYQMIT+GGNAELELVD+LDPFSE
Sbjct: 1240 AVEERNKVKEKLDELKKKRFDEFMQGFGIISMTLKEMYQMITMGGNAELELVDTLDPFSE 1299

Query: 1285 GVTFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSI 1344
            GVTFSVMPPKKSWRNI+NLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSI
Sbjct: 1300 GVTFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSI 1359

Query: 1345 VANYIKERTKNAQFIVISLRNNMFELTKQLVGIYKHENMTKSAALVNEDLV 1395
            VANYIKERTKNAQFIVISLRNNMFEL +QLVGIYK +N TKSA + N D V
Sbjct: 1360 VANYIKERTKNAQFIVISLRNNMFELAQQLVGIYKRDNKTKSATIKNIDFV 1410

>NCAS0B05000 Chr2 (917841..922070) [4230 bp, 1409 aa] {ON} Anc_8.259
            YLR086W
          Length = 1409

 Score = 1154 bits (2984), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 663/1414 (46%), Positives = 888/1414 (62%), Gaps = 38/1414 (2%)

Query: 5    PVSKRQKVTE----------EDEEEDV-IHTP-------KAVTFEQSPRAITPRNLLGSE 46
            P +KRQKVTE          ED++ +  + +P       ++++   + ++ TPR L+  +
Sbjct: 4    PNTKRQKVTEPESKTPEQGTEDQQANASLRSPLQRPEHQQSISPINNSKSHTPRKLILGQ 63

Query: 47   NRNVLPTGGSQNLQIP----SLLPPESLGSARGR-DFKSYXXXXXXXXXXXXXXXLKLIE 101
            N N                 +L PP+S  S+RGR D KSY               L+LI+
Sbjct: 64   NDNRYAFSQPSVSSSSFQVPTLQPPDS-SSSRGRKDIKSYSQSPPRSPGRSPKRRLELIQ 122

Query: 102  LSPIKNSRAELQKLYESKKLDVKKERLFIHQLVLNDFKSYAGRQVIGPFHTSFSAIVGPN 161
            LSP+KN+R +L++LY++     KKERLFI++L LN+FKSYAG+QV+GPFHTSFSA+VGPN
Sbjct: 123  LSPVKNNRIKLRELYDAHNSQSKKERLFINKLTLNNFKSYAGQQVVGPFHTSFSAVVGPN 182

Query: 162  GSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSETFPDLKSCSVEVHFKYVIDKDDGST 221
            GSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSE FPDL SCSV+V F Y ID+ DG T
Sbjct: 183  GSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSEKFPDLTSCSVDVEFLYAIDEHDGDT 242

Query: 222  TIDETKGNLVVTRKAFKNNASKYFVNGKESNYTEVTTLLKKEGIDLDHKRFLILQGEVEN 281
             I ETK  LV++RKAFKNN+SKY++NGKESNYT+VT LLK+EGIDLDHKRFLILQGEVEN
Sbjct: 243  KISETKPKLVISRKAFKNNSSKYYINGKESNYTDVTKLLKEEGIDLDHKRFLILQGEVEN 302

Query: 282  IAQMKAKAEKENDDGLLEYLEDIIGTSKYKESIEKLSMEIESLNEICVEKENRFSIVERE 341
            IAQMK KAEKE+DDGLLEYLEDIIGTSKYK+ IEK  +EIESLNEIC+EKENRF IV+RE
Sbjct: 303  IAQMKPKAEKESDDGLLEYLEDIIGTSKYKQLIEKDLIEIESLNEICIEKENRFEIVDRE 362

Query: 342  KNSLESGKEEALQFXXXXXXXXXXXXXXYQYNLMQXXXXXXXXXXXXTNVQQEQTKQEDE 401
            KNSLESGK  AL+F               QYNL Q            + + +E   ++ +
Sbjct: 363  KNSLESGKNLALEFLEKEKQLTLSKSKLLQYNLWQNNSKLTNTLQKISALNEEYNVEKSK 422

Query: 402  FRKANSHISDITASLNVLKADLEKVHTEEVNLSKTKRTLENKKVENEQIVNNLDSKRKEF 461
             +   + I+     LN  ++ ++ +  EE    K+KR LE + V  ++ + NL  K+ + 
Sbjct: 423  NQTLQNEINRTKQLLNESQSKIKVLEGEEKQQLKSKRILEGEHVSLDEKLKNLTQKKAKT 482

Query: 462  EEQSKILQDKINSTDQEIQTIIEEQSSLAEGTTVLSTNXXXXXXXXXXXXXXXXXXTEHL 521
            E+     +  I+S   EIQ + + Q   ++    L+                    T  +
Sbjct: 483  EKIIATTEKTISSLTSEIQELEKSQKEYSDELETLNQQLQSERESLEAMKLKLKEKTSGI 542

Query: 522  TIQIAEYEKELSPWNEQSQQLKKEIKITESELSIIEENRKGLENDIAGLENAILSQKRDL 581
            + +I  +E +L PWN + Q+ K EI++ ES++S+++E +  L+NDI  L   + +Q    
Sbjct: 543  SEEILIHEHDLEPWNIKVQEKKTEIQLVESQISLLQEGQVKLKNDIKVLSQEVSNQTALK 602

Query: 582  EVQEQEIKSLLEQKTKVIQERELGERECKNAQATLANVREKVEALRQKAIEIRSTYSATE 641
              +E+++ +L +Q++ + +E   GE EC + ++ L  ++  +   RQ+A E R   +  +
Sbjct: 603  IKREEDLVNLKKQQSSITKEISNGETECNDGRSKLKEMKNVLNMQRQRASEARLALANVQ 662

Query: 642  NNNKVLSALLRLQKSGRLNGFHGRLGDLAVIDPKYDVAISTACPRLNDLVVDTVESGQQC 701
            N  KVL+AL +LQKSGR+ GFHGRLGDL  ID  YDVA+STACPRL+D+VV+TVE GQQC
Sbjct: 663  NRGKVLTALYKLQKSGRIVGFHGRLGDLGTIDNTYDVAVSTACPRLDDIVVETVECGQQC 722

Query: 702  IEYLRKNKLGYARFILLDKLNTFNTNRIDTPDQSQRLFDLITVKEKRFNNAFYSVLRDTL 761
            IEYLRKNKLGYARFILLDKL +FNTN I TP    RLFDLI  K+ +F  AFYSVLRDTL
Sbjct: 723  IEYLRKNKLGYARFILLDKLRSFNTNTIQTPKNVPRLFDLIKPKDSKFVPAFYSVLRDTL 782

Query: 762  VCQNMEQANRVAYGKKRYRVVTLDGNLIDLSGTMTGGGRNVXXXXXXXXXXXXXXXAFFS 821
            V ++++QANRVAYG++RYRVVTLDG LID+SGTM+GGG +V                 ++
Sbjct: 783  VAKDLKQANRVAYGQRRYRVVTLDGKLIDVSGTMSGGGNHVSKGLMMLQRKGQNYFDDYN 842

Query: 822  PEEVQAIENELNQKENQYKSALDAYHXXXXXXXXXXXXAPEIDNLVSKKEMDIETAHNDI 881
            PE+V+ IE +L+ KE  ++ A +A++             PEI+  +SK  M+I+T   +I
Sbjct: 843  PEDVEQIEKDLSDKEKNFELANNAFYEMENELQKLNNRKPEIELEISKIIMEIDTYSAEI 902

Query: 882  NSNINVLEEKRKKLESMKNQNDPSITXXXXXXXXXXXXDDIDVQXXXXXXXXXXXXXXXX 941
             S    L+EK     S    N+                  +  +                
Sbjct: 903  KSKERQLQEKTNIDNSELQDNEELKVAIENLQKLKEEHLALQDKTKAKKKKIASLKEKIM 962

Query: 942  ELGGDELKNQSLLVTDITNKISENSRRXXXXXXXXXXXXXXXXXXXXXXTEANEELTNFS 1001
            ++GG EL+ Q+  VT I  +I   + +                        +  ++T  +
Sbjct: 963  KIGGIELQVQNSKVTSIVQRIDILTAKQKKDRTSKKKSDTELEKAKKTLLTSKNDITLIT 1022

Query: 1002 KNAENADIESKEIESKLLDIKESIENLKENEVKLEHEIEMKHNELESHQKVVSDYKSISL 1061
             + +       +I S L +I +SIE  + ++  L+ E +   +++   ++ ++++KS  +
Sbjct: 1023 DDIKEISERIDKISSSLNNIDKSIEEFQAHKETLKDECDELKDKVVDLEENINEFKSFEI 1082

Query: 1062 EYNNKLEKLEASEASLKKSIKRYNDLLSELTIRDVTQVLNTIMTEENASVDKSDPKLENT 1121
            E NNKLEKL      +K  IK   D LS+LT+R + QVL  +  E       S+ K  N 
Sbjct: 1083 EVNNKLEKLNGLLNHIKNQIKTLEDSLSKLTLRKMHQVLMALDEE-------SEAKAPNN 1135

Query: 1122 SAVINADDDGISAVSENQSFNHNDENDDIDSNKMEIDSQGGFINPGIPVLSASELAKVDP 1181
              +    D+ I   + ++  N   ++DD     M+ID+    I+ G+P+LS  EL+ +D 
Sbjct: 1136 GTL---SDEQIHDQTGHELTNTAVQDDD----SMDIDNGAEVISNGLPILSDDELSALDI 1188

Query: 1182 QEVELLITSLDDFITSSEANVDVLEEYALRFVEFNKRKNDLNSAVQSRDSVKDRLEGIKR 1241
              VE  ++ L+ +I S++AN++VLEEY  R  EF  RK DLN AV  R++V+ +LE +K+
Sbjct: 1189 TLVETEVSDLEKYIESTDANIEVLEEYVKRLTEFKTRKLDLNDAVDKRETVRKQLEELKK 1248

Query: 1242 KRYDEFMEGFKIISMTLKEMYQMITLGGNAELELVDSLDPFSEGVTFSVMPPKKSWRNIS 1301
             RY+EFM GF IISMTLKEMYQMIT+GGNAELELVDSLDPFSEGVTFSVMPPKKSWRNIS
Sbjct: 1249 TRYEEFMHGFGIISMTLKEMYQMITMGGNAELELVDSLDPFSEGVTFSVMPPKKSWRNIS 1308

Query: 1302 NLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVI 1361
            NLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVI
Sbjct: 1309 NLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVI 1368

Query: 1362 SLRNNMFELTKQLVGIYKHENMTKSAALVNEDLV 1395
            SLRNNMFEL +QLVGIYK EN T SA + N +++
Sbjct: 1369 SLRNNMFELAQQLVGIYKCENRTHSATIKNREIL 1402

>TDEL0F03860 Chr6 (709579..713778) [4200 bp, 1399 aa] {ON} Anc_8.259
            YLR086W
          Length = 1399

 Score = 1150 bits (2976), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 650/1413 (46%), Positives = 877/1413 (62%), Gaps = 31/1413 (2%)

Query: 1    MSDRPVSKRQKVT--EEDEEEDVIHTPKAVTFEQSPRAI--TPRNLLGSENRNVL----P 52
            M D P++KRQ+V   E  E E V  + K+     S   I  TP+ L+   N +      P
Sbjct: 1    MPDTPLTKRQRVNDNESREFEAVNGSTKSPLTSNSNSTISHTPKKLVIGTNDDTTSQSQP 60

Query: 53   TGGSQNLQIPSLLPPESLGSARGRDFKSYXXXXXXXXXXXXXXXLKLIELSPIKNSRAEL 112
               S +LQ PSL  P S  S+RGR+ ++Y               L+LI++SP+K +R EL
Sbjct: 61   IVSSSSLQAPSLQHPNS--SSRGREQRTYSQSPPRSPGRSPTRKLELIKISPVKKNRLEL 118

Query: 113  QKLYESKKLDVKKERLFIHQLVLNDFKSYAGRQVIGPFHTSFSAIVGPNGSGKSNVIDSM 172
            Q+LY++++      RL I++LVL DFKSYAGRQV+GPFH+SFSA+VGPNGSGKSNVIDSM
Sbjct: 119  QRLYDAEQSQRNAARLCINKLVLQDFKSYAGRQVVGPFHSSFSAVVGPNGSGKSNVIDSM 178

Query: 173  LFVFGFRANKMRQDRLSDLIHKSETFPDLKSCSVEVHFKYVIDKDDGSTTIDETKGNLVV 232
            LFVFGFRANKMRQDRLSDLIH SE  P+LKSCSVEVHF+YV+D+ DG+T IDE K  LVV
Sbjct: 179  LFVFGFRANKMRQDRLSDLIHNSEVHPNLKSCSVEVHFQYVVDEPDGTTRIDEEKPTLVV 238

Query: 233  TRKAFKNNASKYFVNGKESNYTEVTTLLKKEGIDLDHKRFLILQGEVENIAQMKAKAEKE 292
            TRKAFKNN+SKY+VN KESNYTEVT LLKKEGIDLDHKRFLILQGEVENIAQM+ KAEKE
Sbjct: 239  TRKAFKNNSSKYYVNDKESNYTEVTQLLKKEGIDLDHKRFLILQGEVENIAQMRPKAEKE 298

Query: 293  NDDGLLEYLEDIIGTSKYKESIEKLSMEIESLNEICVEKENRFSIVEREKNSLESGKEEA 352
             +DGLLEYLEDI GT+KYK  IE +  EIE LNE C+EKENRF IV++EK+SLE+GK+EA
Sbjct: 299  GEDGLLEYLEDITGTAKYKPQIETILQEIEVLNESCIEKENRFHIVDQEKSSLETGKDEA 358

Query: 353  LQFXXXXXXXXXXXXXXYQYNLMQXXXXXXXXXXXXTNVQQEQTKQEDEFRKANSHISDI 412
            L+F               QY + Q            + ++ +  ++ +++ +    +  +
Sbjct: 359  LEFLEKEKTLTLLRSKMIQYKIWQNDIKLTSTLDKSSKLKGQLDQENEKYSETLKEVDSL 418

Query: 413  TASLNVLKADLEKVHTEEVNLSKTKRTLENKKVENEQIVNNLDSKRKEFEEQSKILQDKI 472
                  +   +E +  EE  L   KR L+ ++V  E+ + +++ K  + E+  K  Q  +
Sbjct: 419  KDESKQVAKRIETLAIEEKALLAQKRGLDQQRVAIEEKIKSVNQKTNKAEKLLKSNQHSL 478

Query: 473  NSTDQEIQTIIEEQSSLAEGTTVLSTNXXXXXXXXXXXXXXXXXXTEHLTIQIAEYEKEL 532
            N+T+  ++ + + Q    +    L+                    T +++  IA+YEK+L
Sbjct: 479  NATEANLRELRQSQLDYEKELQDLNQELITERAKLEDVKISLKEKTVNISAGIAQYEKDL 538

Query: 533  SPWNEQSQQLKKEIKITESELSIIEENRKGLENDIAGLENAILSQKRDLEVQEQEIKSLL 592
             PW+ Q QQ + EI++ ESELS++++    +  DI  L+N I     +   +E+ I+ L 
Sbjct: 539  EPWDGQLQQKRAEIQLAESELSLLKDTNARINKDIEQLKNEIARGGEEKLAKEKVIRELK 598

Query: 593  EQKTKVIQERELGERECKNAQATLANVREKVEALRQKAIEIRSTYSATENNNKVLSALLR 652
            ++++ V  E      EC +A A L  + E + A RQ+ ++ R+ +S+ +N + VL+AL +
Sbjct: 599  QEESDVTAEVHTAGAECSSASARLKKMHEILIAQRQRTLDARAAFSSAQNKSTVLTALTK 658

Query: 653  LQKSGRLNGFHGRLGDLAVIDPKYDVAISTACPRLNDLVVDTVESGQQCIEYLRKNKLGY 712
            LQKSGR++GFHGRLGDL VID KYDVAISTACPRL D+VV++VE GQQCIEYLRKNKLGY
Sbjct: 659  LQKSGRISGFHGRLGDLGVIDEKYDVAISTACPRLEDIVVESVECGQQCIEYLRKNKLGY 718

Query: 713  ARFILLDKLNTFNTNRIDTPDQSQRLFDLITVKEKRFNNAFYSVLRDTLVCQNMEQANRV 772
            ARFILLDKL  F+T +I TP+   RLFDL+  K+ +F  AFYSVLRDTL  Q++ QANRV
Sbjct: 719  ARFILLDKLRKFHTGKIQTPENVPRLFDLVKPKDDKFIPAFYSVLRDTLAAQSLAQANRV 778

Query: 773  AYGKKRYRVVTLDGNLIDLSGTMTGGGRNVXXXXXXXXXXXXXXXAFFSPEEVQAIENEL 832
            AYGKKR+RVV+LDG LID+SGTM+GGG +V                 FSPEEV  +ENEL
Sbjct: 779  AYGKKRFRVVSLDGKLIDISGTMSGGGSHVVRGLMRLSQNNSYSPDIFSPEEVAQLENEL 838

Query: 833  NQKENQYKSALDAYHXXXXXXXXXXXXAPEIDNLVSKKEMDIETAHNDINSNINVLEEKR 892
             +KE  ++ A D +              PEI   VSK  M+ E+  +++     +L E+ 
Sbjct: 839  TEKEKSFQIASDTFREMEDQLKKLKDRVPEIQLKVSKLVMETESWMSELKLKEKLLLERL 898

Query: 893  KKLESMKNQNDPSITXXXXXXXXXXXXDDIDVQXXXXXXXXXXXXXXXXELGGDELKNQS 952
            +  +    +N+                  +  Q                E+GG EL+ Q+
Sbjct: 899  EAQKKATGKNEEYQLAEARVKTLKDEQRALSDQTTTTRQKIAVLKDKIMEIGGSELQIQN 958

Query: 953  LLVTDITNKISENSRRXXXXXXXXXXXXXXXXXXXXXXTEANEELTNFSKN----AENAD 1008
              VT    ++   + +                          ++L  +S+      ENAD
Sbjct: 959  SKVTSTIQRMEILTSKQKKGKASIKKAENELKKSAKIVGNTQKDLDLYSQEIASLKENAD 1018

Query: 1009 IESKEIESKLLDIKESIENLKENEVKLEHEIEMKHNELESH----QKVVSDYKSISLEYN 1064
                 ++  L    ES+E   + +  L HE+  K ++L+      +   +++KS+ +E N
Sbjct: 1019 ----NVQQTL----ESVEKSVDEQQDLSHEMNEKLDQLKQRLAQMEAGFTEFKSLKIEIN 1070

Query: 1065 NKLEKLEASEASLKKSIKRYNDLLSELTIRDVTQVLNTIMTEENASVDKSDPKLENTSAV 1124
            +KLEKL A    + K +++    L+ L IRDVT+ L  +   E+ +  K   +L+     
Sbjct: 1071 DKLEKLNALLGHITKEVRQLESDLNNLKIRDVTRTLQLLDEGESTNNSKMPNELQEKRTE 1130

Query: 1125 INADDDGISAVSENQSFNHNDENDDIDSNKMEIDSQGGFINPGIPVLSASELAKVDPQEV 1184
              AD         + S      ND++    ME+D +   +  G+P +S +EL  +D +++
Sbjct: 1131 -GADATRQEGEESDVSMEEEKSNDEV----MEVDEKPHELENGLPRVSEAELKSLDVEDL 1185

Query: 1185 ELLITSLDDFITSSEANVDVLEEYALRFVEFNKRKNDLNSAVQSRDSVKDRLEGIKRKRY 1244
               I  L +++ S   +V++LEEYA R  E  +RK DLN AV  RD+++++L  +K++R+
Sbjct: 1186 GAQIEDLQNYVDSVNVDVEILEEYAKRLAEHKRRKVDLNEAVGERDAMREKLGELKKRRF 1245

Query: 1245 DEFMEGFKIISMTLKEMYQMITLGGNAELELVDSLDPFSEGVTFSVMPPKKSWRNISNLS 1304
            DEFM+GF IISMTLKEMYQMIT+GGNAELELVDSLDPFSEGVTFSVMPPKKSWRNI+NLS
Sbjct: 1246 DEFMQGFGIISMTLKEMYQMITMGGNAELELVDSLDPFSEGVTFSVMPPKKSWRNITNLS 1305

Query: 1305 GGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLR 1364
            GGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLR
Sbjct: 1306 GGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLR 1365

Query: 1365 NNMFELTKQLVGIYKHENMTKSAALVNEDLVGR 1397
            NNMFEL +QLVGIYK +NMTKSA+L N D++ R
Sbjct: 1366 NNMFELAQQLVGIYKTQNMTKSASLKNNDILNR 1398

>KAFR0B02710 Chr2 (545337..549587) [4251 bp, 1416 aa] {ON} Anc_8.259
            YLR086W
          Length = 1416

 Score = 1145 bits (2962), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 666/1420 (46%), Positives = 879/1420 (61%), Gaps = 31/1420 (2%)

Query: 1    MSDRPVSKRQKVTEEDE-------EEDVIHTPKAVTFEQSPRAITPRNLL--GSENRNVL 51
            MS  P+SK+QKV  ++E       E+D   T   VT     ++ TPR LL   ++N+ VL
Sbjct: 1    MSHTPLSKKQKVVSDEERITPNQNEQDNDKTHPEVTASSFLKSHTPRKLLLGSADNKYVL 60

Query: 52   P-------TGGSQNLQIPSLLPPESLGSARGRDFKSYXXXXXXXXXXXXXXXLKLIELSP 104
                    + GS +LQ+P+L PP S  S RGRD K+Y               L+LI+LSP
Sbjct: 61   SQPIISSSSHGSSSLQVPNLQPPLSQPS-RGRDKKAYSQSPPRSPGRSPVRKLELIQLSP 119

Query: 105  IKNSRAELQKLYESKKLDVKKERLFIHQLVLNDFKSYAGRQVIGPFHTSFSAIVGPNGSG 164
            IKN+R ELQKLY SK  +  K RL+I +LVL DFKSYAG Q++GPF+TSFSAIVGPNGSG
Sbjct: 120  IKNNRIELQKLYNSK--NQNKVRLYIDKLVLQDFKSYAGTQIVGPFNTSFSAIVGPNGSG 177

Query: 165  KSNVIDSMLFVFGFRANKMRQDRLSDLIHKSETFPDLKSCSVEVHFKYVIDKDDGSTTID 224
            KSNVIDSMLFVFGFRANKMRQDRL DLIHKSE FP+++SCSVEVHF+YVID++DG++ I 
Sbjct: 178  KSNVIDSMLFVFGFRANKMRQDRLGDLIHKSEAFPNIQSCSVEVHFQYVIDENDGTSKII 237

Query: 225  ETKGNLVVTRKAFKNNASKYFVNGKESNYTEVTTLLKKEGIDLDHKRFLILQGEVENIAQ 284
            E +  LVV RKAFKNN+SKY++NGKESNYTEVT LLK+EGIDLDHKRFLILQGEVENIAQ
Sbjct: 238  EDRKPLVVMRKAFKNNSSKYYINGKESNYTEVTRLLKEEGIDLDHKRFLILQGEVENIAQ 297

Query: 285  MKAKAEKENDDGLLEYLEDIIGTSKYKESIEKLSMEIESLNEICVEKENRFSIVEREKNS 344
            MKAKAEKE DDGLLEYLEDIIGTSKYK  IE   +EIE+LNEICVEKE RF IVE EKNS
Sbjct: 298  MKAKAEKEGDDGLLEYLEDIIGTSKYKTLIEDKMVEIEALNEICVEKEKRFEIVETEKNS 357

Query: 345  LESGKEEALQFXXXXXXXXXXXXXXYQYNLMQXXXXXXXXXXXXTNVQQEQTKQEDEFRK 404
            LES K+ AL+F               QY L Q            +N +    ++  ++ K
Sbjct: 358  LESDKDAALEFIAKEKQLTLLRSKLTQYKLYQTNTKLATTLDKISNFKNALQEERSKYEK 417

Query: 405  ANSHISDITASLNVLKADLEKVHTEEVNLSKTKRTLENKKVENEQIVNNLDSKRKEFEEQ 464
              S I   T  L      +     +E  L + KR  + + V  E+ + NL  K+ + E  
Sbjct: 418  IQSEIDQSTRELREANEKINASVAQERELVQKKREYDGQCVSMEERIKNLTQKKTKAE-- 475

Query: 465  SKILQDK---INSTDQEIQTIIEEQSSLAEGTTVLSTNXXXXXXXXXXXXXXXXXXTEHL 521
             K L DK   I   +  ++ + + Q +     + L                     T+ +
Sbjct: 476  -KTLHDKRIEIQKNESILKDLQDYQMNYDSEFSNLQKELDKERSKLDDIKLSLKDKTKDI 534

Query: 522  TIQIAEYEKELSPWNEQSQQLKKEIKITESELSIIEENRKGLENDIAGLENAILSQKRDL 581
            + QI+ YEK++ PW  + Q+ + +I++ ESE+S+++E++  L+  +  L+  I   ++++
Sbjct: 535  SSQISLYEKDIEPWVSKIQEKQVQIQLAESEISLLKESQAKLKEGLGSLKVEIDDVRKEI 594

Query: 582  EVQEQEIKSLLEQKTKVIQERELGERECKNAQATLANVREKVEALRQKAIEIRSTYSATE 641
            + +   I++L +++  + +E  LGE EC  A+     +R  + + RQ+AI+ RS     E
Sbjct: 595  DNKNSIIENLKKEQVSLKKEVSLGESECSRAKEKEKEMRVILNSHRQRAIDARSALHMAE 654

Query: 642  NNNKVLSALLRLQKSGRLNGFHGRLGDLAVIDPKYDVAISTACPRLNDLVVDTVESGQQC 701
            N + VLSAL RLQKSGR+NGFHGRLGDL VI  KYD+AISTAC RL+D+VVD+VE GQQC
Sbjct: 655  NKSTVLSALTRLQKSGRINGFHGRLGDLGVIADKYDIAISTACSRLDDIVVDSVECGQQC 714

Query: 702  IEYLRKNKLGYARFILLDKLNTFNTNRIDTPDQSQRLFDLITVKEKRFNNAFYSVLRDTL 761
            IEYLRKNKLGYARFILLDKL  F   ++ TP+   RLFDL+   + +F+NAFYSVLRDTL
Sbjct: 715  IEYLRKNKLGYARFILLDKLRNFQLGQLQTPENVLRLFDLVQPIDLKFSNAFYSVLRDTL 774

Query: 762  VCQNMEQANRVAYGKKRYRVVTLDGNLIDLSGTMTGGGRNVXXXXXXXXXXXXXXXAFFS 821
            V  ++ QANRVAYGK+RYRVVTLDG LID+SGTMTGGG +V                 + 
Sbjct: 775  VATDIRQANRVAYGKRRYRVVTLDGKLIDISGTMTGGGSHVSKGLMKLKNSNMEHLEVYE 834

Query: 822  PEEVQAIENELNQKENQYKSALDAYHXXXXXXXXXXXXAPEIDNLVSKKEMDIETAHNDI 881
              +V+ IE +L ++EN +K A D                PEI+  ++K  MD+++ ++ +
Sbjct: 835  AGDVEKIERDLAERENNFKIAHDTLQEMNNELKRLQDKEPEIELEIAKLLMDVDSLNDQL 894

Query: 882  NSNINVLEEKRKKLESMKNQNDPSITXXXXXXXXXXXXDDIDVQXXXXXXXXXXXXXXXX 941
            N     L+E  K    + N+ DP                 ++ Q                
Sbjct: 895  NLKEQQLKELEKNYTDVINKKDPLDRAEAFLQTLRNEHRALEDQSQSKKEKINTLKEEIM 954

Query: 942  ELGGDELKNQSLLVTDITNKISENSRRXXXXXXXXXXXXXXXXXXXXXXTEANEELTNFS 1001
            ++GG EL+ Q+  V+ +T +I   + +                       +A  + T   
Sbjct: 955  KIGGKELQIQNSKVSSLTERIGIVNAKHKKDKATIKRTEKELQKVQRLFKQAELDNTACV 1014

Query: 1002 KNAENADIESKEIESKLLDIKESIENLKENEVKLEHEIEMKHNELESHQKVVSDYKSISL 1061
             + E        I ++L + +   + +   +  L  + E    +++  ++ +++YKS  +
Sbjct: 1015 NDLETLQTNVIAIRTRLQETEAEFDIILNEKDDLTGQCESLKEKIKDMEESMNEYKSFEI 1074

Query: 1062 EYNNKLEKLEASEASLKKSIKRYNDLLSELTIRDVTQVLNTIMTE---ENASVDKSDPKL 1118
            E  NKLEKL +     KK I+  N  L    +RDVTQ L  I  E    +  V +S   L
Sbjct: 1075 EIKNKLEKLNSLLDYCKKDIRSLNQELQSYHVRDVTQSLEKIQNENANNSVGVKQSSNNL 1134

Query: 1119 E-NTSAVINAD--DDGISAVSENQSFNHNDENDDIDSNKMEIDSQGGFINPGIPVLSASE 1175
            + ++S   N D  DD IS    +    +  E  + D++ M++D+    ++ GIP L+  +
Sbjct: 1135 DVSSSHTPNVDKHDDEISMEDADNDSQNEIEEKEQDADIMDLDNVTEEVSKGIPKLTDDD 1194

Query: 1176 LAKVDPQEVELLITSLDDFITSSEANVDVLEEYALRFVEFNKRKNDLNSAVQSRDSVKDR 1235
            L  +D   +E  I  L D++ +S A++++LEEY  R  EF KRK DLN+ V  RD V+D 
Sbjct: 1195 LKSIDLDSLESEINQLQDYVENSNADIELLEEYIRRLEEFKKRKLDLNTTVARRDEVRDE 1254

Query: 1236 LEGIKRKRYDEFMEGFKIISMTLKEMYQMITLGGNAELELVDSLDPFSEGVTFSVMPPKK 1295
            LE +K+ R+DEFMEGF IIS+TLKEMYQMIT+GGNAELELVDSLDPFSEGVTFSVMPPKK
Sbjct: 1255 LEKLKKTRHDEFMEGFSIISLTLKEMYQMITMGGNAELELVDSLDPFSEGVTFSVMPPKK 1314

Query: 1296 SWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN 1355
            SWRNI+NLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN
Sbjct: 1315 SWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN 1374

Query: 1356 AQFIVISLRNNMFELTKQLVGIYKHENMTKSAALVNEDLV 1395
            AQFIVISLRNNMFEL +QLVGIYK  NMT+SA L N+D++
Sbjct: 1375 AQFIVISLRNNMFELAQQLVGIYKRSNMTQSATLKNKDIL 1414

>SAKL0H17094g Chr8 complement(1508021..1512289) [4269 bp, 1422 aa]
            {ON} similar to uniprot|Q12267 Saccharomyces cerevisiae
            YLR086W SMC4 Subunit of the condensin complex which
            reorganizes chromosomes during cell division forms a
            stable complex with Smc2p that has ATP-hydrolyzing and
            DNA- binding activity and promotes knotting of circular
            DNA potential Cdc28p substrate
          Length = 1422

 Score = 1140 bits (2948), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 647/1434 (45%), Positives = 901/1434 (62%), Gaps = 54/1434 (3%)

Query: 1    MSDRPVSKRQKVTEEDEEEDVIHTPKA-----------VTFEQSPR------AITPRNL- 42
            MSD P++K+QK T  D+   +   P             +  + SP       + TPR L 
Sbjct: 1    MSDSPLAKKQK-TRTDDRGQIQSNPTVSPIPPVSGSSLMAVKSSPTRQDRLPSPTPRKLV 59

Query: 43   LGSENRNVL--PTGGSQNLQIPSLLPPESLGSARGRDF--KSYXXXXXXXXXXXXXXXLK 98
            LGS  +         S +L +P+L PP   GS RGR F  +S                L+
Sbjct: 60   LGSPEKKYAYSQPSTSSSLSVPNLQPPNVDGS-RGRRFYSQSPPRSPHRSPNRSPTRRLE 118

Query: 99   LIELSPIKNSRAELQKLYESKKLDVKK--ERLFIHQLVLNDFKSYAGRQVIGPFHTSFSA 156
            LI+LSP+KN+RAELQK+Y+ K  D  +   RL I +L L++FKSYAG Q+IGPFHTSFSA
Sbjct: 119  LIQLSPVKNNRAELQKIYDEKNKDGNQCVHRLCIDKLSLHNFKSYAGTQIIGPFHTSFSA 178

Query: 157  IVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSETFPDLKSCSVEVHFKYVIDK 216
            +VGPNGSGKSNVIDSMLFVFGFRANKMRQ +LSDLIHKSE +P+L+SCSV++HF+YV+D+
Sbjct: 179  VVGPNGSGKSNVIDSMLFVFGFRANKMRQGKLSDLIHKSEAYPNLESCSVDIHFRYVVDE 238

Query: 217  DDGSTTIDETKGNLVVTRKAFKNNASKYFVNGKESNYTEVTTLLKKEGIDLDHKRFLILQ 276
             DG+T  D+ K  +V+TRKAF+NN+SKY+++GKESNYTEVT LL+ +GIDLDHKRFLILQ
Sbjct: 239  SDGTTRSDDEKPPMVITRKAFRNNSSKYYIDGKESNYTEVTQLLRDQGIDLDHKRFLILQ 298

Query: 277  GEVENIAQMKAKAEKENDDGLLEYLEDIIGTSKYKESIEKLSMEIESLNEICVEKENRFS 336
            GEVE+I+QMK KAE+E+DDGLLEYLEDIIGT+KYK  IE   +EI++LN++CVEKENRF 
Sbjct: 299  GEVESISQMKPKAERESDDGLLEYLEDIIGTAKYKAGIEAGLVEIDTLNDVCVEKENRFE 358

Query: 337  IVEREKNSLESGKEEALQFXXXXXXXXXXXXXXYQYNLMQXXXXXXXXXXXXTNVQQEQT 396
            +VE+EKNSLESGK+EAL+F               QY++ Q            + + +   
Sbjct: 359  LVEKEKNSLESGKDEALEFLEKEKSLTLLKSKLAQYHIWQDQRKLSETLGKISELNEHLG 418

Query: 397  KQEDEFRKANSHISDITASLNVLKADLEKVHTEEVNLSKTKRTLENKKVENEQIVNNLDS 456
            +++ ++ +    ++ +    N  K  + K+  E  +L+  +R ++ +K   E+   NLD 
Sbjct: 419  QEKAKYDQFQREVAQLRERCNDFKKQMVKLDKEHKDLTSKRRLMDREKTSMEEKQRNLDK 478

Query: 457  KRKEFEEQSKILQDKINSTDQEIQTIIEEQSSLAEGTTVLSTNXXXXXXXXXXXXXXXXX 516
            KR + E+  K  ++ +  +  +++ +   Q    E    L+ +                 
Sbjct: 479  KRLKAEKLLKSTENSMADSKHKLEELNNSQKQYKEKLLQLNESLLEERSKLDEIKLSLRD 538

Query: 517  XTEHLTIQIAEYEKELSPWNEQSQQLKKEIKITESELSIIEENRKGLENDIAGLENAILS 576
             T  ++ +IA +E++L PWN Q Q+ K ++K+TES+++I++E+++    +I  L+  I +
Sbjct: 539  KTSEISAEIANHERDLEPWNAQLQEKKSQMKLTESQIAILKESKEKKVQNIIQLKTEIEA 598

Query: 577  QKRDLEVQEQEIKSLLEQKTKVIQERELGERECKNAQATLANVREKVEALRQKAIEIRST 636
                  VQE  I  L  ++  +++  ++GE+EC +A + L  ++  + + RQ+A+E RST
Sbjct: 599  FAEKNNVQEIAIHKLQCEQANILKRIDIGEKECGSASSKLGEMKNVLISHRQRAMEARST 658

Query: 637  YSATENNNKVLSALLRLQKSGRLNGFHGRLGDLAVIDPKYDVAISTACPRLNDLVVDTVE 696
             S  EN NKVLSAL+RLQ+SGR+ GFHGRLGDL  ID  YDVAISTACPRL+D+VVD VE
Sbjct: 659  LSNVENKNKVLSALIRLQRSGRIAGFHGRLGDLGTIDDMYDVAISTACPRLDDIVVDNVE 718

Query: 697  SGQQCIEYLRKNKLGYARFILLDKLNTFNTNRIDTPDQSQRLFDLITVKEKRFNNAFYSV 756
             GQQCIE+LRKNKLGYARFI+LDKL  FN + I TP+   RLFDL+  K  +F  AFYSV
Sbjct: 719  CGQQCIEHLRKNKLGYARFIILDKLRKFNLSPIQTPETVPRLFDLVRSKNGKFLPAFYSV 778

Query: 757  LRDTLVCQNMEQANRVAYGKKRYRVVTLDGNLIDLSGTMTGGGRNVXXXXXXXXXXXXXX 816
            LRDTLV  +++QANRVAYGK+R+RVVTLDG LID SGT++GGG +V              
Sbjct: 779  LRDTLVVSDLKQANRVAYGKRRFRVVTLDGKLIDTSGTLSGGGTHV---MKGLMKSKQQP 835

Query: 817  XAFFSPEEVQAIENELNQKENQYKSALDAYHXXXXXXXXXXXXAPEIDNLVSKKEMDIET 876
             A ++PEEVQ IE ELN++E  +  A++ +H             PEI+  ++K+ +DIE+
Sbjct: 836  GAGYTPEEVQNIEKELNEREKNFHIAIETFHDMEEALKKFKDREPEIEVEIAKRRLDIES 895

Query: 877  AHNDINSNINVLEEKRKKLESMKN----QNDPSITXXXXXXXXXXXXDDIDVQXXXXXXX 932
            +    ++ + + +E+ K+LE+ ++    ++                 D+I+ +       
Sbjct: 896  S----STELKLKQEQLKELETDRDGGSVEDRELADAESKLQVLSEEYDEIENETKNKQQL 951

Query: 933  XXXXXXXXXELGGDELKNQSLLVTDITNKISENSRRXXXXXXXXXXXXXXXXXXXXXXTE 992
                     ++GG +L+ Q+  V  I  +I+  S +                       E
Sbjct: 952  INSLKEKIMKIGGTKLQLQNSKVNSINEQINIISSKQKKDRTATKKAENDLKRLENQCRE 1011

Query: 993  ANEELTNFSKNAENADIESKEIESKLLDIKESI---ENLKENEVKLEHEIEMKHNELESH 1049
            A+ ++ + +       + + E+E+K+  +  S+   E+LKE   +    ++     LE  
Sbjct: 1012 ASNDIESCNLEISKISVLNTELEAKIYKLDTSLNETESLKEEVEEEFERVK---TNLEEK 1068

Query: 1050 QKVVSDYKSISLEYNNKLEKLEASEASLKKSIKRYNDLLSELTIRDVTQVLNTI----MT 1105
                SD+KS+ +E NN+LEKL    + +KK IK   D L+ L IRD+TQ L  +    + 
Sbjct: 1069 TNNTSDFKSVEIEINNRLEKLNGLTSHIKKEIKYNKDELNSLKIRDITQTLQALNEGKLP 1128

Query: 1106 EENA-SVDKSDPKLENTSAVINADDDGISAVSENQS---FNHNDENDDIDSNKMEIDSQG 1161
            EEN    +  D +++     +++D + +  + E Q+   F     + +IDS  M+ID   
Sbjct: 1129 EENEDDFEVQDEEVQREQREMSSDPNAMD-IDEEQAAEQFQVQQTDGEIDS--MDIDEYE 1185

Query: 1162 GFINPGIPVLSASELAKVDPQEVELLITSLDDFITSSEANVDVLEEYALRFVEFNKRKND 1221
               + G+P  S ++L  +  ++VEL I  L+ ++ ++  ++DVLEEYA R  E+ KRK D
Sbjct: 1186 NETSNGLPKFSEAQLQSIQIEDVELQIDELNHYVDNAHVDIDVLEEYARRLAEYKKRKLD 1245

Query: 1222 LNSAVQSRDSVKDRLEGIKRKRYDEFMEGFKIISMTLKEMYQMITLGGNAELELVDSLDP 1281
            LN AV  RD V+   E +K+KR D+FMEGF IISMTLKEMYQMIT+GGNAELELVDSLDP
Sbjct: 1246 LNQAVLKRDEVRKNCEELKKKRLDKFMEGFSIISMTLKEMYQMITMGGNAELELVDSLDP 1305

Query: 1282 FSEGVTFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRN 1341
            FSEGV FSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKY+PTPLYVMDEIDAALDFRN
Sbjct: 1306 FSEGVLFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYRPTPLYVMDEIDAALDFRN 1365

Query: 1342 VSIVANYIKERTKNAQFIVISLRNNMFELTKQLVGIYKHENMTKSAALVNEDLV 1395
            VSIVANYIKERTKNAQFIVISLRNNMFEL +QLVGIYK+ NMT+S  L N D++
Sbjct: 1366 VSIVANYIKERTKNAQFIVISLRNNMFELAQQLVGIYKNNNMTRSTTLQNIDIL 1419

>KNAG0G02020 Chr7 (449115..453449) [4335 bp, 1444 aa] {ON} Anc_8.259
            YLR086W
          Length = 1444

 Score = 1131 bits (2926), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 651/1390 (46%), Positives = 864/1390 (62%), Gaps = 39/1390 (2%)

Query: 35   RAITPRNLL--GSENRNVLP---TGGSQNLQIPSL---LPPESLGSARGRDFKSYXXXXX 86
            + +TPR L+   SEN+  L    T  S +LQ+P+L   L P S  S RGR  K Y     
Sbjct: 64   KTVTPRKLIIGPSENKYALSQPTTSASSSLQVPALQQKLVPLSQDS-RGRRIKMYSQSPP 122

Query: 87   XXX----XXXXXXXLKLIELSPIKNSRAELQKLYESKKLDVKK-ERLFIHQLVLNDFKSY 141
                          L+LI+LSPIKNSR ELQKLY++    + K  RL+IH+LVL++FKSY
Sbjct: 123  RSPGRSPNRSPVRKLELIQLSPIKNSRLELQKLYDAHNAKIGKMNRLYIHKLVLHNFKSY 182

Query: 142  AGRQVIGPFHTSFSAIVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSETFPDL 201
            AG Q IGPF  SFSA+VGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSE F +L
Sbjct: 183  AGEQTIGPFDASFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSERFTNL 242

Query: 202  KSCSVEVHFKYVIDKDDGSTTID--ETKGNLVVTRKAFKNNASKYFVNGKESNYTEVTTL 259
              CSVEVHF+YV D+    T  D  E +  LV+TRKAFKNN+SKYF+NGKESN+TEVT L
Sbjct: 243  NFCSVEVHFRYVKDEYTAPTDGDTMEAENTLVITRKAFKNNSSKYFINGKESNFTEVTKL 302

Query: 260  LKKEGIDLDHKRFLILQGEVENIAQMKAKAEKENDDGLLEYLEDIIGTSKYKESIEKLSM 319
            LK++GIDLDHKRFLILQGEVENIAQMKAKAEK+N+DGLLEYLEDIIGT  YK  IE+ ++
Sbjct: 303  LKEQGIDLDHKRFLILQGEVENIAQMKAKAEKDNEDGLLEYLEDIIGTKHYKPLIEQKTV 362

Query: 320  EIESLNEICVEKENRFSIVEREKNSLESGKEEALQFXXXXXXXXXXXXXXYQYNLM---- 375
            EIE++NE+C+EKENRF IV+ EKNSLE  K+ AL+F               QY+L     
Sbjct: 363  EIEAMNELCIEKENRFRIVDDEKNSLEKDKDAALEFLEKEKQLTLLKSKLTQYHLYVNND 422

Query: 376  QXXXXXXXXXXXXTNVQQEQTKQEDEFRKANSHISDITASLNVLKADLEKVHTEEVNLSK 435
            +            T+ +QE+ +   +F K    +  +  S++  K +L  + TEE +L +
Sbjct: 423  KIKTTLGQIDSLRTDFEQEKQRH-SQFMK---EVETLQNSIDESKNNLTSLTTEEKSLIQ 478

Query: 436  TKRTLENKKVENEQIVNNLDSKRKEFEEQSKILQDKINSTDQEIQTIIEEQSSLAEGTTV 495
             KR +  + V  E+   NLD K K+ +   +  +  I+  + E+Q    EQS L E    
Sbjct: 479  RKREINTQSVSLEETTKNLDQKLKKAKATVESSKSLISKNEHELQ----EQSQLQEEYEA 534

Query: 496  ----LSTNXXXXXXXXXXXXXXXXXXTEHLTIQIAEYEKELSPWNEQSQQLKKEIKITES 551
                LS                    T   + +IA  EKEL P N + Q+ K +IK+ E 
Sbjct: 535  EVNDLSKQREVEEKILLDIKLQLKDKTVTFSDEIASIEKELEPSNTEIQEKKSQIKLVEM 594

Query: 552  ELSIIEENRKGLENDIAGLENAILSQKRDLEVQEQEIKSLLEQKTKVIQERELGERECKN 611
            E+ +I ++++ +  +I  L+  +L  ++DLE  E+++  L + K  +++E++ G++ECK+
Sbjct: 595  EIDLIRDSKRKVGAEIESLKEELLKLQKDLEDNEKDVTDLNKSKRNLVKEKQEGDKECKD 654

Query: 612  AQATLANVREKVEALRQKAIEIRSTYSATENNNKVLSALLRLQKSGRLNGFHGRLGDLAV 671
            A   L  ++  + + RQK +E RST S  +N NKVL++L+R+Q+SGR+NGFHGRLGDL +
Sbjct: 655  AGVKLNEMKAILNSHRQKTMEARSTVSTAQNKNKVLTSLMRMQQSGRINGFHGRLGDLGI 714

Query: 672  IDPKYDVAISTACPRLNDLVVDTVESGQQCIEYLRKNKLGYARFILLDKLNTFNTNRIDT 731
            I  +YDVAISTACPRL+D+VV++VE GQ CIE+LRKNKLGYARF++LDKL  F+ + I T
Sbjct: 715  IADQYDVAISTACPRLDDMVVESVECGQTCIEFLRKNKLGYARFVVLDKLKRFDMSPIQT 774

Query: 732  PDQSQRLFDLITVKEKRFNNAFYSVLRDTLVCQNMEQANRVAYGKKRYRVVTLDGNLIDL 791
            P+   RLFDL+  KEKRF  A YSVLRDTLV ++++QANRVAYGK+R+RVVTLDG LID+
Sbjct: 775  PENVPRLFDLVKPKEKRFAPAIYSVLRDTLVAKDLKQANRVAYGKRRFRVVTLDGQLIDI 834

Query: 792  SGTMTGGGRNVXXXXXXXXXXXXXXXAFFSPEEVQAIENELNQKENQYKSALDAYHXXXX 851
            SGTM+GGG  V                 FS E+++ +E EL  +E Q+  A + +H    
Sbjct: 835  SGTMSGGGSRVFKGLMNLTTKVSGTSEIFSLEDMKKLEMELAAREKQFDVASETFHSMEQ 894

Query: 852  XXXXXXXXAPEIDNLVSKKEMDIETAHNDINSNINVLEEKRKKLESMKNQNDPSITXXXX 911
                     P+++  +SKK +DI+     I    + L EK    E      D        
Sbjct: 895  ELRKLCDREPQLELEISKKLIDIDALTQQIQLTRSQLTEKSNDYEKSIKDTDDLDLLLGN 954

Query: 912  XXXXXXXXDDIDVQXXXXXXXXXXXXXXXXELGGDELKNQSLLVTDITNKISENSRRXXX 971
                      +  Q                 +GG EL+ Q+  V+ +  +I     +   
Sbjct: 955  LEALNQELKYLQDQSKTSSERVSFLKDEIMRIGGSELQLQNSKVSSLNQRIDILQAKLKK 1014

Query: 972  XXXXXXXXXXXXXXXXXXXTEANEELTNFSKNAENADIESKEIESKLLDIKESIENLKEN 1031
                                 + EE TN ++   +A   ++  ++ LLDI +S+E++++ 
Sbjct: 1015 SKTVVKKLNTELKKARKSLIASTEESTNSTEEIAHAKARAEVAKNSLLDINKSLESIQDE 1074

Query: 1032 EVKLEHEIEMKHNELESHQKVVSDYKSISLEYNNKLEKLEASEASLKKSIKRYNDLLSEL 1091
            ++ LE E+E   ++L    + V+++K+I LE  NK+E+  +  + LKK   +  + L+  
Sbjct: 1075 KINLEQELENFSDKLHESNENVNEFKTIQLELENKIERANSILSYLKKENGQLLEELNNF 1134

Query: 1092 TIRDVTQVLNTIMTEENASVDKSDPKLENTSAVINADDDGISAVSE-----NQSFNHNDE 1146
             +RDVT  L+ +  EE    ++  P         N D++ + A        N S   N  
Sbjct: 1135 RLRDVTHTLDLLREEEGTEANQQ-PTTGTDETTSNVDNEMLGAADAGVENMNTSSLSNSV 1193

Query: 1147 NDDIDSNKMEIDSQGGFINPGIPVLSASELAKVDPQEVELLITSLDDFITSSEANVDVLE 1206
                D   M++D  G  ++ GIP LS  EL+ +D   +   I  L  FI +   N+++LE
Sbjct: 1194 KVASDEISMDVDDCGDLVSQGIPRLSDKELSTIDTDNLNEEINQLQSFINNVSINIEILE 1253

Query: 1207 EYALRFVEFNKRKNDLNSAVQSRDSVKDRLEGIKRKRYDEFMEGFKIISMTLKEMYQMIT 1266
            EYA R VEF KRK DLN++V  R+ +   +E +K+KRY+EFMEGF IISMTLKEMYQMIT
Sbjct: 1254 EYAKRLVEFKKRKIDLNNSVGERNQLTSIMEELKKKRYNEFMEGFSIISMTLKEMYQMIT 1313

Query: 1267 LGGNAELELVDSLDPFSEGVTFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTP 1326
            +GGNAELELVDSLDPFSEGVTFSVMPPKKSWRNI+NLSGGEKTLSSLALVFALHKYKPTP
Sbjct: 1314 MGGNAELELVDSLDPFSEGVTFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTP 1373

Query: 1327 LYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELTKQLVGIYKHENMTKS 1386
            LYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFEL KQLVGIYKHENMTK+
Sbjct: 1374 LYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAKQLVGIYKHENMTKN 1433

Query: 1387 AALVN-EDLV 1395
            A + N EDL+
Sbjct: 1434 ATIRNREDLI 1443

>AGR089C Chr7 complement(901437..905549) [4113 bp, 1370 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YLR086W
            (SMC4)
          Length = 1370

 Score = 1128 bits (2918), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 648/1402 (46%), Positives = 859/1402 (61%), Gaps = 65/1402 (4%)

Query: 22   IHTPKAVTFEQSPRAI-TPRNLLGS--ENRNVLPTGGS----QNLQIPSLLPPESLGSAR 74
            I TPK       PR + TP  LL +  + +NV+  G S      L+ PSL PP +   +R
Sbjct: 3    IPTPK------KPRILDTPVKLLATSPDRKNVVSRGSSVSTTMGLRGPSLQPPVAHQISR 56

Query: 75   GRDFKSYXXXXXXXXXXXXXXXLKLIELSPIKNSRAELQKLYESKKLDVKKERLFIHQLV 134
            GR    Y               ++LI+LSPIKNSR ELQ+LY++K+  V  ERL I  LV
Sbjct: 57   GRS--QYSQSPPRSPNRSPGRAVELIQLSPIKNSRLELQRLYDTKQKKV--ERLCIRTLV 112

Query: 135  LNDFKSYAGRQVIGPFHTSFSAIVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHK 194
            L +FKSYAGRQV+GPFH+SFSA+VGPNGSGKSNVIDSMLF FGFRANKMRQ +LS LIHK
Sbjct: 113  LENFKSYAGRQVVGPFHSSFSAVVGPNGSGKSNVIDSMLFAFGFRANKMRQGKLSHLIHK 172

Query: 195  SETFPDLKSCSVEVHFKYVIDKDDGSTTIDETKGNLVVTRKAFKNNASKYFVNGKESNYT 254
            SE +PDL  CSVE+ F+YV+D+ DG+T +   K  L V RKAFKNN SKY++NGKES YT
Sbjct: 173  SEKYPDLDFCSVEIQFQYVVDEPDGTTRVLSGKPELSVMRKAFKNNTSKYYLNGKESTYT 232

Query: 255  EVTTLLKKEGIDLDHKRFLILQGEVENIAQMKAKAEKENDDGLLEYLEDIIGTSKYKESI 314
            EVT LL+ EGIDLDHKRFLILQGEVE+IAQMK KAE E DDGLLEYLEDIIGT+KYK  I
Sbjct: 233  EVTRLLRDEGIDLDHKRFLILQGEVESIAQMKPKAEHEGDDGLLEYLEDIIGTTKYKAQI 292

Query: 315  EKLSMEIESLNEICVEKENRFSIVEREKNSLESGKEEALQFXXXXXXXXXXXXXXYQYNL 374
            E+  +E++SLN+IC+EKENRF +VE+EK SLE GK+EAL F              YQY+L
Sbjct: 293  EQALVEVDSLNDICMEKENRFDLVEKEKLSLEPGKDEALAFLKKEKDLTLLMSKKYQYHL 352

Query: 375  MQXXXXXXXXXXXXTNVQQEQTKQEDEFRKANSHISDITASLNVLKADLEKV-HTEEVNL 433
                          +N   +  +++ +  +A   I ++T +   L   L  + +T + +L
Sbjct: 353  FHNGSKLAKTLSNVSNTMNKLEQEKAKKVEAQKEIVELTDASEQLANRLVSMNNTNKESL 412

Query: 434  SKTKRTLENKKVENEQIVNNLDSKRKEFEEQSKILQDKINSTDQEIQTIIEEQSSLAEGT 493
            +K  R LE + V NE+   +L  KR + E+    ++  I   + +I+  I +        
Sbjct: 413  AKM-RQLERELVSNEEKQKSLLQKRSKAEKTLNTVEKSIKQCENKIEEYISQNQEYETSL 471

Query: 494  TVLSTNXXXXXXXXXXXXXXXXXXTEHLTIQIAEYEKELSPWNEQSQQLKKEIKITESEL 553
            T L+                    T  +T ++A  EKEL PW  + ++ K EIK+ ESE+
Sbjct: 472  TTLNHTIVDAQAELEKMKLALSDKTGDITKEVAVLEKELEPWTNKVEEKKSEIKLVESEI 531

Query: 554  SIIEENRKGLENDIAGLENAILSQKRDLEVQEQEIKSLLEQKTKVIQERELGERECKNAQ 613
            SII+E    LE++IA L   I   + ++  +E+ I++L  + + +     +GEREC +A+
Sbjct: 532  SIIKEADLKLESEIANLSQEIEQLRGNISHREESIETLNVESSSIRDYILVGERECTSAR 591

Query: 614  ATLANVREKVEALRQKAIEIRSTYSATENNNKVLSALLRLQKSGRLNGFHGRLGDLAVID 673
            + L  +++ +   RQ+  + RS  S+ EN NKVL+AL RLQKSGR++G+HGRLGDL  ID
Sbjct: 592  SKLEEMKKVLVTHRQRVNDARSAVSSAENKNKVLTALSRLQKSGRIDGYHGRLGDLGTID 651

Query: 674  PKYDVAISTACPRLNDLVVDTVESGQQCIEYLRKNKLGYARFILLDKLNTFNTNRIDTPD 733
             KYD+AISTACPRL+D+VVDTVE GQQCIE+LRKNKLGYARFILLDKL  FN     TP+
Sbjct: 652  DKYDIAISTACPRLDDIVVDTVECGQQCIEHLRKNKLGYARFILLDKLRKFNLQPAHTPE 711

Query: 734  QSQRLFDLITVKEKRFNNAFYSVLRDTLVCQNMEQANRVAYGKKRYRVVTLDGNLIDLSG 793
               RLFDL+  KE +F  AFYSVLRDTLV  ++ QANRVAYGKKRYRVVTLDG LID+SG
Sbjct: 712  NVPRLFDLVKPKEPKFAPAFYSVLRDTLVTTDLSQANRVAYGKKRYRVVTLDGKLIDISG 771

Query: 794  TMTGGGRNVXXXXXXXXXXXXXXXAFFSPEEVQAIENELNQKENQYKSALDAYHXXXXXX 853
            TMTGGG                  + ++PEEVQ +E ELN++E  +K A + +       
Sbjct: 772  TMTGGGDRA----ASGLMKSTQQSSLYTPEEVQRMEEELNEREKNFKVAFETFQEMESAL 827

Query: 854  XXXXXXAPEIDNLVSKKEMDIETAHNDINSNINVLEEKRKKLESMKNQNDPSITXXXXXX 913
                   PEI+  +SK++MDIET   ++ S I       +KLE ++  N  SI       
Sbjct: 828  QNYLDRQPEIEVELSKQKMDIETISAELESKIE------RKLE-LERSNKTSIEDSSELR 880

Query: 914  XXXXXXDDIDVQXXXXXXXXXXXXXXXXELGGDELKNQSLLVTDITNKISENSRRXXXXX 973
                    ++                  EL    ++   L +  + +K+   +++     
Sbjct: 881  TAEEKLAALNADLNSFMSASESKNQRIKELRAKIMEIGGLELQTLNSKVDSLNQQIKIVA 940

Query: 974  XXXXXXXXXXXXXXXXXTEANEELTNFSKNAENADIE--------------SKEIESKLL 1019
                               A ++      + E+ DIE               +E++ +L 
Sbjct: 941  AKQKKDKTAQKKAELELKRARKQQITAKDDIEHCDIEIQKMKSSYDTISTGMQELQKQLS 1000

Query: 1020 DIKESIENLKENEVKLEHEIEMKHNELESHQKVVSDYKSISLEYNNKLEKLEASEASLKK 1079
            D++E I  L +     +HE++ K+ +++S       Y SI +E   +L+KL+     LKK
Sbjct: 1001 DLQEEIGTLTDEHAVTKHELDQKNEKIDS-------YSSIEIELTEQLQKLQNLANYLKK 1053

Query: 1080 SIKRYNDLLSELTIRDVTQVLNTIMTEENASVDK------SDPKLENTSAVINADDDGIS 1133
             +  Y+  LS L +RD+ QV+  +  EEN S+         D K EN  + +   +  ++
Sbjct: 1054 EMNEYDSKLSHLKLRDLGQVM--LDLEENKSLQSFSHSPTPDTKRENIQSSML--ETHLA 1109

Query: 1134 AVSENQSFNHNDENDDIDSNKMEIDSQGGFINPGIPVLSASELAKVDPQEVELLITSLDD 1193
            + S N+      EN+      ME+D Q   +  G+P L  SELA+VD +++E  I  L D
Sbjct: 1110 SPSPNERKISIAENN----LSMEVDEQASVLENGLPKLPDSELARVDLEDLERDIVQLQD 1165

Query: 1194 FITSSEANVDVLEEYALRFVEFNKRKNDLNSAVQSRDSVKDRLEGIKRKRYDEFMEGFKI 1253
            +I +S  ++++L+EYA R  E+ +R+ DLN A+  RD  +   E +K++R DEFMEGF I
Sbjct: 1166 YIDNSTVDIEILDEYAKRLAEYRRRRIDLNEAIMKRDETRMHCEVLKKRRLDEFMEGFGI 1225

Query: 1254 ISMTLKEMYQMITLGGNAELELVDSLDPFSEGVTFSVMPPKKSWRNISNLSGGEKTLSSL 1313
            IS+TLKEMYQMIT+GGNAELELVDSLDPFSEGV FSVMPPKKSWRNISNLSGGEKTLSSL
Sbjct: 1226 ISITLKEMYQMITMGGNAELELVDSLDPFSEGVLFSVMPPKKSWRNISNLSGGEKTLSSL 1285

Query: 1314 ALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELTKQ 1373
            ALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFEL ++
Sbjct: 1286 ALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQR 1345

Query: 1374 LVGIYKHENMTKSAALVNEDLV 1395
            LVGIYK+ NMT+S  L N D++
Sbjct: 1346 LVGIYKNSNMTRSTTLQNRDII 1367

>Kpol_392.8 s392 complement(19392..23675) [4284 bp, 1427 aa] {ON}
            complement(19392..23675) [4284 nt, 1428 aa]
          Length = 1427

 Score = 1124 bits (2907), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 653/1390 (46%), Positives = 878/1390 (63%), Gaps = 43/1390 (3%)

Query: 32   QSPRAITPRNLLGSENRNVLPTGG---SQNLQIPSLLPPESLGSARGRDFKSYXXXX--- 85
            Q+P+ +  R+    ++  + PT     S +LQ PSL PP +  S+RGR  ++Y       
Sbjct: 56   QTPKKLILRDY---DSIAITPTAAMPPSSSLQAPSLHPP-TESSSRGRTARTYSQSPPRS 111

Query: 86   -XXXXXXXXXXXLKLIELSPIKNSRAELQKLYESKKLDVKKERLFIHQLVLNDFKSYAGR 144
                        L+LI+LSP+KNSR  LQK+YESK  + + ERL I +LVL+DFKSYAG 
Sbjct: 112  PARSPARSPTRKLELIQLSPVKNSRIALQKIYESKN-EKQIERLCIDKLVLHDFKSYAGT 170

Query: 145  QVIGPFHTSFSAIVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSETFPDLKSC 204
            QV+GPFH+SFSA+VGPNGSGKSNVIDSMLFVFGFRA+KMRQDRLSDLIHKSE FPDLKSC
Sbjct: 171  QVVGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRASKMRQDRLSDLIHKSENFPDLKSC 230

Query: 205  SVEVHFKYVIDKDDGSTTIDETKGNLVVTRKAFKNNASKYFVNGKESNYTEVTTLLKKEG 264
            SVEVHF+YVIDK DG+T I+  K  LV+TRKAFKNN SKY++NGKESNYT VT LLK EG
Sbjct: 231  SVEVHFEYVIDKPDGTTIINTVKEKLVITRKAFKNNTSKYYINGKESNYTSVTKLLKDEG 290

Query: 265  IDLDHKRFLILQGEVENIAQMKAKAEKENDDGLLEYLEDIIGTSKYKESIEKLSMEIESL 324
            IDLDH RFLILQGEVENIAQMK KAE + DDGLLEYLEDIIGT+KYK  IEK   EIE+L
Sbjct: 291  IDLDHNRFLILQGEVENIAQMKPKAENDGDDGLLEYLEDIIGTAKYKPLIEKKFEEIEAL 350

Query: 325  NEICVEKENRFSIVEREKNSLESGKEEALQFXXXXXXXXXXXXXXYQYNLMQXXXXXXXX 384
            NEIC+EKENRF IV+REK SLESGK+EAL+F              YQY L Q        
Sbjct: 351  NEICIEKENRFEIVDREKASLESGKDEALEFLEKEKELTLVKSKLYQYKLWQDNKKLSTT 410

Query: 385  XXXXTNVQQEQTKQEDEFRKANSHISDITASLNVLKADLEKVHTEEVNLSKTKRTLENKK 444
                +N+++E  + + +       +++I+ S + +  +++    +E  L+  KR  + ++
Sbjct: 411  LEKLSNIKEEFEETKKKHSTTEIQMNEISKSYHEMLKNIKASQEQEKKLNIQKRNYDTER 470

Query: 445  VENEQIVNNLDSKRKEFEEQSKILQDKINSTDQEIQTIIEEQSSLAEGTTVLSTNXXXXX 504
            V  E+   N+  K+K+ E++ +     I++T  +I+ + + +S        L+       
Sbjct: 471  VSLEEQRKNIMKKKKKMEKELEDCNKTISNTKIKIEDLGKNESEYESQLDELNAQLQIER 530

Query: 505  XXXXXXXXXXXXXTEHLTIQIAEYEKELSPWNEQSQQLKKEIKITESELSIIEENRKGLE 564
                         T   + +I+++EKEL PWN Q Q  K +I++ ESE+S+I+E R  LE
Sbjct: 531  GLLEEIKISLKDKTIEFSDEISQHEKELEPWNLQLQGKKSQIQVKESEISLIKEGRVKLE 590

Query: 565  NDIAGLENAILSQKRDLEV-QEQEIKSLLEQKTKVIQERELGERECKNAQATLANVREKV 623
            NDI  L N+++S K + ++ +E+EI SL  +  ++ +E  +G+ E  NA+  L  ++  +
Sbjct: 591  NDIENL-NSLISVKIEEKISREKEIGSLRNELNRITKEVSIGDTEYTNAKEKLREMKAVL 649

Query: 624  EALRQKAIEIRSTYSATENNNKVLSALLRLQKSGRLNGFHGRLGDLAVIDPKYDVAISTA 683
               RQKAI+ R++ SA EN N+VL++L RLQKSGR++GF+GRLGDL  ID +YD+AISTA
Sbjct: 650  NQHRQKAIDARTSLSAEENKNQVLASLFRLQKSGRISGFYGRLGDLGAIDDRYDIAISTA 709

Query: 684  CPRLNDLVVDTVESGQQCIEYLRKNKLGYARFILLDKLNTFNTNRIDTPDQSQRLFDLIT 743
            CPRLNDLVV+TVE GQQCIEYLRKNKLGYARFILL+KL  F+ N+I TP+   RLFDL+ 
Sbjct: 710  CPRLNDLVVETVECGQQCIEYLRKNKLGYARFILLEKLRNFDMNKISTPNNVPRLFDLVI 769

Query: 744  VKEKRFNNAFYSVLRDTLVCQNMEQANRVAYGKKRYRVVTLDGNLIDLSGTMTGGGRNVX 803
              + +F  AFYSVLRDTLV  N++ ANRVAYG KR+RVVTL G LID+SGTM+GGG    
Sbjct: 770  SSDPKFLPAFYSVLRDTLVVNNLKDANRVAYGNKRFRVVTLSGELIDVSGTMSGGGTQTS 829

Query: 804  XXXXXXXXXXXXXXAFFSPEEVQAIENELNQKENQYKSALDAYHXXXXXXXXXXXXAPEI 863
                            ++ E+V+ IE EL  +E  ++ A + +              P++
Sbjct: 830  RGLMKLTKSGNSGFKSYTIEDVEKIEKELAAREKNFEIANETFTEMETELRRLKDRKPDV 889

Query: 864  DNLVSKKEMDIE---TAHNDINSNINVLEEKRKKLESMKNQNDPSITXXXXXXXXXXXXD 920
            +  +SK E++I    T H  +   +N   EK++ L+   + N+   T             
Sbjct: 890  ELEISKFELEITSWVTEHELMQQQLN---EKQQSLDECMSNNEELSTMEHELGTLQNDYK 946

Query: 921  DIDVQXXXXXXXXXXXXXXXXELGGDELKNQSLLVTDITNKISENSRRXXXXXXXXXXXX 980
             + ++                ++GG +L+ QS  V  I  K    + +            
Sbjct: 947  SLQLETKSKKDRIKFLKDEIMKVGGIKLQVQSSKVDSIIQKKDILNGKHKKDKNDLKKAE 1006

Query: 981  XXXXXXXXXXTEANEELTNFSKNAENADIESKEIESKLLDIKESIENLKENEVKLEHEIE 1040
                      +E + +L   +   EN D +  +I SK L   E++  L E E   E  ++
Sbjct: 1007 TELKRLSKKQSECSTDLLTSTDKLENTDGQLSKI-SKSLSETETL--LHELEFSREESLQ 1063

Query: 1041 MKHN---ELESHQKVVSDYKSISLEYNNKLEKLEASEASLKKSIKRYNDLLSELTIRDVT 1097
               N   +L+  ++ ++ +K   LE+ NK EKL      +KK I+  +  L  L IRD+T
Sbjct: 1064 NSENLKDQLKEFEENLNSFKVFQLEHQNKEEKLNNLLNFIKKDIRSTDSELQSLKIRDIT 1123

Query: 1098 QVLNTIMTEENASVDKS--DPKLENTSAVINADD--------DGISAVSENQSFNHNDEN 1147
              L  +   +N ++D+   D  +++ +  ++A++        +G+  +  N+S    D N
Sbjct: 1124 HTLQEL---DNGNIDQDEEDVSMKDNAVSVSANNSLGNSENMEGVE-IETNESDVSPDAN 1179

Query: 1148 DDIDSNKMEIDSQGGFINPGIPVLSASELAKVDPQEVELLITSLDDFITSSEANVDVLEE 1207
            +D++   MEID     I+ GIP +S  E   VD +E+E     L D+I +   N+DVLEE
Sbjct: 1180 NDLE---MEIDEDNNEISKGIPRISEDEFKNVDVEELEAQKLQLQDYIDTVNVNIDVLEE 1236

Query: 1208 YALRFVEFNKRKNDLNSAVQSRDSVKDRLEGIKRKRYDEFMEGFKIISMTLKEMYQMITL 1267
            YA R  E+ +RK DLN+AV  R+ V++ L+ +K+ R++EFM+GF +IS+TLKEMYQMIT+
Sbjct: 1237 YARRVAEYKRRKLDLNNAVDEREKVRELLDKLKKTRFEEFMQGFGVISITLKEMYQMITM 1296

Query: 1268 GGNAELELVDSLDPFSEGVTFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPL 1327
            GGNAELELVDSLDPFSEGVTFSVMPPKKSWRNI+NLSGGEKTLSSLALVFALHKYKPTPL
Sbjct: 1297 GGNAELELVDSLDPFSEGVTFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPL 1356

Query: 1328 YVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELTKQLVGIYKHENMTKSA 1387
            YVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFEL +QLVGIYK  N TKSA
Sbjct: 1357 YVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAEQLVGIYKSNNQTKSA 1416

Query: 1388 ALVNEDLVGR 1397
             L N D++ R
Sbjct: 1417 TLQNNDIINR 1426

>NDAI0B01970 Chr2 (479208..483455) [4248 bp, 1415 aa] {ON} Anc_8.259
            YLR086W
          Length = 1415

 Score = 1118 bits (2893), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 664/1444 (45%), Positives = 891/1444 (61%), Gaps = 89/1444 (6%)

Query: 5    PVSKRQKVTE------------EDEEEDVI--HTPKAVTFEQSPRAI----TPRNLL--G 44
            P  KRQKV E            ED+E  +   H   AV+   SP AI    TPR L+   
Sbjct: 8    PSPKRQKVLESHTPEQQEENRREDDESPLRFEHQQSAVSL--SPPAISKSHTPRKLILHQ 65

Query: 45   SENRNVL--PTGGSQNLQIPSLLPPESLGSA-RGR-DFKSYXXXXXXXXXXXXXXXLKLI 100
            S+NR     PT  + +LQ+PSL PPE+  S+ RGR D K Y               L+LI
Sbjct: 66   SDNRYAFSQPTVSASSLQVPSLQPPETSSSSSRGRRDIKVYSQSPPRSPGRSPTRKLELI 125

Query: 101  ELSPIKNSRA-ELQKLYESKKLDVKKERLFIHQLVLNDFKSYAGRQVIGPFHTSFSAIVG 159
            +LSP+KN+R  +LQ+LY S+   +KKERLFI++LVLN+FKSYAG QVIGPF+T+FSA+VG
Sbjct: 126  QLSPVKNNRIRKLQELYNSQ---IKKERLFINKLVLNNFKSYAGEQVIGPFNTNFSAVVG 182

Query: 160  PNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSETFPDLKSCSVEVHFKYVIDKDDG 219
            PNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSE+FP+L SCSV+V F+YV+DK +G
Sbjct: 183  PNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSESFPNLPSCSVDVEFQYVVDKSNG 242

Query: 220  STTIDETKGNLVVTRKAFKNNASKYFVNGKESNYTEVTTLLKKEGIDLDHKRFLILQGEV 279
            S+ ID+ K  L++TRKAFKNN+SKYF+NGKES+YTEVT LLK+EGIDLDHKRFLILQGEV
Sbjct: 243  SSKIDDNKPKLIITRKAFKNNSSKYFINGKESSYTEVTKLLKEEGIDLDHKRFLILQGEV 302

Query: 280  ENIAQMKAKAEKENDDGLLEYLEDIIGTSKYKESIEKLSMEIESLNEICVEKENRFSIVE 339
            ENIAQMK KAE+E DDGLLEYLEDIIGT+ YK SIEK ++E+++LNEIC+EKENRF IVE
Sbjct: 303  ENIAQMKPKAEREGDDGLLEYLEDIIGTADYKSSIEKNTIEVDTLNEICIEKENRFEIVE 362

Query: 340  REKNSLESGKEEALQFXXXXXXXXXXXXXXYQYNLMQXXXXXXXXXXXXT---------- 389
            REKNSLES K  AL+F               QYN+++            +          
Sbjct: 363  REKNSLESSKNAALEFVKKERRLTLSKSKLLQYNILKEHEKLASTLQKLSVLQEEYQNES 422

Query: 390  ----NVQQEQTKQEDEFRKANSHISDITASLNVLKADLEKVHTEEVNLSKTKRTLENKKV 445
                N Q+E  K ED F++ N  I  I       K D++       N +  KR L+NKK 
Sbjct: 423  TKFENTQRETNKLEDNFKQMNKKIVSI-------KEDMK-------NNTSKKRELQNKKA 468

Query: 446  ENEQIVNNLDSKR----KEFEEQSKILQDKINSTDQEIQTIIEEQSSLAEGTTVLSTNXX 501
              E+ + +   K+    K   +  K+L++  N    EI+T+  +Q         L +   
Sbjct: 469  SLEEKIKSYTRKKEKASKSIAQSKKLLKNYRN----EIETLNVDQQERESNLQSLLSELK 524

Query: 502  XXXXXXXXXXXXXXXXTEHLTIQIAEYEKELSPWNEQSQQLKKEIKITESELSIIEENRK 561
                            T  ++ +IA++E+EL PW +Q Q+ K EI++ ES++S+++EN+ 
Sbjct: 525  KEKNVLEEIKLSLKDKTTDISNEIAQHERELEPWKKQLQEKKLEIQVAESQISLLQENQS 584

Query: 562  GLENDIAGLENAILSQKRDLEVQEQEIKSLLEQKTKVIQERELGERECKNAQATLANVRE 621
             L+++I  L+N +  Q  + + QE+++  L  Q + +  E + GE EC NA++ + +++ 
Sbjct: 585  KLKDEIEKLKNDLKCQFENKKNQEEKLIDLKVQFSAISTEFDRGESECANAKSKIKDMQH 644

Query: 622  KVEALRQKAIEIRSTYSATENNNKVLSALLRLQKSGRLNGFHGRLGDLAVIDPKYDVAIS 681
             ++  RQK ++ RS  +  EN +KVLSAL +LQKSGR++GF+GRLGDL VID +YD+AIS
Sbjct: 645  VLQTQRQKVMDARSRLATVENKSKVLSALHKLQKSGRISGFYGRLGDLGVIDNEYDIAIS 704

Query: 682  TACPRLNDLVVDTVESGQQCIEYLRKNKLGYARFILLDKLNTFNTNRIDTPDQSQRLFDL 741
            TA  RL+D+VVD+VE GQ CIEYLRKNKLGYARFILL+KL      RI TP+  +RLFDL
Sbjct: 705  TASARLDDIVVDSVECGQHCIEYLRKNKLGYARFILLEKLRNLILKRIQTPENVKRLFDL 764

Query: 742  ITVKEKRFNNAFYSVLRDTLVCQNMEQANRVAYGKKRYRVVTLDGNLIDLSGTMTGGGRN 801
            +   +  F  AFYSVLR+TLV ++++QANRVAYG  R+RVVT+DG LID+SGT+TGGG+ 
Sbjct: 765  VKPDKDIFIPAFYSVLRNTLVAKDLKQANRVAYGATRFRVVTMDGKLIDISGTITGGGKQ 824

Query: 802  VXXXXXXXXXXXXXXXAFFSPEEVQAIENELNQKENQYKSALDAYHXXXXXXXXXXXXAP 861
                              +S ++++ IE EL ++EN +K A D Y              P
Sbjct: 825  TAQGLMKLRKKGQENIDIYSNDDIEKIEKELVERENNFKFANDTYFEMEQALQRLKDRKP 884

Query: 862  EIDNLVSKKEMDIETAHNDINSNINVLEEKRKKLESMKNQNDPSITXXXXXXXXXXXXDD 921
            E++  +SK  MD + +  ++ S  + L++K    E      D  +               
Sbjct: 885  ELELEISKCLMDTDISSKELESTQDQLKQKITFYERHTQNKDEVVEIEHQLNLLQKEYQL 944

Query: 922  IDVQXXXXXXXXXXXXXXXXELGGDELKNQSLLVTDITNKISENSRRXXXXXXXXXXXXX 981
            +                   E+GG +L+ Q+  V  I   I     +             
Sbjct: 945  LLDSTKNISEKIDKLKKRIMEIGGIDLQMQNSKVNSIIQNIDIIKSKQKRGISSMKKIEN 1004

Query: 982  XXXXXXXXXTEANEELTNFSKNAENADIESKEIESKLLDIKESIENLKENEVKLEHE--- 1038
                     + A  +    SK  ++   E + +E  L  I E+   L+    +LE E   
Sbjct: 1005 EIRRSEKALSGAELDFKTCSKEMDSFSQEMESVERSLGSIDETFLKLENENSELEIECCN 1064

Query: 1039 IEMKHNELESHQKVVSDYKSISLEYNNKLEKLEASEASLKKSIKRYNDLLSELTIRDVTQ 1098
            ++ K NE E      + +KS  ++  ++LEKL      +K+ IK Y++ L  L +R+ T 
Sbjct: 1065 LKEKINEAEIEG---TKFKSYEIDVKDRLEKLNNLLKHIKRVIKEYDEQLRALELRNTT- 1120

Query: 1099 VLNTIMTEE--NASVDKSDPKLENTSAVINADDDGISAVSENQSFNHNDENDDIDSN--K 1154
               TI  +E  N S++  D           +   G+    +N+    N+  ++ +S   +
Sbjct: 1121 ---TIFGDEGDNNSINGVDR---------TSHGGGVPLQDQNKVVRENNMRNEKNSTEAE 1168

Query: 1155 MEIDSQGGFINPGIPVLSASELAKVDPQEVELLITSLDDFITSSEANVDVLEEYALRFVE 1214
            MEID      +PGIP +S ++L ++D Q +E  I  L++++  +  N+DVLEEYA R  +
Sbjct: 1169 MEIDDVADEFSPGIPRISKAKLLQIDVQALEAEIGQLEEYVAITNVNIDVLEEYARRLAD 1228

Query: 1215 FNKRKNDLNSAVQSRDSVKDRLEGIKRKRYDEFMEGFKIISMTLKEMYQMITLGGNAELE 1274
            +N RK DLN AV+ R+++K  L+ +K+KRYDEFM+GF IISMTLKEMYQMIT+GGNAELE
Sbjct: 1229 YNSRKLDLNQAVERREALKKLLDELKKKRYDEFMQGFGIISMTLKEMYQMITMGGNAELE 1288

Query: 1275 LVDSLDPFSEGVTFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEID 1334
            L+DSLDPFSEGVTFSVMPPKKSWRNI+NLSGGEKTLSSLALVFALHKYKPTPLYVMDEID
Sbjct: 1289 LIDSLDPFSEGVTFSVMPPKKSWRNIANLSGGEKTLSSLALVFALHKYKPTPLYVMDEID 1348

Query: 1335 AALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELTKQLVGIYKHENMTKSAALVNEDL 1394
            AALDFRNVSIVANYIKERTKNAQFIVISLRNNMFEL +QL+GIYK +N TKSAA+ N+D 
Sbjct: 1349 AALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQLIGIYKRDNKTKSAAIRNKDF 1408

Query: 1395 VGRA 1398
            +  A
Sbjct: 1409 LKEA 1412

>KLTH0G13750g Chr7 complement(1184169..1188368) [4200 bp, 1399 aa]
            {ON} similar to uniprot|Q12267 Saccharomyces cerevisiae
            YLR086W SMC4 Subunit of the condensin complex which
            reorganizes chromosomes during cell division forms a
            stable complex with Smc2p that has ATP-hydrolyzing and
            DNA- binding activity and promotes knotting of circular
            DNA potential Cdc28p substrate
          Length = 1399

 Score = 1091 bits (2822), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 634/1422 (44%), Positives = 879/1422 (61%), Gaps = 54/1422 (3%)

Query: 5    PVSKRQKVTEEDEEEDVIHTPKAVTFEQSPRAITPRNL-LGSENRNVL---PTGGSQNLQ 60
            P+SK+QK T  + +ED   T ++V   ++ R+ TPR L LGS ++      P   S +  
Sbjct: 4    PLSKKQK-TFVNRDEDFSQTEESVDVTRASRSRTPRKLVLGSPDKRFAFSQPVTSSSS-N 61

Query: 61   IPSLLPPES-LGSARGRDFKSYXXXXXXXXXXXXXXXLKLIELSPIKNSRAELQKLYESK 119
            +P L P +S L S+RGR    Y               L+LI+LSP K +R E QK  + +
Sbjct: 62   VPYLQPLKSELSSSRGR---VYSQSPPRSPTRSPTRKLELIQLSPTKKTRLESQKTEQVR 118

Query: 120  KLDVKKERLFIHQLVLNDFKSYAGRQVIGPFHTSFSAIVGPNGSGKSNVIDSMLFVFGFR 179
             L    ERL I++L L++FKSYAG QV+GPFH+SFSA+VGPNGSGKSNVIDS+LFVFGFR
Sbjct: 119  GLAQPIERLCINRLSLHNFKSYAGTQVVGPFHSSFSAVVGPNGSGKSNVIDSLLFVFGFR 178

Query: 180  ANKMRQDRLSDLIHKSETFPDLKSCSVEVHFKYVIDKDDGSTTIDETKGNLVVTRKAFKN 239
            ANKMRQ +LSDLIHKSE  P+L SC VEV F+YV D+ DG TT+ + +  LVVTRKAFKN
Sbjct: 179  ANKMRQGKLSDLIHKSEAHPNLDSCHVEVFFQYVQDELDGRTTVRQDRPGLVVTRKAFKN 238

Query: 240  NASKYFVNGKESNYTEVTTLLKKEGIDLDHKRFLILQGEVENIAQMKAKAEKENDDGLLE 299
            N SKY+VNGKES+YT+VT LL+KEGIDLDHKRFLILQGEVE+IAQMK KAEKE DDGLLE
Sbjct: 239  NTSKYYVNGKESSYTQVTELLRKEGIDLDHKRFLILQGEVESIAQMKPKAEKEGDDGLLE 298

Query: 300  YLEDIIGTSKYKESIEKLSMEIESLNEICVEKENRFSIVEREKNSLESGKEEALQFXXXX 359
            YLEDIIGT+KYK  IE+  ++I+ LN++C EKENR+ IVEREK+SLESGK+EAL+F    
Sbjct: 299  YLEDIIGTAKYKPLIEQTLVQIDQLNDVCQEKENRYEIVEREKSSLESGKDEALEFLEKE 358

Query: 360  XXXXXXXXXXYQYNLMQXXXXXXXXXXXXTNVQQEQTKQEDEFRKANSHISDITASLNVL 419
                       Q+ L +              ++++ + +  ++ +    I  + +    L
Sbjct: 359  KKLTFLRSKLLQHKLWKNSFKSTNTQEKIKTLEEKLSAERAKYTEHKREIKQLESESKSL 418

Query: 420  KADLEKVHTEEVNLSKTKRTLENKKVENEQIVNNLDSKRKEFEEQSKILQDKINSTDQEI 479
               +  +   E +L+  KRT +  +V  E+ + N+  K+ + E+      + IN+T  ++
Sbjct: 419  NVTIRGIKDSESSLTSEKRTCDRDRVSLEEKLKNISQKKVKAEKTHHATVNSINATQAKL 478

Query: 480  QTIIEEQSSLAEGTTVLSTNXXXXXXXXXXXXXXXXXXTEHLTIQIAEYEKELSPWNEQS 539
            + + ++Q    +    L+ +                  T  +++QI E E+EL PWN + 
Sbjct: 479  EELFKDQVQYEKELDELNKSLLVEKTKLDEIKISLKGKTGAISVQIGEIEQELEPWNVKL 538

Query: 540  QQLKKEIKITESELSIIEENRKGLENDIAGLENAILSQKRDLEVQEQEIKSLLEQKTKVI 599
            Q+ + +IK+ E+++S+++E+   +  +I+  EN I + ++ +  Q Q I+ L ++ T + 
Sbjct: 539  QEKRSQIKLEETKISVLKESLAKIAEEISKSENDISNNRKKVAEQHQAIEGLEKEHTDIQ 598

Query: 600  QERELGERECKNAQATLANVREKVEALRQKAIEIRSTYSATENNNKVLSALLRLQKSGRL 659
            ++  +G+ EC NA   +  ++  +   RQ++++ +S+ S  EN NKVLSAL RLQ+SGR+
Sbjct: 599  RQIIIGQTECDNASNKMKEMKAVLTTHRQRSLDAKSSLSTFENKNKVLSALQRLQRSGRI 658

Query: 660  NGFHGRLGDLAVIDPKYDVAISTACPRLNDLVVDTVESGQQCIEYLRKNKLGYARFILLD 719
            +GFHGRLGDL  ID KYDVAISTACPRL+D+VV+TVE GQQCIE+LRKNKLGYARFILLD
Sbjct: 659  SGFHGRLGDLGTIDDKYDVAISTACPRLDDVVVETVECGQQCIEHLRKNKLGYARFILLD 718

Query: 720  KLNTFNTNRIDTPDQSQRLFDLITVKEKRFNNAFYSVLRDTLVCQNMEQANRVAYGKKRY 779
            KL +FN N I TP+   RLFDL+   + +F NAFYSVLRDTLV +++++ANRVAYGK+R+
Sbjct: 719  KLRSFNMNTIQTPNNVSRLFDLVHPIDNKFRNAFYSVLRDTLVAKDLKEANRVAYGKQRF 778

Query: 780  RVVTLDGNLIDLSGTMTGGGRNVXXXXXXXXXXXXXXXAFFSPEEVQAIENELNQKENQY 839
            RVVTLDG LIDLSGTM+GGG +                A F+ EEV+ I+ EL ++E  +
Sbjct: 779  RVVTLDGKLIDLSGTMSGGGNH--RASGMMKSERLNTGASFTAEEVRQIDEELTERERNF 836

Query: 840  KSALDAYHXXXXXXXXXXXXAPEIDNLVSKKEMDIETAHNDINSNINVLEEKRKKLESMK 899
            K A D  H             PEI+  +SK+ M+I++    + S I + E++   L+  +
Sbjct: 837  KIATDTLHEMEDALQSLKDREPEIETDISKRRMEIDS----LLSEIKLCEDRAASLKKEQ 892

Query: 900  NQNDPS----ITXXXXXXXXXXXXDDIDVQXXXXXXXXXXXXXXXXELGGDELKNQSLLV 955
              N+ S    I               ++ +                ++GG +L+ Q  LV
Sbjct: 893  KLNESSDDTLIEANSRLDSLKAECKLLEGEMKSKKNKIKELQEQIMKIGGTKLQLQGSLV 952

Query: 956  TDITNKISENSRRXXXXXXXXXXXXXXXXXXXXXXTEANEELTNFSKNAENADIE----S 1011
              I  +IS                            +A  +L  + K A    ++    +
Sbjct: 953  DSIGQRIS--------------ITLGKQKRDKTAVKKAENDLKRYEKQAGQLSVDIDQCT 998

Query: 1012 KEIES----------KLLDIKESIENLKENEVKLEHEIEMKHNELESHQKVVSDYKSISL 1061
             E+ES          K+L+++ SI+ L++   ++E ++      +E       D+    +
Sbjct: 999  NELESIKELISSSDNKILELEASIDKLQKEGEEIEEKVREIERLIEEKSSEGQDFAVFEV 1058

Query: 1062 EYNNKLEKLEASEASLKKSIKRYNDLLSELTIRDVT---QVLNTIMTEENASVDKSDPKL 1118
            + NN+LEKL      + K        L  L IRDVT   Q LN ++  E+ S D+   + 
Sbjct: 1059 DINNQLEKLNDLLNHIGKDGHDLLKQLESLKIRDVTATLQTLNKLLLSESRSGDELHGQS 1118

Query: 1119 ENTSAVINADDDGISAVSENQSFNHNDENDDIDSNKMEIDSQGGF-INPG-IPVLSASEL 1176
                +   ++ D +  V   +    N+       ++M++D       +P  +P L+ ++L
Sbjct: 1119 SEARSQEPSNGD-LMEVDTVEGCMGNEPTASQPEDQMDVDEPEEMETSPSDLPKLTEAQL 1177

Query: 1177 AKVDPQEVELLITSLDDFITSSEANVDVLEEYALRFVEFNKRKNDLNSAVQSRDSVKDRL 1236
             +++ +EVEL I  L+DF+ ++ A+++VLEEY  R V+F  RK +LN AV+ RDSV+   
Sbjct: 1178 KELNVEEVELEIGQLNDFVENAYADIEVLEEYTKRLVDFQARKLELNKAVEQRDSVRQNC 1237

Query: 1237 EGIKRKRYDEFMEGFKIISMTLKEMYQMITLGGNAELELVDSLDPFSEGVTFSVMPPKKS 1296
            + +++KR DEFM GF  ISMTLKEMYQMIT+GGNAELELVDSLDPFSEGV FSVMPPKKS
Sbjct: 1238 DNLRKKRLDEFMNGFNTISMTLKEMYQMITMGGNAELELVDSLDPFSEGVLFSVMPPKKS 1297

Query: 1297 WRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNA 1356
            WRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNA
Sbjct: 1298 WRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNA 1357

Query: 1357 QFIVISLRNNMFELTKQLVGIYKHENMTKSAALVNEDLVGRA 1398
            QFIVISLRNNMFEL +QLVGIYK+ NMTKS AL N+DL+ R+
Sbjct: 1358 QFIVISLRNNMFELAQQLVGIYKNRNMTKSVALENKDLINRS 1399

>Kwal_56.23825 s56 complement(721498..725688) [4191 bp, 1396 aa] {ON}
            YLR086W (SMC4) - SMC chromosomal ATPase family member
            [contig 172] FULL
          Length = 1396

 Score = 1073 bits (2776), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 634/1429 (44%), Positives = 865/1429 (60%), Gaps = 67/1429 (4%)

Query: 3    DRPVSKRQK--VTEEDEEEDVIHTPKAVTFEQSPRAITPRNL-LGSENRNVLPTGGSQNL 59
            D P++K+QK  V+ E E      +P      ++ R+ TPR L LGS ++       SQ +
Sbjct: 2    DSPLAKKQKTHVSNESENSSTEESPDVT---RASRSRTPRKLVLGSPDKRF---AFSQPV 55

Query: 60   Q-----IPSLLPPES-LGSARGRDFKSYXXXXXXXXXXXXXXXLKLIELSPIKNSRAELQ 113
                  +P L P ++ L S+RGR    Y               L+LI+LSP+K SR E Q
Sbjct: 56   SSSSSNVPHLQPLKNELSSSRGR---VYSQSPPRSPNRSPTRKLELIQLSPMKKSRLESQ 112

Query: 114  KLYESKKLDVKKERLFIHQLVLNDFKSYAGRQVIGPFHTSFSAIVGPNGSGKSNVIDSML 173
            K  ES+ +    +RL I +LVL++FKSYAG QV+GPFH SFSA+VGPNGSGKSNVIDS+L
Sbjct: 113  KFQESRAMMGSIQRLCIDRLVLHNFKSYAGTQVVGPFHNSFSAVVGPNGSGKSNVIDSLL 172

Query: 174  FVFGFRANKMRQDRLSDLIHKSETFPDLKSCSVEVHFKYVIDKDDGSTTIDETKGNLVVT 233
            FVFGFRANKMRQ +LS+LIHKSE  PDL SC V++ F+YV D+ DG+T+I + K ++V+ 
Sbjct: 173  FVFGFRANKMRQGKLSELIHKSELHPDLDSCHVDIFFQYVQDEPDGTTSIIQQKPSMVIR 232

Query: 234  RKAFKNNASKYFVNGKESNYTEVTTLLKKEGIDLDHKRFLILQGEVENIAQMKAKAEKEN 293
            RKAF+NN SKY++NGKES+YT +T LL+ EGIDLDHKRFLILQGEVE+IAQMK KAEKE+
Sbjct: 233  RKAFRNNTSKYYLNGKESSYTIITQLLRDEGIDLDHKRFLILQGEVESIAQMKPKAEKES 292

Query: 294  DDGLLEYLEDIIGTSKYKESIEKLSMEIESLNEICVEKENRFSIVEREKNSLESGKEEAL 353
            DDGLLEYLEDIIGT++YK  IE    EI  LN+IC EKENRF IVEREK+SLE GK EAL
Sbjct: 293  DDGLLEYLEDIIGTAQYKPLIENTLSEIAKLNDICEEKENRFEIVEREKSSLEQGKNEAL 352

Query: 354  QFXXXXXXXXXXXXXXYQYNLMQXXXXXXXXXXXXTNVQQEQTKQEDEFRKANSHISDIT 413
            ++               QY+L +               Q++ + ++ +  K +  ++ + 
Sbjct: 353  EYLEKEKTLTILRSKLLQYHLWKNEQKLNSTKEKIAKAQEKLSAEKAKRTKHSEEMAAMK 412

Query: 414  ASLNVLKADLEKVHTEEVNLSKTKRTLENKKVENEQIVNNLDSKRKEFEEQSKILQDKIN 473
            A L  LK  L  +   E  L+  KR  +  +V  E+ + NL  K  +     + +   I+
Sbjct: 413  ADLQSLKLILGDLGESEKKLTLEKRACDRDRVSLEEKLKNLTQKEVKSSRSLQSITSSIS 472

Query: 474  STDQEIQTIIEEQSSLAEGTTVLSTNXXXXXXXXXXXXXXXXXXTEHLTIQIAEYEKELS 533
            +T  +++ +  +Q    +    L+                       ++ QI E EKEL 
Sbjct: 473  TTQAKMEELANDQEQHEKDLLELNGTMKEEKEKLDEIKSSLKDKISLISEQIREIEKELE 532

Query: 534  PWNEQSQQLKKEIKITESELSIIEENRKGLENDIAGLENAILSQKRDLEVQEQEIKSLLE 593
            PWN + Q+ K ++K+ E+ +S+ +E+   +E DI  +   I   +  +  Q   + SL +
Sbjct: 533  PWNVKLQEKKAQVKLEETTISVFKESHAKIEQDIILVNKGIDELRNKMNEQRGSVFSLEK 592

Query: 594  QKTKVIQERELGERECKNAQATLANVREKVEALRQKAIEIRSTYSATENNNKVLSALLRL 653
            ++  + ++  +G+ EC NA   +  ++  + A RQ++I+ RS+ S  EN NKVL+ALLRL
Sbjct: 593  EQVDIGRQLTVGQSECDNAVKKIKEMKGILTAHRQRSIDARSSLSTFENKNKVLAALLRL 652

Query: 654  QKSGRLNGFHGRLGDLAVIDPKYDVAISTACPRLNDLVVDTVESGQQCIEYLRKNKLGYA 713
            Q+SGR++GFHGRLGDL  ID KYDVAISTACPRL+D+VV+TVE GQQCIEYLRKNKLGYA
Sbjct: 653  QRSGRISGFHGRLGDLGTIDDKYDVAISTACPRLDDIVVETVECGQQCIEYLRKNKLGYA 712

Query: 714  RFILLDKLNTFNTNRIDTPDQSQRLFDLITVKEKRFNNAFYSVLRDTLVCQNMEQANRVA 773
            RFILLDKL  FN + I TP+   RL+DL+     +F NAFYSVLRDTLV +++++AN+VA
Sbjct: 713  RFILLDKLRNFNLSPIKTPENVPRLYDLVRPNNPKFRNAFYSVLRDTLVAKDLKEANKVA 772

Query: 774  YGKKRYRVVTLDGNLIDLSGTMTGGGRNVXXXXXXXXXXXXXXXAFFSPEEVQAIENELN 833
            YGK+RYRVVTLDG LIDLSGTM+GGG                  + F+ EEVQ I+ EL+
Sbjct: 773  YGKQRYRVVTLDGKLIDLSGTMSGGG---NFKARGMMKSEQQSNSAFTAEEVQQIDKELS 829

Query: 834  QKENQYKSALDAYHXXXXXXXXXXXXAPEIDNLVSKKEMDIETAHNDINSNINVLEEKRK 893
            ++E+ ++ A D  H             PEI+  +SK+++DI++  +++ ++   LE   +
Sbjct: 830  EREHNFQIAADTLHEMEEALQKLKDREPEIELDISKRKLDIDSLSSEMKASEGRLEYLLQ 889

Query: 894  KLESMKNQNDPSITXXXXXXXXXXXXDDIDVQXXXXXXXXXXXXXXXXELGGDELKNQSL 953
            +    ++ N+   T             +++ +                ++GG +L+ QS 
Sbjct: 890  EKAQKESSNEELSTAEVKLKSLKSEYRELENEMQSKKKEMKVLQEQIMKVGGTKLQMQSS 949

Query: 954  LVTDITNKISENSRRXXXXXXXXXXXXXXXXXXXXXXTEANEELTNFSKNAE----NADI 1009
            +V  +  +I+    +                       +  EEL + S+       N D 
Sbjct: 950  MVDSVNQRITIVLAKSKKTKTDLKKAQNDIKRYQKQAEQLAEELKSCSQEKSLIENNLDS 1009

Query: 1010 ESKEIESKLLDIKESIENLKENEVKLEHEIEMKHNELESHQKVVS--DYKSISLEYNNKL 1067
             SK+++    ++ ESI  LK +E++L  E  ++  E    +K V   D++++ ++   +L
Sbjct: 1010 SSKKVD----ELSESINKLK-DELELTEE-RVRKAEESIDEKTVEGRDFEALEIQCVAQL 1063

Query: 1068 EKLEASEASLKKSIKRYNDLLSELTIRDVTQVLNTIMTEENASVDKSDPKLENTS----- 1122
            +KL+   A L K    +   L+ L IRDVT  L  +           D  LEN S     
Sbjct: 1064 DKLKELFAILNKEAAEFLHSLNSLKIRDVTATLQAL-----------DESLENESKNEVA 1112

Query: 1123 AVINADDDGISAVSENQSFNHN----DENDDIDSNKMEIDSQGG---------FINPGIP 1169
            A    ++DG     E+ S  H+    DEN    ++  E   Q G          +  G+P
Sbjct: 1113 AETPGEEDG-----EHSSSLHDPMDVDENQGESTSTTEAQLQAGEAERRNTEESLPNGLP 1167

Query: 1170 VLSASELAKVDPQEVELLITSLDDFITSSEANVDVLEEYALRFVEFNKRKNDLNSAVQSR 1229
             L   EL   + + VEL I  L D++ ++ A++++LEEYA R +E+  RK DLN AVQ R
Sbjct: 1168 KLLEDELENFEVETVELEIHQLQDYVENAYADIEILEEYARRLIEYKARKVDLNHAVQER 1227

Query: 1230 DSVKDRLEGIKRKRYDEFMEGFKIISMTLKEMYQMITLGGNAELELVDSLDPFSEGVTFS 1289
            D V+   E +K+KR DEFMEGF  I M LKEMYQMIT+GGNAELELVDSLDPFSEGV FS
Sbjct: 1228 DKVRQSNENLKKKRLDEFMEGFNAICMILKEMYQMITMGGNAELELVDSLDPFSEGVLFS 1287

Query: 1290 VMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYI 1349
            VMPPKKSWRNI+NLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYI
Sbjct: 1288 VMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYI 1347

Query: 1350 KERTKNAQFIVISLRNNMFELTKQLVGIYKHENMTKSAALVNEDLVGRA 1398
            KERTKNAQFIVISLRNNMFEL KQLVG+YK++NMTKS AL N DL+ R+
Sbjct: 1348 KERTKNAQFIVISLRNNMFELAKQLVGVYKNKNMTKSVALQNTDLIDRS 1396

>TBLA0E04410 Chr5 (1122005..1126273) [4269 bp, 1422 aa] {ON} Anc_8.259
            YLR086W
          Length = 1422

 Score = 1071 bits (2769), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 639/1446 (44%), Positives = 880/1446 (60%), Gaps = 75/1446 (5%)

Query: 1    MSDRPVSKRQKVTEEDEEE------------------------DVIHTP--------KAV 28
            M D P+SK+QK+TE  +E+                        D+   P        +  
Sbjct: 1    MPDSPISKKQKITESRDEDKKINNNIIINHNNRDINRSHVDDADITIGPYQGQEKHIQPQ 60

Query: 29   TFEQSPRAITPRNLL--GSENRNVL--PTGGSQNLQIPSLLPPESLGSARGRDF--KSYX 82
            + ++  R+ TPR L+   +++R  +  P   S + Q PSL  P S+ + R   F  +S  
Sbjct: 61   SQDRHGRSRTPRKLIVSSADHRFTMSQPNLLSADSQTPSLQHP-SVSTGREHKFYSQSPP 119

Query: 83   XXXXXXXXXXXXXXLKLIELSPIKNSRAELQKLYESKKLDVKKERLFIHQLVLNDFKSYA 142
                          L+LI+LSPIKN+RAELQK+YE ++   +  RL I +LVL +FKSYA
Sbjct: 120  RSPHRSPVRSPKKALELIQLSPIKNNRAELQKMYELQQTQKRTIRLVIERLVLTNFKSYA 179

Query: 143  GRQVIGPFHTSFSAIVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSETFPDLK 202
            GRQV+GPFHT+FSA+VGPNGSGKSNVIDSMLFVFGFRANKMRQ +L DLIHKSE +P+L 
Sbjct: 180  GRQVVGPFHTNFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGKLKDLIHKSEKYPELS 239

Query: 203  SCSVEVHFKYVIDKDDGSTT-IDETKGNLVVTRKAFKNNASKYFVNGKESNYTEVTTLLK 261
            SCSVE+HF+YVID  +G  + IDE+K  LVV RKAFKNN+SKY++N KES++T+VTTLLK
Sbjct: 240  SCSVEIHFQYVIDDPNGGPSKIDESKEKLVVMRKAFKNNSSKYYINDKESSFTQVTTLLK 299

Query: 262  KEGIDLDHKRFLILQGEVENIAQMKAKAEKENDDGLLEYLEDIIGTSKYKESIEKLSMEI 321
             EGIDLDHKRFLILQGEVENIAQMK K+EKE DDGLLEYLEDIIGTS YK  IE    ++
Sbjct: 300  NEGIDLDHKRFLILQGEVENIAQMKPKSEKEGDDGLLEYLEDIIGTSHYKVQIEHNLSKV 359

Query: 322  ESLNEICVEKENRFSIVEREKNSLESGKEEALQFXXXXXXXXXXXXXXYQYNLMQXXXXX 381
            E+LNEIC+EKENRF+IVE+EK+SL  GK EAL++              YQ+ L       
Sbjct: 360  EALNEICIEKENRFNIVEKEKDSLVDGKNEALKYLANEKNLVLAKSKKYQHQLYIDNKKL 419

Query: 382  XXXXXXXTNVQQEQTKQEDEFRKANSHISDITASLNVLKADLEKVHTEEVNLSKTKRTLE 441
                   T+ Q+   K+ +++   +  + ++      L   L +    E  L   +R   
Sbjct: 420  TSTLAKITDAQENYDKELEKYSTISKELKNLQDEEITLNKRLNETKKYEEKLLSNQRKNN 479

Query: 442  NKKVENEQIVNNLDSKRKEFEEQSKILQDKINSTDQEIQTIIEEQSSLAEGTTVLSTNXX 501
            ++ +  ++++ N++ K+   E+     +  I  T+ +++T+  +Q    +    L+    
Sbjct: 480  SELISTQEMIKNIEKKKDNAEKLVNTTEKSITQTNNKLETLNNQQEDYTKQIEELNEKLK 539

Query: 502  XXXXXXXXXXXXXXXXTEHLTIQIAEYEKELSPWNEQSQQLKKEIKITESELSIIEENRK 561
                            TE  + +I + EKEL P+  Q Q+   +I++ +SE+S++ EN+ 
Sbjct: 540  IEKSKLEEIKISLKGKTEQFSNEILKNEKELEPYQIQLQEKMSQIQLLQSEISLLNENKD 599

Query: 562  GLENDIAGLENAILSQKRDLEVQEQEI----KSLLEQKTKVIQERELGERECKNAQATLA 617
             L N+I  ++  I  +K  +    ++I    + LLEQ+ +V    E G+ E       + 
Sbjct: 600  NLSNEIISIKKLIEEKKLSVVRMSEKITGWKQQLLEQRKEV----ESGDIEFNKFTKKIQ 655

Query: 618  NVREKVEALRQKAIEIRSTYSATENNNKVLSALLRLQKSGRLNGFHGRLGDLAVIDPKYD 677
             +R+K+++ RQKA + R++ S  +N N VL+AL +LQKSGR++GF+GRLGDL VID KYD
Sbjct: 656  EMRDKLDSHRQKANDSRTSLSNVQNKNSVLTALFKLQKSGRISGFYGRLGDLGVIDEKYD 715

Query: 678  VAISTACPRLNDLVVDTVESGQQCIEYLRKNKLGYARFILLDKLNTFNTNRIDTPDQSQR 737
            VAISTACPRL DLVVD+V+ GQQCI+YLRKN+LGYARFILLDKL  FN NRI+TPD + R
Sbjct: 716  VAISTACPRLEDLVVDSVDCGQQCIDYLRKNRLGYARFILLDKLRKFNLNRIETPDNAPR 775

Query: 738  LFDLITVKEKRFNNAFYSVLRDTLVCQNMEQANRVAYGKKRYRVVTLDGNLIDLSGTMTG 797
            LFDLI V+E +F  AFYSVLRDTLV  N+  AN+VAYGK+R+RVVTLDG LID+SGTM+G
Sbjct: 776  LFDLIQVREDKFLPAFYSVLRDTLVATNLLHANKVAYGKRRFRVVTLDGKLIDISGTMSG 835

Query: 798  GGRNVXXXXXXXXXXXXXXXAF--FSPEEVQAIENELNQKENQYKSALDAYHXXXXXXXX 855
            GG N                 F   SPEEVQ +E EL   E  +K A ++          
Sbjct: 836  GG-NYVLRGLMKLGQDLPENDFEQTSPEEVQKLERELEILEKNFKVAYNSLKEMNQEILH 894

Query: 856  XXXXAPEIDNLVSKKEMDIETAHNDINSNINVLEEKRKKLESMKNQNDPSITXXXXXXXX 915
                 P  +  +SK  ++IE   N+I   I+ L+EK++  +   N ND            
Sbjct: 895  MKEQIPATELNISKTTIEIEYCENEIKQLISQLKEKQEIHDQESNNNDEIKVADDKLQAL 954

Query: 916  XXXXDDIDVQXXXXXXXXXXXXXXXXELGGDELKNQSLLVTDITNKIS-ENSRRXXXXXX 974
                  ++ Q                + GG ELK Q+  VT + N++   NS++      
Sbjct: 955  KKEYYSLNDQTKVTKQEIEKLRQQIMDAGGIELKMQNSKVTSLVNQLKIVNSKQKNDKSA 1014

Query: 975  XXXXXXXXXXXXXXXXTEANEELTNFSKNAENADIESKEIESKLLDIKESIENLKENEVK 1034
                            T  +  L  F  N EN+  +   +  +L  ++  I + +  + +
Sbjct: 1015 IKKNNNILKKLQNELNTTKDNSL-EFKTNLENSKKKVTLLSEELAKLESDINDTQNAKEE 1073

Query: 1035 LEHEIEMKHNELESHQKVVSDYKSISLEYNNKLEKLEASEASLKKSIKRYNDLLSELTIR 1094
            +   I+    + +  ++   ++KS  LE  NKL+KL+     L+K I + +  L+ LTIR
Sbjct: 1074 ILLNIDGNKEKAQELEEDSRNFKSFELEIKNKLDKLKDLSHHLEKQIGKLDTELNALTIR 1133

Query: 1095 DVTQVLNTI---MTEENASVDKSDPKLENTSAVINADDDGISAVSENQSFNHNDENDDID 1151
            +++Q L +    + + + S + +    ++TS+ +N+       VS            +I+
Sbjct: 1134 EISQNLESFDERLEKYDISKNGATEDTQHTSSALNS-------VS------------NIN 1174

Query: 1152 SNKMEIDSQGGFINPGIPVLSASELAKVDPQEVELLITSLDDFITSSEANVDVLEEYALR 1211
            ++ M+IDS    INPGI  LS  E+ ++D + ++  I +L++ +  S AN+++LEEY  R
Sbjct: 1175 TDTMDIDSTDNEINPGIKRLSELEINELDIESLDAEIENLEEQLEHSTANIEILEEYVRR 1234

Query: 1212 FVEFNKRKNDLNSAVQSRDSVKDRLEGIKRKRYDEFMEGFKIISMTLKEMYQMITLGGNA 1271
              E+ KRK+DL+ ++  +++ K+  E +K+KR +EF  GF IIS+TLKEMYQMIT+GGNA
Sbjct: 1235 LSEYKKRKSDLDESISEKETAKEETEVLKKKRLEEFTTGFDIISLTLKEMYQMITMGGNA 1294

Query: 1272 ELELVDSLDPFSEGVTFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMD 1331
            ELELVDSLDPFSEGVTFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMD
Sbjct: 1295 ELELVDSLDPFSEGVTFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMD 1354

Query: 1332 EIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELTKQLVGIYKHENMTKSAALVN 1391
            EIDAALDFRNVSIVANYIKERTK+AQ IVISLRNNMFEL+KQLVGIYK ENMT+SA LVN
Sbjct: 1355 EIDAALDFRNVSIVANYIKERTKDAQLIVISLRNNMFELSKQLVGIYKSENMTQSATLVN 1414

Query: 1392 EDLVGR 1397
             D++ R
Sbjct: 1415 NDMLNR 1420

>Ecym_4311 Chr4 complement(666871..671001) [4131 bp, 1376 aa] {ON}
            similar to Ashbya gossypii AGR089C
          Length = 1376

 Score = 1060 bits (2740), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 619/1391 (44%), Positives = 839/1391 (60%), Gaps = 65/1391 (4%)

Query: 38   TPRNLL-GSENRNVLPTGGSQN----LQIPSLLPPESLGSARGRDFKSYXXXXXXXXXXX 92
            TP  L+ GS  R  + +  S N    L+ PSL PP     +RGR    Y           
Sbjct: 15   TPSKLMFGSPGRKHVASQASSNSTTALRGPSLQPPTYSQLSRGRSV--YSQSPPRSPNRS 72

Query: 93   XXXXLKLIELSPIKNSRAELQKLYESKKLDVKKERLFIHQLVLNDFKSYAGRQVIGPFHT 152
                ++LI+LSPIKNSR ELQK+Y+ K+   K  RL I  L+LN+FKSYAG QV+GPFH+
Sbjct: 73   PARRIELIQLSPIKNSRLELQKIYDGKQTTTK--RLSIKNLILNNFKSYAGVQVVGPFHS 130

Query: 153  SFSAIVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSETFPDLKSCSVEVHFKY 212
            SFSA+VGPNGSGKSNVIDSMLFVFGFRANKMRQ +LS+LIHKSE   +L  CSVE+ F+Y
Sbjct: 131  SFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGKLSNLIHKSENHENLSFCSVEITFQY 190

Query: 213  VIDKDDGSTTIDETKGNLVVTRKAFKNNASKYFVNGKESNYTEVTTLLKKEGIDLDHKRF 272
            V+D  DG+T +      L V RK FKNN SKY++NGKES+YTEVT  L+ EGIDLDHKRF
Sbjct: 191  VMDDADGNTKVLPDVQELSVMRKVFKNNTSKYYINGKESSYTEVTQFLRNEGIDLDHKRF 250

Query: 273  LILQGEVENIAQMKAKAEKENDDGLLEYLEDIIGTSKYKESIEKLSMEIESLNEICVEKE 332
            LILQGEVE+IAQMK KA+ E DDGLLEYLEDIIGT+KYK  I    +E+++LN+IC+EKE
Sbjct: 251  LILQGEVESIAQMKPKADHEGDDGLLEYLEDIIGTAKYKSQIRDALVEMDTLNDICMEKE 310

Query: 333  NRFSIVEREKNSLESGKEEALQFXXXXXXXXXXXXXXYQYNLMQXXXXXXXXXXXXTNVQ 392
             RF +VE+EK SLE+GKE+AL+F               Q+++ +            +   
Sbjct: 311  IRFELVEKEKRSLEAGKEQALEFIAKEKQLTLLKSKQLQWDINKETKKLAVTLDKISAFT 370

Query: 393  QEQTKQEDEFRKANSHISDITASLNVLKADLEKVHTEEVNLSKTKRTLENKKVENEQIVN 452
            ++   + +++ +    I+D+    + L+  + K++ E+  L K K  L+ + V +E+ + 
Sbjct: 371  EKLENERNKYGELQKEITDLRELSDNLEEQITKINAEKSQLVKDKLQLQRELVSSEEKLK 430

Query: 453  NLDSKRKEFEEQSKILQDKINSTDQEIQTIIEEQSSLAEGTTVLSTNXXXXXXXXXXXXX 512
            +L+ KR + E+  ++ +  I   +  I+ + E Q+        L+ +             
Sbjct: 431  SLNQKRTKAEKTLQVAEKNIRHCENNIRRLNEAQTEFENSLLELNESLHSERSELDAIKM 490

Query: 513  XXXXXTEHLTIQIAEYEKELSPWNEQSQQLKKEIKITESELSIIEENRKGLENDIAGLEN 572
                 T  ++ ++A  EKEL PW  + +    +IK+ ESE+ II+E++  LE +I+ L  
Sbjct: 491  SLRDKTSSISEEVASLEKELEPWTTKLEAKNSQIKLAESEILIIKESKLKLEQEISQLRK 550

Query: 573  AILSQKRDLEVQEQEIKSLLEQKTKVIQERELGERECKNAQATLANVREKVEALRQKAIE 632
             I S K  +E  +++I  L ++   +       + EC +A+  L ++++ +   RQ+  +
Sbjct: 551  DIESYKDRIENHKKKINKLEKESAAITSFISTAQGECDSAKKKLVDMKQVLTNHRQRMTD 610

Query: 633  IRSTYSATENNNKVLSALLRLQKSGRLNGFHGRLGDLAVIDPKYDVAISTACPRLNDLVV 692
             R   S  EN NKVL AL RLQKSGR++GFHGRLGDL  ID KYD+AIS ACPRL+D+VV
Sbjct: 611  ARVALSNVENKNKVLGALCRLQKSGRIHGFHGRLGDLGTIDDKYDIAISVACPRLDDIVV 670

Query: 693  DTVESGQQCIEYLRKNKLGYARFILLDKLNTFNTNRIDTPDQSQRLFDLITVKEKRFNNA 752
            +TVE  QQCIE+LRKNKLGYARFILLDKL  FN  ++ TP+   RLFDL T K + F  A
Sbjct: 671  ETVECAQQCIEHLRKNKLGYARFILLDKLKKFNMAKVTTPENVPRLFDLTTPKNEIFAPA 730

Query: 753  FYSVLRDTLVCQNMEQANRVAYGKKRYRVVTLDGNLIDLSGTMTGGGRNVXXXXXXXXXX 812
             YSVLRDTLV +++ QANRVAYG +R+RVVTLDG LID+SGTM+GGG  V          
Sbjct: 731  LYSVLRDTLVAKDLAQANRVAYGTRRFRVVTLDGKLIDISGTMSGGGDRVVKGLMKSKQR 790

Query: 813  XXXXXAFFSPEEVQAIENELNQKENQYKSALDAYHXXXXXXXXXXXXAPEIDNLVSKKEM 872
                   ++ EEVQ +E EL  +E  +K A D +              P ID  +SK ++
Sbjct: 791  SND---MYTSEEVQRMEAELTDRETNFKIATDTFQEMEAALQKYKDRQPNIDVEISKHKI 847

Query: 873  DIETAHNDINSNINVLEEKRKKLESMKNQNDPSITXXXXXXXXXXXXDDIDVQXXXXXXX 932
            DI+T  +++ S  + L E     E+ +  N P                 +  +       
Sbjct: 848  DIDTLSSELQSKKDTLIELESTAENNQRDNGPLEDIENQLVALNSELVALKDESKVKNEQ 907

Query: 933  XXXXXXXXXELGGDELKNQSLLVTDITNKISENSRRXXXXXXXXXXXXXXXXXXXXXXTE 992
                     ++GG +L++Q+  V  +T ++                             +
Sbjct: 908  ISELRAQIMKIGGLKLQSQNSKVDSLTQQLQ---------------IIVAKQKKNRTELK 952

Query: 993  ANE-ELTNFSK---NAENADIESKEIE-SKLLDIKESI-ENLKENEVKLE---------- 1036
             NE E+   SK    AEN DI   EIE SK  +  E++ E L+E E  +E          
Sbjct: 953  KNELEMNRASKQKLGAEN-DINHCEIELSKTNNSHEALQEGLRETEHLIEVIEDKKEQLN 1011

Query: 1037 HEIEMKHNELESHQKVVSDYKSISLEYNNKLEKLEASEASLKKSIKRYNDLLSELTIRDV 1096
             E E     L+     V  +KS  +E    LEKL+  E  +K  I R ++ L+ L +RDV
Sbjct: 1012 QEHETAKKNLDDKAAYVEKFKSEEIEMCTHLEKLKNLEHHIKAEISRTDEELNTLKLRDV 1071

Query: 1097 TQVLNTIMTEENASVDK-SDPKLENTSAVI--------NAD-DDG-ISAVSEN-QSFNHN 1144
             Q+L   + E N  ++  +D  +  ++  I        +AD +DG    +SE+  SFN  
Sbjct: 1072 EQLLQK-LDEHNLPLESLTDRAVTPSNQCIPEMTVEDHDADMNDGEAKLISEDPNSFN-- 1128

Query: 1145 DENDDIDSNKMEIDSQGGFINPGIPVLSASELAKVDPQEVELLITSLDDFITSSEANVDV 1204
                  D   M++D    +I PG+P L+ +EL  +D +E+ L I  L +++ ++ A++D+
Sbjct: 1129 ------DQESMDVDQDASYIGPGLPKLTEAELDNIDIEELALEIAQLKEYMDTAYADIDI 1182

Query: 1205 LEEYALRFVEFNKRKNDLNSAVQSRDSVKDRLEGIKRKRYDEFMEGFKIISMTLKEMYQM 1264
            LEEYALR  E+ +RK DLN +V+ R+ +++R E +K+ R +EFM+GF IISMT+KE+YQM
Sbjct: 1183 LEEYALRLAEYKRRKLDLNESVEKREEIRNRYEMLKKSRLEEFMDGFGIISMTVKEIYQM 1242

Query: 1265 ITLGGNAELELVDSLDPFSEGVTFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKP 1324
            IT+GGNAELELVDSLDPFSEGV FSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKP
Sbjct: 1243 ITMGGNAELELVDSLDPFSEGVLFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKP 1302

Query: 1325 TPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELTKQLVGIYKHENMT 1384
            TPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFEL +QL+GIYK  NMT
Sbjct: 1303 TPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQLIGIYKSSNMT 1362

Query: 1385 KSAALVNEDLV 1395
            KS  L N D++
Sbjct: 1363 KSTTLQNIDIL 1373

>KLLA0F19085g Chr6 (1758111..1762229) [4119 bp, 1372 aa] {ON} similar
            to uniprot|Q12267 Saccharomyces cerevisiae YLR086W SMC4
            subunit of the condensin complex which reorganizes
            chromosomes during cell division
          Length = 1372

 Score = 1016 bits (2627), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 623/1431 (43%), Positives = 850/1431 (59%), Gaps = 107/1431 (7%)

Query: 1    MSDRPVSKRQKVTEEDEEEDVIHTPKAVTFEQSPRAITPRNL-LGSENRNVL------PT 53
            + D P  KRQ+V+                  QSP   TPR L LGS  +          T
Sbjct: 10   LGDSPEIKRQRVS------------------QSP-TRTPRKLVLGSPEKKYAVSNSQATT 50

Query: 54   GGSQNLQIPSLLPPESLGSARGRDF-KSYXXXXXXXXXXXXXXXLKLIELSPIKNSRAEL 112
              S  +  PSL PP +  + RGR++ +S                L+LI LSP K++R EL
Sbjct: 51   AASNTMDPPSLQPP-TAHAVRGREYSQSPPRSPTRSPTRSPTRKLELIRLSPKKSTRLEL 109

Query: 113  QKLYESKKLDVKKERLFIHQLVLNDFKSYAGRQVIGPFHTSFSAIVGPNGSGKSNVIDSM 172
            QK++E+       +RL I +LVLN+FKSYAG Q IGPFHTSFSA+VGPNGSGKSNVIDSM
Sbjct: 110  QKMHEAN--TQTSQRLCIDKLVLNNFKSYAGIQEIGPFHTSFSAVVGPNGSGKSNVIDSM 167

Query: 173  LFVFGFRANKMRQDRLSDLIHKSETFPDLKSCSVEVHFKYVIDKDDGSTTIDETKGNLVV 232
            LFVFGFRANKMRQ +LS+LIHKSE FP L SCSV++HF YV D D+G T I  + G +VV
Sbjct: 168  LFVFGFRANKMRQGKLSELIHKSEQFPSLASCSVQIHFHYVHDTDNGETKILPSAGTMVV 227

Query: 233  TRKAFKNNASKYFVNGKESNYTEVTTLLKKEGIDLDHKRFLILQGEVENIAQMKAKAEKE 292
             R+AFKNN+SKY+VNGKESNYTEVT LLK+EGIDLDHKRFLILQGEVE+IAQMKAKAEK+
Sbjct: 228  ERRAFKNNSSKYYVNGKESNYTEVTRLLKEEGIDLDHKRFLILQGEVESIAQMKAKAEKD 287

Query: 293  NDDGLLEYLEDIIGTSKYKESIEKLSMEIESLNEICVEKENRFSIVEREKNSLESGKEEA 352
            NDDGLLEYLEDIIGT+K+K  IEK   EIE+LNE+C+EKENRF +V++EK +LESGKEEA
Sbjct: 288  NDDGLLEYLEDIIGTAKFKPQIEKCLEEIETLNEVCMEKENRFELVDKEKQNLESGKEEA 347

Query: 353  LQFXXXXXXXXXXXXXXYQYNLMQXXXXXXXXXXXXTNVQQEQTKQEDEFRKANSHISDI 412
            L+F               Q  +              + +  E  +++ ++         +
Sbjct: 348  LEFLDKERKHTILKAQLLQRQIYDSNRKLATSCDKISALNMEFQEEKSQYEHLQKEAETL 407

Query: 413  TASLNVLKADLEKVHTEEVNLSKTKRTLENKKVENEQIVNNLDSKRKEFEEQSKILQDKI 472
            T  +N  K +   + TE  N++  KR+LE   +  ++ + ++  K K  E+     +   
Sbjct: 408  THEINNTKKESTALETESKNVNSKKRSLEKDFIATDEKLKSIARKLKAAEKAFSQSESNG 467

Query: 473  NSTDQEIQTIIEEQSSLAEGTTVLSTNXXXXXXXXXXXXXXXXXXTEHLTIQIAEYEKEL 532
             +   EI+++ +           L+ +                  T+ L+ ++   E++L
Sbjct: 468  KAAVNEIESLKKNHDDCEIELHNLNHSISIEKEKLNEIKIHLHEKTKDLSQEMESLERQL 527

Query: 533  SPWNEQSQQLKKEIKITESELSIIEENRKGLENDIAGLENAILSQKRDLEVQEQEIK--- 589
             P+ +Q Q+ + EIK++E+++++++ +   L  + A +E+ I     DL+++E + K   
Sbjct: 528  EPFRDQIQEKQSEIKLSETKITMLKSSHSNLLKEKATIESKI----EDLQLEELKQKETE 583

Query: 590  -SLLEQKTKVIQERELGERECKNAQATLANVREKVEALRQKAIEIRSTYSATENNNKVLS 648
             SL  +K+KV       ++EC+ AQ     +R+ +   RQ   E ++  +  +N N+VL 
Sbjct: 584  TSLRNEKSKVEARISTAQKECEEAQKQTNEMRDVLIQQRQIVEEAKANLNGFQNKNRVLL 643

Query: 649  ALLRLQKSGRLNGFHGRLGDLAVIDPKYDVAISTACPRLNDLVVDTVESGQQCIEYLRKN 708
            AL +LQ SGR+ GFHGRLGDL  ID +YD+AISTACPRL+D+VV+TVE GQQCI++LRKN
Sbjct: 644  ALTKLQNSGRITGFHGRLGDLGTIDDQYDIAISTACPRLDDIVVETVECGQQCIDHLRKN 703

Query: 709  KLGYARFILLDKLNTFNTNRIDTPDQSQRLFDLITVKEKRFNNAFYSVLRDTLVCQNMEQ 768
            KLGY RFILLDKL   N +RI TP+   RLFDLIT     F  AFYSVLRDTLV ++++Q
Sbjct: 704  KLGYGRFILLDKLRKCNLDRIATPENVPRLFDLITPVRDLFRPAFYSVLRDTLVARDLQQ 763

Query: 769  ANRVAYGKKRYRVVTLDGNLIDLSGTMTGGGRNVXXXXXXXXXXXXXXXAFFSPEEVQAI 828
            ANRVAYGK+R+RVVTLDG LID+SGTM+                     + +S +EV+ +
Sbjct: 764  ANRVAYGKRRFRVVTLDGKLIDISGTMS---GGGSSPQSGLMRSKATTASQYSRDEVEKM 820

Query: 829  ENELNQKENQYKSALDAYHXXXXXXXXXXXXAPEIDNLVSKKEM-------DIETAHNDI 881
            E +L+ KE  Y+SAL   H             PEID  +SK ++       ++E+ H  +
Sbjct: 821  EVQLSTKETNYRSALSMVHEMESALQKLTDRLPEIDIQISKIQLEKGSRVAEVESYHQRL 880

Query: 882  NS----------NINVLEEKRKKLESMKNQNDPSITXXXXXXXXXXXXDDIDVQXXXXXX 931
            +           N   L ++ KKL+ ++     +I              D  +Q      
Sbjct: 881  SQLARELSMNEKNQQPLLDEEKKLDILRQHLQQTIDASKFSQDKIDDLKDRIMQK----- 935

Query: 932  XXXXXXXXXXELGGDELKNQSLLVTDITNKI---SENSRRXXXXXXXXXXXXXXXXXXXX 988
                        GG ELK Q   V  +   I    E  ++                    
Sbjct: 936  ------------GGIELKMQIAKVASLEQHIEILHEKQKKEKTRSKKLDIDLARATREKN 983

Query: 989  XXTE----ANEELTNFSKNAENADIESKEIESKLLDIKESIENLKENEVKLEHEIEMKHN 1044
              +E     N++++  S+  E+  +E + IE ++      IEN  E + +L   +E    
Sbjct: 984  KYSEEVLVCNKDISILSEQLESIRLEKERIEEQV------IEN-NERKAELNSSVEKLKQ 1036

Query: 1045 ELESHQKVVSDYKSISLEYNNKLEKLEASEASLKKSIKRYNDLLSELTIRDVTQVLNTIM 1104
            EL S ++  +++K+  LEY+++LEKL   +  +KK ++ Y   L  L IRDV+++L+ + 
Sbjct: 1037 ELLSIERDSNEFKAKELEYSDRLEKLHGLQEYVKKQLRSYETSLQSLKIRDVSKLLSQL- 1095

Query: 1105 TEENASVDKSDPKLENTSAVINADDDGISAVSENQSFNHNDENDDIDSNKMEIDSQGGFI 1164
               N  + +S   +  T+ V+N D      + + QS      ND ++      DS     
Sbjct: 1096 ---NDGIIESCTDV--TAKVMNGD------IVQTQSITDVGNNDAME------DSGEAAT 1138

Query: 1165 NPGIPVLSASELAKVDPQEVELLITSLDDFITSSEANVDVLEEYALRFVEFNKRKNDLNS 1224
            + G+P L+ +EL  +D + +EL +  L D++ +   +++VLEEYA R  E+ +RK DLN 
Sbjct: 1139 HSGLPSLTETELENLDLETLELELHQLQDYLDNFNGDIEVLEEYARRLAEYQRRKLDLNQ 1198

Query: 1225 AVQSRDSVKDRLEGIKRKRYDEFMEGFKIISMTLKEMYQMITLGGNAELELVDSLDPFSE 1284
            AV  R+ V+++ E  K +R ++FMEGF IISMTLKEMYQMIT+GGNAELELVDSLDPFSE
Sbjct: 1199 AVAKREEVRNKCESFKNERLEKFMEGFGIISMTLKEMYQMITMGGNAELELVDSLDPFSE 1258

Query: 1285 GVTFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSI 1344
            GV FSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSI
Sbjct: 1259 GVLFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSI 1318

Query: 1345 VANYIKERTKNAQFIVISLRNNMFELTKQLVGIYKHENMTKSAALVNEDLV 1395
            VANYIKERTKNAQFIVISLRNNMFEL + LVGIYK+ NMTKS  L N D++
Sbjct: 1319 VANYIKERTKNAQFIVISLRNNMFELAQNLVGIYKNNNMTKSTTLQNIDIL 1369

>YLR086W Chr12 (302243..306499) [4257 bp, 1418 aa] {ON}  SMC4Subunit
           of the condensin complex; reorganizes chromosomes during
           cell division; forms a complex with Smc2p that has
           ATP-hydrolyzing and DNA-binding activity; required for
           tRNA gene clustering at the nucleolus; potential Cdc28p
           substrate
          Length = 1418

 Score =  797 bits (2059), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 435/913 (47%), Positives = 593/913 (64%), Gaps = 38/913 (4%)

Query: 1   MSDRPVSKRQK----------VTEEDEEEDVIHTPKAVTFEQSP------------RAIT 38
           MSD P+SKRQK          + + D EED     +    E +P            ++ T
Sbjct: 1   MSDSPLSKRQKRKSAQEPELSLDQGDAEEDSQVENRVNLSENTPEPDLPALEASYSKSYT 60

Query: 39  PRNLLGS--ENRNVL--PTGGSQ-NLQIPSLLPPESLGSARGRDFKSYXXXXXXXXXXXX 93
           PR L+ S  ENR     PT  +  +L +P+L PP++  S+RGRD KSY            
Sbjct: 61  PRKLVLSSGENRYAFSQPTNSTTTSLHVPNLQPPKT--SSRGRDHKSYSQSPPRSPGRSP 118

Query: 94  XXXLKLIELSPIKNSRAELQKLYESKKLDVKKE-RLFIHQLVLNDFKSYAGRQVIGPFHT 152
              L+L++LSP+KNSR ELQK+Y+  +   K++ RLFI++LVL +FKSYAG+QV+GPFHT
Sbjct: 119 TRRLELLQLSPVKNSRVELQKIYDRHQSSSKQQSRLFINELVLENFKSYAGKQVVGPFHT 178

Query: 153 SFSAIVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSETFPDLKSCSVEVHFKY 212
           SFSA+VGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSE FP L+SCSV VHF+Y
Sbjct: 179 SFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSEAFPSLQSCSVAVHFQY 238

Query: 213 VIDKDDGSTTIDETKGNLVVTRKAFKNNASKYFVNGKESNYTEVTTLLKKEGIDLDHKRF 272
           VID+  G++ IDE K  L++TRKAFKNN+SKY++N KES+YTEVT LLK EGIDLDHKRF
Sbjct: 239 VIDESSGTSRIDEEKPGLIITRKAFKNNSSKYYINEKESSYTEVTKLLKNEGIDLDHKRF 298

Query: 273 LILQGEVENIAQMKAKAEKENDDGLLEYLEDIIGTSKYKESIEKLSMEIESLNEICVEKE 332
           LILQGEVENIAQMK KAEKE+DDGLLEYLEDIIGT+ YK  IE+   +IE+LNE+C+EKE
Sbjct: 299 LILQGEVENIAQMKPKAEKESDDGLLEYLEDIIGTANYKPLIEERMGQIENLNEVCLEKE 358

Query: 333 NRFSIVEREKNSLESGKEEALQFXXXXXXXXXXXXXXYQYNLMQXXXXXXXXXXXXTNVQ 392
           NRF IV+REKNSLESGKE AL+F              +Q+ L+Q            ++  
Sbjct: 359 NRFEIVDREKNSLESGKETALEFLEKEKQLTLLRSKLFQFKLLQSNSKLASTLEKISSSN 418

Query: 393 QEQTKQEDEFRKANSHISDITASLNVLKADLEKVHTEEVNLSKTKRTLENKKVENEQIVN 452
           ++   ++ +F+++   + +I A    +K  +    ++E  L   +R LE  +V  E+   
Sbjct: 419 KDLEDEKMKFQESLKKVDEIKAQRKEIKDRISSCSSKEKTLVLERRELEGTRVSLEERTK 478

Query: 453 NLDSKRKEFEEQSKILQDKINSTDQEIQTIIEEQSSLAEGTTVLSTNXXXXXXXXXXXXX 512
           NL SK ++ E+  K  +  I+  +  ++ +  +Q+        L+               
Sbjct: 479 NLVSKMEKAEKTLKSTKHSISEAENMLEELRGQQTEHETEIKDLTQLLEKERSILDDIKL 538

Query: 513 XXXXXTEHLTIQIAEYEKELSPWNEQSQQLKKEIKITESELSIIEENRKGLENDIAGLEN 572
                T++++ +I  +EKEL PW+ Q Q+ + +I++ ESELS++EE +  L+ ++  LE 
Sbjct: 539 SLKDKTKNISAEIIRHEKELEPWDLQLQEKESQIQLAESELSLLEETQAKLKKNVETLEE 598

Query: 573 AILSQKRDLEVQEQEIKSL---LEQKTKVIQ-ERELGERECKNAQATLANVREKVEALRQ 628
            IL++K      +QE++ L   L++K   ++ ER  GE+   +A   L  +++ + A RQ
Sbjct: 599 KILAKK----THKQELQDLILDLKKKLNSLKDERSQGEKNFTSAHLKLKEMQKVLNAHRQ 654

Query: 629 KAIEIRSTYSATENNNKVLSALLRLQKSGRLNGFHGRLGDLAVIDPKYDVAISTACPRLN 688
           +A+E RS+ S  +N +KVL+AL RLQKSGR+NGFHGRLGDL VID  +DVAISTACPRL+
Sbjct: 655 RAMEARSSLSKAQNKSKVLTALSRLQKSGRINGFHGRLGDLGVIDDSFDVAISTACPRLD 714

Query: 689 DLVVDTVESGQQCIEYLRKNKLGYARFILLDKLNTFNTNRIDTPDQSQRLFDLITVKEKR 748
           D+VVDTVE  Q CI+YLRKNKLGYARFILLD+L  FN   I TP+   RLFDL+  K  +
Sbjct: 715 DVVVDTVECAQHCIDYLRKNKLGYARFILLDRLRQFNLQPISTPENVPRLFDLVKPKNPK 774

Query: 749 FNNAFYSVLRDTLVCQNMEQANRVAYGKKRYRVVTLDGNLIDLSGTMTGGGRNVXXXXXX 808
           F+NAFYSVLRDTLV QN++QAN VAYGKKR+RVVT+DG LID+SGTM+GGG +V      
Sbjct: 775 FSNAFYSVLRDTLVAQNLKQANNVAYGKKRFRVVTVDGKLIDISGTMSGGGNHVAKGLMK 834

Query: 809 XXXXXXXXXAFFSPEEVQAIENELNQKENQYKSALDAYHXXXXXXXXXXXXAPEIDNLVS 868
                      ++PEEV  IE EL+++EN ++ A D  H             P++++ +S
Sbjct: 835 LGTNQSDKVDDYTPEEVDKIERELSERENNFRVASDTVHEMEEELKKLRDHEPDLESQIS 894

Query: 869 KKEMDIETAHNDI 881
           K EM+ ++  +++
Sbjct: 895 KAEMEADSLASEL 907

 Score =  392 bits (1006), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 220/409 (53%), Positives = 282/409 (68%), Gaps = 13/409 (3%)

Query: 997  LTNFSKNAENADIESKEIESKL----LDIKESIENLKEN---EVKLEHEIEMKHNELESH 1049
            L N  ++ E +  E K IE +L    L + E+  N+ E    +V+L+ + E    ++E  
Sbjct: 1016 LQNSERDVELSSDELKVIEEQLKHTKLALAENDTNMNETLNLKVELKEQSEQLKEQMEDM 1075

Query: 1050 QKVVSDYKSISLEYNNKLEKLEASEASLKKSIKRYNDLLSELTIRDVTQVLNTIMTEENA 1109
            ++ ++++KSI +E  NKLEKL +    +K  I +    L+EL+IRDVT  L   M ++N 
Sbjct: 1076 EESINEFKSIEIEMKNKLEKLNSLLTYIKSEITQQEKGLNELSIRDVTHTLG--MLDDN- 1132

Query: 1110 SVDKSDPKLENTSAVINADDDGISAVSENQSFNHNDENDDIDSNKMEIDSQGGFINPGIP 1169
               K D   E+       D +  S  ++++S   + E    + + M ID     ++ GIP
Sbjct: 1133 ---KMDSVKEDVKNNQELDQEYRSCETQDESEIKDAETSCDNYHPMNIDETSDEVSRGIP 1189

Query: 1170 VLSASELAKVDPQEVELLITSLDDFITSSEANVDVLEEYALRFVEFNKRKNDLNSAVQSR 1229
             LS  EL ++D + +E  I  L  ++  +  ++ VLEEYA R  EF +RK DLN+AVQ R
Sbjct: 1190 RLSEDELRELDVELIESKINELSYYVEETNVDIGVLEEYARRLAEFKRRKLDLNNAVQKR 1249

Query: 1230 DSVKDRLEGIKRKRYDEFMEGFKIISMTLKEMYQMITLGGNAELELVDSLDPFSEGVTFS 1289
            D VK++L  +K+KR+DEFM GF IISMTLKEMYQMIT+GGNAELELVDSLDPFSEGVTFS
Sbjct: 1250 DEVKEQLGILKKKRFDEFMAGFNIISMTLKEMYQMITMGGNAELELVDSLDPFSEGVTFS 1309

Query: 1290 VMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYI 1349
            VMPPKKSWRNI+NLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYI
Sbjct: 1310 VMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYI 1369

Query: 1350 KERTKNAQFIVISLRNNMFELTKQLVGIYKHENMTKSAALVNEDLVGRA 1398
            KERTKNAQFIVISLRNNMFEL +QLVG+YK +N TKS  + N D++ R 
Sbjct: 1370 KERTKNAQFIVISLRNNMFELAQQLVGVYKRDNRTKSTTIKNIDILNRT 1418

>TPHA0J00720 Chr10 (161017..165198) [4182 bp, 1393 aa] {ON}
           Anc_8.259 YLR086W
          Length = 1393

 Score =  708 bits (1827), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 419/911 (45%), Positives = 572/911 (62%), Gaps = 44/911 (4%)

Query: 1   MSDRPVSKRQKVTEEDEEEDVIH-TPK-AVTFEQSP--------RAITPRNLLGSENRN- 49
           MS  P +K+QKV + +    + +  PK A +   SP        ++ TP  ++ S N + 
Sbjct: 1   MSALPDAKKQKVKDIESNSPLNNDIPKIAQSRNDSPLQVANDPLKSYTPMKVIISNNHSN 60

Query: 50  ---VLPTG-GSQNLQIPSLLPPESLGSARGRDFKSYXXXXXXXX----XXXXXXXLKLIE 101
               LP+   S + Q PSL  P S  S+RGR  K+Y                   L+LI+
Sbjct: 61  SISPLPSQLMSSSTQPPSLQHPSS--SSRGRAVKAYSQSPPRSPDRSPVRSPTRKLELIQ 118

Query: 102 LSPIKNSRAELQKLYESKKLDVKKERLFIHQLVLNDFKSYAGRQVIGPFHTSFSAIVGPN 161
           LSPIKNSR+ELQK+Y SK+ + K ER+ +++LVL++FKSYAG Q IGPFH+SFSA+VGPN
Sbjct: 119 LSPIKNSRSELQKIYSSKQ-EEKIERICLNKLVLHNFKSYAGTQTIGPFHSSFSAVVGPN 177

Query: 162 GSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSETFPDLKSCSVEVHFKYVIDKDDGST 221
           GSGKSNVIDSMLFVFGFRANKMRQ +L+DLIHKSE +PDL SC+V+VHF+Y+ID  D +T
Sbjct: 178 GSGKSNVIDSMLFVFGFRANKMRQGKLADLIHKSEEYPDLTSCAVDVHFEYLIDYPDDTT 237

Query: 222 TIDETKGNLVVTRKAFKNNASKYFVNGKESNYTEVTTLLKKEGIDLDHKRFLILQGEVEN 281
            I+ +K  L++TR+AFKN+ SKY++NGKESNY  +T LLK+EGIDLDH RFLILQGEVEN
Sbjct: 238 KINPSKQPLIITRRAFKNSTSKYYLNGKESNYKTITALLKEEGIDLDHNRFLILQGEVEN 297

Query: 282 IAQMKAKAEKENDDGLLEYLEDIIGTSKYKESIEKLSMEIESLNEICVEKENRFSIVERE 341
           IAQMK KAEKE DDGLLEYLEDIIGT+KYKE I+K  +EIE+LN+IC+E+ENRF I++RE
Sbjct: 298 IAQMKPKAEKEGDDGLLEYLEDIIGTTKYKELIDKKFIEIEALNDICIERENRFDIIDRE 357

Query: 342 KNSLESGKEEALQFXXXXXXXXXXXXXXYQYNLMQXXXXXXXXXXXXTNVQQEQTKQEDE 401
           K SLES KE AL++               QY + Q            +N  ++ TK EDE
Sbjct: 358 KESLESEKESALEYLSKEKEQVIVKSKLIQYKIWQ-------NNIKLSNTLEKITKLEDE 410

Query: 402 FRKANSHISDITASLNVLKA-------DLEKVHTEEVNLSKTKRTLENKKVENEQIVNNL 454
           + +  +  +++   ++ L+        +L+ +  +E  L   KR+L++  V N + + N+
Sbjct: 411 YNQEKNKNTELKNKIDELRKLYTKNQDELQALLKDEKELVNAKRSLDSDNVSNTEQLKNI 470

Query: 455 DSK----RKEFEEQSKILQDKINSTDQEIQTIIEEQSSLAEGTTVLSTNXXXXXXXXXXX 510
           + K     KE EE  K     I+S++  ++   + +         L  N           
Sbjct: 471 EKKLKKTAKEIEEDLKT----ISSSNVRLKNFHDNKKLFETQLIELDNNLVTESQLLENI 526

Query: 511 XXXXXXXTEHLTIQIAEYEKELSPWNEQSQQLKKEIKITESELSIIEENRKGLENDIAGL 570
                  T  L+ +I + EK+L PWN +  +LK EI+I ESE ++ EE++  L+ +I  L
Sbjct: 527 KLDLKDKTVGLSEEILKTEKDLEPWNIKLDELKSEIQIKESEKALFEESKNKLKANIEAL 586

Query: 571 ENAILSQKRDLEVQEQEIKSLLEQKTKVIQERELGERECKNAQATLANVREKVEALRQKA 630
           E  +  + +  E + +E+K+L+ +   V +E   G  E K A   L  +++ +   RQKA
Sbjct: 587 EKDVNEKSKLTEDRRKEVKNLMTKLENVSKEVIFGTNELKKANEKLCEMQKILIQDRQKA 646

Query: 631 IEIRSTYSATENNNKVLSALLRLQKSGRLNGFHGRLGDLAVIDPKYDVAISTACPRLNDL 690
            + R++ S  EN +KVL ALL+LQKSGR+NGFHGRLG+L VID KYDVAISTACPRLND+
Sbjct: 647 NDARTSLSNVENRSKVLRALLKLQKSGRINGFHGRLGNLGVIDEKYDVAISTACPRLNDI 706

Query: 691 VVDTVESGQQCIEYLRKNKLGYARFILLDKLNTFNTNRIDTPDQSQRLFDLITVKEKRFN 750
           VVD+VE GQQCIEYLRKN LG+ARFILLDKLN F+  +I TP    RLFDLI V +++F 
Sbjct: 707 VVDSVECGQQCIEYLRKNNLGHARFILLDKLNKFSMEKISTPRNVPRLFDLIKVNDEKFL 766

Query: 751 NAFYSVLRDTLVCQNMEQANRVAYGKKRYRVVTLDGNLIDLSGTMTGGGRNVXXXXXXXX 810
            AFYSVLR+TLV  ++++AN VAYGK RYRVVTL GNLID+SGTM+GGG           
Sbjct: 767 PAFYSVLRNTLVANDLKEANAVAYGKTRYRVVTLKGNLIDISGTMSGGGNQASKGAMQLS 826

Query: 811 XXXXXXXAFFSPEEVQAIENELNQKENQYKSALDAYHXXXXXXXXXXXXAPEIDNLVSKK 870
                  + +S EEV  IE EL+ +E  Y++A +                P+I+  +SK 
Sbjct: 827 NSTSKEKSTYSSEEVMEIEKELSIREKNYQNAYNTVQEMEIELRNLKESEPKIELEISKL 886

Query: 871 EMDIETAHNDI 881
             +I++  N+ 
Sbjct: 887 NFEIDSLENEC 897

>NDAI0G03320 Chr7 (781468..785163) [3696 bp, 1231 aa] {ON} 
          Length = 1231

 Score =  144 bits (364), Expect = 5e-34,   Method: Compositional matrix adjust.
 Identities = 128/410 (31%), Positives = 204/410 (49%), Gaps = 38/410 (9%)

Query: 1014 IESKLLDIKESIENLKENEVKLEHEIEMKHNELESHQK----VVSDYKSISLEYN---NK 1066
            IE+KL    E +EN ++     E  +E  H  L+S QK    +    K I  E N   N+
Sbjct: 834  IENKLQFEIERLENTQKRLTSAESNLEKAHETLKSLQKDENELAEQVKQIESEINSARNE 893

Query: 1067 LEKLEASEASLKKSIKRYNDLLSELTIRDVTQVLNTIMTEENASVDKSDPKLENTSAVIN 1126
            L+ +     + +  I R  + L EL   D +Q L     E    + K+D  LE    + N
Sbjct: 894  LDSVNKVFTAQQLDINRMEESLGELN--DNSQTLKRNRDEIKEDIAKND--LERIGILKN 949

Query: 1127 AD--DDGISAVSENQSFNHND-ENDDIDSNKMEIDSQGGFINPGIPVLSASELAKVDPQE 1183
            A   +  I  +SE    N +D   D ID + + + ++       +P     E+      E
Sbjct: 950  AKVTNIDIPVISET---NLSDLPIDRIDEDTISVSNEIDVDYTALPAKYKEEMGSATKNE 1006

Query: 1184 VELLITSLDDFITSSEANVDVLEEYALRFVEFNKRKNDLNSAVQS-----RDSVKDRLEG 1238
            ++  I +++D +   + N       A RF E  +R   ++   +      R +++  L+ 
Sbjct: 1007 LDTKIKNVEDLLDVLQPNARA----ADRFTEAQERFEIIDGETEKIKTTERKALQQFLK- 1061

Query: 1239 IKRKRYDEFMEGFKIISMTLKEMYQMIT---------LGGNAELELVDSLDPFSEGVTFS 1289
            IK+KR + F   F  +S  L  +Y+ +T          GGNA L L D  +PF+ GV + 
Sbjct: 1062 IKKKRKELFENAFDFVSEHLDNIYRELTRNPNSSADLAGGNASLTLEDEDEPFNAGVRYH 1121

Query: 1290 VMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYI 1349
              PP K ++++  LSGGEKT+++LAL+FA++ Y+P+P +V+DE+DAALD  NV  +A YI
Sbjct: 1122 ATPPLKRFKDMEYLSGGEKTVAALALLFAINAYQPSPFFVLDEVDAALDITNVERIAAYI 1181

Query: 1350 KER-TKNAQFIVISLRNNMFELTKQLVGIYKHENMTKSAALVNEDLVGRA 1398
            +     N QFIVISL+N MFE +  LVG+++ +    S+ +V  DL   A
Sbjct: 1182 RRHGNPNLQFIVISLKNTMFEKSDALVGVFRQQ-QENSSKIVTLDLRNYA 1230

 Score =  100 bits (250), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 68/205 (33%), Positives = 108/205 (52%), Gaps = 14/205 (6%)

Query: 133 LVLNDFKSYAGRQVIGPFHTSFSAIVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLI 192
           L LN+FKSY G   +G   ++F++I+GPNGSGKSN++D++ FV G R++ +R + + DLI
Sbjct: 7   LELNNFKSYKGITKVGFGDSNFTSIIGPNGSGKSNMMDAISFVLGVRSSHLRSNIVKDLI 66

Query: 193 HK------SETFPDLKSCSVEVHFKYVIDKDDGSTTIDETKGNLVVTRKAFKNNA-SKYF 245
           ++       +T    K  S  V   Y  +  D     D+     V   +A   N  + Y 
Sbjct: 67  YRGVINDNGDTNEHGKVTSAYVKAFYEKNTADDGDNDDDDDERPVELMRAISTNGDTTYK 126

Query: 246 VNGKESNYTEVTTLLKKEGIDLDHKRFLILQGEVENIAQMKAKAEKENDDGLLEYLEDII 305
           +NGK   Y E +  L++E I +  K FL+ QG+VE IA             L +  E++ 
Sbjct: 127 INGKTVTYKEYSEFLERENILIKAKNFLVFQGDVEQIASQSPM-------DLSKLFEEVS 179

Query: 306 GTSKYKESIEKLSMEIESLNEICVE 330
           G+ +YK+  ++L  +IE LN+   E
Sbjct: 180 GSIQYKKEYDELKEQIEKLNQSAAE 204

>Suva_6.52 Chr6 (91156..94950) [3795 bp, 1264 aa] {ON} YFL008W (REAL)
          Length = 1264

 Score =  144 bits (363), Expect = 7e-34,   Method: Compositional matrix adjust.
 Identities = 86/250 (34%), Positives = 137/250 (54%), Gaps = 18/250 (7%)

Query: 1152 SNKMEIDSQGGFINPGIPVLSASELAKVDPQEVELLITSLDDFITSSEANVDVLEEYALR 1211
            SN +++D QG      +P            +E+E  IT  D+ +   + N   +E Y   
Sbjct: 1014 SNNIDVDYQG------LPKKYKENSNDSARKELEQKITEADEILNELQPNARAVERYDEA 1067

Query: 1212 FVEFNKRKNDLNSAVQSRDSVKDRLEGIKRKRYDEFMEGFKIISMTLKEMYQMIT----- 1266
               F+   N+          + ++   IK+KR + F + F  +S  L  +Y+ +T     
Sbjct: 1068 EERFDVINNETEELKSEEKKILNQFLKIKKKRKELFEKTFDYVSDHLDAIYRELTKNPNS 1127

Query: 1267 ----LGGNAELELVDSLDPFSEGVTFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKY 1322
                 GGNA L + D  +PF+ G+ +   PP K ++++  LSGGEKT+++LAL+FA++ Y
Sbjct: 1128 TVELAGGNASLTIEDEDEPFNAGIKYHATPPLKRFKDMEYLSGGEKTVAALALLFAINSY 1187

Query: 1323 KPTPLYVMDEIDAALDFRNVSIVANYI-KERTKNAQFIVISLRNNMFELTKQLVGIYK-- 1379
            +P+P +V+DE+DAALD  NV  +A YI + R  + QFIVISL+N MFE +  LVG+Y+  
Sbjct: 1188 QPSPFFVLDEVDAALDITNVQRIAAYIRRHRNPDLQFIVISLKNTMFEKSDALVGVYRQQ 1247

Query: 1380 HENMTKSAAL 1389
             EN +K+  L
Sbjct: 1248 QENSSKTVTL 1257

 Score =  100 bits (249), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 69/209 (33%), Positives = 113/209 (54%), Gaps = 25/209 (11%)

Query: 133 LVLNDFKSYAGRQVIGPFHTSFSAIVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLI 192
           L L++FKSY G   +G   ++F++I+GPNGSGKSN++D++ FV G R+N +R + L DLI
Sbjct: 43  LELSNFKSYRGITKVGFGESNFTSIIGPNGSGKSNMMDAISFVLGVRSNHLRSNILKDLI 102

Query: 193 HKSETFPDLKSCSVEVHFKYVIDKDDGSTTIDET---------KGNLVV--TRKAFKNNA 241
           ++     D    +++         DD + T +           KGN +V  TR   +N  
Sbjct: 103 YRG-VLDDGNDENIDS------GADDNAITSNPNSAYVKAFYQKGNKLVELTRLISRNGD 155

Query: 242 SKYFVNGKESNYTEVTTLLKKEGIDLDHKRFLILQGEVENIAQMKAKAEKENDDGLLEYL 301
           + Y ++GK   Y + +  L+ E I +  K FL+ QG+VE IA     A+   D  L    
Sbjct: 156 TTYKIDGKTVTYKDYSIFLENENILIKAKNFLVFQGDVEQIA-----AQSPTD--LSRMF 208

Query: 302 EDIIGTSKYKESIEKLSMEIESLNEICVE 330
           E++ G+ +YK+  ++L  +IE L++   E
Sbjct: 209 EEVSGSIQYKKEYDELKEKIEKLSKSATE 237

>KLTH0A02706g Chr1 complement(234723..238409) [3687 bp, 1228 aa] {ON}
            similar to uniprot|P32908 Saccharomyces cerevisiae
            YFL008W SMC1 Subunit of the multiprotein cohesin complex
            essential protein involved in chromosome segregation and
            in double-strand DNA break repair SMC chromosomal ATPase
            family member binds DNA with a preference for DNA with
            secondary structure
          Length = 1228

 Score =  142 bits (359), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 68/169 (40%), Positives = 107/169 (63%), Gaps = 10/169 (5%)

Query: 1232 VKDRLEGIKRKRYDEFMEGFKIISMTLKEMYQMIT---------LGGNAELELVDSLDPF 1282
            V ++   I+R R D F   F  +S  + ++Y+ +T          GGNA L L D  +P+
Sbjct: 1052 VNEQFAKIRRLRKDAFESAFDHVSNAIDDVYRELTRDPHSTAELAGGNASLTLEDEDEPY 1111

Query: 1283 SEGVTFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNV 1342
              G+ +   PP K ++++  LSGGEKT+++LAL+FA++ ++P+P +V+DE+DAALD  NV
Sbjct: 1112 LAGIRYHATPPTKRFKDMEFLSGGEKTIAALALLFAINSFQPSPFFVLDEVDAALDILNV 1171

Query: 1343 SIVANYIKERT-KNAQFIVISLRNNMFELTKQLVGIYKHENMTKSAALV 1390
              +A YI++R   N QFIVISL+N MFE ++ LVG+++ +    S AL 
Sbjct: 1172 ERIATYIRQRALSNLQFIVISLKNTMFEKSQALVGVFRQQRDNTSRALT 1220

 Score = 87.0 bits (214), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 58/200 (29%), Positives = 101/200 (50%), Gaps = 26/200 (13%)

Query: 135 LNDFKSYAGRQVIGPFHTSFSAIVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHK 194
           L +FKSY G+  IG   ++F++++GPNGSGKSN++D++ FV G ++  +R   L+DLI++
Sbjct: 9   LYNFKSYKGKVSIGFGESNFTSVIGPNGSGKSNLMDAISFVLGMKSIHLRSHTLADLIYR 68

Query: 195 ------------SETFPDLKSCSVEVHFKYVIDKDDGSTTIDETKGNLVVTRKAFKNNAS 242
                       SET  +  + S   + K           + E      +TR    +  S
Sbjct: 69  GTLQDGDADSGYSETHDNENNPS-SAYVKAFYSPSGQENDVAE------LTRTITLSQES 121

Query: 243 KYFVNGKESNYTEVTTLLKKEGIDLDHKRFLILQGEVENIAQMKAKAEKENDDGLLEYLE 302
            Y +NG+  ++ +    L+ E I +  + FL+ QG+VE +A  K +        L    E
Sbjct: 122 TYKLNGETVSHKKYCDFLESENILIKARNFLVFQGDVEQVASQKPRE-------LTTLFE 174

Query: 303 DIIGTSKYKESIEKLSMEIE 322
            + G+ +YK+  ++L  E+E
Sbjct: 175 QVSGSIQYKQEYDRLREELE 194

 Score = 63.5 bits (153), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 40/128 (31%), Positives = 69/128 (53%), Gaps = 6/128 (4%)

Query: 675 KYDVAISTACPRLND-LVVDTVESGQQCIEYLRKNKLGYARFILLDKL--NTFNTNRIDT 731
           KY VA+ST   +  D ++VD     QQC+ +L+K + G   FI LD +  N  +   +DT
Sbjct: 547 KYTVAVSTILGKSFDAVIVDHFSVAQQCVSFLKKQRSGILSFIPLDTIDVNKVSMMALDT 606

Query: 732 PDQSQRLFDLITVKEKRFNNAFYSVLRDTLVCQNMEQANRVAYGKK-RYRVVTLDGNLID 790
              +  + D I   E+    A   V  D+++C ++  A  + + +  R ++V+LDG+++ 
Sbjct: 607 KGCTLAI-DAIDY-ERDLERAMQYVCSDSIICDSLAIAKDLKWRRNVRAKLVSLDGSIVH 664

Query: 791 LSGTMTGG 798
            +G MTGG
Sbjct: 665 KAGLMTGG 672

>Kwal_23.5043 s23 (978758..982435) [3678 bp, 1225 aa] {ON} YFL008W
            (SMC1) - SMC chromosomal ATPase family member [contig 7]
            FULL
          Length = 1225

 Score =  140 bits (354), Expect = 6e-33,   Method: Compositional matrix adjust.
 Identities = 67/162 (41%), Positives = 106/162 (65%), Gaps = 10/162 (6%)

Query: 1239 IKRKRYDEFMEGFKIISMTLKEMYQMIT---------LGGNAELELVDSLDPFSEGVTFS 1289
            IKR R + F + F  +S ++ E+Y+ +T          GGNA L L D  +P+  G+ + 
Sbjct: 1056 IKRLRKEAFEKAFDHVSSSIDEIYRELTRDPHSRAELAGGNASLTLEDEDEPYLAGIRYH 1115

Query: 1290 VMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYI 1349
              PP K ++++  LSGGEKT+++LAL+FA++ ++P+P +V+DE+DAALD  NV  VA+YI
Sbjct: 1116 ATPPAKRFKDMEYLSGGEKTIAALALLFAINSFQPSPFFVLDEVDAALDISNVERVASYI 1175

Query: 1350 KERT-KNAQFIVISLRNNMFELTKQLVGIYKHENMTKSAALV 1390
            + +   + QFIVISL+N MFE ++ LVG+++ +    S AL 
Sbjct: 1176 RRKAGADLQFIVISLKNTMFEKSQALVGVFRQQQNNTSKALT 1217

 Score = 98.6 bits (244), Expect = 7e-20,   Method: Compositional matrix adjust.
 Identities = 65/222 (29%), Positives = 114/222 (51%), Gaps = 36/222 (16%)

Query: 133 LVLNDFKSYAGRQVIGPFHTSFSAIVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLI 192
           L LN+FKSY G+  IG   ++F++I+GPNGSGKSN++D++ FV G ++  +R   L+DLI
Sbjct: 7   LELNNFKSYKGKVSIGFRDSNFTSIIGPNGSGKSNLMDAISFVLGVKSVHLRSHLLADLI 66

Query: 193 HK--------------SETFPDLKSCSVEVHFKYVIDKDDGSTTIDETKGNLVVTRKAFK 238
           ++              SE  P+  S  V+  +    ++DD           + ++R   +
Sbjct: 67  YRGTLSEEEASSADFESENHPN--SAYVKAFYSPSNNEDDV----------VELSRTVTR 114

Query: 239 NNASKYFVNGKESNYTEVTTLLKKEGIDLDHKRFLILQGEVENIAQMKAKAEKENDDGLL 298
           +  S Y ++GK   Y + +  L+ E I +  + FL+ QG+VE +A  K +        L 
Sbjct: 115 SQESTYRIDGKTVGYKKYSQFLESENILIKARNFLVFQGDVEQVAAQKPQE-------LT 167

Query: 299 EYLEDIIGTSKYKESIEKLSMEIE---SLNEICVEKENRFSI 337
           +  E + G+ +YK+  +++  E+E   S    C++   R  I
Sbjct: 168 DLFEQVSGSLQYKQDYDRIREELERARSETSDCIQSRKRAHI 209

 Score = 58.9 bits (141), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 40/145 (27%), Positives = 71/145 (48%), Gaps = 9/145 (6%)

Query: 661 GFHGRLGDLAVIDPK---YDVAISTACPR-LNDLVVDTVESGQQCIEYLRKNKLGYARFI 716
           G  G + DL    PK   + VA+ST   +  + ++VD     QQC+ +L+K + G   FI
Sbjct: 529 GVRGLVHDLC--HPKKEKFAVAVSTVLGKNFDAVIVDNFLVAQQCVSFLKKQRSGVVSFI 586

Query: 717 LLDKLNTFNTNRIDTPDQSQRL-FDLITVKEKRFNNAFYSVLRDTLVCQNMEQANRVAYG 775
            LD ++      I +  +   L  D I   E     A   V  D+++C  ++ A  + + 
Sbjct: 587 PLDTVDVSKVPMIASEFKGCILAIDAIDY-EPDLERAMQYVCSDSIICDTLQIAKDLKWK 645

Query: 776 KK-RYRVVTLDGNLIDLSGTMTGGG 799
              R ++V+++G+++  +G MTGG 
Sbjct: 646 HNIRSKLVSINGSIVHRAGLMTGGA 670

>Skud_6.64 Chr6 (121616..125308) [3693 bp, 1230 aa] {ON} YFL008W
            (REAL)
          Length = 1230

 Score =  140 bits (354), Expect = 6e-33,   Method: Compositional matrix adjust.
 Identities = 71/163 (43%), Positives = 106/163 (65%), Gaps = 12/163 (7%)

Query: 1239 IKRKRYDEFMEGFKIISMTLKEMYQMIT---------LGGNAELELVDSLDPFSEGVTFS 1289
            IKRKR + F + F  +S  L  +Y+ +T          GGNA L + D  +PF+ G+ + 
Sbjct: 1061 IKRKRKELFEKTFDYVSDHLDAIYRELTKNPNSNVELAGGNASLTIEDEDEPFNAGIKYH 1120

Query: 1290 VMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYI 1349
              PP K ++++  LSGGEKT+++LAL+FA++ Y+P+P +V+DE+DAALD  NV  +A YI
Sbjct: 1121 ATPPLKRFKDMEYLSGGEKTVAALALLFAINSYQPSPFFVLDEVDAALDITNVQRIAAYI 1180

Query: 1350 -KERTKNAQFIVISLRNNMFELTKQLVGIYK--HENMTKSAAL 1389
             + R  + QFIVISL+N MFE +  LVG+Y+   EN +K+  L
Sbjct: 1181 RRHRNPDLQFIVISLKNTMFEKSDALVGVYRQQQENSSKTITL 1223

 Score = 98.2 bits (243), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 68/219 (31%), Positives = 113/219 (51%), Gaps = 43/219 (19%)

Query: 133 LVLNDFKSYAGRQVIGPFHTSFSAIVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLI 192
           L L++FKSY G   +G   ++F++I+GPNGSGKSN++D++ FV G R+N +R + L DLI
Sbjct: 7   LELSNFKSYRGVTKVGFGESNFTSIIGPNGSGKSNMMDAISFVLGVRSNHLRSNVLKDLI 66

Query: 193 HKS-------------------ETFPDLKSCSVEVHFKYVIDKDDGSTTIDETKGNLVV- 232
           ++                     T  + KS  V+  ++               KGN +V 
Sbjct: 67  YRGILNDGNDNDNDDDSASDDDATTSNPKSAYVKAFYQ---------------KGNKLVE 111

Query: 233 -TRKAFKNNASKYFVNGKESNYTEVTTLLKKEGIDLDHKRFLILQGEVENIAQMKAKAEK 291
             R   +N  + Y ++GK  +Y + +  L+ E I +  K FL+ QG+VE IA   A++  
Sbjct: 112 LMRIISRNGDTSYKIDGKSVSYRDYSVFLENENILIKAKNFLVFQGDVEQIA---AQSPI 168

Query: 292 ENDDGLLEYLEDIIGTSKYKESIEKLSMEIESLNEICVE 330
           E    L +  E++ G+ +YK+  ++L  +IE L +   E
Sbjct: 169 E----LSKMFEEVSGSIQYKKEYDELKEKIEKLGKSATE 203

>YFL008W Chr6 (119429..123106) [3678 bp, 1225 aa] {ON}  SMC1Subunit of
            the multiprotein cohesin complex, essential protein
            involved in chromosome segregation and in double-strand
            DNA break repair; SMC chromosomal ATPase family member,
            binds DNA with a preference for DNA with secondary
            structure
          Length = 1225

 Score =  140 bits (352), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 118/415 (28%), Positives = 203/415 (48%), Gaps = 59/415 (14%)

Query: 1002 KNAENADIESKE-------IESKLLDIKESIENLKENEVKLEHEIEMKHNELESHQKVVS 1054
            K+ ENA +E K        IE K+  I+  +E  K +  +L+ +   K +EL S + ++ 
Sbjct: 851  KDLENAQVEMKSLEEQEYAIEMKIGSIESKLEEHKNHLDELQKKFVTKQSELNSSEDILE 910

Query: 1055 DYKSISLEYNNKLEKLEASEASLKKSIKRYNDLLSELTIRDVTQVLNTIMTEENASVDKS 1114
            D        N+ L+ L+     +K+ I++++       +  VT + N  ++  N  +   
Sbjct: 911  DM-------NSNLQVLKRERDGIKEDIEKFD-------LERVTALKNCKISNINIPI--- 953

Query: 1115 DPKLENTSAVINADDDGISAVSENQSFNHNDENDDID-SNKMEIDSQGGFINPGIPVLSA 1173
                   S+    DD  IS+           +N+ I  SN ++I+ +G      +P    
Sbjct: 954  -------SSETTIDDLPISST----------DNEAITISNSIDINYKG------LPKKYK 990

Query: 1174 SELAKVDPQEVELLITSLDDFITSSEANVDVLEEYALRFVEFNKRKNDLNSAVQSRDSVK 1233
                    +E+E  I  +++ +   + N   LE Y      F    N+          + 
Sbjct: 991  ENNTDSARKELEQKIHEVEEILNELQPNARALERYDEAEGRFEVINNETEQLKAEEKKIL 1050

Query: 1234 DRLEGIKRKRYDEFMEGFKIISMTLKEMYQMIT---------LGGNAELELVDSLDPFSE 1284
            ++   IK+KR + F + F  +S  L  +Y+ +T          GGNA L + D  +PF+ 
Sbjct: 1051 NQFLKIKKKRKELFEKTFDYVSDHLDAIYRELTKNPNSNVELAGGNASLTIEDEDEPFNA 1110

Query: 1285 GVTFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSI 1344
            G+ +   PP K ++++  LSGGEKT+++LAL+FA++ Y+P+P +V+DE+DAALD  NV  
Sbjct: 1111 GIKYHATPPLKRFKDMEYLSGGEKTVAALALLFAINSYQPSPFFVLDEVDAALDITNVQR 1170

Query: 1345 VANYI-KERTKNAQFIVISLRNNMFELTKQLVGIYKHENMTKSAALVNEDLVGRA 1398
            +A YI + R  + QFIVISL+N MFE +  LVG+Y+ +    S+ ++  DL   A
Sbjct: 1171 IAAYIRRHRNPDLQFIVISLKNTMFEKSDALVGVYRQQ-QENSSKIITLDLSNYA 1224

 Score = 93.2 bits (230), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 56/160 (35%), Positives = 89/160 (55%), Gaps = 17/160 (10%)

Query: 133 LVLNDFKSYAGRQVIGPFHTSFSAIVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLI 192
           L L++FKSY G   +G   ++F++I+GPNGSGKSN++D++ FV G R+N +R + L DLI
Sbjct: 7   LELSNFKSYRGVTKVGFGESNFTSIIGPNGSGKSNMMDAISFVLGVRSNHLRSNILKDLI 66

Query: 193 HK-------SETFPDLKSCSVEVHFKYVIDKDDGSTTIDETKGNLVV--TRKAFKNNASK 243
           ++       S+ + +  + S      YV             KGN +V   R   +N  + 
Sbjct: 67  YRGVLNDENSDDYDNEGAASSNPQSAYV--------KAFYQKGNKLVELMRIISRNGDTS 118

Query: 244 YFVNGKESNYTEVTTLLKKEGIDLDHKRFLILQGEVENIA 283
           Y ++GK  +Y + +  L+ E I +  K FL+ QG+VE IA
Sbjct: 119 YKIDGKTVSYKDYSIFLENENILIKAKNFLVFQGDVEQIA 158

>Smik_6.71 Chr6 (132627..136313) [3687 bp, 1228 aa] {ON} YFL008W
            (REAL)
          Length = 1228

 Score =  140 bits (352), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 71/170 (41%), Positives = 108/170 (63%), Gaps = 11/170 (6%)

Query: 1239 IKRKRYDEFMEGFKIISMTLKEMYQMIT---------LGGNAELELVDSLDPFSEGVTFS 1289
            IKRKR + F + F  +S  L  +Y+ +T          GGNA L + D  +PF+ G+ + 
Sbjct: 1059 IKRKRKELFEKTFDYVSDHLDAIYRELTKNPNSNVELAGGNASLTIEDEDEPFNAGIKYH 1118

Query: 1290 VMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYI 1349
              PP K ++++  LSGGEKT+++LAL+FA++ Y+P+P +V+DE+DAALD  NV  +A YI
Sbjct: 1119 ATPPLKRFKDMEYLSGGEKTVAALALLFAINSYQPSPFFVLDEVDAALDITNVQRIAAYI 1178

Query: 1350 -KERTKNAQFIVISLRNNMFELTKQLVGIYKHENMTKSAALVNEDLVGRA 1398
             + R  + QFIVISL+N MFE +  LVG+Y+ +    S+ ++  DL   A
Sbjct: 1179 RRHRNPDLQFIVISLKNTMFEKSDALVGVYRQQ-QENSSKIITLDLSNYA 1227

 Score = 96.3 bits (238), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 66/202 (32%), Positives = 110/202 (54%), Gaps = 11/202 (5%)

Query: 133 LVLNDFKSYAGRQVIGPFHTSFSAIVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLI 192
           L L++FKSY G   +G   ++F++I+GPNGSGKSN++D++ FV G R+N +R + L DLI
Sbjct: 7   LELSNFKSYRGITKVGFGESNFTSIIGPNGSGKSNMMDAISFVLGVRSNHLRSNILKDLI 66

Query: 193 HKSETFPDLKSCSVEVHFKYVIDKDDGSTTIDE--TKGNLVV--TRKAFKNNASKYFVNG 248
           ++     D      +     V   +  S  +     KGN +V   R   +N  + Y ++ 
Sbjct: 67  YRGVLNDDNDDNYNDTSDDDVASSNPKSAYVKAFYQKGNKMVELMRIISRNGDTSYKIDE 126

Query: 249 KESNYTEVTTLLKKEGIDLDHKRFLILQGEVENIAQMKAKAEKENDDGLLEYLEDIIGTS 308
           K  +Y + +  L+ E I +  K FL+ QG+VE IA   A++  E    L    E++ G+ 
Sbjct: 127 KTVSYKDYSIFLENENILIKAKNFLVFQGDVEQIA---AQSPIE----LSRMFEEVSGSI 179

Query: 309 KYKESIEKLSMEIESLNEICVE 330
           +YK+  ++L  +IE L++   E
Sbjct: 180 QYKKEYDELKEKIEKLSKSATE 201

>TPHA0P00340 Chr16 (65711..69370) [3660 bp, 1219 aa] {ON} Anc_8.68
            YFL008W
          Length = 1219

 Score =  139 bits (350), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 115/372 (30%), Positives = 199/372 (53%), Gaps = 36/372 (9%)

Query: 1024 SIENLKENEVKLEHEIEMKHNELESHQKVVSDYKSISLEYNNKLEKLEASEASLKKSIKR 1083
            +IE+L+ENE ++  +I+   N +   +KV+ D+   S E + K +KL  +E SL +    
Sbjct: 853  TIESLQENEAEVVAKIKDIENGMLEIKKVLEDF---SKEIDRKKKKLAIAEDSLSEK--- 906

Query: 1084 YNDLLSELTIRDVTQVLNTIMTEENASVDKSDPKLENTSAVINADDDGISAVSENQSFNH 1143
             ++LL+  T   ++      + EE   ++K D  LE    + N     I     ++   +
Sbjct: 907  -SELLTTSTNEKIS------IKEE---IEKKD--LEKLGILTNCKISNIQVPVASKIDLN 954

Query: 1144 NDENDDIDSNKMEIDSQGGFINPGIPV----LSASELAKVDPQEVELLITSLDDFITSSE 1199
            N     ID++ + I ++       +P      S+S++      E+E++   L D   ++ 
Sbjct: 955  NLPIGKIDNDAILISNEISLDYKTLPAKYKESSSSKIRSALEHEIEVVEDLLQDLQPNAR 1014

Query: 1200 ANVDVLEEYALRFVEFNKRKNDLNSAVQSRDSVKDRLEGIKRKRYDEFMEGFKIISMTLK 1259
            A VD  +E   RF   +     L    Q R  +   L  IK+KR + F + F  +S  ++
Sbjct: 1015 A-VDRFDEAKERFDSASDETETLKK--QERKLLTQFL-AIKKKRREVFEKAFDYVSEHIE 1070

Query: 1260 EMYQMIT---------LGGNAELELVDSLDPFSEGVTFSVMPPKKSWRNISNLSGGEKTL 1310
             +Y+ +T          GGNA L L D  +PF  G+ +   PP K ++++  LSGGEKT+
Sbjct: 1071 PIYRELTKNPNSTAELSGGNASLTLEDEDEPFDAGIKYHATPPLKRFKDMEYLSGGEKTV 1130

Query: 1311 SSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERT-KNAQFIVISLRNNMFE 1369
            ++LAL+FA++ Y+P+P +++DE+DAALD  N+  +ANYI++ +  + QFIVISL+N+MFE
Sbjct: 1131 AALALLFAINSYQPSPFFILDEVDAALDVTNIERIANYIRKHSNSDIQFIVISLKNSMFE 1190

Query: 1370 LTKQLVGIYKHE 1381
             +  LVGI++ +
Sbjct: 1191 KSDALVGIHRQQ 1202

 Score = 85.5 bits (210), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 51/152 (33%), Positives = 82/152 (53%), Gaps = 7/152 (4%)

Query: 133 LVLNDFKSYAGRQVIGPFHTSFSAIVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLI 192
           L L +FKSY G   +G   ++F++I+GPNGSGKSN++D++ FV GF+++ +R   L DL+
Sbjct: 7   LELFNFKSYKGVTKVGFGESNFTSIIGPNGSGKSNMMDAISFVLGFQSSNLRSSTLKDLV 66

Query: 193 HKSETFPDLKSCSVEVHFKYVIDKDDGSTTIDETKGNLV-VTRKAFKNNASKYFVNGKES 251
           ++     D+ S   E  F    ++        E  G +V + R       S Y ++ K +
Sbjct: 67  YR-----DIASAD-ENEFGEDGERSAYVKAFYEKDGTVVELMRAITAGRDSVYKIDNKTT 120

Query: 252 NYTEVTTLLKKEGIDLDHKRFLILQGEVENIA 283
            Y   +  L  E I +  + FL+ QG+VE IA
Sbjct: 121 TYKHYSDFLAAENILIKARNFLVFQGDVEQIA 152

>Kpol_1011.5 s1011 complement(13399..17064) [3666 bp, 1221 aa] {ON}
            complement(13399..17064) [3666 nt, 1222 aa]
          Length = 1221

 Score =  139 bits (350), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 69/154 (44%), Positives = 105/154 (68%), Gaps = 12/154 (7%)

Query: 1239 IKRKRYDEFMEGFKIISMTLKEMYQMIT---------LGGNAELELVDSLDPFSEGVTFS 1289
            IK+KR + F + F+ ++  +  +Y+ +T          GGNA L L D  +P++ GV + 
Sbjct: 1052 IKKKRKELFEKAFEYVNEHIDPIYRELTKNPNSSVELAGGNASLTLEDEDEPYNGGVKYH 1111

Query: 1290 VMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYI 1349
              PP K ++++  LSGGEKT+++LAL+FA++ Y+P+P +V+DEIDAALD  NV  +A YI
Sbjct: 1112 ATPPLKRFKDMEYLSGGEKTVAALALLFAINSYQPSPFFVLDEIDAALDITNVERIATYI 1171

Query: 1350 KERTKNA--QFIVISLRNNMFELTKQLVGIYKHE 1381
             +R  N   QFIVISL+N+MFE ++ LVGIY+H+
Sbjct: 1172 -QRHGNPELQFIVISLKNSMFEKSEALVGIYRHQ 1204

 Score = 87.4 bits (215), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 53/157 (33%), Positives = 86/157 (54%), Gaps = 15/157 (9%)

Query: 133 LVLNDFKSYAGRQVIGPFHTSFSAIVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLI 192
           L LN+FKSY G   +G   ++F++I+GPNGSGKSN++D++ FV G +++ +R + L DLI
Sbjct: 7   LELNNFKSYKGVVNVGFGESNFTSIIGPNGSGKSNMMDAISFVLGVQSSHLRSNVLKDLI 66

Query: 193 HKSETFPDLKSCSVE------VHFKYVIDKDDGSTTIDETKGNLVVTRKAFKNNASKYFV 246
           ++     D +  + E       + K    K+D +  +          R    +  S Y +
Sbjct: 67  YRGFLSGDDEDNNNEDVNPNSAYVKAFYQKEDVTHEL---------MRSISNSGDSTYKI 117

Query: 247 NGKESNYTEVTTLLKKEGIDLDHKRFLILQGEVENIA 283
           N K  +Y + T+ L+ E I +  K FL+ QG+VE IA
Sbjct: 118 NNKTVSYKQYTSFLEDENILIKAKNFLVFQGDVEQIA 154

>NCAS0C04000 Chr3 (807106..810777) [3672 bp, 1223 aa] {ON} Anc_8.68
            YFL008W
          Length = 1223

 Score =  139 bits (350), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 89/264 (33%), Positives = 145/264 (54%), Gaps = 17/264 (6%)

Query: 1148 DDIDSNKMEIDSQGGFINPGIPVLSASELAKVDPQEVELLITSLDDFITSSEANVDVLEE 1207
            D ID + + I ++       +P       A    +E+E  I S++D +   + N   +E 
Sbjct: 963  DKIDEDTIAISNEIDVDYNDLPAKYKESSATTIREELENHIRSIEDTLNVLQPNARAVER 1022

Query: 1208 Y---ALRFVEFNKRKNDLNSAVQSRDSVKDRLEGIKRKRYDEFMEGFKIISMTLKEMYQM 1264
            +     RF    K   DL +  + + ++   L+ IK++R + F   F  ++  L  +Y+ 
Sbjct: 1023 FDDAQERFEVVEKETEDLKA--REKKALTQFLK-IKKRRRELFENAFDFVNEHLDPIYRE 1079

Query: 1265 ITL---------GGNAELELVDSLDPFSEGVTFSVMPPKKSWRNISNLSGGEKTLSSLAL 1315
            +T          GGNA L L D  +PF+ G+ +  MPP K ++++  LSGGEKT+++LAL
Sbjct: 1080 LTRNPNSSALLSGGNASLTLEDEDEPFNAGIKYHAMPPLKRFKDMEYLSGGEKTVAALAL 1139

Query: 1316 VFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKER-TKNAQFIVISLRNNMFELTKQL 1374
            +FA++ Y+P+P +V+DE+DAALD  NV  +A YI+     + QFIVISL+N MFE +  L
Sbjct: 1140 LFAINAYQPSPFFVLDEVDAALDITNVERIAAYIRRHGNPDLQFIVISLKNTMFEKSDAL 1199

Query: 1375 VGIYKHENMTKSAALVNEDLVGRA 1398
            VG+Y+ +    S+ +V  DL   A
Sbjct: 1200 VGVYRQQQ-ENSSKIVTLDLRNYA 1222

 Score = 95.5 bits (236), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 89/318 (27%), Positives = 143/318 (44%), Gaps = 42/318 (13%)

Query: 133 LVLNDFKSYAGRQVIGPFHTSFSAIVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLI 192
           L L++FKSY G   IG   ++F++I+GPNGSGKSN++D++ FV G R++ +R + L DLI
Sbjct: 7   LELSNFKSYRGVTKIGFGDSNFTSIIGPNGSGKSNMMDAISFVLGVRSSHLRSNILKDLI 66

Query: 193 HKSETFPDLKSCSVEVHFKYVIDKDDGS---------TTIDETKGNLV-VTRKAFKNNAS 242
           ++      ++  S E       D +DG              E  G +V + R    N  +
Sbjct: 67  YRGV----IRDFSEE-------DPEDGEEQHPTSAYVKAFYEMDGKVVELMRTININGDT 115

Query: 243 KYFVNGKESNYTEVTTLLKKEGIDLDHKRFLILQGEVENIAQMKAKAEKENDDGLLEYLE 302
            Y ++ K  +Y +    L+KE I +  K FL+ QG+VE IA   A         L +  E
Sbjct: 116 TYKIDNKTVSYKQYAAFLEKENILIKAKNFLVFQGDVEQIASQSAL-------DLSKLFE 168

Query: 303 DIIGTSKYKESIEKLSMEIESLNEICVEK-ENRFSIV-------------EREKNSLESG 348
           +I G+ +YK+  + L  E+E L +   E   NR  I              E  KN++E  
Sbjct: 169 EISGSIQYKKEYDSLKDELEKLGKSTTESIRNRRRIHGELKTYKEGISKDEEYKNNVEKK 228

Query: 349 KEEALQFXXXXXXXXXXXXXXYQYNLMQXXXXXXXXXXXXTNVQQEQTKQEDEFRKANSH 408
           K+  + F              ++  L Q             N ++  T+ +  F K NS 
Sbjct: 229 KKYEMYFTLWKLFHLDAQRIQFKDKLKQAKTEMSKLKEKINNEEKHLTRSKSAFLKENSI 288

Query: 409 ISDITASLNVLKADLEKV 426
           ++   + L+    + EKV
Sbjct: 289 LTKKRSQLDYTVKEKEKV 306

>KAFR0C03200 Chr3 (643231..646902) [3672 bp, 1223 aa] {ON} Anc_8.68
            YFL008W
          Length = 1223

 Score =  138 bits (348), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 69/163 (42%), Positives = 106/163 (65%), Gaps = 12/163 (7%)

Query: 1239 IKRKRYDEFMEGFKIISMTLKEMYQMITL---------GGNAELELVDSLDPFSEGVTFS 1289
            IK++R + F + F+ ++  L  +Y+ +T          GGNA L L D  +PF+ G+ + 
Sbjct: 1054 IKKRRRELFEKAFEHVTNHLDSIYRELTRDPHSSAELSGGNASLTLEDEDEPFNAGIRYH 1113

Query: 1290 VMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYI 1349
              PP K ++++  LSGGEKT+++LAL+FA++ ++P+P +V+DE+DAALD RNV  +A YI
Sbjct: 1114 ATPPLKRFKDMEYLSGGEKTMAALALLFAINSFQPSPFFVLDEVDAALDVRNVERIAAYI 1173

Query: 1350 KER-TKNAQFIVISLRNNMFELTKQLVGIYK--HENMTKSAAL 1389
            +     N QFIVISL+N MFE +  LVG+Y+   EN +K   L
Sbjct: 1174 RRHGNPNLQFIVISLKNTMFEKSDALVGVYRQQQENSSKIVTL 1216

 Score = 90.9 bits (224), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 63/209 (30%), Positives = 107/209 (51%), Gaps = 30/209 (14%)

Query: 133 LVLNDFKSYAGRQVIGPFHTSFSAIVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLI 192
           L L +FKSY G   +G   ++F++I+GPNGSGKSN++D++ FV G R++ +R   L DLI
Sbjct: 7   LELYNFKSYKGSVKLGFGESNFTSIIGPNGSGKSNMMDAISFVLGVRSSHLRSSILRDLI 66

Query: 193 HKSE-TFPDLKSCSVEVHFKYVIDKDDGSTTIDETK----------GNLVVTRKAFKNNA 241
           ++   T  D +S             +DGS     T             + + R   +N  
Sbjct: 67  YRGVITGEDSES------------DEDGSVNNPSTAYVKAFYEKENKTIELMRTISRNGD 114

Query: 242 SKYFVNGKESNYTEVTTLLKKEGIDLDHKRFLILQGEVENIAQMKAKAEKENDDGLLEYL 301
           + Y + GK  +Y + ++ L+ E I +  K FL+ QG+VE IA        ++   L    
Sbjct: 115 TNYKIGGKVVSYKDYSSFLESENILIKAKNFLVFQGDVEQIAS-------QSPMDLSRLF 167

Query: 302 EDIIGTSKYKESIEKLSMEIESLNEICVE 330
           E++ G+ +YK+  ++L  ++E L++   E
Sbjct: 168 EEVSGSIQYKKEYDQLKEKMEQLSKAATE 196

>KNAG0G00910 Chr7 (172759..176439) [3681 bp, 1226 aa] {ON} Anc_8.68
            YFL008W
          Length = 1226

 Score =  137 bits (344), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 119/387 (30%), Positives = 200/387 (51%), Gaps = 56/387 (14%)

Query: 1025 IENLKENEVKLEHEIEMKHNELESHQKVVSDYKSISLEYNNKLEKLEASEASLKKSIKRY 1084
            I+ L+E+    E +IE K  E+E  +          LE NNK E L   ++S++ ++KR 
Sbjct: 874  IKPLEEDICSFEKQIEEKETEIEGKK----------LEINNKEESLNEVQSSVE-AVKRQ 922

Query: 1085 NDLLSELTIRDVTQV-LNTIMTEENASVDKSD-PKLENTSAVINADDDGISAVSENQSFN 1142
            +D +S     D+  + L  I    N  +   D P L  T    N  D  I++        
Sbjct: 923  HDEIST----DIENLDLERIGILRNCKISNRDLPILSET----NLADVPITS-------- 966

Query: 1143 HNDENDDID-SNKMEIDSQGGFINPGIPVLSASELAKVDPQEVELLITSLDDFITSSEAN 1201
             N++ D I  SN+++ID +       +P       +K   +E+   I  +++ +   + N
Sbjct: 967  -NEQGDAIKMSNEIDIDYEE------LPTKYKESSSKQLEKELTRSIEEVNEMLEILQPN 1019

Query: 1202 VDVLEEYALRFVEFNKRKNDLNSAVQSRDSVKDRLEG----IKRKRYDEFMEGFKIISMT 1257
               +     RF E  +R N +++  +   S + ++       K+KR + F   F  +S  
Sbjct: 1020 ARAVG----RFDEAQERFNAIDNETERLKSEERKIYAQFLKTKKKRKELFDRAFDYVSTH 1075

Query: 1258 LKEMYQMIT---------LGGNAELELVDSLDPFSEGVTFSVMPPKKSWRNISNLSGGEK 1308
            +  +Y+ +T          GG+A L L D  +PF+ G+ +   PP K ++++  LSGGEK
Sbjct: 1076 IDGIYRELTKDPNSTAELAGGSASLTLEDEDEPFNAGIKYHATPPLKRFKDMEYLSGGEK 1135

Query: 1309 TLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKER-TKNAQFIVISLRNNM 1367
            T+++LAL+FA++ Y+P+P +V+DEIDAALD +NV  +A YI++    + QFIVISL+N+M
Sbjct: 1136 TVAALALLFAINSYQPSPFFVLDEIDAALDIKNVERIAAYIRKHGNPSLQFIVISLKNSM 1195

Query: 1368 FELTKQLVGIYKHENMTKSAALVNEDL 1394
            FE +  LVG+Y+ +    S+ LV  DL
Sbjct: 1196 FEKSDALVGVYRRQQ-ENSSRLVTLDL 1221

 Score = 90.1 bits (222), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 59/206 (28%), Positives = 107/206 (51%), Gaps = 23/206 (11%)

Query: 133 LVLNDFKSYAGRQVIGPFHTSFSAIVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLI 192
           L L +FKSY G   +G   ++F++I+GPNGSGKSN++D++ FV G R++ +R   ++DLI
Sbjct: 7   LELYNFKSYRGVVKVGFGESNFTSIIGPNGSGKSNMMDAISFVLGVRSSYLRSSAVADLI 66

Query: 193 HKSETFP-----DLKSCSVEVHFKYV---IDKDDGSTTIDETKGNLVVTRKAFKNNASKY 244
           ++    P            + H  YV     K    +T++       + R   KN  S Y
Sbjct: 67  YRG-VVPEEEDDGEGEGDGDAHRAYVSAFYSKGPQESTVE-------LKRTISKNGDSTY 118

Query: 245 FVNGKESNYTEVTTLLKKEGIDLDHKRFLILQGEVENIAQMKAKAEKENDDGLLEYLEDI 304
            ++ ++  Y + +  L+ + I +  K FL+ QG+VE +A        ++   L +  E++
Sbjct: 119 QIDRRQVTYKQYSEFLESQNILIKAKNFLVFQGDVEQVAS-------QSPLQLTKLFEEV 171

Query: 305 IGTSKYKESIEKLSMEIESLNEICVE 330
            G+++YK+  + L  ++E L+    E
Sbjct: 172 SGSAQYKKEYDLLKDQLEQLSHSATE 197

 Score = 65.9 bits (159), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 40/143 (27%), Positives = 71/143 (49%), Gaps = 7/143 (4%)

Query: 661 GFHGRLGDLAVIDPK---YDVAISTACPR-LNDLVVDTVESGQQCIEYLRKNKLGYARFI 716
           G  G + DL    PK   Y V+++T   +  + ++VD++   Q+CI YL+K + G   FI
Sbjct: 528 GVKGIVSDLC--HPKKDKYSVSVATVLGKNFDSVIVDSLSVAQECIAYLKKQRAGVISFI 585

Query: 717 LLDKLNTFNTNRIDTPDQSQRLFDLITVKEKRFNNAFYSVLRDTLVCQNMEQANRVAYGK 776
            LD +++          Q   L       E ++  A   V  D ++C  ++ A ++ +  
Sbjct: 586 PLDTVDSAVATLPSVNIQGYLLAKNAMEYESQYERAINYVCGDAIICDTLDLAKKLKWDH 645

Query: 777 K-RYRVVTLDGNLIDLSGTMTGG 798
             + +++ LDG+LI  +G MTGG
Sbjct: 646 GFKNKLIALDGSLIHRAGLMTGG 668

>CAGL0F02079g Chr6 (201002..204673) [3672 bp, 1223 aa] {ON} similar to
            uniprot|P32908 Saccharomyces cerevisiae YFL008w SMC1
            chromosome segregation protein
          Length = 1223

 Score =  136 bits (343), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 114/377 (30%), Positives = 182/377 (48%), Gaps = 57/377 (15%)

Query: 1035 LEHEIEMKHNEL-------ESHQKVVSDYKSISLEYNNKLEKLEASEASLKKSIKRYNDL 1087
            LE E++ K+ EL       +S QK  S  + I  EYNN+L  +E+    +K  I R +  
Sbjct: 875  LEGELDGKNEELKSIKAAFDSKQKDASATEDIISEYNNRLASIESDRNEIKDDITRLD-- 932

Query: 1088 LSELTIRDVTQVLNTIMTEENASVDKSDPKLENTSAVINADDDGISAVSENQSFNHNDEN 1147
            L +++I    QV   I+         S+  LE   A    DD+ I               
Sbjct: 933  LEKMSILKNCQVSGIIVPV------VSEVGLEELPAS-KVDDEAIEI------------- 972

Query: 1148 DDIDSNKMEIDSQGGFINPGIPVLSASELAKVDPQEVELLITSLDDFITSSEANVDVLEE 1207
                + K+EID         +P       +    Q++   I  +DD +   + N   +E 
Sbjct: 973  ----AKKIEIDF------SKLPRKYKEATSAAVKQDLNNQIRDIDDVLEELQPNARAVER 1022

Query: 1208 Y---ALRFVEFNKRKNDLNSAVQSRDSVKDRLEGIKRKRYDEFMEGFKIISMTLKEMYQM 1264
            +     RF E +K    L +  +    V D    +K+KR + F   F+ I+  L  +Y  
Sbjct: 1023 FDDAKSRFDEVDKETEGLKTEERK---VFDEFLKVKQKRKELFENAFEKINEHLDAIYSE 1079

Query: 1265 ITL---------GGNAELELVDSLDPFSEGVTFSVMPPKKSWRNISNLSGGEKTLSSLAL 1315
            +T          GG+A + + D  +PF+ G+ +   PP K ++++  LSGGEKT+++LAL
Sbjct: 1080 LTRNVNSTSILGGGSASMTIEDEDEPFNAGIRYHATPPMKRFKDMEYLSGGEKTVAALAL 1139

Query: 1316 VFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKER-TKNAQFIVISLRNNMFELTKQL 1374
            +FA++ Y P+P +++DE+DAALD  NV  +A YI+     + QFIVISL+N MFE +  L
Sbjct: 1140 LFAINSYNPSPFFILDEVDAALDISNVQRIAAYIRRHGNPDLQFIVISLKNTMFEKSDAL 1199

Query: 1375 VGIYK--HENMTKSAAL 1389
            VG+++   EN +K   L
Sbjct: 1200 VGVFRQQQENSSKIVTL 1216

 Score = 78.6 bits (192), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 62/212 (29%), Positives = 104/212 (49%), Gaps = 43/212 (20%)

Query: 133 LVLNDFKSYAGRQVIGPFHTSFSAIVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLI 192
           L L +FKSY G   +    ++F++I+GPNGSGKSN++D++ FV G R++ +R   L DLI
Sbjct: 7   LELYNFKSYKGTVNVDFGDSNFTSIIGPNGSGKSNLMDAISFVLGIRSSSLRSSALKDLI 66

Query: 193 HKSETFPDLKSCSVEVHFKYVIDKDDGSTTID-ETKGNLVVTRKAFKNNASK-------- 243
           ++                  +I +++  T  D +  GN     KAF     K        
Sbjct: 67  YRD-----------------IISRENTPTGADNDENGNRTAYVKAFYEYDGKVVELMRLI 109

Query: 244 -------YFVNGKESNYTEVTTLLKKEGIDLDHKRFLILQGEVENIAQMKAKAEKENDDG 296
                  Y ++G    Y E +  L+ + I +  K FL+ QG+VE IA        ++  G
Sbjct: 110 SRLGDTSYKLDGNTVTYKEYSQFLESQNILIKAKNFLVFQGDVEQIAS-------QSPLG 162

Query: 297 LLEYLEDIIGTSKYKESIEKLSMEIESLNEIC 328
           L + +E++ G+ +YK+  E+L    +  ++IC
Sbjct: 163 LTKLIEEVSGSMQYKKEYEELK---DQYDKIC 191

>TDEL0C00960 Chr3 (153572..157240) [3669 bp, 1222 aa] {ON} Anc_8.68
            YFL008W
          Length = 1222

 Score =  136 bits (342), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 66/158 (41%), Positives = 101/158 (63%), Gaps = 10/158 (6%)

Query: 1239 IKRKRYDEFMEGFKIISMTLKEMYQMIT---------LGGNAELELVDSLDPFSEGVTFS 1289
            IKRKR   F E F+ ++  +  +Y+ +T          GG+A L L D  +PF+ G+ + 
Sbjct: 1053 IKRKRKSLFEEAFEYVTEHIDPIYRELTKNPNSTSELAGGSASLTLEDEDEPFNAGIRYH 1112

Query: 1290 VMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYI 1349
              PP K ++++  LSGGEKT+++LAL+F ++ Y+P+P +V+DE+DAALD  NV  VA YI
Sbjct: 1113 ATPPLKRFKDMEYLSGGEKTVAALALLFTVNSYQPSPFFVLDEVDAALDTTNVERVATYI 1172

Query: 1350 KER-TKNAQFIVISLRNNMFELTKQLVGIYKHENMTKS 1386
            +     + QFIVISL+N MFE +  LVG+Y+ + +  S
Sbjct: 1173 RRHGNPDLQFIVISLKNTMFEKSDALVGVYRQQELNTS 1210

 Score = 96.7 bits (239), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 66/205 (32%), Positives = 109/205 (53%), Gaps = 23/205 (11%)

Query: 133 LVLNDFKSYAGRQVIGPFHTSFSAIVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLI 192
           L L++FKSY G   +G   ++F++I+GPNGSGKSN++D++ FV G R+  +R + L DLI
Sbjct: 7   LELHNFKSYKGTVKVGFGDSNFTSIIGPNGSGKSNMMDAISFVLGVRSRHLRSNVLKDLI 66

Query: 193 HK---SETFPDLKSCSVE----VHFKYVIDKDDGSTTIDETKGNLVVTRKAFKNNASKYF 245
           ++   SE   D +S  V      + K    K  G +TI+       ++R   K   + Y 
Sbjct: 67  YRGVASEEEGDGESDVVNNPTTAYVKAFYSK--GDSTIE-------LSRSISKGGDTTYR 117

Query: 246 VNGKESNYTEVTTLLKKEGIDLDHKRFLILQGEVENIAQMKAKAEKENDDGLLEYLEDII 305
           +NGK  +Y    + L+ E I +  K FL+ QG+V  IA   A         L ++ E+  
Sbjct: 118 MNGKVVDYKRYASFLEDENILIRAKNFLVFQGDVVQIASQSAME-------LTQFFEEFS 170

Query: 306 GTSKYKESIEKLSMEIESLNEICVE 330
           G+ +YK+  + L  ++++L +   E
Sbjct: 171 GSIQYKKEYDMLKEKLQTLGQSTAE 195

 Score = 73.6 bits (179), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 45/144 (31%), Positives = 76/144 (52%), Gaps = 9/144 (6%)

Query: 661 GFHGRLGDLAVIDPK---YDVAISTACPR-LNDLVVDTVESGQQCIEYLRKNKLGYARFI 716
           G  G + DL    PK   Y +A+ST   R  + ++VD +   Q+CI YL+K + G A FI
Sbjct: 525 GIRGLVSDLC--QPKKERYALAVSTILGRNFDSIIVDNLAVAQECIAYLKKQRAGIASFI 582

Query: 717 LLDKLNTFNTNRIDTPDQSQRLFDLITVK-EKRFNNAFYSVLRDTLVCQNMEQANRVAYG 775
            LD +    T+ +   + S  +  +  ++ +  +  A   V  D+++C  +E A  + + 
Sbjct: 583 PLDTIEV-ETSTLPASESSGCILAINAIEYDPEYERAMRYVCSDSIICNTLEIARDMKWK 641

Query: 776 KK-RYRVVTLDGNLIDLSGTMTGG 798
           +  R ++VTL+G LI  +G MTGG
Sbjct: 642 RNVRSKLVTLEGTLIHRAGLMTGG 665

>KLLA0D07502g Chr4 complement(642751..646482) [3732 bp, 1243 aa] {ON}
            similar to uniprot|P32908 Saccharomyces cerevisiae
            YFL008W SMC1 Subunit of the multiprotein cohesin complex
            essential protein involved in chromosome segregation and
            in double-strand DNA break repair SMC chromosomal ATPase
            family member binds DNA with a preference for DNA with
            secondary structure
          Length = 1243

 Score =  133 bits (334), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 64/160 (40%), Positives = 103/160 (64%), Gaps = 10/160 (6%)

Query: 1232 VKDRLEGIKRKRYDEFMEGFKIISMTLKEMYQMIT---------LGGNAELELVDSLDPF 1282
             K++   +K KR + F   FK +   + ++Y+ +T          GGNA L + +  +P+
Sbjct: 1066 AKEKFLEVKAKRKELFEACFKHVDKHIDQIYRALTKNPHDKSELAGGNASLTVENEDEPY 1125

Query: 1283 SEGVTFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNV 1342
              G+ +   PP K ++++  LSGGEKT+++LAL+F ++ Y+P+P +V+DE+DAALD  NV
Sbjct: 1126 LGGIKYFATPPLKRFKDMEYLSGGEKTMAALALLFTINSYQPSPFFVLDEVDAALDITNV 1185

Query: 1343 SIVANYIKERT-KNAQFIVISLRNNMFELTKQLVGIYKHE 1381
              +A+YIK     NAQFIVISL+N MFE ++ LVGI++ +
Sbjct: 1186 ERIAHYIKRNANPNAQFIVISLKNAMFEKSQSLVGIFREQ 1225

 Score = 87.0 bits (214), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 68/214 (31%), Positives = 101/214 (47%), Gaps = 40/214 (18%)

Query: 133 LVLNDFKSYAGRQVIGPFHTSFSAIVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLI 192
           L L++FKSY     +G   + F++I+GPNGSGKSN++D++ FV G R+N++R   L DLI
Sbjct: 7   LELHNFKSYKDTVQVGFGESYFTSIIGPNGSGKSNLMDAISFVLGVRSNQLRSSALVDLI 66

Query: 193 HK----------------------SETFPDLKSCSVE----VHFKYVIDKDDGSTTIDET 226
           ++                      SE  P+  + S E     +   V  KDD    +DE 
Sbjct: 67  YRGRIENGDPDNGNAKRMHRSDADSEAGPENATYSEEEPRSAYVSCVYQKDD----LDEP 122

Query: 227 KGNLVVTRKAFKNNASKYFVNGKESNYTEVTTLLKKEGIDLDHKRFLILQGEVENIAQMK 286
                 TR    +  S Y +N +  +Y +    L+ E I +  K FL+ QG+VE IA   
Sbjct: 123 TK---FTRTINTSGDSVYKINDRAVSYKKYNEELESENILVKAKNFLVFQGDVERIAS-- 177

Query: 287 AKAEKENDDGLLEYLEDIIGTSKYKESIEKLSME 320
                +  + L   LE + G+  YK   EKL  E
Sbjct: 178 -----QGPESLTLLLEQVSGSINYKNDYEKLKEE 206

>SAKL0B02288g Chr2 (215750..219436) [3687 bp, 1228 aa] {ON} similar to
            uniprot|P32908 Saccharomyces cerevisiae YFL008W SMC1
            Subunit of the multiprotein cohesin complex essential
            protein involved in chromosome segregation and in
            double-strand DNA break repair SMC chromosomal ATPase
            family member binds DNA with a preference for DNA with
            secondary structure
          Length = 1228

 Score =  132 bits (333), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 70/195 (35%), Positives = 121/195 (62%), Gaps = 16/195 (8%)

Query: 1211 RFVEFNKRKNDLNSAVQSRDS----VKDRLEGIKRKRYDEFMEGFKIISMTLKEMYQMIT 1266
            R+ E   R + +N   +S  +    ++++   +K+ R + F + +  +S  + ++Y+ +T
Sbjct: 1027 RYEETQMRYDVINGETESLKAKEKKIREQYLKVKQSRREMFEKAYNHVSDHIDQIYRELT 1086

Query: 1267 ---------LGGNAELELVDSLDPFSEGVTFSVMPPKKSWRNISNLSGGEKTLSSLALVF 1317
                      GG+A L L D  +P+  G+ +   PP K ++++ +LSGGEKT+++LAL+F
Sbjct: 1087 KDPHSTAALAGGSASLTLEDEDEPYLAGIKYHATPPMKRFKDMEHLSGGEKTVAALALLF 1146

Query: 1318 ALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKER-TKNAQFIVISLRNNMFELTKQLVG 1376
            A++ Y+P+P +V+DE+DAALD  NV  +A YIK   + N QFIVISL+N+MFE ++ LVG
Sbjct: 1147 AINSYQPSPFFVLDEVDAALDNTNVEKIATYIKRHASPNFQFIVISLKNSMFEKSQALVG 1206

Query: 1377 IYK--HENMTKSAAL 1389
            +++   EN +K   L
Sbjct: 1207 VFRQQQENTSKVITL 1221

 Score = 93.2 bits (230), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 64/203 (31%), Positives = 101/203 (49%), Gaps = 26/203 (12%)

Query: 133 LVLNDFKSYAGRQVIGPFHTSFSAIVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLI 192
           L L++FKSY G   +G    +F++I+GPNGSGKSN++D++ FV G R++ +R   L DL+
Sbjct: 7   LELSNFKSYKGTVKVGFGDANFTSIIGPNGSGKSNMMDAISFVLGVRSSHLRSHLLMDLV 66

Query: 193 HKSETFPD------------LKSCSVEVHFKYVIDKDDGSTTIDETKGNLVVTRKAFKNN 240
           ++     D              S +   + K    K+   + I+         R   ++ 
Sbjct: 67  YRGRRTGDEEESMEEEPSSSKISSTRSAYVKAFYLKEGEESPIE-------FMRTISRSG 119

Query: 241 ASKYFVNGKESNYTEVTTLLKKEGIDLDHKRFLILQGEVENIAQMKAKAEKENDDGLLEY 300
            S Y VNGK   Y + T +L+KE I +  + FL+ QG+VE IA   A         L + 
Sbjct: 120 ESAYKVNGKTVGYKDYTDILEKENILIKARNFLVFQGDVEQIASQSAGE-------LTKL 172

Query: 301 LEDIIGTSKYKESIEKLSMEIES 323
            E I G+ +YK   E L+ E ++
Sbjct: 173 FEQISGSVQYKREYEILNDEYKA 195

>AGL023W Chr7 (670877..674545) [3669 bp, 1222 aa] {ON} Syntenic
            homolog of Saccharomyces cerevisiae YFL008W (SMC1)
          Length = 1222

 Score =  132 bits (332), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 74/228 (32%), Positives = 129/228 (56%), Gaps = 15/228 (6%)

Query: 1183 EVELLITSLDDFITSSEANVDVLEEYALRFVEFNKRKNDLNSAVQSRDSVKDRLEGIKRK 1242
            E E  I ++D+ +T  + N   +E +     +FN    + +   +S    K+    IK K
Sbjct: 995  EFESSIKAIDNTLTELQPNSKAVERFDEARDQFNAVSGESDKLKESERKAKELYLKIKEK 1054

Query: 1243 RYDEFMEGFKIISMTLKEMYQMIT---------LGGNAELELVDSLDPFSEGVTFSVMPP 1293
            R + F+  F  +   +  +Y+ +T          GG+A L L D  +P+  G+ +   PP
Sbjct: 1055 RINTFLACFNHVRDNIDRIYRELTRNPGSTAELAGGSASLTLEDEDEPYLGGIRYHATPP 1114

Query: 1294 KKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKER- 1352
             K ++++  LSGGEKT+++LAL+FA++ Y+P+P +++DE+DAALD  NV  +A YI+   
Sbjct: 1115 MKRFKDMDYLSGGEKTMAALALLFAINSYQPSPFFILDEVDAALDVTNVERIAAYIRRHA 1174

Query: 1353 TKNAQFIVISLRNNMFELTKQLVGIYK--HENMTKSAALVNEDLVGRA 1398
            +   QFIVISL++N+F  ++ + G+++  HEN   S+ ++  DL   A
Sbjct: 1175 SPKMQFIVISLKSNLFSKSESMAGVFRNQHEN---SSMVITTDLTQYA 1219

 Score = 86.3 bits (212), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 64/194 (32%), Positives = 96/194 (49%), Gaps = 26/194 (13%)

Query: 133 LVLNDFKSYAGRQVIGPFHTSFSAIVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLI 192
           L + +FKSY G   +G    +F +IVGPNGSGKSN++D++ FV G R++ +R   L DLI
Sbjct: 7   LEVKNFKSYKGVHNVGFGGKNFISIVGPNGSGKSNMMDAISFVLGIRSSHLRSSALVDLI 66

Query: 193 HKS---------ETFPDLKSCSVEVHFKYVIDKDDGSTTIDETKGNLVVTRKAFKNNASK 243
           ++          E  P  KS  V     YV  K D S      +  +  TR       S 
Sbjct: 67  YRGRMEEGGSAHENNP--KSAYVTAF--YV--KQDASG----AERRMEFTRVIHNTGDST 116

Query: 244 YFVNGKESNYTEVTTLLKKEGIDLDHKRFLILQGEVENIAQMKAKAEKENDDGLLEYLED 303
           Y ++GK   Y E   +L+ E I +  + FL+ QG+VE IA        ++   L +  E 
Sbjct: 117 YKLDGKTVGYKEYVDVLEGERILVKARNFLVFQGDVEQIAS-------QSGVDLTKLFEQ 169

Query: 304 IIGTSKYKESIEKL 317
           + G+ +Y+   E+L
Sbjct: 170 VSGSVQYQREYERL 183

>ZYRO0F03828g Chr6 (318190..321843) [3654 bp, 1217 aa] {ON} similar to
            uniprot|P32908 Saccharomyces cerevisiae YFL008W SMC1
            Subunit of the multiprotein cohesin complex essential
            protein involved in chromosome segregation and in
            double-strand DNA break repair SMC chromosomal ATPase
            family member binds DNA with a preference for DNA with
            secondary structure
          Length = 1217

 Score =  129 bits (323), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 66/163 (40%), Positives = 102/163 (62%), Gaps = 12/163 (7%)

Query: 1239 IKRKRYDEFMEGFKIISMTLKEMYQMIT---------LGGNAELELVDSLDPFSEGVTFS 1289
            IK+KR   F   F+  S  +  +Y+ +T          GG+A L L D  +PF+ G+ + 
Sbjct: 1048 IKKKRKALFERAFEYASEHIDPIYRELTKNPGSTNELAGGSASLTLEDEDEPFNAGIRYH 1107

Query: 1290 VMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYI 1349
              PP K ++++  LSGGEKT+++LAL+F ++ ++P+P +V+DE+DAALD  NV  +A YI
Sbjct: 1108 ATPPFKRFKDMEYLSGGEKTVAALALLFTINSFQPSPFFVLDEVDAALDSTNVDRIAAYI 1167

Query: 1350 -KERTKNAQFIVISLRNNMFELTKQLVGIYK--HENMTKSAAL 1389
             +   ++ QFIVISL+N MFE +  LVG+Y+   EN +K   L
Sbjct: 1168 SRHGNRDLQFIVISLKNTMFEKSDALVGVYRQQQENSSKIVTL 1210

 Score = 94.0 bits (232), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 60/200 (30%), Positives = 102/200 (51%), Gaps = 18/200 (9%)

Query: 133 LVLNDFKSYAGRQVIGPFHTSFSAIVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLI 192
           L L +FKSY G   +G   ++F +I+GPNGSGKSN++D++ FV G +++ +R   L DLI
Sbjct: 7   LELYNFKSYRGTVRVGFGDSNFISIIGPNGSGKSNMMDAISFVLGVKSSHLRSQILKDLI 66

Query: 193 HKS--ETFPDLKSCSVEVHFKYVIDKDDGSTTIDETKGNLVVTRKAFKNNASKYFVNGKE 250
           ++       +        + K    K D +  +         +R   +N  ++Y +NGK 
Sbjct: 67  YRGVEGEEDEEDGEGRTAYVKAFYLKSDSTVEL---------SRSISRNGDTQYKMNGKN 117

Query: 251 SNYTEVTTLLKKEGIDLDHKRFLILQGEVENIAQMKAKAEKENDDGLLEYLEDIIGTSKY 310
             Y +    L++E I +  + FL+ QG+V  IA   A         L +  E+I G+ +Y
Sbjct: 118 CGYKQYAEFLEEENILIKAQNFLVFQGDVVQIASQSAT-------DLTKLFEEISGSIQY 170

Query: 311 KESIEKLSMEIESLNEICVE 330
           K+  + L  +++SLN+   E
Sbjct: 171 KKEYDSLKGKVDSLNQSAAE 190

>Ecym_7303 Chr7 (638719..642387) [3669 bp, 1222 aa] {ON} similar to
            Ashbya gossypii AGL023W
          Length = 1222

 Score =  118 bits (295), Expect = 7e-26,   Method: Compositional matrix adjust.
 Identities = 102/406 (25%), Positives = 188/406 (46%), Gaps = 56/406 (13%)

Query: 1032 EVKLEHEIEMKHNELESHQKVVSDYKSISLEYNNKLEKLEASEASLKKSIKRYNDLLSEL 1091
            E KLE E E        H+K + D + +  E     E LE  E+ ++  I++ +  +S+ 
Sbjct: 825  ENKLEFETERLQGTRVRHEKTIGDLEKVKQE----TESLEEQESKIQSQIEQVDSQISQH 880

Query: 1092 -------------------TIRDVTQVLNTIMTEENASVDKSDPKLENTSAVINADDDGI 1132
                                + ++   LN ++      VD+    +E T         GI
Sbjct: 881  NEEIEHLQEASRKKYQSVKALEEIANDLNEMVQTSKREVDQLKDDIEKT---------GI 931

Query: 1133 SAVSENQSFNHNDENDDIDSNKME------IDSQGGFINPGIPVLSASELAKVDPQEVEL 1186
              V+  ++    +     D + ++      IDS+   +   I V  +S   K       L
Sbjct: 932  ERVNLFKNCKMTNVELPTDKSTLDELPIERIDSEAIEMANSITVDYSSLDNKYKESGSNL 991

Query: 1187 LITSLDDFITSSEANVDVLEEYALRFVEFNKRKNDLNSAVQSRDSV-------KDRLEGI 1239
                 +D I   E  +  L+  +     F++ K   + A+   + +       K++   I
Sbjct: 992  TREEFEDSIKDIENTLRELQPNSKAVERFDEAKEQFSVAIDESEKLKEIERESKEKYLKI 1051

Query: 1240 KRKRYDEFMEGFKIISMTLKEMYQMIT---------LGGNAELELVDSLDPFSEGVTFSV 1290
            K KR   F+  F+ ++  +  +Y+ +T          GG+A L L D  +P+  G+ +  
Sbjct: 1052 KEKRVKTFLSCFQHVTDHIDRIYRELTRNPGSTAELAGGSASLTLEDEDEPYLAGIRYHA 1111

Query: 1291 MPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIK 1350
             PP K ++++  LSGGEKT+++LAL+FA++ Y+P+P +++DE+DAALD  NV  +A YIK
Sbjct: 1112 TPPMKRFKDMDYLSGGEKTMAALALLFAINSYQPSPFFILDEVDAALDVTNVERIAAYIK 1171

Query: 1351 ER-TKNAQFIVISLRNNMFELTKQLVGIYKHENMTKSAALVNEDLV 1395
               +   QFIVISL++N+F  ++ + G+++++    S+ ++  DL 
Sbjct: 1172 RHASPKFQFIVISLKSNLFGKSQSMAGVFRNQQ-ANSSMVITTDLT 1216

 Score = 93.6 bits (231), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 63/202 (31%), Positives = 102/202 (50%), Gaps = 24/202 (11%)

Query: 133 LVLNDFKSYAGRQVIGPFHTSFSAIVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLI 192
           L LN+FKSY G   +G  +  F +IVGPNGSGKSN++D++ FV G R+N +R + L DLI
Sbjct: 7   LELNNFKSYKGTHNVGFGNKHFISIVGPNGSGKSNMMDAISFVLGIRSNHLRSNALVDLI 66

Query: 193 HKS-------ETFPDLKSCSVEVHFKYVIDKDDGSTTIDETKGNLVVTRKAFKNNA-SKY 244
           ++        E     KS  V+  +   +  D+G       +G  +   +  +N   S Y
Sbjct: 67  YRGRMDDRSDEHVASPKSAYVKAFY---LKDDNGE------QGTKIEFMRIIQNTGDSVY 117

Query: 245 FVNGKESNYTEVTTLLKKEGIDLDHKRFLILQGEVENIAQMKAKAEKENDDGLLEYLEDI 304
            ++GK  ++      L+ E I +  + FL+ QG+VE IA        ++   L +  E +
Sbjct: 118 RIDGKTVSFKRYVEYLEGESILVKARNFLVFQGDVEQIAS-------QSGIELTKLFEQV 170

Query: 305 IGTSKYKESIEKLSMEIESLNE 326
            G+ +Y+   E+L  E +   E
Sbjct: 171 SGSVQYQREYERLKEEYQKATE 192

 Score = 72.4 bits (176), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 49/151 (32%), Positives = 81/151 (53%), Gaps = 16/151 (10%)

Query: 661 GFHGRLGDLAVIDP-KYDVAISTACPR-LNDLVVDTVESGQQCIEYLRKNKLGYARFILL 718
           G  G + DL      KY +A+S+   +  + +VVD+V   QQCI YL+K++ G A FI L
Sbjct: 524 GVKGLVHDLCRPKKDKYALAVSSMLGKNFDSIVVDSVSVAQQCISYLKKHRSGAASFIPL 583

Query: 719 DKLNTFNTNRIDTPDQSQRLFD--LITVKEKRFNN----AFYSVLRDTLVCQNMEQANRV 772
           D ++      I+TP    R     ++TV    +++    A   V  D+++C  ++ A  +
Sbjct: 584 DTID------INTPTLPVRNLKGCILTVNAIEYDSELEKAMQYVCSDSIICDTLDIAKNL 637

Query: 773 AYGKK-RYRVVTLDGNLIDLSGTMTGG-GRN 801
            + +  + ++VT+ G LI  +G MTGG GRN
Sbjct: 638 KWDRGIKSKLVTIQGALIHRAGLMTGGVGRN 668

>Kwal_55.20421 s55 (391382..394894) [3513 bp, 1170 aa] {ON} YFR031C
           (SMC2) - SMC chromosomal ATPase family member [contig
           149] FULL
          Length = 1170

 Score =  115 bits (288), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 179/740 (24%), Positives = 314/740 (42%), Gaps = 139/740 (18%)

Query: 130 IHQLVLNDFKSYAGRQVIGPFHTSFSAIVGPNGSGKSNVIDSMLFVFGFRA-NKMRQDRL 188
           + +L+++ FKSYA R VI  +   F+AI G NGSGKSN++D++ FV G  + + +R   L
Sbjct: 3   VEELIIDGFKSYATRTVISNWDPQFNAITGLNGSGKSNILDAICFVLGISSMSTVRASNL 62

Query: 189 SDLIHKSETFPDLKSCSVEVHFKYVIDKDDGSTTID-ETKGNLVVTRKAFKNNASKYFVN 247
            DLI+K      +   SV + F    + D  ++ I  E+   + VTR+      SKY +N
Sbjct: 63  QDLIYKRGQ-AGVTKASVTIVFA---NSDKNNSPIGFESYPKISVTRQIVLGGTSKYLIN 118

Query: 248 GKESNYTEVTTLLKKEGIDLDHKRFLILQGEVENIAQMKAKAEKENDDGLLEYLEDIIGT 307
           G  +    V  L +   +++++  FLI+QG++  +  MK          +L  +E+  GT
Sbjct: 119 GHRAQQQTVLHLFQSVQLNINNPNFLIMQGKITKVLNMKPTE-------ILSLIEEAAGT 171

Query: 308 SKYKESIEK----LSMEIESLNEI--CVEKENRFSIVEREKNSLESGKEEALQFXXXXXX 361
             +++  EK    ++ +   L EI   +++E     VE + N L + K   L F      
Sbjct: 172 KMFEDRREKAERTMNKKETKLQEIRSLLQEE-----VEPKLNKLRNEKRAFLDFQETQSD 226

Query: 362 XXXXXXXXYQYNLMQXXXXXXXXXXXXTNVQQEQTKQEDEFRKANSHISDITAS------ 415
                     +                +++ Q++   E+ F+ + S IS++TAS      
Sbjct: 227 LENTSKIVNAFVF--------------SSLVQKRKNIENAFQNSESRISELTASVQQTKV 272

Query: 416 -LNVLKADLEKVHTEEVN-------LSKTKR------------------TLENKKVEN-- 447
            L  L+ DL+ + T++ N       LSK +                   T+EN   EN  
Sbjct: 273 ELTNLEEDLDTIRTQKRNEMRKDGALSKLEALETQLINEVSRLKTSLSLTIENINQENGK 332

Query: 448 -EQIVNNLDSKRKEFEEQSKI----------LQDKINSTDQEIQTIIEEQSSLAEG-TTV 495
            E +  ++   +   +E+S I          L D + +  Q++QT  E  S+L  G ++ 
Sbjct: 333 RESLERSIRGIQTSLQEKSAISKNAENEYNELHDLVQNLSQQLQTKEELLSTLTTGISST 392

Query: 496 LSTNXXXXXXXXXXXXXXXXXXTEHLTIQIAEYEKELSPWNEQSQQLKKEIKITESEL-- 553
            +TN                       IQ+  +E +++        LKKE+   E ++  
Sbjct: 393 GATNSGYSAQLSNTKARLNDAR-----IQVQRFEMKINI-------LKKELAANEPKIVD 440

Query: 554 --SIIEENRKGLENDIAGLENAILSQKRD-LEVQEQEIKSLLEQKTKVIQERELGERECK 610
             S+ EE +K +E  + G++ + L    + L       KSL E+++ +            
Sbjct: 441 AKSLSEEAKKQVE--VTGIQCSDLKMHLEKLGFNPDLFKSLKEEESSL------------ 486

Query: 611 NAQATLANVREKVEALRQKAIEIRSTYSATENNNKVLSALLRLQKSGRLNGFHGRLGDLA 670
             ++ + N+   +E LR+K   I   YS   +     S          + G   +L  L 
Sbjct: 487 --KSKIYNLSNDMEGLRRKVANIDFAYSKPSDKFDPTS----------VKGVAAQLFSLN 534

Query: 671 VIDPKYDVAIS-TACPRLNDLVVDTVESGQQCIEYLRKNKLGYARFILLDKL-------N 722
             +     A+   A  RL ++VV+   +  Q +E  R  K      I L+K+       +
Sbjct: 535 EENFSSATALQICAGGRLFNVVVNNESTASQLLERGRLRK--RVTIIPLNKISARRLHQD 592

Query: 723 TFNTNRIDTPDQSQRLFDLITVKEKRFNNAFYSVLRDTLVCQNMEQANRVAYGKK-RYRV 781
           T N  +   PD  +   +LI   E     A   +   +L+C++ E A +V +  K R R 
Sbjct: 593 TVNFAKQLAPDSVELALNLIGY-EDEVAKAMEFIFGTSLICRDAETAKKVTFHPKVRARS 651

Query: 782 VTLDGNLIDLSGTMTGGGRN 801
           +TL G++ D  GT++GG RN
Sbjct: 652 ITLQGDIYDPEGTLSGGSRN 671

 Score = 67.8 bits (164), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 33/73 (45%), Positives = 54/73 (73%), Gaps = 1/73 (1%)

Query: 1297 WR-NISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN 1355
            W+ ++  LSGG+++L +L+L+ AL ++KP P+Y++DE+DAALD  +   + + IK R K 
Sbjct: 1077 WKESLVELSGGQRSLIALSLILALLQFKPAPMYILDEVDAALDLSHTQNIGHLIKTRFKG 1136

Query: 1356 AQFIVISLRNNMF 1368
            +QFIV+SL+  MF
Sbjct: 1137 SQFIVVSLKEGMF 1149

>AGR236W Chr7 (1189845..1193357) [3513 bp, 1170 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YFR031C (SMC2)
          Length = 1170

 Score =  100 bits (249), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 61/190 (32%), Positives = 100/190 (52%), Gaps = 15/190 (7%)

Query: 130 IHQLVLNDFKSYAGRQVIGPFHTSFSAIVGPNGSGKSNVIDSMLFVFGFRA-NKMRQDRL 188
           + +L+++ FKSYA R VI  +   F+AI G NGSGKSN++DS+ FV G  +   +R   L
Sbjct: 3   VEELIIDGFKSYATRTVISGWDPQFNAITGLNGSGKSNILDSICFVLGISSMATVRAQNL 62

Query: 189 SDLIHKSETFPDLKSCSVEVHFKYVIDKDDGSTTI--DETKGNLVVTRKAFKNNASKYFV 246
            DLI+K       ++  ++     V D  D S++    ET   + VTR+      SKY +
Sbjct: 63  QDLIYKRG-----QAGVIKASVTIVFDNSDPSSSPFGFETYPKISVTRQIILGGTSKYLI 117

Query: 247 NGKESNYTEVTTLLKKEGIDLDHKRFLILQGEVENIAQMKAKAEKENDDGLLEYLEDIIG 306
           NG  +    V  L +   +++++  FLI+QG++  +  MK        D +L  +E+  G
Sbjct: 118 NGHRAQQLTVLHLFQSVQLNINNPNFLIMQGKITKVLNMKP-------DEILALIEEAAG 170

Query: 307 TSKYKESIEK 316
           T  +++  EK
Sbjct: 171 TRMFEDRREK 180

 Score = 67.8 bits (164), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 33/73 (45%), Positives = 54/73 (73%), Gaps = 1/73 (1%)

Query: 1297 WR-NISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN 1355
            W+ ++  LSGG+++L +L+L+ AL ++KP P+Y++DE+DAALD  +   + + IK R K 
Sbjct: 1077 WKESLVELSGGQRSLIALSLILALLQFKPAPMYILDEVDAALDLSHTQNIGHLIKTRFKG 1136

Query: 1356 AQFIVISLRNNMF 1368
            +QFIV+SL+  MF
Sbjct: 1137 SQFIVVSLKEGMF 1149

>NDAI0G02070 Chr7 (461697..465212) [3516 bp, 1171 aa] {ON} Anc_7.186
           YFR031C
          Length = 1171

 Score = 96.7 bits (239), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 59/188 (31%), Positives = 98/188 (52%), Gaps = 11/188 (5%)

Query: 130 IHQLVLNDFKSYAGRQVIGPFHTSFSAIVGPNGSGKSNVIDSMLFVFGFRA-NKMRQDRL 188
           + +L+++ FKSYA R VI  +   F+AI G NGSGKSN++D++ FV G  +   +R   L
Sbjct: 3   VEELIIDGFKSYATRTVISDWDPQFNAITGLNGSGKSNILDAICFVLGITSMTTVRASNL 62

Query: 189 SDLIHKSETFPDLKSCSVEVHFKYVIDKDDGSTTIDETKGNLVVTRKAFKNNASKYFVNG 248
            DLI+K      +   SV + F    DK +     + +   + VTR+      SKY +NG
Sbjct: 63  QDLIYKRGQ-AGITKASVTIVFDNT-DKTNSPIGFNNS-AKISVTRQVVLGGTSKYLING 119

Query: 249 KESNYTEVTTLLKKEGIDLDHKRFLILQGEVENIAQMKAKAEKENDDGLLEYLEDIIGTS 308
             +    V  L +   +++++  FLI+QG++  +  MK K        +L  +E+  GT 
Sbjct: 120 HRAPQQSVLQLFQSVQLNINNPNFLIMQGKITKVLNMKPKE-------ILSLIEEAAGTK 172

Query: 309 KYKESIEK 316
            +++  EK
Sbjct: 173 MFEDRREK 180

 Score = 81.3 bits (199), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 32/73 (43%), Positives = 54/73 (73%), Gaps = 1/73 (1%)

Query: 1297 WR-NISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN 1355
            W+ ++  LSGG+++L +L+L+ AL +++P P+Y++DE+DAALD  +   + + IK R K 
Sbjct: 1078 WKESLVELSGGQRSLIALSLIMALLQFRPAPMYILDEVDAALDLSHTQNIGHLIKTRFKG 1137

Query: 1356 AQFIVISLRNNMF 1368
            +QFIV+SL+  MF
Sbjct: 1138 SQFIVVSLKEGMF 1150

 Score = 38.1 bits (87), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 33/123 (26%), Positives = 60/123 (48%), Gaps = 12/123 (9%)

Query: 682 TACPRLNDLVVDTVESGQQCIEYLRKNKLGYARFILLDKLN--TFNTNRIDT------PD 733
            A  RL ++VVD  ++    +E  R  K      I L+K++  T N     T      P 
Sbjct: 547 CAGGRLYNVVVDNEKTASSLLERGRLRK--RVTIIPLNKISARTLNERSCTTKRKKLAPG 604

Query: 734 QSQRLFDLITVKEKRFNNAFYSVLRDTLVCQNMEQANRVAYGKK-RYRVVTLDGNLIDLS 792
           + +   +LI   ++  +NA   +   +L+CQ+ + A +V +  + R R +TL+G++ D  
Sbjct: 605 KVELALNLIGYDDE-VSNAMEFIFGGSLICQDADTAKKVTFHPQIRTRSITLEGDVYDPE 663

Query: 793 GTM 795
           GT+
Sbjct: 664 GTL 666

>TBLA0G03530 Chr7 complement(941941..945639) [3699 bp, 1232 aa] {ON}
           Anc_8.68 YFL008W
          Length = 1232

 Score = 96.7 bits (239), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 63/201 (31%), Positives = 104/201 (51%), Gaps = 23/201 (11%)

Query: 133 LVLNDFKSYAGRQVIGPFHTSFSAIVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLI 192
           L L++FKSY G   IG   ++F++I+GPNGSGKSN++D++ FV G R+N +R   + DLI
Sbjct: 7   LELSNFKSYKGTVKIGFGDSNFTSIIGPNGSGKSNMMDAISFVLGVRSNDLRSSGMKDLI 66

Query: 193 HKS-----ETFPDLKSCSVEVHFKYVIDKDDGSTTIDETKGNLVVTRKAFKNNASKYFVN 247
           H+S      +  D  S  V+  +K      D S   +       + R    +  + Y +N
Sbjct: 67  HRSVRDSQSSNDDPTSAYVKAFYKVT----DASEITE-------LMRIVNLSGETIYKIN 115

Query: 248 GKESNYTEVTTLLKKEGIDLDHKRFLILQGEVENIAQMKAKAEKENDDGLLEYLEDIIGT 307
           GK +++   +  L KE I +  K FL+ QG+VE IA   +         L +  E + G+
Sbjct: 116 GKTTSFKNYSDWLAKENILIKAKNFLVFQGDVETIASQSSLE-------LTKLFEQVSGS 168

Query: 308 SKYKESIEKLSMEIESLNEIC 328
            +YK+  + L  ++  +N + 
Sbjct: 169 IQYKKEYDLLKEDLNKINRLT 189

 Score = 66.2 bits (160), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 46/153 (30%), Positives = 74/153 (48%), Gaps = 16/153 (10%)

Query: 661 GFHGRLGDLAVIDPK---YDVAISTACPR-LNDLVVDTVESGQQCIEYLRKNKLGYARFI 716
           G  G + DL    PK   Y +AI T   +  N ++VD++   Q+CI YL+K + G   FI
Sbjct: 522 GVRGLVHDLC--HPKKDKYALAILTILGKNFNSVIVDSLSVAQECISYLKKQRAGIISFI 579

Query: 717 LLD-------KLNTFNTNRIDTPDQSQRLFDLITVK-EKRFNNAFYSVLRDTLVCQNMEQ 768
            LD        L T   N     + S  +  +  ++ E  F  A   +  ++++C N++ 
Sbjct: 580 PLDTIEAQIPSLPTIIQNNPKYNNDSNCILTINAIEYEPEFERAMQYICSNSIICDNLDI 639

Query: 769 ANRVAYGK--KRYRVVTLDGNLIDLSGTMTGGG 799
           A  + + +  K  + VTLDG++I  S  MTGG 
Sbjct: 640 AKDLKWNQNVKNVKFVTLDGSIIHKSNLMTGGA 672

>SAKL0F07282g Chr6 complement(554459..557971) [3513 bp, 1170 aa]
           {ON} similar to uniprot|P38989 Saccharomyces cerevisiae
           YFR031C SMC2 Component of the condensin complex
           essential SMC chromosomal ATPase family member that
           forms a complex with Smc4p to form the active ATPase
           Smc2p/Smc4p complex binds DNA possibly in the cleft
           formed by the coiled-coil of the folded dimer
          Length = 1170

 Score = 96.3 bits (238), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 61/189 (32%), Positives = 99/189 (52%), Gaps = 13/189 (6%)

Query: 130 IHQLVLNDFKSYAGRQVIGPFHTSFSAIVGPNGSGKSNVIDSMLFVFGFRAN-KMRQDRL 188
           + +L+++ FKSYA R VI  +   F+AI G NGSGKSN++DS+ FV G  +   +R   L
Sbjct: 3   VEELIIDGFKSYATRTVISNWDPQFNAITGLNGSGKSNILDSICFVLGISSMVTVRASNL 62

Query: 189 SDLIHKSETFPDLKSCSVEVHFKYVIDKDDGSTTID-ETKGNLVVTRKAFKNNASKYFVN 247
            DLI+K      +   SV + F    + D  S+ I  E+   + VTR+      SKY +N
Sbjct: 63  QDLIYKRGQ-AGVTKASVTIVFD---NTDKSSSPIGFESYPKISVTRQIILGGTSKYLIN 118

Query: 248 GKESNYTEVTTLLKKEGIDLDHKRFLILQGEVENIAQMKAKAEKENDDGLLEYLEDIIGT 307
           G  +    V  L +   +++++  FLI+QG++  +  MK          +L  +E+  GT
Sbjct: 119 GHRAQQQTVLHLFQSVQLNINNPNFLIMQGKITKVLNMKPTE-------ILSLIEEAAGT 171

Query: 308 SKYKESIEK 316
             +++  EK
Sbjct: 172 RMFEDRREK 180

 Score = 67.8 bits (164), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 33/73 (45%), Positives = 54/73 (73%), Gaps = 1/73 (1%)

Query: 1297 WR-NISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN 1355
            W+ ++  LSGG+++L +L+L+ AL ++KP P+Y++DE+DAALD  +   + + IK R K 
Sbjct: 1077 WKESLVELSGGQRSLIALSLILALLQFKPAPMYILDEVDAALDLSHTQNIGHLIKTRFKG 1136

Query: 1356 AQFIVISLRNNMF 1368
            +QFIV+SL+  MF
Sbjct: 1137 SQFIVVSLKEGMF 1149

>KAFR0G02930 Chr7 complement(609210..612722) [3513 bp, 1170 aa] {ON}
           Anc_7.186 YFR031C
          Length = 1170

 Score = 95.9 bits (237), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 60/188 (31%), Positives = 98/188 (52%), Gaps = 11/188 (5%)

Query: 130 IHQLVLNDFKSYAGRQVIGPFHTSFSAIVGPNGSGKSNVIDSMLFVFGFRA-NKMRQDRL 188
           I +L+++ FKSYA R VI  +   F+AI G NGSGKSN++D++ FV G  + + +R   L
Sbjct: 3   IEELIIDGFKSYAARTVISDWDPQFNAITGLNGSGKSNILDAICFVLGISSMSTVRASNL 62

Query: 189 SDLIHKSETFPDLKSCSVEVHFKYVIDKDDGSTTIDETKGNLVVTRKAFKNNASKYFVNG 248
            DLI+K      +   SV V F    D+D+       +   + VTR+      SKY +NG
Sbjct: 63  QDLIYKRGQ-AGVTKASVTVVFDNS-DRDNSPIGFTNSP-KISVTRQVVLGGTSKYLING 119

Query: 249 KESNYTEVTTLLKKEGIDLDHKRFLILQGEVENIAQMKAKAEKENDDGLLEYLEDIIGTS 308
             +    V  L +   +++++  FLI+QG++  +  MK          +L  +E+  GT 
Sbjct: 120 HRAPQQSVLQLFQSVQLNINNPNFLIMQGKITKVLNMKPTE-------ILSLIEEAAGTK 172

Query: 309 KYKESIEK 316
            +++  EK
Sbjct: 173 MFEDRREK 180

 Score = 81.6 bits (200), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 32/73 (43%), Positives = 54/73 (73%), Gaps = 1/73 (1%)

Query: 1297 WR-NISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN 1355
            W+ ++  LSGG+++L +L+L+ AL +++P P+Y++DE+DAALD  +   + + IK R K 
Sbjct: 1077 WKESLVELSGGQRSLIALSLIMALLQFRPAPMYILDEVDAALDLSHTQNIGHLIKTRFKG 1136

Query: 1356 AQFIVISLRNNMF 1368
            +QFIV+SL+  MF
Sbjct: 1137 SQFIVVSLKEGMF 1149

 Score = 45.1 bits (105), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 52/207 (25%), Positives = 88/207 (42%), Gaps = 26/207 (12%)

Query: 607 RECKNAQATLANVREKVEALRQKAIEIRSTYSATENNNKVLSALLRLQKSGRLNGFHGRL 666
           +E    Q  L    E+ EAL+++   I   Y+    N    S          + G   +L
Sbjct: 481 KEESEVQQQLYRANEEAEALKRRVANIEFNYTRPSANFDPKS----------VKGVAAQL 530

Query: 667 GDLAVIDPKYDVAIS---TACPRLNDLVVDTVESGQQCIEYLRKNKLGYARFILLDKL-- 721
               V   ++D AI+    A  RL +++VD   +  Q +E  R  K      I L K+  
Sbjct: 531 --FTVDQQQFDNAIALQVCAGGRLYNIIVDNEITASQLLERGRLKK--RVTIIPLSKIAT 586

Query: 722 NTFNTNRID-----TPDQSQRLFDLITVKEKRFNNAFYSVLRDTLVCQNMEQANRVAYGK 776
            T N N +       P + +   +LI   ++  + A   +  + LVC++ + A +V +  
Sbjct: 587 RTLNKNTLALAKELAPGKVELALNLIGYDDE-VSKAMEFIFGNGLVCKDADTAKKVTFHP 645

Query: 777 K-RYRVVTLDGNLIDLSGTMTGGGRNV 802
             R R +T  G++ D  GT++GG RN 
Sbjct: 646 NIRTRSITQQGDVYDPEGTLSGGSRNT 672

>KLLA0D16005g Chr4 complement(1346492..1350004) [3513 bp, 1170 aa]
           {ON} similar to uniprot|P38989 Saccharomyces cerevisiae
           YFR031C SMC2 Component of the condensin complex
           essential SMC chromosomal ATPase family member that
           forms a complex with Smc4p to form the active ATPase
           Smc2p/Smc4p complex binds DNA possibly in the cleft
           formed by the coiled-coil of the folded dimer
          Length = 1170

 Score = 95.5 bits (236), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 58/189 (30%), Positives = 100/189 (52%), Gaps = 13/189 (6%)

Query: 130 IHQLVLNDFKSYAGRQVIGPFHTSFSAIVGPNGSGKSNVIDSMLFVFGFRA-NKMRQDRL 188
           + +L+++ FKSYA R VI  +   F+AI G NGSGKSN++D++ FV G  +   +R   L
Sbjct: 3   VEELIIDGFKSYATRTVITDWDPQFNAITGLNGSGKSNILDAICFVLGISSMATVRAQNL 62

Query: 189 SDLIHKSETFPDLKSCSVEVHFKYVIDKDDGSTTID-ETKGNLVVTRKAFKNNASKYFVN 247
            DLI+K      +   SV + F    + D  ++ I  E+   + +TR+      SKY +N
Sbjct: 63  QDLIYKRGQ-AGVTKASVTIVFN---NSDTSNSPIGFESHAKISITRQIILGGVSKYLIN 118

Query: 248 GKESNYTEVTTLLKKEGIDLDHKRFLILQGEVENIAQMKAKAEKENDDGLLEYLEDIIGT 307
           G  +    V  L +   +++++  FLI+QG++  +  MK +        +L  +E+  GT
Sbjct: 119 GHRAQQQTVLQLFQSVQLNINNPNFLIMQGKITKVLNMKPQE-------ILSLIEEAAGT 171

Query: 308 SKYKESIEK 316
             +++  EK
Sbjct: 172 RMFEDRREK 180

 Score = 69.3 bits (168), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 42/140 (30%), Positives = 83/140 (59%), Gaps = 1/140 (0%)

Query: 1229 RDSVKDRLEGIKRKRYDEFMEGFKIISMTLKEMYQMITLGGNAELELVDSLDPFSEGVTF 1288
            +  +++ +E +   + +  ++ ++ +S+    ++  +     A+LE  +  D  +EG+  
Sbjct: 1011 KQKIQETIEKLNEYKRETLIKTWEKVSVDFGNIFGDLLPNSFAKLEPSEGKD-VTEGLEV 1069

Query: 1289 SVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANY 1348
             V   K    ++  LSGG+++L +L+L+ AL ++KP P+Y++DE+DAALD  +   + + 
Sbjct: 1070 KVKLGKIWKESLVELSGGQRSLIALSLILALLQFKPAPMYILDEVDAALDLSHTQNIGHL 1129

Query: 1349 IKERTKNAQFIVISLRNNMF 1368
            IK R K +QFIV+SL+  MF
Sbjct: 1130 IKTRFKGSQFIVVSLKEGMF 1149

>TPHA0I01090 Chr9 complement(252902..256552) [3651 bp, 1216 aa] {ON}
           Anc_1.295 YJL074C
          Length = 1216

 Score = 95.5 bits (236), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 163/717 (22%), Positives = 304/717 (42%), Gaps = 91/717 (12%)

Query: 128 LFIHQLVLNDFKSYAGRQVIGPFHTSFSAIVGPNGSGKSNVIDSMLFVFGFRANKMRQDR 187
           ++I ++++  FK+Y    +I  F   ++ I+G NGSGKSN   ++ FV     + ++++ 
Sbjct: 1   MYIQKVIIKGFKTYRNETIIDDFSPHYNIIIGSNGSGKSNFFAAIRFVLSDDYSNLKREE 60

Query: 188 LSDLIHKSETFPDLKSCSVEVHFKYVIDKDDGSTTIDET-----KGNLVVTRKAFKNNAS 242
              LIH+      + S SVE+ F      D G++ I  +       + V  R+       
Sbjct: 61  RQGLIHQGS--GSVMSASVEIQF-----YDPGNSMILPSGVAVNPDSTVSIRRTVGLKKD 113

Query: 243 KYFVNGKESNYTEVTTLLKKEGIDLDHKRFLILQGEVENIAQMKAKAEKENDDGLLEYLE 302
            Y +N +    +++  +++  G  + +   ++ QG +  +A   AK     D   L+ LE
Sbjct: 114 DYQINDRNVTKSDIVRMMESTGFSMSNPYNIVPQGRI--VALTNAK-----DKERLQILE 166

Query: 303 DIIGTSKYK----------ESIEKLSMEI-ESLNEIC--VEKENRFSIVEREKNSLESGK 349
           D++G   ++          E  EK  M+I + + E+   +++         + N LE G 
Sbjct: 167 DVVGAKSFEAKLTASLKKMEETEKKRMQIAKEMKELTKKLDEMEEERKELEKYNDLE-GD 225

Query: 350 EEALQFXXXXXXXXXXXXXXYQYNLMQXXXXXXXXXXXXTNVQQEQTKQEDEFRKANSHI 409
            +  QF              Y   L              TN+     +   E  K    +
Sbjct: 226 RKVFQF------------TLYDRELNDIINQIEKLESEYTNILYTSEQYLQELDKREGIV 273

Query: 410 SDITASLNVLKADLEKVHTEEVNLSKTKRT-LENKKVENEQIVNNLDSKRKEFEEQSKIL 468
            DIT +L   +A L+   T E+  +K   T L+NK    +  +N++ S+    EEQ+KI 
Sbjct: 274 VDITKTLQNTEASLKLKGTTELQQAKFHFTDLQNKVANYDVTINDIQSQINSQEEQTKID 333

Query: 469 QDKINSTDQEIQTIIEEQSSLAEGTTVLSTNXXXXXXXXXXXXXXXXXXTEHLTIQIAEY 528
           Q+ +N     +   I+E+  L                             ++L I+  +Y
Sbjct: 334 QNNLNI----LSDAIKEKRKLVAECLPKFEELTKQENELRSVLASLQERQKNLMIKKGKY 389

Query: 529 EKELSPWNEQSQQLKKEIKITESELSIIEENR--------------KGLENDIAGL---- 570
            K  +   E+++ + +E+   + E ++++ N+              K L+ DI  L    
Sbjct: 390 AK-FTTVEERNKWIDEEVANIKEEFTLLKTNKEQLTSEQEYNEQEVKKLDEDIEDLIDST 448

Query: 571 ENAILSQKRDLEVQEQEIKSLLEQKTKVIQERELGERECKNAQATLANVREKVEALRQKA 630
           +  ++  + D EV+E+  K   E   K    REL  RE +  Q  L N+ E V+  R + 
Sbjct: 449 QGPVVLGELD-EVKEKIAKVKTEYSQKFDARRELW-REEQRLQTILENMSEGVK--RSER 504

Query: 631 IEIRSTYSATENNNKVLSALLRLQKSGRLN----GFHGRLGDLAVIDPKYD-VAISTACP 685
           I   + + +  N  K +  ++      +LN       G LG+L  +  KY   A      
Sbjct: 505 ILNETMHRSVANGIKNVKEIV-----DKLNLPDDAVLGTLGELIKVSEKYKRCAEVIGGN 559

Query: 686 RLNDLVVDTVESGQQCIEYLRKNKLGYARFILLDKLNTFNTNRIDTPDQSQRLFDLI-TV 744
            L ++VVDT E+    ++ L + K G   F+ L+++   ++N    P+       LI  +
Sbjct: 560 SLFNIVVDTDETASLIMDELYRMKGGRVTFMPLNRIR-MDSNFTYPPNDQASCTPLIKKI 618

Query: 745 K-EKRFNNAFYSVLRDTLVCQNMEQANRVAYGKKRYRV--VTLDGNLIDLSGTMTGG 798
           K + R+  A   V   T+V +++ + +++A   KR+++  +TLDG+  D  G +TGG
Sbjct: 619 KFDVRYEKAVMHVFGKTIVVKDLGEGSKLA---KRFKMNAITLDGDRADKRGELTGG 672

 Score = 80.5 bits (197), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 54/205 (26%), Positives = 106/205 (51%), Gaps = 24/205 (11%)

Query: 1212 FVEFNKRKNDLNSAVQ----SRDSVKDRLEGIKRKRYDEFMEGFKIISMTLKEMYQMITL 1267
            F +F++++N+L    +    S++S+++ +  +K ++       FK +S    ++++ +  
Sbjct: 998  FKKFSEKQNELVERAKELDDSKNSIQELITQLKEQKITAVDTTFKKVSENFTKVFEKLVP 1057

Query: 1268 GGNAELEL-------VDSLDPFSE----------GVTFSVM--PPKKSWRNISNLSGGEK 1308
             G A L +       + S+D  ++          GV+ SV     +    ++  LSGG+K
Sbjct: 1058 RGTANLIIHRRSDDSLASMDINTDSQNISELVYTGVSISVSFNSKRDEQLHVEQLSGGQK 1117

Query: 1309 TLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMF 1368
            T+ ++A++ A+    P P Y+ DEIDAALD +  + VA+ IK  + NAQFI  + R +M 
Sbjct: 1118 TVCAIAMILAIQMVDPAPFYLFDEIDAALDKQYRTAVADVIKSLSSNAQFICTTFRTDML 1177

Query: 1369 ELTKQLVGIYKHENMTKSAALVNED 1393
            ++  +   + K+EN   +   +N D
Sbjct: 1178 QVADKFFRV-KYENKISTVVEINRD 1201

>TBLA0D04610 Chr4 complement(1139885..1143409) [3525 bp, 1174 aa]
           {ON} Anc_7.186 YFR031C
          Length = 1174

 Score = 95.1 bits (235), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 59/188 (31%), Positives = 98/188 (52%), Gaps = 11/188 (5%)

Query: 130 IHQLVLNDFKSYAGRQVIGPFHTSFSAIVGPNGSGKSNVIDSMLFVFGFRA-NKMRQDRL 188
           + +L+++ FKSYA R VI  +   F+AI G NGSGKSN++D++ FV G  +   +R   L
Sbjct: 3   VEELIIDGFKSYATRTVISDWDPQFNAITGLNGSGKSNILDAICFVLGISSMTTVRASNL 62

Query: 189 SDLIHKSETFPDLKSCSVEVHFKYVIDKDDGSTTIDETKGNLVVTRKAFKNNASKYFVNG 248
            DLI+K      +   SV + F    DK +     + T   + VTR+      SKY +NG
Sbjct: 63  QDLIYKRGQ-AGVTKASVTIVFDNT-DKSNSPIGFN-TSPRISVTRQIVIGGTSKYLING 119

Query: 249 KESNYTEVTTLLKKEGIDLDHKRFLILQGEVENIAQMKAKAEKENDDGLLEYLEDIIGTS 308
             +    V  L +   +++++  FLI+QG++  +  MK+         +L  +E+  GT 
Sbjct: 120 HRAPQQSVLQLFQSVQLNINNPNFLIMQGKITKVLNMKSTE-------ILSLIEEAAGTK 172

Query: 309 KYKESIEK 316
            +++  EK
Sbjct: 173 MFEDRKEK 180

 Score = 82.0 bits (201), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 33/73 (45%), Positives = 54/73 (73%), Gaps = 1/73 (1%)

Query: 1297 WR-NISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN 1355
            W+ ++  LSGG+++L +L+L+ AL +++P P+Y++DE+DAALD  +   + + IK R K 
Sbjct: 1081 WKESLVELSGGQRSLVALSLILALLQFRPAPMYILDEVDAALDLSHTQNIGHLIKTRFKG 1140

Query: 1356 AQFIVISLRNNMF 1368
            AQFIV+SL+  MF
Sbjct: 1141 AQFIVVSLKEGMF 1153

>KLTH0E04774g Chr5 (426535..430047) [3513 bp, 1170 aa] {ON} similar
           to uniprot|P38989 Saccharomyces cerevisiae YFR031C SMC2
           Component of the condensin complex essential SMC
           chromosomal ATPase family member that forms a complex
           with Smc4p to form the active ATPase Smc2p/Smc4p complex
           binds DNA possibly in the cleft formed by the
           coiled-coil of the folded dimer
          Length = 1170

 Score = 94.7 bits (234), Expect = 9e-19,   Method: Compositional matrix adjust.
 Identities = 59/189 (31%), Positives = 99/189 (52%), Gaps = 13/189 (6%)

Query: 130 IHQLVLNDFKSYAGRQVIGPFHTSFSAIVGPNGSGKSNVIDSMLFVFGFRA-NKMRQDRL 188
           + +L+++ FKSYA R VI  +   F+AI G NGSGKSN++D++ FV G  +   +R   L
Sbjct: 3   VEELIIDGFKSYATRTVISDWDPQFNAITGLNGSGKSNILDAICFVLGISSMATVRASNL 62

Query: 189 SDLIHKSETFPDLKSCSVEVHFKYVIDKDDGSTTID-ETKGNLVVTRKAFKNNASKYFVN 247
            DLI+K      +   SV + F    + D  ++ I  E+   + VTR+      SKY +N
Sbjct: 63  QDLIYKRGQ-AGVTKASVTIVF---TNDDKANSPIGFESYPKISVTRQIVLGGTSKYLIN 118

Query: 248 GKESNYTEVTTLLKKEGIDLDHKRFLILQGEVENIAQMKAKAEKENDDGLLEYLEDIIGT 307
           G  +    V  L +   +++++  FLI+QG++  +  MK          +L  +E+  GT
Sbjct: 119 GHRAQQQTVLHLFQSVQLNINNPNFLIMQGKITKVLNMKPSE-------ILSLIEEAAGT 171

Query: 308 SKYKESIEK 316
             +++  EK
Sbjct: 172 KMFEDRREK 180

 Score = 68.2 bits (165), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 33/73 (45%), Positives = 54/73 (73%), Gaps = 1/73 (1%)

Query: 1297 WR-NISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN 1355
            W+ ++  LSGG+++L +L+L+ AL ++KP P+Y++DE+DAALD  +   + + IK R K 
Sbjct: 1077 WKESLVELSGGQRSLIALSLILALLQFKPAPMYILDEVDAALDLSHTQNIGHLIKTRFKG 1136

Query: 1356 AQFIVISLRNNMF 1368
            +QFIV+SL+  MF
Sbjct: 1137 SQFIVVSLKEGMF 1149

>Ecym_4390 Chr4 (816076..819588) [3513 bp, 1170 aa] {ON} similar to
           Ashbya gossypii AGR236W
          Length = 1170

 Score = 94.7 bits (234), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 62/189 (32%), Positives = 100/189 (52%), Gaps = 13/189 (6%)

Query: 130 IHQLVLNDFKSYAGRQVIGPFHTSFSAIVGPNGSGKSNVIDSMLFVFGFRA-NKMRQDRL 188
           + +L+++ FKSYA R VI  +   F+AI G NGSGKSN++DS+ FV G  +   +R   L
Sbjct: 3   VEELIIDGFKSYATRTVISDWDPQFNAITGLNGSGKSNILDSICFVLGISSMATVRAQNL 62

Query: 189 SDLIHKSETFPDLKSCSVEVHFKYVIDKDDGSTTID-ETKGNLVVTRKAFKNNASKYFVN 247
            DLI+K      +K+ SV + F    + D  S+ I  E    + VTR+      SKY +N
Sbjct: 63  QDLIYKRGQAGVIKA-SVTIVFD---NSDIKSSPIGFERYPKISVTRQIALGGTSKYLIN 118

Query: 248 GKESNYTEVTTLLKKEGIDLDHKRFLILQGEVENIAQMKAKAEKENDDGLLEYLEDIIGT 307
           G  +    V  L +   +++++  FLI+QG++  +  MK          +L  +E+  GT
Sbjct: 119 GHRAQQQTVLHLFQSVQLNINNPNFLIMQGQITKVLNMKPTE-------ILSLIEEAAGT 171

Query: 308 SKYKESIEK 316
             +++  EK
Sbjct: 172 RMFEDRREK 180

 Score = 67.8 bits (164), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 33/73 (45%), Positives = 54/73 (73%), Gaps = 1/73 (1%)

Query: 1297 WR-NISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN 1355
            W+ ++  LSGG+++L +L+L+ AL ++KP P+Y++DE+DAALD  +   + + IK R K 
Sbjct: 1077 WKESLVELSGGQRSLIALSLILALLQFKPAPMYILDEVDAALDLNHTQNIGHLIKTRFKG 1136

Query: 1356 AQFIVISLRNNMF 1368
            +QFIV+SL+  MF
Sbjct: 1137 SQFIVVSLKEGMF 1149

 Score = 46.6 bits (109), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 35/130 (26%), Positives = 63/130 (48%), Gaps = 15/130 (11%)

Query: 682 TACPRLNDLVVDTVESGQQCIE--YLRKNKLGYARFILLDKLNT-------FNTNRIDTP 732
            A  RL +++VD  ++  Q +E   LRK        I L+K++T           +   P
Sbjct: 547 CAGGRLFNIIVDNEKTASQLLEKGMLRKR----VTIIPLNKISTRVLSDESLALAKKIAP 602

Query: 733 DQSQRLFDLITVKEKRFNNAFYSVLRDTLVCQNMEQANRVAYGKK-RYRVVTLDGNLIDL 791
            + +   +LI  +E   + A   +   +L+C + E A ++ +  + R R +TLDG++ D 
Sbjct: 603 GKVELALNLIGYEED-VSKAMQYIFGGSLICADAETAKKITFHPQIRARSITLDGDIYDP 661

Query: 792 SGTMTGGGRN 801
            GT++GG  N
Sbjct: 662 EGTLSGGSSN 671

>KLTH0H09966g Chr8 complement(859362..863036) [3675 bp, 1224 aa]
           {ON} similar to uniprot|P47037 Saccharomyces cerevisiae
           YJL074C SMC3 Subunit of the multiprotein cohesin complex
           required for sister chromatid cohesion in mitotic cells
           also required with Rec8p for cohesion and recombination
           during meiosis phylogenetically conserved SMC
           chromosomal ATPase family member
          Length = 1224

 Score = 94.7 bits (234), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 163/703 (23%), Positives = 298/703 (42%), Gaps = 63/703 (8%)

Query: 128 LFIHQLVLNDFKSYAGRQVIGPFHTSFSAIVGPNGSGKSNVIDSMLFVFGFRANKMRQDR 187
           ++I  +V+  FK+Y     +      F+ I+G NGSGKSN   ++ FV     + ++++ 
Sbjct: 1   MYIKSVVIQGFKTYKNTTSVEGLSPRFNVIIGGNGSGKSNFFAAVRFVLSDDYSNLKREE 60

Query: 188 LSDLIHKSETFPDLKSCSVEVHFKYVIDKDDGSTTIDETKGNLVVTRKAFKNNASKYFVN 247
              LIH+      + S  VE+ F     +   ++ I  T+ ++V  R+       +Y VN
Sbjct: 61  RQGLIHQGT--GSVMSAYVEIIFHDPSGQMMITSGIPMTEEHIVRVRRTIGLKKDEYSVN 118

Query: 248 GKESNYTEVTTLLKKEGIDLDHKRFLILQGEVENIAQMKAKAEKENDDGLLEYLEDIIGT 307
           GK  + ++++ + +  G    +   ++ QG +  +A   AK     D   L  LE+++G 
Sbjct: 119 GKTCHKSDISRMFESVGFSAVNPYNIVPQGRI--VAVTNAK-----DRERLALLEEVVGA 171

Query: 308 SKYKESIEKLSMEIESLNEICVEKENRFSIVEREKNSLESGKEEALQFXXXXXXXXXXXX 367
             ++  + + + ++E+ N      ++  + +    + L   ++E  ++            
Sbjct: 172 KSFEIKLRESAKKMEATNRDRTRIDSELAELRTRLDELNEERQELEKYQKLERDRRIFQF 231

Query: 368 XXYQYNLMQXXXXXXXXXXXXTNV-------QQEQTKQEDEFRKANSHISDITASLNVLK 420
             Y   L +             +V        QE  K+E+       +IS+I   L V +
Sbjct: 232 VLYDRELNEVTSQIESLEDEYNHVLQSSEEFLQELYKREELIENVTKNISNIETELRVKE 291

Query: 421 A-DLEKVHTE-----------EVNLSKTKRTLENKKVENEQIVNNLDSKRKEFEEQSKIL 468
           + DL++  +            EV+L + KR  E  K +     NNL +  +E E++S  L
Sbjct: 292 SMDLQQEKSRLQEISKRKADLEVHLEEAKRQAEAHKKQTSVDQNNLKTVEEEIEKKSLQL 351

Query: 469 QDKINSTDQEIQTIIEEQSSLAEGTTVLSTNXXXXXXXXXXXXXXXXXXTEHLTIQIAEY 528
           +  I   +Q      E +S L+      S                     E L  +IA  
Sbjct: 352 ERLIPRFEQLKSESQEFESQLSNYQR--SQREIVSKRGIYAQFKSKVERDEWLKNEIASL 409

Query: 529 EKELSPWNEQSQQLKKEIKITESELSIIEENRKGLENDIAGLENAILSQKRDLEVQEQEI 588
           + +     EQ   L +E + T SE+ +  E    L + + G    I ++ +DL   +  +
Sbjct: 410 KAQHQDLAEQLAALTREKEQTGSEVEVFNEEITELNDSVRG--PGIQAELQDL---QSHL 464

Query: 589 KSLLEQKTKVIQERELGERECKNAQATLANVREKV-EALRQKAIEIRSTYSATENNNKVL 647
            SL +     I ER    +E   A+     V + + + ++      RS  + +E  ++ L
Sbjct: 465 DSLKQSYLGKIDER----KELWRAEQKFLTVSDALNDGVK------RSERNLSETMDRGL 514

Query: 648 SALLRLQK--SGRL----NGFHGRLGDLAVIDPKYD-VAISTACPRLNDLVVDTVESGQQ 700
           ++ LR  +  S RL    +  HG LG+L  ++ KY   A +     L  +VVDT E+   
Sbjct: 515 ASGLRAVREISERLKLPADSVHGPLGELIKVNEKYKACAEAVGGNALLHVVVDTDETASI 574

Query: 701 CIEYLRKNKLGYARFILLDKLNTFNTNRIDTPDQSQRLFDLITVK---EKRFNNAFYSVL 757
            +E L   K G   FI L+++   ++N +  PD SQ     +  K   EKRF  A   V 
Sbjct: 575 LMEELYNTKAGRVTFIPLNRIA--DSNPVTFPDNSQAECTPLIWKMKYEKRFEKAVRHVF 632

Query: 758 RDTLVCQNMEQANRVAYGKKRYRV--VTLDGNLIDLSGTMTGG 798
             T+V +++   +++A   K + +  VTLDG+  D  G +TGG
Sbjct: 633 GRTIVVRDIGTGSKLA---KSFNLDAVTLDGDRTDKRGLITGG 672

 Score = 80.5 bits (197), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 61/249 (24%), Positives = 124/249 (49%), Gaps = 36/249 (14%)

Query: 1179 VDPQEVELLITSLDDFIT-SSEANVDVLEEYALRFVEFNKRKNDL-NSA---VQSRDSVK 1233
            +D +EV   +  ++D I+ +S  N   +E     F +FN+++ +L N A    +S++S++
Sbjct: 968  LDSEEVLRRLNEVNDKISKTSNVNRRAIEN----FRKFNEKREELENRAEELARSKESIE 1023

Query: 1234 DRLEGIKRKRYDEFMEGFKIISMTLKEMYQMITLGGNAELELV----------------- 1276
            + ++ +K+++ +     F  ++     +++ +   G  +L +                  
Sbjct: 1024 ELVDSLKKQKIEAVEATFSKVANNFTHIFEKLVPAGVGKLVIHRNESTRNASGGRGPQQG 1083

Query: 1277 --------DSLDPFSEGVTFSVMPPKKSWRN--ISNLSGGEKTLSSLALVFALHKYKPTP 1326
                    DS++    GV+ SV    K+     +  LSGG+KT+ ++AL+ A+    P P
Sbjct: 1084 SGASGNEDDSIETMYSGVSISVSFNSKNNEQLYVEQLSGGQKTVCAIALILAIQMVDPAP 1143

Query: 1327 LYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELTKQLVGIYKHENMTKS 1386
             Y+ DEIDAALD +  + VAN IKE + +AQFI  + R++M ++      +     +++ 
Sbjct: 1144 FYLFDEIDAALDKQYRTSVANVIKELSVHAQFICTTFRSDMLQVADSFYRVRFDNKISEI 1203

Query: 1387 AALVNEDLV 1395
            +A+  +D +
Sbjct: 1204 SAVSQQDAI 1212

>Kwal_14.2435 s14 complement(756213..759956) [3744 bp, 1247 aa] {ON}
           YJL074C (SMC3) - SMC chromosomal ATPase family member
           [contig 224] FULL
          Length = 1247

 Score = 94.7 bits (234), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 153/700 (21%), Positives = 300/700 (42%), Gaps = 57/700 (8%)

Query: 128 LFIHQLVLNDFKSYAGRQVIGPFHTSFSAIVGPNGSGKSNVIDSMLFVFGFRANKMRQDR 187
           ++I  +++  FK+Y     +  F   F+ ++G NGSGKSN   ++ FV     + ++++ 
Sbjct: 25  MYIQSVLIQGFKTYRNITAVEDFSPHFNVVIGGNGSGKSNFFAAVRFVLSDDYSSLKREE 84

Query: 188 LSDLIHKSETFPDLKSCSVEVHFKYVIDKDDGSTTIDETKGNLVVTRKAFKNNASKYFVN 247
              LIH+      + S  VE+ F    D+   ++ I  T+ ++V  R+       +Y VN
Sbjct: 85  RQGLIHQGT--GSIMSAYVEIVFHDPSDQMMMTSGIPVTEEHIVRVRRTIGLKKDEYSVN 142

Query: 248 GKESNYTEVTTLLKKEGIDLDHKRFLILQGEVENIAQMKAKAEKENDDGLLEYLEDIIGT 307
           GK  + ++++ + +  G    +   ++ QG +  +A   AK     D   L  LED++G 
Sbjct: 143 GKTCHKSDISRMFESVGFSASNPYNIVPQGRI--VAVTNAK-----DKERLLLLEDVVGA 195

Query: 308 SKYKESIEKLSMEIESLNEICVEKENRFSIVEREKNSLESGKEEALQFXXXXXXXXXXXX 367
             ++  + + S ++E+ N    +  +  S ++     L+  ++E  ++            
Sbjct: 196 RSFEIKLRESSKKMEATNRDRAKITSELSELKARLEELDEERQELEKYQELERDRRIFQF 255

Query: 368 XXYQYNLMQXXXXXXXXXXXXTNVQQEQTKQEDEFRKANSHISDITASLNVLKADLEKVH 427
             Y   L +             NV Q   +   E  K  + I+++T +++ ++A+L+   
Sbjct: 256 VLYDRELNEVTSQIESLEDEYNNVLQSSEEYIQELYKRETLIANLTKNISNVEAELKLKE 315

Query: 428 TEEVNLSKTK-RTLENKKVENEQIVNNLDSKRKEFEEQSKILQDKINSTDQEIQTIIEEQ 486
           + +    K++ + +  +K + E        +R +   Q  + +  + + ++EIQ    + 
Sbjct: 316 STDFQQDKSRLQEIVKRKADLEIRYEETKRQRDQVHGQCAVYRKNLATVEEEIQNTSTQL 375

Query: 487 SSLAEGTTVLSTNXXXXXXXXXXXXXXXXXXTEHLTIQIAEYE----------KELSPWN 536
           + L+     L                          I  A++E          KELS   
Sbjct: 376 NRLSPRYEQLKLEAEAFEAQLSQYQRKQREIISKRGI-YAQFENQSERDAWIAKELSSLK 434

Query: 537 EQSQQLKKEIKITESE----LSIIEENRKG---LENDIAGLENAILSQKRDLEVQEQEIK 589
            Q+  LKK ++I E+E     + I+++++    L + + G    I S+ +D++    ++K
Sbjct: 435 AQTDDLKKNVEIMEAEKEQVAAEIQQDKEAITELNDSVRG--PGISSELQDIQTHLNDLK 492

Query: 590 -SLLEQKTKVIQERELGERECKNAQATLANVREKVEALRQKAIEIRSTYSATENNNKV-- 646
            S LE+    I ER    +E   ++  L  V    EAL           S T + N    
Sbjct: 493 RSYLEK----IDER----KELWRSEQRLQTVS---EALLDGVKRSERNLSETMDRNLANG 541

Query: 647 LSALLRLQKSGRL--NGFHGRLGDLAVIDPKYD-VAISTACPRLNDLVVDTVESGQQCIE 703
           L A+  + +  +L     HG LG+L  ++ KY   A +     L  +VVDT E+    + 
Sbjct: 542 LKAVREITQRLKLPPGAVHGPLGELIKVNEKYKTCAEAVGGNSLLHVVVDTEETASILMS 601

Query: 704 YLRKNKLGYARFILLDKLNTFNTNRIDTPDQSQRLFDLITVK---EKRFNNAFYSVLRDT 760
            L   K G   FI L++++  + N +  P+ +Q     +  K   +K F  A   V   T
Sbjct: 602 ELYNTKAGRVTFIPLNRIS--DRNAVTFPENAQAECTPLLWKIKYDKVFEKAVRHVFGRT 659

Query: 761 LVCQNMEQANRVAYGKKRYRV--VTLDGNLIDLSGTMTGG 798
           +V +++   +++A   + Y +  VTLDG+  D  G +TGG
Sbjct: 660 IVVRDLGNGSKLA---RSYNLDAVTLDGDRADNRGVITGG 696

 Score = 88.2 bits (217), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 59/210 (28%), Positives = 100/210 (47%), Gaps = 31/210 (14%)

Query: 1212 FVEFNKRKNDLNSAV----QSRDSVKDRLEGIKRKRYDEFMEGFKIISMTLKEMYQMITL 1267
            F +FN ++ DL S      QS++S++  +E +K+++ +     F  ++     +++ +  
Sbjct: 1022 FKKFNDKREDLESRAEELEQSKESIEKLVESLKKQKVEAVEATFSKVATNFTTIFEKLVP 1081

Query: 1268 GGNAELEL------------------------VDSLDPFSEGVTFSVMPPKKSWRN--IS 1301
             G   L +                         D+LD    GV+ SV    K+     + 
Sbjct: 1082 AGIGRLIIHRTTEKSNRGTGQRSPEYSPLNSNADTLDSMYSGVSISVSFNSKNNEQLYVE 1141

Query: 1302 NLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVI 1361
             LSGG+KT+ ++AL+ A+    P P Y+ DEIDAALD +  + VAN IKE + +AQFI  
Sbjct: 1142 QLSGGQKTVCAIALILAIQMVDPAPFYLFDEIDAALDKQYRTSVANTIKELSAHAQFICT 1201

Query: 1362 SLRNNMFELTKQLVGIYKHENMTKSAALVN 1391
            + R +M ++      + K EN     A V+
Sbjct: 1202 TFRTDMLQVADSFYRV-KFENKISEIATVS 1230

>TPHA0C04440 Chr3 complement(958279..961791) [3513 bp, 1170 aa] {ON}
           Anc_7.186 YFR031C
          Length = 1170

 Score = 94.4 bits (233), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 60/189 (31%), Positives = 98/189 (51%), Gaps = 13/189 (6%)

Query: 130 IHQLVLNDFKSYAGRQVIGPFHTSFSAIVGPNGSGKSNVIDSMLFVFGFRA-NKMRQDRL 188
           + +L+++ FKSYA R VI  +   F+AI G NGSGKSN++D++ FV G  + + +R   L
Sbjct: 3   VAELIIDGFKSYATRTVISEWDPQFNAITGLNGSGKSNILDAICFVLGISSMSTVRASNL 62

Query: 189 SDLIHKSETFPDLKSCSVEVHFKYVIDKDDGSTTID-ETKGNLVVTRKAFKNNASKYFVN 247
            DLI+K      +   SV + F    + D     I  ET   + VTR+      SKY +N
Sbjct: 63  QDLIYKRGQ-AGVTKASVTIVFD---NSDKSKAPIGFETSLTISVTRQIVLGGTSKYLIN 118

Query: 248 GKESNYTEVTTLLKKEGIDLDHKRFLILQGEVENIAQMKAKAEKENDDGLLEYLEDIIGT 307
           G  +    V  L +   +++++  FLI+QG++  +  MK          +L  +E+  GT
Sbjct: 119 GHRAPQQSVLHLFQSVQLNINNPNFLIMQGKITKVLNMKPTE-------ILALIEEAAGT 171

Query: 308 SKYKESIEK 316
             +++  EK
Sbjct: 172 KMFEDRREK 180

 Score = 82.0 bits (201), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 40/137 (29%), Positives = 80/137 (58%), Gaps = 1/137 (0%)

Query: 1232 VKDRLEGIKRKRYDEFMEGFKIISMTLKEMYQMITLGGNAELELVDSLDPFSEGVTFSVM 1291
            ++D +  +   + D  ++ +K +++    ++  +     A+L   +  D  +EG+   + 
Sbjct: 1014 IQDTITKLNEYKRDTLIKTWKKVTVDFGNIFADLLPNSFAKLVPSEGKD-ITEGLEVKIK 1072

Query: 1292 PPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKE 1351
              K    ++  LSGG+++L +L+L+ AL +++P P+Y++DE+DAALD  +   + + IK 
Sbjct: 1073 LGKLWKESLVELSGGQRSLIALSLIMALLQFRPAPMYILDEVDAALDLSHTQNIGHLIKT 1132

Query: 1352 RTKNAQFIVISLRNNMF 1368
            R K +QFIV+SL+  MF
Sbjct: 1133 RFKGSQFIVVSLKEGMF 1149

 Score = 52.8 bits (125), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 54/199 (27%), Positives = 85/199 (42%), Gaps = 26/199 (13%)

Query: 613 QATLANVREKVEALRQKAIEIRSTYSATENNNKVLSALLRLQKSGRLNGFHGRLGDLAVI 672
           Q  L  +  + E LR+K   +  +YS  E N    S          + G   RL    + 
Sbjct: 487 QQILYKLNNENEYLRRKVSNVDFSYSNPEPNFDPKS----------VKGVAARL--FTID 534

Query: 673 DPKYDVAIS---TACPRLNDLVVDTVESGQQCIEYLRKNKLGYARFILLDKL-------N 722
              YD A +    A  RL ++VVD   +  + +E  R  K      I L+K+       N
Sbjct: 535 KQNYDSATALQVCAGGRLYNVVVDNETTASKLLEKGRLRK--RVTIIPLNKISARTIDNN 592

Query: 723 TFNTNRIDTPDQSQRLFDLITVKEKRFNNAFYSVLRDTLVCQNMEQANRVAYGKK-RYRV 781
           T N  +   P + +   +LI   E     A   +   +L+C + E A ++ +  K R R 
Sbjct: 593 TLNYAKQLAPGKVELALNLIGY-EDEVAKALQFIFGSSLICNDAETAKKITFNPKIRTRS 651

Query: 782 VTLDGNLIDLSGTMTGGGR 800
           +TLDG++ D  GT++GG R
Sbjct: 652 ITLDGDVYDPEGTLSGGSR 670

>Kpol_1063.20 s1063 (46233..49748) [3516 bp, 1171 aa] {ON}
           (46233..49748) [3516 nt, 1172 aa]
          Length = 1171

 Score = 94.0 bits (232), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 59/189 (31%), Positives = 98/189 (51%), Gaps = 13/189 (6%)

Query: 130 IHQLVLNDFKSYAGRQVIGPFHTSFSAIVGPNGSGKSNVIDSMLFVFGFRA-NKMRQDRL 188
           + +L+++ FKSYA R VI  +   F+AI G NGSGKSN++D++ FV G  +   +R   L
Sbjct: 3   VEELIIDGFKSYATRTVISDWDPQFNAITGLNGSGKSNILDAICFVLGISSMATVRASNL 62

Query: 189 SDLIHKSETFPDLKSCSVEVHFKYVIDKDDGSTTID-ETKGNLVVTRKAFKNNASKYFVN 247
            DLI+K      +   SV + F    + D  +  I  E+   + VTR+      SKY +N
Sbjct: 63  QDLIYKRGQ-AGVTKASVTIVFD---NSDKSNAPIGFESSPTISVTRQVALGGTSKYLIN 118

Query: 248 GKESNYTEVTTLLKKEGIDLDHKRFLILQGEVENIAQMKAKAEKENDDGLLEYLEDIIGT 307
           G  +    V  L +   +++++  FLI+QG++  +  MK          +L  +E+  GT
Sbjct: 119 GHRAPQQSVLHLFQSVQLNINNPNFLIMQGKITKVLNMKPTE-------ILSLIEEAAGT 171

Query: 308 SKYKESIEK 316
             +++  EK
Sbjct: 172 KMFEDRREK 180

 Score = 81.6 bits (200), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 32/73 (43%), Positives = 54/73 (73%), Gaps = 1/73 (1%)

Query: 1297 WR-NISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN 1355
            W+ ++  LSGG+++L +L+L+ AL +++P P+Y++DE+DAALD  +   + + IK R K 
Sbjct: 1077 WKESLVELSGGQRSLIALSLIMALLQFRPAPMYILDEVDAALDLSHTQNIGHLIKTRFKG 1136

Query: 1356 AQFIVISLRNNMF 1368
            +QFIV+SL+  MF
Sbjct: 1137 SQFIVVSLKEGMF 1149

>ZYRO0D15642g Chr4 complement(1307703..1311215) [3513 bp, 1170 aa]
           {ON} similar to uniprot|P38989 Saccharomyces cerevisiae
           YFR031C SMC2 Component of the condensin complex
           essential SMC chromosomal ATPase family member that
           forms a complex with Smc4p to form the active ATPase
           Smc2p/Smc4p complex binds DNA possibly in the cleft
           formed by the coiled-coil of the folded dimer
          Length = 1170

 Score = 94.0 bits (232), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 60/185 (32%), Positives = 96/185 (51%), Gaps = 13/185 (7%)

Query: 130 IHQLVLNDFKSYAGRQVIGPFHTSFSAIVGPNGSGKSNVIDSMLFVFGFRA-NKMRQDRL 188
           I +L+++ FKSYA R VI  +   F+AI G NGSGKSNV+D++ FV G  + + +R   L
Sbjct: 3   IEELIIDGFKSYATRTVISDWDPQFNAITGLNGSGKSNVLDAICFVLGIASMSTVRASSL 62

Query: 189 SDLIHKSETFPDLKSCSVEVHFKYVIDKDDGSTTID-ETKGNLVVTRKAFKNNASKYFVN 247
            DLI+K      +   SV + F  +   D   + I  E    L VTR+      SKY +N
Sbjct: 63  QDLIYKRGQ-AGVTKASVTIVFSNL---DPKCSPIGFENSPKLSVTRQIILGGTSKYLIN 118

Query: 248 GKESNYTEVTTLLKKEGIDLDHKRFLILQGEVENIAQMKAKAEKENDDGLLEYLEDIIGT 307
           G  +    V  L +   +++++  FLI+QG++  +  MK          +L  +E+  GT
Sbjct: 119 GHRAPQQSVLQLFQSVQLNINNPNFLIMQGKITKVLNMKPSE-------ILSLIEEAAGT 171

Query: 308 SKYKE 312
             +++
Sbjct: 172 KMFED 176

 Score = 81.3 bits (199), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 32/73 (43%), Positives = 54/73 (73%), Gaps = 1/73 (1%)

Query: 1297 WR-NISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN 1355
            W+ ++  LSGG+++L +L+L+ AL +++P P+Y++DE+DAALD  +   + + IK R K 
Sbjct: 1077 WKESLVELSGGQRSLIALSLIMALLQFRPAPMYILDEVDAALDLSHTQNIGHLIKTRFKG 1136

Query: 1356 AQFIVISLRNNMF 1368
            +QFIV+SL+  MF
Sbjct: 1137 SQFIVVSLKEGMF 1149

 Score = 48.1 bits (113), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 40/139 (28%), Positives = 69/139 (49%), Gaps = 18/139 (12%)

Query: 676 YDVAIS---TACPRLNDLVVDTVESGQQCIEY--LRKNKLGYARFILLDKLNT--FNTNR 728
           YD A++    A  RL +++VD   +  Q +E   LRK        I L+K+ T   N+  
Sbjct: 538 YDSALALQVCAGGRLFNVIVDDQNTASQLLERGKLRKR----VTIIPLNKIATRVINSES 593

Query: 729 ID-----TPDQSQRLFDLITVKEKRFNNAFYSVLRDTLVCQNMEQANRVAYGKK-RYRVV 782
           +       P + Q   +L+  +E+  + A   +  ++LVC + E A R+ +  + R R +
Sbjct: 594 LKLAKQLAPGKVQLALNLVGYEEE-VSKAMEYIFGNSLVCNDAETAKRLTFHPQIRTRSI 652

Query: 783 TLDGNLIDLSGTMTGGGRN 801
           T  G++ D  GT++GG RN
Sbjct: 653 TQQGDVYDPEGTLSGGSRN 671

>Suva_6.104 Chr6 complement(183396..186908) [3513 bp, 1170 aa] {ON}
           YFR031C (REAL)
          Length = 1170

 Score = 93.6 bits (231), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 59/189 (31%), Positives = 98/189 (51%), Gaps = 13/189 (6%)

Query: 130 IHQLVLNDFKSYAGRQVIGPFHTSFSAIVGPNGSGKSNVIDSMLFVFGFRA-NKMRQDRL 188
           + +L+++ FKSYA R VI  +   F+AI G NGSGKSN++D++ FV G  +   +R   L
Sbjct: 3   VEELIIDGFKSYATRTVITDWDPQFNAITGLNGSGKSNILDAICFVLGIASMTTVRASSL 62

Query: 189 SDLIHKSETFPDLKSCSVEVHFKYVIDKDDGSTTIDETKG-NLVVTRKAFKNNASKYFVN 247
            DLI+K      +   SV + F    + D  ++ I  T    + VTR+      SKY +N
Sbjct: 63  QDLIYKRGQ-AGVTKASVTIVFD---NTDKSNSPIGFTNSPQISVTRQVVLGGTSKYLIN 118

Query: 248 GKESNYTEVTTLLKKEGIDLDHKRFLILQGEVENIAQMKAKAEKENDDGLLEYLEDIIGT 307
           G  +    V  L +   +++++  FLI+QG++  +  MK          +L  +E+  GT
Sbjct: 119 GHRAPQQSVLQLFQSVQLNINNPNFLIMQGKITKVLNMKPTE-------ILSLIEEAAGT 171

Query: 308 SKYKESIEK 316
             +++  EK
Sbjct: 172 KMFEDRREK 180

 Score = 82.8 bits (203), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 33/73 (45%), Positives = 54/73 (73%), Gaps = 1/73 (1%)

Query: 1297 WRN-ISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN 1355
            W++ +  LSGG+++L +LAL+ AL +++P P+Y++DE+DAALD  +   + + IK R K 
Sbjct: 1077 WKDSLIELSGGQRSLIALALIMALLQFRPAPMYILDEVDAALDLSHTQNIGHLIKTRFKG 1136

Query: 1356 AQFIVISLRNNMF 1368
            +QFIV+SL+  MF
Sbjct: 1137 SQFIVVSLKEGMF 1149

 Score = 56.6 bits (135), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 57/217 (26%), Positives = 100/217 (46%), Gaps = 26/217 (11%)

Query: 609 CKNAQATLANV---REKVEALRQKAIEIRSTYSATENNNKVLS---ALLRLQKSG----- 657
           C   QA L        +++ L+QK  E++S Y    N+++ L    A L    +      
Sbjct: 459 CNKLQAQLTEYGFDPSRIKDLKQKENELKSQYYQISNDSEYLKRRVANLEFNYTTPYPDF 518

Query: 658 RLNGFHGRLGDLAVIDP---KYDVAIST-ACPRLNDLVVDTVESGQQCIEYLRKNKLGYA 713
           + N  +G +G L  +D    +Y  A+ T A  RL ++VV   ++  Q +E  R  K    
Sbjct: 519 KANLVYGVVGQLFELDDDKIRYSTALQTCAGGRLFNVVVQDSQTATQLLERGRLRK--RV 576

Query: 714 RFILLDKLNT-------FNTNRIDTPDQSQRLFDLITVKEKRFNNAFYSVLRDTLVCQNM 766
             I L+K++T           +   P + +   +LI   +K    A   +  ++L+C++ 
Sbjct: 577 TIIPLNKISTRPISPQVLELAKKIAPGKVELAINLIKF-DKSVTKAMEFIFGNSLICEDP 635

Query: 767 EQANRVAYGKK-RYRVVTLDGNLIDLSGTMTGGGRNV 802
           E A ++ +  K R R +TL G++ D  GT++GG RN 
Sbjct: 636 ETAKKITFHPKIRARSITLQGDVYDPEGTLSGGSRNT 672

>CAGL0D05258g Chr4 (500858..504370) [3513 bp, 1170 aa] {ON} similar
           to uniprot|P38989 Saccharomyces cerevisiae YFR031c SMC2
           chromosome segregation protein
          Length = 1170

 Score = 93.6 bits (231), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 60/189 (31%), Positives = 99/189 (52%), Gaps = 13/189 (6%)

Query: 130 IHQLVLNDFKSYAGRQVIGPFHTSFSAIVGPNGSGKSNVIDSMLFVFGFRA-NKMRQDRL 188
           + +L+++ FKSYA R VI  +   F+AI G NGSGKSN++D++ FV G  +   +R   L
Sbjct: 3   VEELIIDGFKSYATRTVISDWDPQFNAITGLNGSGKSNILDAICFVLGISSMATVRASNL 62

Query: 189 SDLIHKSETFPDLKSCSVEVHFKYVIDKDDGSTTIDETK-GNLVVTRKAFKNNASKYFVN 247
            DLI+K      +   SV + F    + D  +T I  ++   + VTR+      SKY +N
Sbjct: 63  QDLIYKRGQ-AGVTKASVTIVFD---NTDKSNTPIGFSEYPKISVTRQIVLGGTSKYLIN 118

Query: 248 GKESNYTEVTTLLKKEGIDLDHKRFLILQGEVENIAQMKAKAEKENDDGLLEYLEDIIGT 307
           G  +    V  L +   +++++  FLI+QG++  I  MK          +L  +E+  GT
Sbjct: 119 GHRAPQQSVLQLFQSVQLNINNPNFLIMQGKITKILNMKPSE-------ILSLIEEAAGT 171

Query: 308 SKYKESIEK 316
             +++  EK
Sbjct: 172 KMFEDRKEK 180

 Score = 81.6 bits (200), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 32/73 (43%), Positives = 54/73 (73%), Gaps = 1/73 (1%)

Query: 1297 WR-NISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN 1355
            W+ ++  LSGG+++L +L+L+ AL +++P P+Y++DE+DAALD  +   + + IK R K 
Sbjct: 1077 WKESLVELSGGQRSLIALSLIMALLQFRPAPMYILDEVDAALDLSHTQNIGHLIKTRFKG 1136

Query: 1356 AQFIVISLRNNMF 1368
            +QFIV+SL+  MF
Sbjct: 1137 SQFIVVSLKEGMF 1149

>Skud_6.119 Chr6 complement(211918..215430) [3513 bp, 1170 aa] {ON}
           YFR031C (REAL)
          Length = 1170

 Score = 92.4 bits (228), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 59/189 (31%), Positives = 99/189 (52%), Gaps = 13/189 (6%)

Query: 130 IHQLVLNDFKSYAGRQVIGPFHTSFSAIVGPNGSGKSNVIDSMLFVFGFRA-NKMRQDRL 188
           + +L+++ FKSYA R VI  +   F+AI G NGSGKSN++D++ FV G  + + +R   L
Sbjct: 3   VEELIIDGFKSYATRTVITDWDPQFNAITGLNGSGKSNILDAICFVLGIASMSTVRASSL 62

Query: 189 SDLIHKSETFPDLKSCSVEVHFKYVIDKDDGSTTIDETKG-NLVVTRKAFKNNASKYFVN 247
            DLI+K      +   SV + F    + D  ++ I  T    + VTR+      SKY +N
Sbjct: 63  QDLIYKRGQ-AGVTKASVTIVFN---NTDKLNSPIGFTNSPQISVTRQVVLGGTSKYLIN 118

Query: 248 GKESNYTEVTTLLKKEGIDLDHKRFLILQGEVENIAQMKAKAEKENDDGLLEYLEDIIGT 307
           G  +    V  L +   +++++  FLI+QG++  +  MK          +L  +E+  GT
Sbjct: 119 GHRAPQQSVLQLFQSVQLNINNPNFLIMQGKITKVLNMKPSE-------ILSLIEEAAGT 171

Query: 308 SKYKESIEK 316
             +++  EK
Sbjct: 172 KMFEDRREK 180

 Score = 80.9 bits (198), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 32/73 (43%), Positives = 54/73 (73%), Gaps = 1/73 (1%)

Query: 1297 WRN-ISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN 1355
            W++ +  LSGG+++L +L+L+ AL +++P P+Y++DE+DAALD  +   + + IK R K 
Sbjct: 1077 WKDSLIELSGGQRSLIALSLIMALLQFRPAPMYILDEVDAALDLSHTQNIGHLIKTRFKG 1136

Query: 1356 AQFIVISLRNNMF 1368
            +QFIV+SL+  MF
Sbjct: 1137 SQFIVVSLKEGMF 1149

>NCAS0E01920 Chr5 (368382..371894) [3513 bp, 1170 aa] {ON} Anc_7.186
          Length = 1170

 Score = 92.0 bits (227), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 58/188 (30%), Positives = 97/188 (51%), Gaps = 11/188 (5%)

Query: 130 IHQLVLNDFKSYAGRQVIGPFHTSFSAIVGPNGSGKSNVIDSMLFVFGFRANKM-RQDRL 188
           + +L+++ FKSYA R VI  +   F+AI G NGSGKSN++D++ FV G  +  + R   L
Sbjct: 3   VEELIIDGFKSYATRTVIADWDPQFNAITGLNGSGKSNILDAICFVLGISSMTIVRASNL 62

Query: 189 SDLIHKSETFPDLKSCSVEVHFKYVIDKDDGSTTIDETKGNLVVTRKAFKNNASKYFVNG 248
            DLI+K      +   SV + F    DK +     + +   + VTR+      SKY +NG
Sbjct: 63  QDLIYKRGQ-AGVTKASVTIVFDNS-DKTNSPIGFNNS-SKISVTRQIILGGTSKYLING 119

Query: 249 KESNYTEVTTLLKKEGIDLDHKRFLILQGEVENIAQMKAKAEKENDDGLLEYLEDIIGTS 308
             +    V  L +   +++++  FLI+QG++  +  MK        + +L  +E+  GT 
Sbjct: 120 HRAPQQSVLQLFQSVQLNINNPNFLIMQGKITKVLNMKP-------NEILSLIEEAAGTK 172

Query: 309 KYKESIEK 316
            ++   EK
Sbjct: 173 MFENRREK 180

 Score = 81.6 bits (200), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 32/73 (43%), Positives = 54/73 (73%), Gaps = 1/73 (1%)

Query: 1297 WRN-ISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN 1355
            W++ +  LSGG+++L +L+L+ AL +++P P+Y++DE+DAALD  +   + + IK R K 
Sbjct: 1077 WKDSLVELSGGQRSLVALSLIMALLQFRPAPMYILDEVDAALDLSHTQNIGHLIKTRFKG 1136

Query: 1356 AQFIVISLRNNMF 1368
            +QFIV+SL+  MF
Sbjct: 1137 SQFIVVSLKEGMF 1149

 Score = 44.3 bits (103), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 36/127 (28%), Positives = 61/127 (48%), Gaps = 11/127 (8%)

Query: 682 TACPRLNDLVVDTVESGQQCIEYLRKNKLGYARFILLDKL--NTFNTNRID-----TPDQ 734
            A  RL ++VVD  ++    +E  R  K      I L+K+   T N   +       P +
Sbjct: 547 CAGGRLYNVVVDNEKTASLLLEKGRLRK--RVTIIPLNKIAARTLNARTLQMAKDIAPGK 604

Query: 735 SQRLFDLITVKEKRFNNAFYSVLRDTLVCQNMEQANRVAYGKK-RYRVVTLDGNLIDLSG 793
            +   +LI   ++  + A   +   +LVCQ+   A +V +  + R R +TLDG++ D  G
Sbjct: 605 VELALNLIGYDDE-VSRAMEFIFGGSLVCQDANTAKKVTFHPQIRTRSITLDGDVYDPEG 663

Query: 794 TMTGGGR 800
           T++GG R
Sbjct: 664 TLSGGSR 670

>Smik_7.346 Chr7 complement(577634..581146) [3513 bp, 1170 aa] {ON}
           YFR031C (REAL)
          Length = 1170

 Score = 92.0 bits (227), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 58/188 (30%), Positives = 97/188 (51%), Gaps = 11/188 (5%)

Query: 130 IHQLVLNDFKSYAGRQVIGPFHTSFSAIVGPNGSGKSNVIDSMLFVFGFRA-NKMRQDRL 188
           + +L+++ FKSYA R VI  +   F+AI G NGSGKSN++D++ FV G  + + +R   L
Sbjct: 3   VEELIIDGFKSYATRTVITDWDPQFNAITGLNGSGKSNILDAICFVLGIASMSTVRASSL 62

Query: 189 SDLIHKSETFPDLKSCSVEVHFKYVIDKDDGSTTIDETKGNLVVTRKAFKNNASKYFVNG 248
            DLI+K      +   SV + F    DK +       +   + VTR+      SKY +NG
Sbjct: 63  QDLIYKRGQ-AGVTKASVTIVFDNT-DKSNSPIGFANSP-QISVTRQVVLGGTSKYLING 119

Query: 249 KESNYTEVTTLLKKEGIDLDHKRFLILQGEVENIAQMKAKAEKENDDGLLEYLEDIIGTS 308
             +    V  L +   +++++  FLI+QG++  +  MK          +L  +E+  GT 
Sbjct: 120 HRAPQQSVLQLFQSVQLNINNPNFLIMQGKITKVLNMKPSE-------ILSLIEEAAGTK 172

Query: 309 KYKESIEK 316
            +++  EK
Sbjct: 173 MFEDRKEK 180

 Score = 81.3 bits (199), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 32/73 (43%), Positives = 54/73 (73%), Gaps = 1/73 (1%)

Query: 1297 WR-NISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN 1355
            W+ ++  LSGG+++L +L+L+ AL +++P P+Y++DE+DAALD  +   + + IK R K 
Sbjct: 1077 WKESLIELSGGQRSLVALSLIMALLQFRPAPMYILDEVDAALDLSHTQNIGHLIKTRFKG 1136

Query: 1356 AQFIVISLRNNMF 1368
            +QFIV+SL+  MF
Sbjct: 1137 SQFIVVSLKEGMF 1149

 Score = 52.4 bits (124), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 44/151 (29%), Positives = 71/151 (47%), Gaps = 12/151 (7%)

Query: 661 GFHGRLGDLAVIDPKYDVAIST-ACPRLNDLVVDTVESGQQCIEYLRKNKLGYARFILLD 719
           G  GRL  L   + +Y  A+ T A  RL ++VV   ++  Q +E  R  K      I LD
Sbjct: 525 GVVGRLFQLDNDNIRYSSALQTCAGGRLFNVVVRDSQTATQLLEGGRLRK--RVTIIPLD 582

Query: 720 KLNT-------FNTNRIDTPDQSQRLFDLITVKEKRFNNAFYSVLRDTLVCQNMEQANRV 772
           K+ T           +   P + +   +LI   +K    A   +  ++L+C + E A ++
Sbjct: 583 KIYTRPITPQVLELAKSIAPGKVELAINLIRF-DKPVTKAMEFIFGNSLICDDPETAKKI 641

Query: 773 AYGKK-RYRVVTLDGNLIDLSGTMTGGGRNV 802
            +  K R R +TL G++ D  GT++GG RN 
Sbjct: 642 TFHPKIRARSITLQGDVYDPEGTLSGGSRNT 672

>AAL182W Chr1 (16155..19850) [3696 bp, 1231 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YJL074C (SMC3)
          Length = 1231

 Score = 90.5 bits (223), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 160/706 (22%), Positives = 305/706 (43%), Gaps = 73/706 (10%)

Query: 128 LFIHQLVLNDFKSYAGRQVIGPFHTSFSAIVGPNGSGKSNVIDSMLFVFGFRANKMRQDR 187
           ++I ++++  FK+Y  +  I  F    + +VG NGSGKSN   ++ FV       ++++ 
Sbjct: 1   MYIKKVIIRGFKTYKNKTEIDNFSPHHNVVVGFNGSGKSNFFAAIRFVLSDDYTNLKREE 60

Query: 188 LSDLIHKSETFPDLKSCSVEVHFKYVIDKDDGSTTIDETKGNLVVTRKAFKNNASKYFVN 247
              LI++  +   + S  VE+ F       +  T +    G ++  R+       +Y +N
Sbjct: 61  RRSLIYQGTS--SVMSGYVEIVFHGA----ENRTLLGAQDGGVIHIRRTVGLKKDEYMIN 114

Query: 248 GKESNYTEVTTLLKKEGIDLDHKRFLILQGEVENIAQMKAKAEKENDDGLLEYLEDIIGT 307
            K ++ ++V  LL+  G    +   ++ QG + ++   + +         L+ LE++IG 
Sbjct: 115 NKNASRSDVQRLLESAGFSTSNPYNIVPQGRIVSLTNAQNRER-------LQLLEEVIGA 167

Query: 308 S----KYKESIEKLSMEIESLNEICVEKENRFSIVEREKNSLESGKEEALQFXXXXXXXX 363
                K KES++K+    ++  +I +E E     VE + N L+  ++E  ++        
Sbjct: 168 KSFERKLKESLQKMETTEKNREKIRIELEE----VEAKLNELDEERKELEKYNSLDRKRK 223

Query: 364 XXXXXXYQYNLMQXXXXXXXXXXXXTN--VQQEQTKQEDEFRKANSHISDITASLNVLKA 421
                 Y   L +            TN  V  EQ  QE E R+  S I  +T SLN L +
Sbjct: 224 MCQFALYDRELNEVTSMVEKLDGEYTNTLVLSEQYIQELEKRE--SLIETLTKSLNQLGS 281

Query: 422 DLEKVHTEEVNLSKTKRTLENKKVENEQIVNNLDSKRKEFEEQSKILQDKINSTDQEIQT 481
           +L+    E  +L + K    + ++E  + + +L+ K +E   Q+  L+++  S  + +  
Sbjct: 282 ELK--MKESTDLQQAK----DSELELAKHLADLNVKYEELISQNNALKEQSASNSESLLA 335

Query: 482 IIEEQSSLAEGTTVLSTNXXXXXXXXXXXXXXXXXXTEH---LTIQIAEYEK-----ELS 533
           I  + +   +    LS                     +    L  +  +Y +     E  
Sbjct: 336 IRSQIAVKEQQLARLSPRFEQLTIEEAAMKAEFKALQQRQRDLLAKRGKYSQFRNKAERD 395

Query: 534 PWNEQSQQ-LKKEIKITESELSIIEENRKGLENDIAGLENAIL---------SQKRDLEV 583
            W +Q    LK+E++ +   L+ I E R  L   +  L++ I+             +LE 
Sbjct: 396 AWIDQELSILKEELQCSSIALTSISEERDSLRIKLTTLDDQIMELNDSAHGPGINAELED 455

Query: 584 QEQEIKSLLEQKTKVIQERELGERECKNAQATLANVREKVEALRQKAIEIRSTYSATENN 643
            +QE+  L +     I ER+   R  +  Q+ L ++ + V+         R+  + +E  
Sbjct: 456 VQQELTVLKKAHLFKIDERKQLWRSEQKIQSVLESLVDDVK---------RAEGTLSETM 506

Query: 644 NKVLSALLR--LQKSGRLN----GFHGRLGDLAVIDPKYD-VAISTACPRLNDLVVDTVE 696
           ++ L+  L+   + + RLN       G LG+L  I  KY   A       L  +VVDT  
Sbjct: 507 DRSLATGLKNVSEIAQRLNLPEGSVFGPLGELIKISEKYKACAEVVGGTSLFHVVVDTEN 566

Query: 697 SGQQCIEYLRKNKLGYARFILLDKLNTFNTNRIDTPDQSQRLFDLI-TVK-EKRFNNAFY 754
           +    ++ L  +K G   FI L++++  ++N +   +       LI  +K + +F  A  
Sbjct: 567 TAALLMQELYNSKGGRVTFIPLNRVHV-DSNIVYPSNDEHHCTPLIKKIKYDPKFERAIK 625

Query: 755 SVLRDTLVCQNMEQANRVAYGKKRYRV--VTLDGNLIDLSGTMTGG 798
            V   T+V +++ Q  ++A   K++R+  +TLDG+  D  G +TGG
Sbjct: 626 HVFGKTIVVKDLNQGTKLA---KQFRLNAITLDGDKADSRGVLTGG 668

 Score = 70.9 bits (172), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 35/93 (37%), Positives = 52/93 (55%), Gaps = 2/93 (2%)

Query: 1278 SLDPFSEGVTFSVM--PPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDA 1335
            S D    GV+  V     K    ++  LSGG+KT+ ++AL+ A+    P P Y+ DEIDA
Sbjct: 1099 SQDSIYSGVSIEVSFNSKKDEQVHVEQLSGGQKTVCAIALILAIQMVDPAPFYLFDEIDA 1158

Query: 1336 ALDFRNVSIVANYIKERTKNAQFIVISLRNNMF 1368
            ALD +  + VA  +K+ +  AQFI  + R +M 
Sbjct: 1159 ALDKQYRTAVAATVKQLSSQAQFICTTFRGDMI 1191

>Suva_6.149 Chr6 (248275..251967) [3693 bp, 1230 aa] {ON} YJL074C
            (REAL)
          Length = 1230

 Score = 85.9 bits (211), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 62/219 (28%), Positives = 110/219 (50%), Gaps = 35/219 (15%)

Query: 1212 FVEFNKRKNDLNSAV----QSRDSVKDRLEGIKRKRYDEFMEGFKIISMTLKEMYQMITL 1267
            F +FN+++ DL+       +S+DS++D +  +K+++       F+ +S   K +++ +  
Sbjct: 1002 FKKFNEKRKDLSGRASELDESKDSIQDLIVKLKQQKVSAVDSTFQKVSENFKTVFERLVP 1061

Query: 1268 GGNAELELV----DSLDPFSE-----------------------GVTFSVMPPKKS--WR 1298
             G A+L +     DS+D  ++                       GV+ SV    K     
Sbjct: 1062 RGTAKLVIHRRNEDSIDQANDVDVDMDTGNNEDTINKEGETVYTGVSISVSFNSKQNEQL 1121

Query: 1299 NISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQF 1358
            ++  LSGG+KT+ ++AL+ A+    P   Y+ DEIDAALD +  + VA  IKE + NAQF
Sbjct: 1122 HVEQLSGGQKTVCAIALILAIQMVDPASFYLFDEIDAALDKQYRTAVATMIKELSTNAQF 1181

Query: 1359 IVISLRNNMFELTKQLVGIYKHENMTKSAALVN-EDLVG 1396
            I  + R +M ++  +   + K+EN   +   VN E+ +G
Sbjct: 1182 ICTTFRTDMLQVADKFFRV-KYENKISTVIEVNREEAIG 1219

 Score = 60.8 bits (146), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 52/204 (25%), Positives = 95/204 (46%), Gaps = 32/204 (15%)

Query: 128 LFIHQLVLNDFKSYAGRQVIGPFHTSFSAIVGPNGSGKSNVIDSMLFVFGFRANKMRQDR 187
           ++I ++V+  FK+Y    +I  F    + I+G NGSGKSN   ++ FV     + ++++ 
Sbjct: 1   MYIKRVVIKGFKTYRNETIIDNFSPHQNVIIGSNGSGKSNFFAAIRFVLSDDYSNLKREE 60

Query: 188 LSDLIHKSETFPDLKSCSVEVHF----------KYVIDKDDGSTTIDETKGNLVVTRKAF 237
              LIH+  +   + S SVE+ F            V+ + D   TI  T G         
Sbjct: 61  RQGLIHQG-SGGSVMSASVEIVFHDPDHSMILPSGVLSRGDDEVTIRRTVG--------L 111

Query: 238 KNNASKYFVNGKESNYTEVTTLLKKEGIDLDHKRFLILQGEVENIAQMKAKAEKENDDGL 297
           K +   Y +N +     ++  +L+  G  +++   ++ QG++  +A   AK     D   
Sbjct: 112 KKD--DYQLNDRNVTKGDIVRMLETAGFSMNNPYNIVPQGKI--VALTNAK-----DKER 162

Query: 298 LEYLEDIIGTS----KYKESIEKL 317
           L+ LED++G      K K S++K+
Sbjct: 163 LQLLEDVVGAKSFEVKLKASLKKM 186

>Kpol_1018.2 s1018 complement(5901..9536) [3636 bp, 1211 aa] {ON}
            complement(5901..9536) [3636 nt, 1212 aa]
          Length = 1211

 Score = 85.5 bits (210), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 55/189 (29%), Positives = 98/189 (51%), Gaps = 19/189 (10%)

Query: 1212 FVEFNKRKNDLNSAVQSRD----SVKDRLEGIKRKRYDEFMEGFKIISMTLKEMYQMITL 1267
            F +FN++K +LN      D    S+++ +E +K+++       FK +S     +++ +  
Sbjct: 998  FRKFNEKKIELNERAAELDDSKVSIQNLIEKLKQQKVTAVDSTFKKVSENFSTVFEKLVP 1057

Query: 1268 GGNAELEL------------VDSLDPFSEGVTFSVM--PPKKSWRNISNLSGGEKTLSSL 1313
             G A+L +             +S +    G++ SV     K    ++  LSGG+KT+ ++
Sbjct: 1058 RGTAKLIIHRQEENKTRSKDKNSTESIYSGISISVSFNSKKNEQLHVEQLSGGQKTVCAI 1117

Query: 1314 ALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELTKQ 1373
            AL+ A+    P P Y+ DEIDAALD +  + VA+ IK  + NAQFI  + R +M ++  +
Sbjct: 1118 ALILAIQMVDPAPFYLFDEIDAALDKQYRAAVADVIKSLSGNAQFICTTFRTDMLQVADK 1177

Query: 1374 LVGIYKHEN 1382
               + K+EN
Sbjct: 1178 FFRV-KYEN 1185

 Score = 47.0 bits (110), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 40/143 (27%), Positives = 66/143 (46%), Gaps = 7/143 (4%)

Query: 660 NGFHGRLGDLAVIDPKYD-VAISTACPRLNDLVVDTVESGQQCIEYLRKNKLGYARFILL 718
           +   G LG+L  +  KY   A       L ++VVDT E+    +  L   K G   F+ L
Sbjct: 533 DAVFGTLGELIKVSEKYKRCAEVIGGNSLFNVVVDTEETATIIMNELYHMKGGRVTFMPL 592

Query: 719 DKLNTFNTNRIDTPDQSQRLFDLITVKEK---RFNNAFYSVLRDTLVCQNMEQANRVAYG 775
           ++++    N I  P   Q     +  K K   R+  A   +   T+V +++ + +++A  
Sbjct: 593 NRIHV--DNNITYPPNEQASCTPLIKKIKYDVRYEKAVKHIFGRTIVVKDLLEGSKIA-K 649

Query: 776 KKRYRVVTLDGNLIDLSGTMTGG 798
           K +   VTLDG+  D  G +TGG
Sbjct: 650 KLKLNAVTLDGDRADKMGVLTGG 672

>Smik_10.167 Chr10 complement(290936..294625) [3690 bp, 1229 aa] {ON}
            YJL074C (REAL)
          Length = 1229

 Score = 84.7 bits (208), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 61/218 (27%), Positives = 111/218 (50%), Gaps = 34/218 (15%)

Query: 1212 FVEFNKRKNDLNSAV----QSRDSVKDRLEGIKRKRYDEFMEGFKIISMTLKEMYQMITL 1267
            F +F++++ DL+       +S+DS++D +  +K+++ +     F+ +S   + +++ +  
Sbjct: 1002 FKKFDEKRKDLSERASELDESKDSIQDLIVKLKQQKVNAVDSTFQKVSENFEAVFERLVP 1061

Query: 1268 GGNAELEL---------VDSLDP-----------------FSEGVTFSVMPPKKS--WRN 1299
             G A+L +         +DS+D                     GV+ SV    K     +
Sbjct: 1062 RGIAKLVIHRRDDTKDQMDSIDDDMDVASSERTSSKDGDIMYTGVSISVSFNSKQNEQLH 1121

Query: 1300 ISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFI 1359
            +  LSGG+KT+ ++AL+ A+    P   Y+ DEIDAALD +  + VA  IKE +KNAQFI
Sbjct: 1122 VEQLSGGQKTVCAIALILAIQMVDPASFYLFDEIDAALDKQYRTAVATLIKELSKNAQFI 1181

Query: 1360 VISLRNNMFELTKQLVGIYKHENMTKSAALVN-EDLVG 1396
              + R +M ++  +   + K+EN   +   VN E+ +G
Sbjct: 1182 CTTFRTDMLQVADKFFRV-KYENKISTVIEVNREEAIG 1218

 Score = 60.5 bits (145), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 51/204 (25%), Positives = 95/204 (46%), Gaps = 32/204 (15%)

Query: 128 LFIHQLVLNDFKSYAGRQVIGPFHTSFSAIVGPNGSGKSNVIDSMLFVFGFRANKMRQDR 187
           ++I ++++  FK+Y    +I  F    + I+G NGSGKSN   ++ FV     + ++++ 
Sbjct: 1   MYIKRVIIKGFKTYRNETIIDNFSPHQNVIIGSNGSGKSNFFAAIRFVLSDDYSNLKREE 60

Query: 188 LSDLIHKSETFPDLKSCSVEVHF----------KYVIDKDDGSTTIDETKGNLVVTRKAF 237
              LIH+  +   + S SVE+ F            V+ + D   TI  T G         
Sbjct: 61  RQGLIHQG-SGGSVMSASVEIVFHDPDHSMILPSGVLSRGDDEVTIRRTVG--------L 111

Query: 238 KNNASKYFVNGKESNYTEVTTLLKKEGIDLDHKRFLILQGEVENIAQMKAKAEKENDDGL 297
           K +   Y +N +     ++  +L+  G  +++   ++ QG++  +A   AK     D   
Sbjct: 112 KKD--DYQLNDRNVTKGDIVRMLETAGFSMNNPYNIVPQGKI--VALTNAK-----DKER 162

Query: 298 LEYLEDIIGTS----KYKESIEKL 317
           L+ LED++G      K K S++K+
Sbjct: 163 LQLLEDVVGAKSFEVKLKASLKKM 186

>YJL074C Chr10 complement(299157..302849) [3693 bp, 1230 aa] {ON}
            SMC3Subunit of the multiprotein cohesin complex required
            for sister chromatid cohesion in mitotic cells; also
            required, with Rec8p, for cohesion and recombination
            during meiosis; phylogenetically conserved SMC
            chromosomal ATPase family member
          Length = 1230

 Score = 84.3 bits (207), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 63/219 (28%), Positives = 110/219 (50%), Gaps = 35/219 (15%)

Query: 1212 FVEFNKRKNDLNSAV----QSRDSVKDRLEGIKRKRYDEFMEGFKIISMTLKEMYQMITL 1267
            F +FN+R+ DL        +S+DS++D +  +K+++ +     F+ +S   + +++ +  
Sbjct: 1002 FKKFNERRKDLAERASELDESKDSIQDLIVKLKQQKVNAVDSTFQKVSENFEAVFERLVP 1061

Query: 1268 GGNAEL-------------ELVD-SLDPFSE-------------GVTFSVMPPKKS--WR 1298
             G A+L             E +D  +D  S              GV+ SV    K     
Sbjct: 1062 RGTAKLIIHRKNDNANDHDESIDVDMDAESNESQNGKDSEIMYTGVSISVSFNSKQNEQL 1121

Query: 1299 NISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQF 1358
            ++  LSGG+KT+ ++AL+ A+    P   Y+ DEIDAALD +  + VA  +KE +KNAQF
Sbjct: 1122 HVEQLSGGQKTVCAIALILAIQMVDPASFYLFDEIDAALDKQYRTAVATLLKELSKNAQF 1181

Query: 1359 IVISLRNNMFELTKQLVGIYKHENMTKSAALVN-EDLVG 1396
            I  + R +M ++  +   + K+EN   +   VN E+ +G
Sbjct: 1182 ICTTFRTDMLQVADKFFRV-KYENKISTVIEVNREEAIG 1219

 Score = 61.6 bits (148), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 61/238 (25%), Positives = 111/238 (46%), Gaps = 39/238 (16%)

Query: 128 LFIHQLVLNDFKSYAGRQVIGPFHTSFSAIVGPNGSGKSNVIDSMLFVFGFRANKMRQDR 187
           ++I ++++  FK+Y    +I  F    + I+G NGSGKSN   ++ FV     + ++++ 
Sbjct: 1   MYIKRVIIKGFKTYRNETIIDNFSPHQNVIIGSNGSGKSNFFAAIRFVLSDDYSNLKREE 60

Query: 188 LSDLIHKSETFPDLKSCSVEVHF----------KYVIDKDDGSTTIDETKGNLVVTRKAF 237
              LIH+  +   + S SVE+ F            V+ + D   TI  T G         
Sbjct: 61  RQGLIHQG-SGGSVMSASVEIVFHDPDHSMILPSGVLSRGDDEVTIRRTVG--------L 111

Query: 238 KNNASKYFVNGKESNYTEVTTLLKKEGIDLDHKRFLILQGEVENIAQMKAKAEKENDDGL 297
           K +   Y +N +     ++  +L+  G  +++   ++ QG++  +A   AK     D   
Sbjct: 112 KKD--DYQLNDRNVTKGDIVRMLETAGFSMNNPYNIVPQGKI--VALTNAK-----DKER 162

Query: 298 LEYLEDIIGTS----KYKESIEKLSMEIESLNEICVEKE-----NRFSIVEREKNSLE 346
           L+ LED++G      K K S++K  ME     +I + KE     ++ S +E+E+  LE
Sbjct: 163 LQLLEDVVGAKSFEVKLKASLKK--MEETEQKKIQINKEMGELNSKLSEMEQERKELE 218

>SAKL0D06116g Chr4 complement(503196..506885) [3690 bp, 1229 aa] {ON}
            similar to uniprot|P47037 Saccharomyces cerevisiae
            YJL074C SMC3 Subunit of the multiprotein cohesin complex
            required for sister chromatid cohesion in mitotic cells
            also required with Rec8p for cohesion and recombination
            during meiosis phylogenetically conserved SMC chromosomal
            ATPase family member
          Length = 1229

 Score = 84.0 bits (206), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 57/213 (26%), Positives = 102/213 (47%), Gaps = 36/213 (16%)

Query: 1215 FNKRKNDLNSAV----QSRDSVKDRLEGIKRKRYDEFMEGFKIISMTLKEMYQMITLGGN 1270
            FN++K +L +      +S+ S++D +  +K+++ D     F+ ++    E+++ +   G 
Sbjct: 1000 FNEKKKELETRAHELTESKKSIEDLITSLKQQKVDAVEATFQKVAKNFSEVFEKLVPSGA 1059

Query: 1271 AELEL-----------------------------VDSLDPFSEGVTFSVM--PPKKSWRN 1299
             +L +                                 D    GV+ SV     +    +
Sbjct: 1060 GKLVIHHRSEESKGKPQARKKRRNDEDEGAVEDGTSDEDIVYTGVSISVSFNSRQDEQLH 1119

Query: 1300 ISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFI 1359
            +  LSGG+KT+ ++AL+ A+ K  P P Y+ DEIDAALD +  + VAN IKE + NAQFI
Sbjct: 1120 VEQLSGGQKTVCAIALILAIQKVDPAPFYLFDEIDAALDKQYRTSVANTIKELSANAQFI 1179

Query: 1360 VISLRNNMFELTKQLVGIYKHENMTKSAALVNE 1392
              + R++M  +      + K+EN   + A V++
Sbjct: 1180 CTTFRSDMLRVADVFYRV-KYENKISTVAEVSQ 1211

 Score = 66.2 bits (160), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 52/213 (24%), Positives = 98/213 (46%), Gaps = 22/213 (10%)

Query: 128 LFIHQLVLNDFKSYAGRQVIGPFHTSFSAIVGPNGSGKSNVIDSMLFVFGFRANKMRQDR 187
           ++I ++ +  FK+Y    +I  F    + ++G NGSGKSN   ++ FV     N ++++ 
Sbjct: 1   MYIKRVTIQGFKTYKNTTLIDNFSPHHNVVIGSNGSGKSNFFAAIRFVLSDDYNNLKREE 60

Query: 188 LSDLIHKSETFPDLKSCSVEVHFKYVIDKDDG---STTIDETKGNLVVTRKAFKNNASKY 244
              LIH+      + S  VE+    V D  DG   +     +  + VV R+       +Y
Sbjct: 61  RQGLIHQGS--GSVMSAYVEI----VFDNSDGRLLNAAASPSSPDEVVIRRTIGLKKDEY 114

Query: 245 FVNGKESNYTEVTTLLKKEGIDLDHKRFLILQGEVENIAQMKAKAEKENDDGLLEYLEDI 304
            +N K  +  E+  LL+  G    +  +++ QG +  +A   AK     D   L+ L+++
Sbjct: 115 SLNSKSCSKIEIKNLLESAGFSTANPYYIVPQGRI--VALTNAK-----DYERLQLLKEV 167

Query: 305 IGTSKYKESIEKLSMEIESLNEICVEKENRFSI 337
            G + +++ +       +SLN++     NR  I
Sbjct: 168 TGANSFEKKLR------DSLNKMDATNRNRKKI 194

>KAFR0A01610 Chr1 complement(326620..330303) [3684 bp, 1227 aa] {ON}
            Anc_1.295 YJL074C
          Length = 1227

 Score = 84.0 bits (206), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 44/115 (38%), Positives = 67/115 (58%), Gaps = 3/115 (2%)

Query: 1281 PFSEGVTFSVMPPKKS--WRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALD 1338
            P   GV+ SV    K+    ++  LSGG+KT+ ++AL+ A+    P P Y+ DEIDAALD
Sbjct: 1099 PMYTGVSISVSFNSKNDEQLHVEQLSGGQKTVCAIALILAIQMVDPAPFYLFDEIDAALD 1158

Query: 1339 FRNVSIVANYIKERTKNAQFIVISLRNNMFELTKQLVGIYKHENMTKSAALVNED 1393
             +  + VAN +KE +KNAQFI  + R +M ++  +   + K+EN   S   +  D
Sbjct: 1159 KQYRTAVANTLKELSKNAQFICTTFRTDMLQVADKFFRV-KYENKISSVLEIERD 1212

 Score = 70.1 bits (170), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 48/189 (25%), Positives = 91/189 (48%), Gaps = 16/189 (8%)

Query: 128 LFIHQLVLNDFKSYAGRQVIGPFHTSFSAIVGPNGSGKSNVIDSMLFVFGFRANKMRQDR 187
           ++I ++++  FK+Y    +I  F    + I+G NGSGKSN+  ++ FV     + ++++ 
Sbjct: 1   MYIKRVIIKGFKTYRNETIIDNFSPHHNIIIGSNGSGKSNLFAAIRFVLSDDYSNLKREE 60

Query: 188 LSDLIHKSET-FPDLKSCSVEVHFKYVIDKDD-----GSTTIDETKGNLVVTRKAFKNNA 241
              LIH+  +    + SCSVE+ F    D D+      + +I     N V  R+      
Sbjct: 61  RQGLIHQGTSGGSSVMSCSVEIVFH---DPDNRMILASNASIVPRPNNEVFIRRTVGLKK 117

Query: 242 SKYFVNGKESNYTEVTTLLKKEGIDLDHKRFLILQGEVENIAQMKAKAEKENDDGLLEYL 301
             Y +N +    +++  +L+  G  + +   ++ QG++  IA   AK     D   L+ L
Sbjct: 118 DDYQINDRNVTKSDIVRILETAGFSMSNPYNIVPQGKI--IALTNAK-----DKERLQLL 170

Query: 302 EDIIGTSKY 310
           ED++G   +
Sbjct: 171 EDVVGAKSF 179

>KNAG0B05230 Chr2 complement(1005244..1008921) [3678 bp, 1225 aa] {ON}
            Anc_1.295 YJL074C
          Length = 1225

 Score = 83.6 bits (205), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 60/202 (29%), Positives = 99/202 (49%), Gaps = 32/202 (15%)

Query: 1212 FVEFNKRKNDLNSAV----QSRDSVKDRLEGIKRKRYDEFMEGFKIISMTLKEMYQMITL 1267
            F  FN+++ +L+       +S+ S++D +E +K+++       FK +S     +++ +  
Sbjct: 999  FKRFNEKQRELSQRAAELEESKVSIQDLIERLKQQKISAVDNTFKKVSDNFVTVFEQLVP 1058

Query: 1268 GGNAEL---------------ELVD----------SLDPFSEGVTFSVM--PPKKSWRNI 1300
             G A L               E VD           L+    GV+ SV     K     +
Sbjct: 1059 KGTARLIIHKNTDKGDLAVRDEDVDEDVNMDGESQDLESVYTGVSISVSFSSKKNEQLRV 1118

Query: 1301 SNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIV 1360
              LSGG+KT+ ++AL+ A+    P P Y+ DEIDAALD +  + VAN IK+ +KNAQFI 
Sbjct: 1119 EQLSGGQKTVCAIALILAIQMVDPAPFYLFDEIDAALDKQYRTSVANAIKKLSKNAQFIC 1178

Query: 1361 ISLRNNMFELTKQLVGIYKHEN 1382
             + R +M  +  +   + K+EN
Sbjct: 1179 TTFRTDMLAVADRFYRV-KYEN 1199

 Score = 60.1 bits (144), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 45/183 (24%), Positives = 83/183 (45%), Gaps = 9/183 (4%)

Query: 128 LFIHQLVLNDFKSYAGRQVIGPFHTSFSAIVGPNGSGKSNVIDSMLFVFGFRANKMRQDR 187
           ++I ++V+  FK+Y    +I  F    + ++G NGSGKSN   ++ FV     + ++++ 
Sbjct: 1   MYIKRVVIKGFKTYRNETIIDNFSPHHNIVIGSNGSGKSNFFAAIRFVLSDDYSNLKREE 60

Query: 188 LSDLIHKSETFPDLKSCSVEVHFKYVIDKDDGSTTIDETKGNLVVTRKAFKNNASKYFVN 247
              LIH+      + S SVE+ F     +   S+ +     + V  R+        Y +N
Sbjct: 61  RQGLIHQGS--GSVMSASVEIVFHDPDHRIILSSGVIPRPNDEVFVRRTVGLKKDDYQIN 118

Query: 248 GKESNYTEVTTLLKKEGIDLDHKRFLILQGEVENIAQMKAKAEKENDDGLLEYLEDIIGT 307
            +    +++  +L+  G  +     ++ QG +  IA   AK     D   L  LED+IG 
Sbjct: 119 DRNVTKSDLVRMLESAGFSMGSPYNIVPQGRI--IALTNAK-----DKERLLLLEDVIGA 171

Query: 308 SKY 310
             +
Sbjct: 172 KSF 174

 Score = 44.3 bits (103), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 41/144 (28%), Positives = 68/144 (47%), Gaps = 8/144 (5%)

Query: 660 NGFHGRLGDLAVIDPKYD-VAISTACPRLNDLVVDTVESGQQCIEYLRKNKLGYARFILL 718
           +   G LG+L  +  KY   A       L  +VVDT ++    +  L K K G   F+ L
Sbjct: 533 DAVFGTLGELLKVSEKYKTCAEVVGGNSLFHVVVDTDKTASLLMRELYKMKGGRVTFMPL 592

Query: 719 DKLNTFNTNRIDTPDQSQRLFDLIT-VK-EKRFNNAFYSVLRDTLVCQNMEQANRVAYGK 776
           ++L+  +       DQS     L+  +K + +F  A   V   T+V +++    ++A   
Sbjct: 593 NRLHEDSGVTFPPQDQSAACTPLLKKIKYDAKFEKAVKHVFGKTIVVRDLTTGVKMA--- 649

Query: 777 KRYRV--VTLDGNLIDLSGTMTGG 798
           K Y++  +TLDG+  D  G +TGG
Sbjct: 650 KSYQLNAITLDGDRADNRGVLTGG 673

>TDEL0H02610 Chr8 (434116..437628) [3513 bp, 1170 aa] {ON} Anc_7.186
            YFR031C
          Length = 1170

 Score = 83.6 bits (205), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 35/86 (40%), Positives = 58/86 (67%)

Query: 1283 SEGVTFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNV 1342
            +EG+ F V        ++  LSGG+++L +L+L+ AL +++P P+Y++DE+DAALD  + 
Sbjct: 1064 TEGLEFKVRLGSIWKESLVELSGGQRSLIALSLIMALLQFRPAPMYILDEVDAALDLSHT 1123

Query: 1343 SIVANYIKERTKNAQFIVISLRNNMF 1368
              + + IK R K +QFIV+SL+  MF
Sbjct: 1124 QNIGHLIKTRFKGSQFIVVSLKEGMF 1149

 Score = 49.3 bits (116), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 40/154 (25%), Positives = 74/154 (48%), Gaps = 16/154 (10%)

Query: 659 LNGFHGRLGDLAVIDPKYDVAIS---TACPRLNDLVVDTVESGQQCIEYLRKNKLGYARF 715
           + G   +L  LA  +  YD A +    A  RL ++VVD   +  Q +E  R  K      
Sbjct: 523 VKGVAAQLFTLA--EDNYDSATALQVCAGGRLYNVVVDNERTASQLLEKGRLRK--RVTI 578

Query: 716 ILLDKL-------NTFNTNRIDTPDQSQRLFDLITVKEKRFNNAFYSVLRDTLVCQNMEQ 768
           I L+++        T    +   P + +   +L+  +E+  + A   +  ++L+C++ E 
Sbjct: 579 IPLNRIAARALNSQTLQLAQKTAPGKVELALNLVGYEEE-VSRAMEFIFGNSLICKDAET 637

Query: 769 ANRVAYGKK-RYRVVTLDGNLIDLSGTMTGGGRN 801
           A ++ +  + R R +TL G++ D  GT++GG RN
Sbjct: 638 AKKITFHPQIRTRSITLQGDVYDPEGTLSGGSRN 671

>ZYRO0G21296g Chr7 (1747217..1750900) [3684 bp, 1227 aa] {ON} similar
            to uniprot|P47037 Saccharomyces cerevisiae YJL074C SMC3
            Subunit of the multiprotein cohesin complex required for
            sister chromatid cohesion in mitotic cells also required
            with Rec8p for cohesion and recombination during meiosis
            phylogenetically conserved SMC chromosomal ATPase family
            member
          Length = 1227

 Score = 83.2 bits (204), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 42/107 (39%), Positives = 68/107 (63%), Gaps = 3/107 (2%)

Query: 1278 SLDPFSEGVTFSVM--PPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDA 1335
            S++    GV+ SV     K   +++  LSGG+KT+ ++AL+ A+   +P P Y+ DEIDA
Sbjct: 1096 SVEAMYSGVSISVSFNSKKNEQQHVEQLSGGQKTVCAVALILAIQMVEPAPFYLFDEIDA 1155

Query: 1336 ALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELTKQLVGIYKHEN 1382
            ALD +  + VA+ IKE ++NAQFI  + R++M E+  +   + K+EN
Sbjct: 1156 ALDKQYRTAVASTIKELSENAQFICTTFRSDMLEVADKFYRV-KYEN 1201

 Score = 53.5 bits (127), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 43/140 (30%), Positives = 69/140 (49%), Gaps = 9/140 (6%)

Query: 664 GRLGDLAVIDPKYD-VAISTACPRLNDLVVDTVESGQQCIEYLRKNKLGYARFILLDKLN 722
           G LG+L  ++ KY   A       L  +VVDT E+    I+ L + K G   F+ L+++ 
Sbjct: 537 GTLGELIKVNDKYKKCAEVVGGNSLFHIVVDTDETASLIIQELYRMKGGRVTFLPLNRVY 596

Query: 723 TFNTNRIDTPDQSQRLFDLI--TVKEKRFNNAFYSVLRDTLVCQNMEQANRVAYGKKRYR 780
           + + N    P++      LI     + RF  A   V   T+V +++    R+A   KR+R
Sbjct: 597 S-DPNITYPPNEQASCTPLIKKIRYDARFEKAVKQVFGKTIVVRDLSTGARLA---KRFR 652

Query: 781 V--VTLDGNLIDLSGTMTGG 798
           +  +TLDG+  D  G +TGG
Sbjct: 653 LNAITLDGDRADKKGALTGG 672

>KNAG0L01160 Chr12 complement(206434..209946) [3513 bp, 1170 aa] {ON}
            Anc_7.186 YFR031C
          Length = 1170

 Score = 80.9 bits (198), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 32/73 (43%), Positives = 54/73 (73%), Gaps = 1/73 (1%)

Query: 1297 WR-NISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN 1355
            W+ ++  LSGG+++L +L+L+ AL +++P P+Y++DE+DAALD  +   + + IK R K 
Sbjct: 1077 WKESLIELSGGQRSLIALSLIMALLQFRPAPMYILDEVDAALDLSHTQNIGHLIKTRFKG 1136

Query: 1356 AQFIVISLRNNMF 1368
            +QFIV+SL+  MF
Sbjct: 1137 SQFIVVSLKEGMF 1149

 Score = 55.5 bits (132), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 47/154 (30%), Positives = 72/154 (46%), Gaps = 15/154 (9%)

Query: 660 NGFHGRLGDLAVIDPK--YDVAISTACP--RLNDLVVDTVESGQQCIEYLRKNKLGYARF 715
           N   G    L  +D +  Y       C   RL ++VVD   +  Q +E  R  K   A  
Sbjct: 521 NSVKGIAAQLFSLDEQNFYSATALQVCAGGRLFNVVVDNENTAAQLLERGRLRK--RATI 578

Query: 716 ILLDKL--NTFNTNRID-----TPDQSQRLFDLITVKEKRFNNAFYSVLRDTLVCQNMEQ 768
           I L+K+   T N N ++      P + +   +LI  +E+    A   +   +LVC++ E 
Sbjct: 579 IPLNKIAARTLNDNIVNMAKSVAPGRVELALNLIGYEEE-VRRAMEFIFGSSLVCKDAEA 637

Query: 769 ANRVAYGKK-RYRVVTLDGNLIDLSGTMTGGGRN 801
           A  V +  K R R +TLDG++ D  GT++GG RN
Sbjct: 638 AKMVTFNPKIRTRSITLDGDVYDPEGTLSGGSRN 671

>YFR031C Chr6 complement(216594..220106) [3513 bp, 1170 aa] {ON}
            SMC2Subunit of the condensin complex; essential SMC
            chromosomal ATPase family member that forms a complex
            with Smc4p to form the active ATPase; Smc2p/Smc4p complex
            binds DNA; required for clustering of tRNA genes at the
            nucleolus
          Length = 1170

 Score = 80.9 bits (198), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 32/73 (43%), Positives = 54/73 (73%), Gaps = 1/73 (1%)

Query: 1297 WR-NISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN 1355
            W+ ++  LSGG+++L +L+L+ AL +++P P+Y++DE+DAALD  +   + + IK R K 
Sbjct: 1077 WKESLIELSGGQRSLIALSLIMALLQFRPAPMYILDEVDAALDLSHTQNIGHLIKTRFKG 1136

Query: 1356 AQFIVISLRNNMF 1368
            +QFIV+SL+  MF
Sbjct: 1137 SQFIVVSLKEGMF 1149

 Score = 58.5 bits (140), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 65/260 (25%), Positives = 118/260 (45%), Gaps = 33/260 (12%)

Query: 573 AILSQKRDLEVQEQEIKSLLEQKTKVIQERELGERECKNAQATLANVR----------EK 622
           AI      +E+ ++E+ ++  +  +  ++ EL  +  K  Q T   +R           +
Sbjct: 416 AIKKSSMKMELLKKELLTIEPKLKEATKDNELNVKHVKQCQETCDKLRARLVEYGFDPSR 475

Query: 623 VEALRQKAIEIRSTYSATENNNKVLSAL---LRLQKSGRLNGF-----HGRLGDLAVIDP 674
           ++ L+Q+  +++S Y  T  N++ L      L    +     F     HG +G L  ID 
Sbjct: 476 IKDLKQREDKLKSHYYQTCKNSEYLKRRVTNLEFNYTKPYPNFEASFVHGVVGQLFQIDN 535

Query: 675 ---KYDVAIST-ACPRLNDLVVDTVESGQQCIEYLRKNKLGYARFILLDKLNT--FNTNR 728
              +Y  A+ T A  RL ++VV   ++  Q +E  R  K      I LDK+ T   ++  
Sbjct: 536 DNIRYATALQTCAGGRLFNVVVQDSQTATQLLERGRLRK--RVTIIPLDKIYTRPISSQV 593

Query: 729 ID-----TPDQSQRLFDLITVKEKRFNNAFYSVLRDTLVCQNMEQANRVAYGKK-RYRVV 782
           +D      P + +   +LI   E     A   +  ++L+C++ E A ++ +  K R R +
Sbjct: 594 LDLAKKIAPGKVELAINLIRFDES-ITKAMEFIFGNSLICEDPETAKKITFHPKIRARSI 652

Query: 783 TLDGNLIDLSGTMTGGGRNV 802
           TL G++ D  GT++GG RN 
Sbjct: 653 TLQGDVYDPEGTLSGGSRNT 672

>NCAS0A09330 Chr1 (1844122..1847805) [3684 bp, 1227 aa] {ON} Anc_1.295
            YJL074C
          Length = 1227

 Score = 78.6 bits (192), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 41/111 (36%), Positives = 67/111 (60%), Gaps = 3/111 (2%)

Query: 1274 ELVDSLDPFSEGVTFSVMPPKKS--WRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMD 1331
            E++++ +    GV+ SV    K     ++  LSGG+KT+ ++AL+ A+    P P Y+ D
Sbjct: 1092 EVINNNESIYTGVSISVSFNSKENEQLHVEQLSGGQKTVCAIALILAIQMVDPAPFYLFD 1151

Query: 1332 EIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELTKQLVGIYKHEN 1382
            EIDAALD +  + VAN IK+ + NAQFI  + R +M ++  +   + K+EN
Sbjct: 1152 EIDAALDKQYRTAVANIIKQLSVNAQFICTTFRTDMLQVADRFFRV-KYEN 1201

 Score = 63.2 bits (152), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 47/199 (23%), Positives = 93/199 (46%), Gaps = 21/199 (10%)

Query: 128 LFIHQLVLNDFKSYAGRQVIGPFHTSFSAIVGPNGSGKSNVIDSMLFVFGFRANKMRQDR 187
           ++I ++V+  FK+Y  + VI  F    + ++G NGSGKSN   ++ FV     + ++++ 
Sbjct: 1   MYIKRVVIKGFKTYRNQTVIDDFSPHHNIVIGSNGSGKSNFFSAIRFVLSDDYSNLKREE 60

Query: 188 LSDLIHKSETFPDLKSCSVEVHF-----KYVIDKDDGSTTIDETKGNLVVTRKAFKNNAS 242
              LIH+  +   + S SVE+ F     K ++     S  +     + +  R+       
Sbjct: 61  RQGLIHQG-SGGSVMSASVEIVFHDPEHKMIL----PSGVVPRENNDEICIRRTVGLKKD 115

Query: 243 KYFVNGKESNYTEVTTLLKKEGIDLDHKRFLILQGEVENIAQMKAKAEKENDDGLLEYLE 302
            Y +N +     +V  +L+  G  + +   ++ QG++ ++   K K         L+ LE
Sbjct: 116 DYQLNDRNVTKGDVVRMLESTGFSMSNPYNIVPQGKIISLTNAKDKER-------LQLLE 168

Query: 303 DIIGTS----KYKESIEKL 317
           D++G      K K S++K+
Sbjct: 169 DVVGAKSFEVKLKASLKKM 187

>Skud_10.170 Chr10 (316063..319755) [3693 bp, 1230 aa] {ON} YJL074C
            (REAL)
          Length = 1230

 Score = 78.6 bits (192), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 59/219 (26%), Positives = 107/219 (48%), Gaps = 35/219 (15%)

Query: 1212 FVEFNKRKNDLNSAV----QSRDSVKDRLEGIKRKRYDEFMEGFKIISMTLKEMYQMITL 1267
            F +FN+++ DL+       +S++S++D +  +K+++       F+ +S   + +++ +  
Sbjct: 1002 FKKFNEKRKDLSERASELDESKNSIQDLIVRLKQQKVSAVDSTFQKVSENFETVFERLVP 1061

Query: 1268 GGNAELEL----------VDSLD-----------------PFSEGVTFSVMPPKKS--WR 1298
             G A+L +           DS D                     GV+ SV    K     
Sbjct: 1062 RGTAKLVIHRRNENVGDQTDSADVEMDADASKVTSSRDGETVYTGVSISVSFNSKQNEQL 1121

Query: 1299 NISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQF 1358
            ++  LSGG+KT+ ++AL+ A+    P   Y+ DEIDAALD +  + VA  IKE + +AQF
Sbjct: 1122 HVEQLSGGQKTVCAIALILAIQMVDPASFYLFDEIDAALDKQYRTAVATLIKELSNDAQF 1181

Query: 1359 IVISLRNNMFELTKQLVGIYKHENMTKSAALVN-EDLVG 1396
            I  + R +M ++  +   + K+EN   +   VN E+ +G
Sbjct: 1182 ICTTFRTDMLQVADKFFRV-KYENKISTVIEVNKEEAIG 1219

 Score = 60.1 bits (144), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 52/204 (25%), Positives = 94/204 (46%), Gaps = 32/204 (15%)

Query: 128 LFIHQLVLNDFKSYAGRQVIGPFHTSFSAIVGPNGSGKSNVIDSMLFVFGFRANKMRQDR 187
           ++I ++V+  FK+Y    +I  F    + I+G NGSGKSN   ++ FV     + ++++ 
Sbjct: 1   MYIKRVVIKGFKTYRNETIIDNFSPHQNVIIGSNGSGKSNFFAAIRFVLSDDYSNLKREE 60

Query: 188 LSDLIHKSETFPDLKSCSVEVHF----------KYVIDKDDGSTTIDETKGNLVVTRKAF 237
              LIH+  +   + S SVE+ F            V+ + D   TI  T G         
Sbjct: 61  RQGLIHQG-SGGSVMSASVEIVFHDPDHSMILPSGVLSRGDDEVTIRRTVG--------L 111

Query: 238 KNNASKYFVNGKESNYTEVTTLLKKEGIDLDHKRFLILQGEVENIAQMKAKAEKENDDGL 297
           K +   Y +N +     ++  +L+  G  + +   ++ QG++  +A   AK     D   
Sbjct: 112 KKD--DYQLNDRNVTKGDIVRMLETAGFSMTNPYNIVPQGKI--VALTNAK-----DKER 162

Query: 298 LEYLEDIIGTS----KYKESIEKL 317
           L+ LED++G      K K S++K+
Sbjct: 163 LQLLEDVVGAKSFEVKLKASLKKM 186

>TDEL0D01620 Chr4 complement(321963..325634) [3672 bp, 1223 aa] {ON}
            Anc_1.295 YJL074C
          Length = 1223

 Score = 78.2 bits (191), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 40/100 (40%), Positives = 60/100 (60%), Gaps = 3/100 (3%)

Query: 1285 GVTFSVMPPKKSWR--NISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNV 1342
            GV+ SV    K  R  ++  LSGG+KT+ ++AL+ A+    P P Y+ DEIDAALD +  
Sbjct: 1099 GVSISVSFNSKKTRQLHVEQLSGGQKTVCAVALILAIQMVDPAPFYLFDEIDAALDKQYR 1158

Query: 1343 SIVANYIKERTKNAQFIVISLRNNMFELTKQLVGIYKHEN 1382
            + VA  IK  + NAQFI  + R +M ++  +   + K+EN
Sbjct: 1159 TAVAGIIKALSANAQFICTTFRTDMLQVADKFFRV-KYEN 1197

 Score = 63.2 bits (152), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 46/188 (24%), Positives = 87/188 (46%), Gaps = 19/188 (10%)

Query: 128 LFIHQLVLNDFKSYAGRQVIGPFHTSFSAIVGPNGSGKSNVIDSMLFVFGFRANKMRQDR 187
           ++I ++++  FK+Y    VI  F    + ++G NGSGKSN   ++ FV     + ++++ 
Sbjct: 1   MYIRRVIIKGFKTYRNETVIDDFSPHHNIVIGSNGSGKSNFFAAIRFVLSGDYSNLKREE 60

Query: 188 LSDLIHKSETFPDLKSCSVEVHF-----KYVIDKDDGSTTIDETKGNLVVTRKAFKNNAS 242
              LIH+      + S SVE+ F     + ++       + DE     V+ R+       
Sbjct: 61  RQGLIHQGS--GSVMSASVEIVFHDPDHRIILPSGVAPRSNDE-----VLVRRTVGLKKD 113

Query: 243 KYFVNGKESNYTEVTTLLKKEGIDLDHKRFLILQGEVENIAQMKAKAEKENDDGLLEYLE 302
            Y +N +     +V  +L+  G  +++   ++ QG +  IA   AK     D   L+ LE
Sbjct: 114 DYQLNDRNVTKGDVVRMLESAGFSMNNPYNIVPQGRI--IALTNAK-----DKERLQLLE 166

Query: 303 DIIGTSKY 310
           D++G   +
Sbjct: 167 DVVGAKSF 174

 Score = 57.8 bits (138), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 74/294 (25%), Positives = 139/294 (47%), Gaps = 50/294 (17%)

Query: 518 TEHLTIQIA----EYEKELSPWNEQSQQLKKEIKITESELSIIEENRKGLENDIAGLENA 573
           T HL  QI     E  ++L+   EQ Q+L+  ++     ++ IE+  K + ND+      
Sbjct: 416 TTHLKSQIDNERNELHEKLNATEEQIQELEDSVR-GPGVVAEIEDIEKKV-NDLKAEYVE 473

Query: 574 ILSQKRDLEVQEQEIKSLLEQKTKVIQ--ERELGERECKNAQATLANVREKVEALRQKAI 631
            ++++++L   EQ+++++ E     ++  ER + E   K+    +A+VRE  E LR    
Sbjct: 474 KINERKELWRSEQKLQTISETLLDTVKNSERSVSETMAKSLANGIASVREITEKLRLP-- 531

Query: 632 EIRSTYSATENNNKVLSALLRLQKSGRLNGFHGRLGDLAVIDPKYDVAISTACP-RLNDL 690
                                    GR+    G LG+L  ++ KY +         L  +
Sbjct: 532 ------------------------EGRV---FGTLGELIKVNEKYKMCAEVVGGNSLFHI 564

Query: 691 VVDTVESGQQCIEYLRKNKLGYARFILLDKLNTFNTNRIDTPDQSQRLFDLITVKEKRFN 750
           VVDT E+    I+ L + + G   F+ L+++  +N   I  P  +Q     + +K+ +F+
Sbjct: 565 VVDTDETASLMIQELYRMRGGRVTFMPLNRI--YNDPNITYPPNAQSSCTPL-IKKIKFD 621

Query: 751 NAFYSVLRD----TLVCQNMEQANRVAYGKKRYRV--VTLDGNLIDLSGTMTGG 798
             F SV+++    T+V +++   +++A   K Y++  +TLDG+  D SG +TGG
Sbjct: 622 AQFESVVKNVFGKTIVVRDLAAGSKIA---KHYKLDAITLDGDRADKSGLLTGG 672

>NDAI0G05630 Chr7 complement(1393671..1397360) [3690 bp, 1229 aa] {ON}
            Anc_1.295 YJL074C
          Length = 1229

 Score = 77.0 bits (188), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 40/106 (37%), Positives = 62/106 (58%), Gaps = 3/106 (2%)

Query: 1279 LDPFSEGVTFSVMPPKKS--WRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAA 1336
            ++P   GV+ SV    K     ++  LSGG+KT+ ++AL+ A+    P P Y+ DEIDAA
Sbjct: 1099 IEPIYTGVSISVSFNSKENEQLHVEQLSGGQKTVCAIALILAIQMVDPAPFYLFDEIDAA 1158

Query: 1337 LDFRNVSIVANYIKERTKNAQFIVISLRNNMFELTKQLVGIYKHEN 1382
            LD +  + VA  I++ + NAQFI  + R +M E+      + K+EN
Sbjct: 1159 LDKQYRTSVAKLIEKLSANAQFICTTFRTDMLEVADTFFRV-KYEN 1203

 Score = 62.0 bits (149), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 52/207 (25%), Positives = 98/207 (47%), Gaps = 12/207 (5%)

Query: 128 LFIHQLVLNDFKSYAGRQVIGPFHTSFSAIVGPNGSGKSNVIDSMLFVFGFRANKMRQDR 187
           ++I ++V+  FK+Y    +I  F    + ++G NGSGKSN   ++ FV     + ++++ 
Sbjct: 1   MYIKRVVIKGFKTYRNETIIDNFSPHHNIVIGSNGSGKSNFFSAIRFVLSDDYSNLKREE 60

Query: 188 LSDLIHKSETFPDLKSCSVEVHFKYVIDKDDGSTTIDETKGNLVVTRKAFKNNASKYFVN 247
              LIH+  +   + S SVE+ F     K    + +   + + V  R+        Y +N
Sbjct: 61  RQGLIHQG-SGGAVMSASVEIVFHDPNHKIILPSGVVPRENDEVYIRRTVGLKKDDYQLN 119

Query: 248 GKESNYTEVTTLLKKEGIDLDHKRFLILQGEVENIAQMKAKAEKENDDGLLEYLEDIIGT 307
            +     +V  +L+  G  +++   ++ QG++  IA   AK     D   L  LED++G 
Sbjct: 120 DRNVTKGDVVRMLESTGFSMNNPYNIVPQGKI--IALTNAK-----DKERLNLLEDVVGA 172

Query: 308 S----KYKESIEKLSMEIESLNEICVE 330
                K K S++K+    +  N+I +E
Sbjct: 173 KSFELKLKASLKKMDETEQKRNQIDME 199

>CAGL0H02805g Chr8 complement(256682..260341) [3660 bp, 1219 aa] {ON}
            similar to uniprot|P47037 Saccharomyces cerevisiae
            YJL074c SMC3 required for structural maintenance of
            chromosomes
          Length = 1219

 Score = 75.5 bits (184), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 57/209 (27%), Positives = 103/209 (49%), Gaps = 24/209 (11%)

Query: 1212 FVEFNKRKNDLNSAV----QSRDSVKDRLEGIKRKRYDEFMEGFKIISMTLKEMYQMITL 1267
            + +FN+++++L         S+ S++D +  +K ++ +   + F  +S     +++ I  
Sbjct: 1001 YKKFNEKQSELRERATELDDSKQSIQDLIIKLKEQKLNAVDKTFDKVSKNFVMIFEKIVP 1060

Query: 1268 GGNAELELV--------DSLDPFS---------EGVTFSVMPPKKS--WRNISNLSGGEK 1308
             G A L +         D+ + F+         EGV+ SV    K      +  LSGG+K
Sbjct: 1061 RGTATLNIHRINLQGTDDNSELFTQSNEHTTPYEGVSISVSFNSKQDEQLKVEQLSGGQK 1120

Query: 1309 TLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMF 1368
            T+ ++AL+ A+   +P P Y+ DEIDAALD +    VA  I + + NAQFI  + R++M 
Sbjct: 1121 TVCAIALILAIQMVEPAPFYLFDEIDAALDKQYRRAVAQTISQLSNNAQFICTTFRSDMV 1180

Query: 1369 ELTKQLVGIYKHENMTKSAALVNEDLVGR 1397
            +   +   + K+EN   S   V ++   R
Sbjct: 1181 DAANKFYRV-KYENKQSSVIEVTKEEAKR 1208

 Score = 60.1 bits (144), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 42/184 (22%), Positives = 83/184 (45%), Gaps = 9/184 (4%)

Query: 128 LFIHQLVLNDFKSYAGRQVIGPFHTSFSAIVGPNGSGKSNVIDSMLFVFGFRANKMRQDR 187
           ++I ++++  FK+Y    +IG F    + ++G NGSGKSN   ++ FV     + ++++ 
Sbjct: 1   MYIKRVIIKGFKTYRNETIIGDFSPHHNVVIGANGSGKSNFFAAVRFVLSDDYSNLKREE 60

Query: 188 LSDLIHKSETFPDLKSCSVEVHFKYVIDKDDGSTTIDET-KGNLVVTRKAFKNNASKYFV 246
              LIH+      + S SVE+ F          T I+     + V  R+        Y V
Sbjct: 61  RQGLIHQG-AGASVMSASVEIVFHDPEHSIIAPTGINSNGSSDEVRIRRTVGLKKDDYQV 119

Query: 247 NGKESNYTEVTTLLKKEGIDLDHKRFLILQGEVENIAQMKAKAEKENDDGLLEYLEDIIG 306
           N +     ++  +L+  G  + +   ++ QG + ++   K K         L+ LE+++G
Sbjct: 120 NDRNVTKGDLVRMLESAGFYMSNPYNIVPQGRIVSLTNAKDKER-------LQLLEEVVG 172

Query: 307 TSKY 310
              +
Sbjct: 173 AKSF 176

>Ecym_6322 Chr6 (611978..615676) [3699 bp, 1232 aa] {ON} similar to
            Ashbya gossypii AAL182W
          Length = 1232

 Score = 74.3 bits (181), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 38/98 (38%), Positives = 59/98 (60%), Gaps = 3/98 (3%)

Query: 1285 GVTFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSI 1344
            GV+F+    K    ++  LSGG+KT+ ++AL+ A+    P P Y+ DEIDAALD +  + 
Sbjct: 1105 GVSFN--SKKDEQLHVEQLSGGQKTVCAIALILAIQMVDPAPFYLFDEIDAALDKQYRTA 1162

Query: 1345 VANYIKERTKNAQFIVISLRNNMFELTKQLVGIYKHEN 1382
            VA  IKE +  AQFI  + R++M  +  +   + K+EN
Sbjct: 1163 VAATIKELSSEAQFICTTFRSDMIGIADKFYRV-KYEN 1199

 Score = 39.3 bits (90), Expect = 0.095,   Method: Compositional matrix adjust.
 Identities = 39/141 (27%), Positives = 66/141 (46%), Gaps = 11/141 (7%)

Query: 664 GRLGDLAVIDPKYD-VAISTACPRLNDLVVDTVESGQQCIEYLRKNKLGYARFILLDKLN 722
           G LG+L  +  KY   A       L  +VVDT  +    ++ L  +K G   F+ L+++ 
Sbjct: 534 GPLGELIKVSEKYKTCAEVVGGNSLFHVVVDTENTASLIMQELYNSKGGRVTFMPLNRI- 592

Query: 723 TFNTNRIDTPDQSQRLFDLITVKEK---RFNNAFYSVLRDTLVCQNMEQANRVAYGKKRY 779
            +    I  P   +     +  K K   +F  A   V   T+V +++ Q +++A   K++
Sbjct: 593 -YVDPNIQYPSNEEYNCTPLIKKIKFDGKFEKAVKHVFGKTIVVKDLLQGSKLA---KQF 648

Query: 780 RV--VTLDGNLIDLSGTMTGG 798
            +  VTLDG+  D  G +TGG
Sbjct: 649 NLNSVTLDGDKADNKGVLTGG 669

>TBLA0C02740 Chr3 (656941..660300) [3360 bp, 1119 aa] {ON} Anc_1.295
            YJL074C
          Length = 1119

 Score = 72.8 bits (177), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 43/148 (29%), Positives = 77/148 (52%), Gaps = 4/148 (2%)

Query: 1236 LEGIKRKRYDEFMEGFKIISMTLKEMYQMITLGGNAELELVDSLDPFSEGVTFSVMPPKK 1295
            ++ +K ++ +     F  +S    ++++ +   G  EL +      +S GV+  V    K
Sbjct: 952  IDNLKEQKVNAVERTFNQVSENFSDIFEQLVPRGTGELVIGRQGQEYS-GVSIQVSFNSK 1010

Query: 1296 S--WRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERT 1353
            +     I  LSGG+KT+ ++AL+ A+ +  P P Y+ DEIDAALD      V+  IK  +
Sbjct: 1011 NDEQLQIEQLSGGQKTVCAIALILAIQQVDPAPFYLFDEIDAALDKEYRKSVSQVIKRLS 1070

Query: 1354 KNA-QFIVISLRNNMFELTKQLVGIYKH 1380
            +N  QFI+ + R++M E+   +  +  H
Sbjct: 1071 QNGTQFILTTFRSDMIEIADMIYMVKYH 1098

 Score = 53.9 bits (128), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 39/146 (26%), Positives = 73/146 (50%), Gaps = 7/146 (4%)

Query: 661 GFHGRLGDLAVIDPKYDVAIST-ACPRLNDLVVDTVESGQQCIEYLRKNKLGYARFILLD 719
             +G LG+L  +  KY   +   A   L +++VDT E+  Q +  L + + G   FI L+
Sbjct: 460 SIYGTLGELIKVSEKYKRCVEIIAGNSLFNIIVDTDETASQIMNELIRMQNGRVTFIPLN 519

Query: 720 KLNTFNTNRIDTPDQSQRLFDLITVK---EKRFNNAFYSVLRDTLVCQNMEQANRVAYGK 776
           ++   N   I+ P   +     +  K   +K+F     +V   T+V ++++  NR+   +
Sbjct: 520 RIE--NGVNINYPSNEESNCTALIKKIKYDKKFEKVIRNVFGKTIVVKDLQLGNRLC-KE 576

Query: 777 KRYRVVTLDGNLIDLSGTMTGGGRNV 802
            + + +TLDG+ ID  G ++GG  N+
Sbjct: 577 FKLQAITLDGDRIDSKGVVSGGYFNI 602

>KLLA0A00286g Chr1 complement(22024..25698) [3675 bp, 1224 aa] {ON}
            similar to uniprot|P47037 Saccharomyces cerevisiae
            YJL074C SMC3 Subunit of the multiprotein cohesin complex
            required for sister chromatid cohesion in mitotic cells
          Length = 1224

 Score = 67.0 bits (162), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 30/69 (43%), Positives = 42/69 (60%)

Query: 1300 ISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFI 1359
            +  LSGG+KT+ ++AL+ A+    P P Y+ DEIDAALD +    VA  IK  +  AQFI
Sbjct: 1117 VEQLSGGQKTVCAIALILAIQMVDPAPFYLFDEIDAALDKQYRIAVARTIKNLSDTAQFI 1176

Query: 1360 VISLRNNMF 1368
              + R +M 
Sbjct: 1177 CTTFRTDMI 1185

 Score = 55.8 bits (133), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 50/201 (24%), Positives = 89/201 (44%), Gaps = 30/201 (14%)

Query: 128 LFIHQLVLNDFKSYAGRQVIGPFHTSFSAIVGPNGSGKSNVIDSMLFVFGFRANKMRQDR 187
           + I  ++++ FK+Y  R V+  F    + +VG NGSGKSN   ++ FV     + ++++ 
Sbjct: 2   VHIKTVIISGFKTYKNRTVVENFSPHHNVVVGSNGSGKSNFFAAIRFVLSEENSNLKRED 61

Query: 188 LSDLIHKSETFPDLKSCSVEVHFK-------YVIDKDDGSTTIDETKGNLVVTRKAFKNN 240
               I++      + S  VE+ F          +  D G   I  T G         K +
Sbjct: 62  RKGFIYQGA--GQVMSAFVEIIFDDPENLMLAPLRNDTGEVRIRRTVG--------LKKD 111

Query: 241 ASKYFVNGKESNYTEVTTLLKKEGIDLDHKRFLILQGEVENIAQMKAKAEKENDDGLLEY 300
             +Y +N K S   +V  +L+  G    +   ++ QG + ++   K       D   L  
Sbjct: 112 --EYMINDKNSTRQDVRRVLENVGFSTSNPYNIVPQGRIISLTNAK-------DLERLHL 162

Query: 301 LEDIIGT----SKYKESIEKL 317
           LED++G     +K KES++K+
Sbjct: 163 LEDVVGAKSFENKLKESLKKM 183

>KLTH0D02816g Chr4 complement(272310..275594) [3285 bp, 1094 aa]
           {ON} similar to uniprot|Q08204 Saccharomyces cerevisiae
           YOL034W SMC5 Structural maintenance of chromosomes (SMC)
           protein interacts with Rhc18p and Nse1p to form a large
           complex S. pombe homolog forms a heterodimer with S.
           pombe Rad18p that is involved in DNA repair
          Length = 1094

 Score = 52.8 bits (125), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 49/162 (30%), Positives = 75/162 (46%), Gaps = 16/162 (9%)

Query: 130 IHQLVLNDFKSYAGRQVIGPFHTSFS--AIVGPNGSGKSNVIDSMLFVFGFRANKM-RQD 186
           I  L L +F +YA    +  FH S S   I+GPNGSGKS  + ++      +   + R  
Sbjct: 47  IVTLRLENFVTYA----LTEFHMSPSLNMIIGPNGSGKSTFVCAVCLGLAGKPEYIGRST 102

Query: 187 RLSDLIHKSETFPDLKSCSVEVHFKYVIDKDDGSTTIDETKGNLVVTRKAFKNN-ASKYF 245
           ++ D I   E         +EV  K   + +D     D   G   VTR   +N  AS+YF
Sbjct: 103 KIEDYIKNGED-----RSVIEVTLKRDPEAEDRYVASD---GTTKVTRVLHRNRKASEYF 154

Query: 246 VNGKESNYTEVTTLLKKEGIDLDHKRFLILQGEVENIAQMKA 287
           +NG+    + V  L+ +  I LD+    + Q  VE  A++K+
Sbjct: 155 LNGQSVTESAVKRLVSELNIQLDNLCQFLSQERVEEFARLKS 196

 Score = 41.2 bits (95), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 25/83 (30%), Positives = 42/83 (50%), Gaps = 11/83 (13%)

Query: 1304 SGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERT---KNAQFIV 1360
            SGGE+ +S++  + AL      P  V+DEI+  +D RN  IV   + E      N+Q+I+
Sbjct: 989  SGGERAVSTVLYMIALQDVTSAPFRVVDEINQGMDSRNERIVHKSMVESACSQNNSQYIL 1048

Query: 1361 ISLRNNMFELTKQLVGIYKHENM 1383
            ++         K L  ++ HE +
Sbjct: 1049 VT--------PKLLTQLHYHEKV 1063

>ZYRO0G01584g Chr7 (120582..123848) [3267 bp, 1088 aa] {ON} similar
           to uniprot|Q08204 Saccharomyces cerevisiae YOL034W SMC5
           Structural maintenance of chromosomes (SMC) protein
           interacts with Rhc18p and Nse1p to form a large complex
           S. pombe homolog forms a heterodimer with S. pombe
           Rad18p that is involved in DNA repair
          Length = 1088

 Score = 50.4 bits (119), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 57/213 (26%), Positives = 102/213 (47%), Gaps = 20/213 (9%)

Query: 130 IHQLVLNDFKSYAGRQV-IGPFHTSFSAIVGPNGSGKSNVIDSMLFVFGFRANKM-RQDR 187
           I ++ L +F +Y   +  + P   S + I+GPNGSGKS  + ++      +   + R  R
Sbjct: 36  IVKMRLENFVTYTLTEFDLSP---SLNMIIGPNGSGKSTFVCAVCLGLAGKPEFIKRSKR 92

Query: 188 LSDLIHKSETFPDLKSCSVEVHFKYVIDKDDGSTTIDETKGNLVVTRKAFKNNA-SKYFV 246
           + D I   E        S+E+  K    K +G   +D     + +TR+  K+ + S+Y +
Sbjct: 93  VEDFIKNGED-----RGSIEITLKNS-PKVEGMPGVDSEADTIKITRELIKSKSKSRYMI 146

Query: 247 NGKESNYTEVTTLLKKEGIDLDHKRFLILQGEVENIAQMK-----AKAEKENDDGLLEYL 301
           N +  +  +V  L+ K  I LD+    + Q  VE  A++K     A+  +  D  LL+ L
Sbjct: 147 NDRVVSEEDVRLLVSKLNIQLDNLCQFLSQERVEEFARLKSDKLLAETTRSIDAKLLDVL 206

Query: 302 EDIIGTSKYKE--SIEKLSMEIESLNEICVEKE 332
           E ++   + KE  S  +L +  +  +E+ V+KE
Sbjct: 207 E-LLKDLQAKEISSQRELDLNKQKYDELLVQKE 238

 Score = 45.4 bits (106), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 28/85 (32%), Positives = 44/85 (51%), Gaps = 15/85 (17%)

Query: 1304 SGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRN-----VSIVANYIKERTKNAQF 1358
            SGGE+ +S++  + AL ++   P  V+DEI+  +D RN      S+V N   E T  +Q+
Sbjct: 981  SGGERAVSTVLYMIALQEFTTAPFRVVDEINQGMDSRNERIVHKSMVENACAENT--SQY 1038

Query: 1359 IVISLRNNMFELTKQLVGIYKHENM 1383
             +I+         K L  +Y HE M
Sbjct: 1039 FLIT--------PKLLTDLYYHEKM 1055

>SAKL0B09526g Chr2 (805816..809115) [3300 bp, 1099 aa] {ON} similar
           to uniprot|Q08204 Saccharomyces cerevisiae YOL034W SMC5
           Structural maintenance of chromosomes (SMC) protein
           interacts with Rhc18p and Nse1p to form a large complex
           S. pombe homolog forms a heterodimer with S. pombe
           Rad18p that is involved in DNA repair
          Length = 1099

 Score = 49.7 bits (117), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 43/162 (26%), Positives = 76/162 (46%), Gaps = 14/162 (8%)

Query: 130 IHQLVLNDFKSYAGRQVIGPFH--TSFSAIVGPNGSGKSNVIDSMLFVFGFRANKM-RQD 186
           I ++ L +F +YA    +  FH   S + I+GPNGSGKS  + ++      R   + R  
Sbjct: 48  IIKIRLKNFVTYA----LTEFHLSPSLNMIIGPNGSGKSTFVCAICLGLAGRPEYIGRSK 103

Query: 187 RLSDLIHKSETFPDLKSCSVEVHFKYVIDKDDGSTTIDETKGNLVVTRKAFKNN-ASKYF 245
           R+ D I   E       C +E+  K    K  G   +  +   + +TR   ++   S YF
Sbjct: 104 RVEDFIKNGED-----ECEIEITLKNN-SKIQGIANVLSSDDVIKITRVLIRHRKKSDYF 157

Query: 246 VNGKESNYTEVTTLLKKEGIDLDHKRFLILQGEVENIAQMKA 287
           +N + ++   V +++ +  I LD+    + Q  VE  A++K+
Sbjct: 158 INDRPASEGVVKSMILQLNIQLDNLCQFLSQERVEEFARLKS 199

 Score = 48.5 bits (114), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 47/174 (27%), Positives = 77/174 (44%), Gaps = 28/174 (16%)

Query: 1220 NDLNSAVQSRDSVKDRLEGIKRKRYDEFMEGFKIISMTLKEMYQMITLGGNAELELVDSL 1279
            N L      RDSVK++ + ++  R DE ++    +S     ++  +   G   LE     
Sbjct: 913  NQLTHLANIRDSVKEKRDVLE-PRLDEVVQR---VSQRFARLFVGVGSAGAVNLE----- 963

Query: 1280 DP--FSEGVTFSVMPPKKSWRNISNL-----SGGEKTLSSLALVFALHKYKPTPLYVMDE 1332
             P  FSE     +M   +    +  L     SGGE+ +S++  + AL ++   P  V+DE
Sbjct: 964  KPTLFSEW-KLEIMVKFRDNATLKRLDSHTQSGGERAVSTVLYMIALQEFTTAPFRVVDE 1022

Query: 1333 IDAALDFRNVSIVANYIKERT---KNAQFIVISLRNNMFELTKQLVGIYKHENM 1383
            I+  +D RN  IV   + E       +Q+ +I+         K L G+Y HE M
Sbjct: 1023 INQGMDTRNERIVHKAMVENACAENTSQYFLIT--------PKLLTGLYYHEKM 1068

>Skud_15.121 Chr15 (218825..222106) [3282 bp, 1093 aa] {ON} YOL034W
            (REAL)
          Length = 1093

 Score = 48.1 bits (113), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 27/83 (32%), Positives = 43/83 (51%), Gaps = 11/83 (13%)

Query: 1304 SGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERT---KNAQFIV 1360
            SGGE+ +S++  + AL ++   P  V+DEI+  +D RN  IV   + E       +Q+ +
Sbjct: 987  SGGERAVSTVLYMIALQEFTSAPFRVVDEINQGMDSRNERIVHKAMVENACAENTSQYFL 1046

Query: 1361 ISLRNNMFELTKQLVGIYKHENM 1383
            I+         K L G+Y HE M
Sbjct: 1047 IT--------PKLLTGLYYHEKM 1061

 Score = 39.7 bits (91), Expect = 0.065,   Method: Compositional matrix adjust.
 Identities = 41/163 (25%), Positives = 74/163 (45%), Gaps = 16/163 (9%)

Query: 130 IHQLVLNDFKSYAGRQV-IGPFHTSFSAIVGPNGSGKSNVIDSMLFVFGFRANKM-RQDR 187
           I ++ L DF +Y   +  + P   S + I+GPNGSGKS  + ++      +   + R  +
Sbjct: 42  ITKIRLQDFVTYTLTEFNLSP---SLNMIIGPNGSGKSTFVCAVCLGLAGKPEYIGRSKK 98

Query: 188 LSDLIHKSETFPDLKSC---SVEVHFKYVIDKDDGSTTIDETKGNLVVTRKAFKNNASKY 244
           + D I   +    ++     S +VH    I+  D +  I       ++TR   +   S Y
Sbjct: 99  VEDFIKNGQDVSRIEITLKNSPKVHDIENINAHDETIKITR-----IITRSKRR---SDY 150

Query: 245 FVNGKESNYTEVTTLLKKEGIDLDHKRFLILQGEVENIAQMKA 287
            +N  + +   V TL+ +  I LD+    + Q  VE  A++K+
Sbjct: 151 LINDGQVSENTVKTLVTQLNIQLDNLCQFLSQERVEEFARLKS 193

>TDEL0H03490 Chr8 (578645..581956) [3312 bp, 1103 aa] {ON} Anc_7.101
            YOL034W
          Length = 1103

 Score = 48.1 bits (113), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 28/85 (32%), Positives = 44/85 (51%), Gaps = 15/85 (17%)

Query: 1304 SGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRN-----VSIVANYIKERTKNAQF 1358
            SGGE+ +S++  + AL +Y   P  ++DEI+  +D  N      S+V N   E T  +Q+
Sbjct: 998  SGGERAVSTVLYMIALQQYTTAPFRIVDEINQGMDSHNERIVHKSMVINACAENT--SQY 1055

Query: 1359 IVISLRNNMFELTKQLVGIYKHENM 1383
             +I+         K L G+Y HE M
Sbjct: 1056 FLIT--------PKLLTGLYYHEKM 1072

>TDEL0E01340 Chr5 complement(265681..269001) [3321 bp, 1106 aa] {ON}
            Anc_4.237 YLR383W
          Length = 1106

 Score = 47.8 bits (112), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 27/85 (31%), Positives = 44/85 (51%), Gaps = 3/85 (3%)

Query: 1281 PFSEGVTFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFR 1340
            P  + + +++ P     RN+  LSGGEK+ S +AL+ A  K   + +  +DE D  +D  
Sbjct: 987  PAKQLMIYTLTPNDNRPRNVDTLSGGEKSFSQMALLLATWKPMRSRIIALDEFDVFMDQV 1046

Query: 1341 NVSIVANYIKERTKN---AQFIVIS 1362
            N  +    I E+ KN    Q I+I+
Sbjct: 1047 NRKMGTRLILEKLKNNSRTQTIIIT 1071

>KNAG0L00630 Chr12 complement(93928..97254) [3327 bp, 1108 aa] {ON}
           Anc_7.101 YOL034W
          Length = 1108

 Score = 46.6 bits (109), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 43/156 (27%), Positives = 79/156 (50%), Gaps = 16/156 (10%)

Query: 132 QLVLNDFKSYAGRQVIGPFHTSFSAIVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDL 191
           +L L++F +Y+  +    F  S + +VGPNGSGKS ++ ++      R   + + + SD 
Sbjct: 59  RLRLHNFVTYSLAEF--EFSPSLNMVVGPNGSGKSTLVCALCLGLAGRTEYLGRMKRSDS 116

Query: 192 IHKSETFPDLKSCSVEVHFKYVIDKDDGSTTIDETKGNLVVTRKAFKNNASKYFVNGKES 251
             K+       S  ++V   ++  +D G+T     K + V+TR   K  AS Y+V+G E+
Sbjct: 117 FIKN----GADSARIDV---WLAGEDPGTT----LKVSRVLTRNHKK--ASLYYVDGVET 163

Query: 252 NYTEVTTLLK-KEGIDLDHKRFLILQGEVENIAQMK 286
           +   V  L+  +  I LD+    + Q  V+  A+++
Sbjct: 164 SEQRVRQLVATQHNIQLDNLCQFLSQERVQEFARLR 199

 Score = 44.3 bits (103), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 25/83 (30%), Positives = 42/83 (50%), Gaps = 11/83 (13%)

Query: 1304 SGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERT---KNAQFIV 1360
            SGGE+ +S++  + AL ++   P  V+DEI+  +D RN  IV   + +       +Q+ +
Sbjct: 1003 SGGERAVSTVLYIIALQEFTSAPFRVVDEINQGMDQRNERIVHKAMVQSACADNTSQYFL 1062

Query: 1361 ISLRNNMFELTKQLVGIYKHENM 1383
            I+         K L  +Y HE M
Sbjct: 1063 IT--------PKLLTDLYYHEKM 1077

>TPHA0L00600 Chr12 complement(102317..105670) [3354 bp, 1117 aa] {ON}
            Anc_7.101 YOL034W
          Length = 1117

 Score = 46.6 bits (109), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 27/83 (32%), Positives = 43/83 (51%), Gaps = 11/83 (13%)

Query: 1304 SGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERT---KNAQFIV 1360
            SGGEK +S++  + AL ++   P  V+DEI+  +D RN  IV   + E       +Q+ +
Sbjct: 1012 SGGEKAVSTVFYMIALQEFTIAPFRVVDEINQGMDPRNEKIVHQSMVENACADNTSQYFL 1071

Query: 1361 ISLRNNMFELTKQLVGIYKHENM 1383
            I+         K L G++ HE M
Sbjct: 1072 IT--------PKLLTGLFYHEKM 1086

>KLLA0F07997g Chr6 complement(748561..751920) [3360 bp, 1119 aa] {ON}
            similar to uniprot|Q08204 YOL034W Saccharomyces
            cerevisiae YOL034W SMC5 Structural maintenance of
            chromosomes (SMC) protein, interacts with Rhc18p and
            Nse1p to form a large complex
          Length = 1119

 Score = 46.2 bits (108), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 47/206 (22%), Positives = 90/206 (43%), Gaps = 39/206 (18%)

Query: 1189 TSLDDFITSSEANVDVLEEYALRFVEFNKRKNDLNSAVQSRDSVKDRLEGIKRKRYDEFM 1248
            TS+ D +  +  ++ +LE+         K  ++  + ++ R+S++ RL+ I         
Sbjct: 911  TSVIDILKKTNEDISILEKTLPHLRA--KLASNAQTILEIRNSLEPRLDDI--------- 959

Query: 1249 EGFKIISMTLKEMYQMITLGGNAELELVDSLDPFSEGVTFSVMPPKKSWRNISNL----- 1303
               K IS     ++  +   G  EL+  DS + +        +  K  +R+ S L     
Sbjct: 960  --VKQISKKFSHLFAYVGSAGQVELKKPDSFNDW-------CIEIKVKFRDNSELQQLNP 1010

Query: 1304 ---SGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERT---KNAQ 1357
               SGGE+ +S++  + AL ++  +P  V+DEI+  +D  N  IV   + E       +Q
Sbjct: 1011 HVQSGGERAVSTVLYMIALQQFTSSPFRVVDEINQGMDQTNERIVHRIMVENACAENTSQ 1070

Query: 1358 FIVISLRNNMFELTKQLVGIYKHENM 1383
            + +I+         K L  ++ HE M
Sbjct: 1071 YFLIT--------PKLLTNLFYHERM 1088

 Score = 40.8 bits (94), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 90/379 (23%), Positives = 161/379 (42%), Gaps = 56/379 (14%)

Query: 132 QLVLNDFKSYAGRQVIGPFH--TSFSAIVGPNGSGKSNVIDSMLFVFGFRANKM-RQDRL 188
           +L L +F +YA    +  FH   S + I+GPNGSGKS  + ++      +   + R  ++
Sbjct: 62  KLKLTNFVTYA----LTEFHLSPSLNMIIGPNGSGKSTFVCAICLGLAGKPEYIGRSKKV 117

Query: 189 SDLIHKSE----TFPDLKSCSVEVHFKY-VIDKDDGSTTIDETKGNLVVTRKAFKNNASK 243
            + I            LK+ S  +H  + +I+ DD    +   K  L + +K      SK
Sbjct: 118 EEYIKNGTDEGVIEITLKNSSALLHSDFNMINTDDDVVHV---KRVLSMEKKK-----SK 169

Query: 244 YFVNGKESNYTEVTTLLKKEGIDLDHKRFLILQGEVENIAQMKAKAEKENDDGLLEYLED 303
           Y++N K      V ++++   I LD+    + Q  VE  A++K       D  L E +  
Sbjct: 170 YYINNKVVTEEVVKSMVRVLNIQLDNLCQFLSQERVEEFARLKP------DTLLNETIRS 223

Query: 304 IIGTSKYKESIEKLSMEIESL----NEICVE---KENRFSIVEREKNSLESGKEEALQFX 356
           I         +EKLS E++SL    NE+ ++   KEN+   +   + +LES +  AL+  
Sbjct: 224 IEAG-----LLEKLS-ELKSLQAEGNELQIDLGAKENKLKELTSSRAALES-QAHALELY 276

Query: 357 XXXXXXXXXXXXXYQYNLMQXXXXXXXXXXXXTNVQQEQTK-QEDEFRKANSHISDITAS 415
                          Y  ++             N  + + K  E+E +  N     +TA 
Sbjct: 277 EEKARELDIHQKLLNYTYLKEHKEKIRGLKDKRNALRNEVKTMENESKPFNLLGVRLTAD 336

Query: 416 LNVLKADLEKV-----------HTEEVNLSKTKRTLENKKVENEQIVNNLDSKRKEFEEQ 464
            N  K+D++ +           ++   N+ KT + L     E E  VN L ++ K  +E 
Sbjct: 337 ENNCKSDIDDLSRRRYSAKTSFNSSTENIQKTSKYLS----ECESKVNFLTTRNKSLKED 392

Query: 465 SKILQDKINSTDQEIQTII 483
            K+ ++KI + ++E   ++
Sbjct: 393 IKVNEEKIKALEEERNKVV 411

>NCAS0I00570 Chr9 complement(90806..94093) [3288 bp, 1095 aa] {ON}
           Anc_7.101 YOL034W
          Length = 1095

 Score = 46.2 bits (108), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 53/210 (25%), Positives = 96/210 (45%), Gaps = 29/210 (13%)

Query: 153 SFSAIVGPNGSGKSNVIDSMLFVFGFRANKM-RQDRLSDLIHKSETFPDLKSCSVEVHFK 211
           S + I+GPNGSGKS  + ++      +   + R  R+ D I   E      +  +E+  K
Sbjct: 59  SLNMIIGPNGSGKSTFVCAVCLGLAGKPEFIGRAKRVDDFIKNGED-----TSRIEIFLK 113

Query: 212 YVIDKDDGSTTID-----ETKGNLVVTRKAFKNN---ASKYFVNGKESNYTEVTTLLKKE 263
              D  +  ++++       K  L VTR   ++     S YF+N K      +  L+K  
Sbjct: 114 NYEDPTELQSSLNLKFNLAGKDLLKVTRLIQRDGNKCKSDYFINDKPVTENVIKNLVKFL 173

Query: 264 GIDLDHKRFLILQGEVENIAQMKA-----KAEKENDDGLLEYLEDIIGTSKYKESIEKLS 318
            I LD+    + Q  VE  A++K+     +  +  D  LL+ L+D+  +   + ++E   
Sbjct: 174 NIQLDNLCQFLSQERVEEFARLKSDKLLVETVRSIDAQLLQILDDLKSSQNDETTLE--- 230

Query: 319 MEIESLNEICVEKENRFSIVEREKNSLESG 348
                 NE+ + K+ RF+ +E ++N LE+ 
Sbjct: 231 ------NEVDI-KQKRFNELETDRNKLEAS 253

 Score = 43.1 bits (100), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 25/83 (30%), Positives = 42/83 (50%), Gaps = 11/83 (13%)

Query: 1304 SGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERT---KNAQFIV 1360
            SGGE+ +S++  + AL ++   P  V+DEI+  +D RN  IV   + E       +Q+ +
Sbjct: 990  SGGERAVSTVLYMIALQEFTSAPFRVVDEINQGMDARNERIVHKAMVENACAENTSQYFL 1049

Query: 1361 ISLRNNMFELTKQLVGIYKHENM 1383
            I+         K L  ++ HE M
Sbjct: 1050 IT--------PKLLTDLHYHEKM 1064

>Smik_15.131 Chr15 (226115..229396) [3282 bp, 1093 aa] {ON} YOL034W
            (REAL)
          Length = 1093

 Score = 46.2 bits (108), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 26/83 (31%), Positives = 43/83 (51%), Gaps = 11/83 (13%)

Query: 1304 SGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERT---KNAQFIV 1360
            SGGE+ +S++  + AL ++   P  V+DEI+  +D RN  IV   + E       +Q+ +
Sbjct: 987  SGGERAVSTVLYMIALQEFTSAPFRVVDEINQGMDSRNERIVHKAMVENACAENTSQYFL 1046

Query: 1361 ISLRNNMFELTKQLVGIYKHENM 1383
            I+         K L G++ HE M
Sbjct: 1047 IT--------PKLLTGLHYHEKM 1061

 Score = 40.4 bits (93), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 40/156 (25%), Positives = 71/156 (45%), Gaps = 12/156 (7%)

Query: 135 LNDFKSYAGRQV-IGPFHTSFSAIVGPNGSGKSNVIDSMLFVFGFRANKM-RQDRLSDLI 192
           L DF +Y   +  + P   S + I+GPNGSGKS  + ++      +   + R  R+ D I
Sbjct: 47  LQDFVTYTLTEFNLSP---SLNMIIGPNGSGKSTFVCAVCLGLAGKPEYIGRSKRVEDFI 103

Query: 193 HKSETFPDLKSCSVEVHFKYVIDKDDGSTTIDET-KGNLVVTRKAFKNNASKYFVNGKES 251
              +   D+    + +     ++  +     DET K   ++TR   +   S Y +N  E 
Sbjct: 104 KNGQ---DVSRIEITLKNSPKVNDIENVNAHDETIKITRIITRSKRR---SDYLINDCEV 157

Query: 252 NYTEVTTLLKKEGIDLDHKRFLILQGEVENIAQMKA 287
           + + V  L+ +  I LD+    + Q  VE  A++K+
Sbjct: 158 SESVVKALVAQLNIQLDNLCQFLSQERVEEFARLKS 193

>YOL034W Chr15 (259923..263204) [3282 bp, 1093 aa] {ON}  SMC5Component
            of the SMC5-SMC6 complex; this complex plays a key role
            in the removal of X-shaped DNA structures that arise
            between sister chromatids during DNA replication and
            repair; binds single-stranded DNA and has ATPase
            activity; S. pombe homolog forms a heterodimer with S.
            pombe Rad18p that is involved in DNA repair
          Length = 1093

 Score = 45.8 bits (107), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 26/83 (31%), Positives = 43/83 (51%), Gaps = 11/83 (13%)

Query: 1304 SGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERT---KNAQFIV 1360
            SGGE+ +S++  + AL ++   P  V+DEI+  +D RN  IV   + E       +Q+ +
Sbjct: 987  SGGERAVSTVLYMIALQEFTSAPFRVVDEINQGMDSRNERIVHKAMVENACAENTSQYFL 1046

Query: 1361 ISLRNNMFELTKQLVGIYKHENM 1383
            I+         K L G++ HE M
Sbjct: 1047 IT--------PKLLTGLHYHEKM 1061

 Score = 40.4 bits (93), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 42/164 (25%), Positives = 77/164 (46%), Gaps = 18/164 (10%)

Query: 130 IHQLVLNDFKSYAGRQV-IGPFHTSFSAIVGPNGSGKSNVIDSMLFVFGFRANKM-RQDR 187
           I ++ L DF +Y   +  + P   S + I+GPNGSGKS  + ++      +   + R  +
Sbjct: 42  IIKIRLQDFVTYTLTEFNLSP---SLNMIIGPNGSGKSTFVCAVCLGLAGKPEYIGRSKK 98

Query: 188 LSDLIHKSETFPD----LKSCSVEVHFKYVIDKDDGSTTIDETKGNLVVTRKAFKNNASK 243
           + D I   +        LK+       +Y+  +D+   TI  T+   ++TR   +   S 
Sbjct: 99  VEDFIKNGQDVSKIEITLKNSPNVTDIEYIDARDE---TIKITR---IITRSKRR---SD 149

Query: 244 YFVNGKESNYTEVTTLLKKEGIDLDHKRFLILQGEVENIAQMKA 287
           Y +N  + + + V TL+ +  I LD+    + Q  VE  A++K+
Sbjct: 150 YLINDYQVSESVVKTLVAQLNIQLDNLCQFLSQERVEEFARLKS 193

>Kwal_26.7204 s26 complement(263266..266619) [3354 bp, 1117 aa] {ON}
           YOL034W - Protein required for cell viability [contig
           47] FULL
          Length = 1117

 Score = 45.8 bits (107), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 49/180 (27%), Positives = 80/180 (44%), Gaps = 23/180 (12%)

Query: 118 SKKLDVKKERLF------IHQLVLNDFKSYAGRQVIGPFH--TSFSAIVGPNGSGKSNVI 169
           SK+L   KE L       I +L L +F +Y+    +  FH   S + I+GPNGSGKS  +
Sbjct: 51  SKRLKFGKEDLSQFQPGSIVKLRLENFVTYS----LTEFHLSPSLNMIIGPNGSGKSTFV 106

Query: 170 DSMLFVFGFRANKM-RQDRLSDLIHKSETFPDLKSCSVEVHFKYVIDKDDGST-TIDETK 227
            ++      +   + R  R+   I   E         +EV  K    +D G T +     
Sbjct: 107 CAVCLGLAGKPEYIGRGKRVDSFIKNGEN-----RGLIEVTLK----RDPGRTGSFVAVD 157

Query: 228 GNLVVTRKAFKNNASKYFVNGKESNYTEVTTLLKKEGIDLDHKRFLILQGEVENIAQMKA 287
           G   V+R  +    S+Y++N +  +   V  L+ +  I LD+    + Q  VE  A++K+
Sbjct: 158 GTTKVSRVLWVGKKSEYYLNDEPVSELTVKNLMGELNIQLDNLCQFLSQERVEEFARLKS 217

 Score = 45.1 bits (105), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 41/168 (24%), Positives = 75/168 (44%), Gaps = 22/168 (13%)

Query: 1220 NDLNSAVQSRDSVKDRLEGIKRKRYDEFMEGFKIISMTLKEMYQMITLGGNAELELVDSL 1279
            NDL  A++   SV +          D  +EG   IS+    ++Q +  GG+  LE  +  
Sbjct: 937  NDLTIAIEKERSVLE-------PNVDGIVEG---ISINFSRLFQNVGSGGSVVLEKNELF 986

Query: 1280 DPFSEGVTFSVMPPKKSWRNISNL-SGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALD 1338
              +   +           +  S + SGGE+ +S++  + AL ++   P  ++DEI+  +D
Sbjct: 987  SNWKINIMVRFRDSALMKKLDSQIQSGGERAVSTVLYMIALQEFTSAPFRIVDEINQGMD 1046

Query: 1339 FRNVSIVANYIKERT---KNAQFIVISLRNNMFELTKQLVGIYKHENM 1383
             RN  IV   + E     K +Q+I+++         K L  ++ HE +
Sbjct: 1047 TRNERIVHKAMVENACAEKTSQYILVT--------PKLLTNLHYHEKV 1086

>Suva_15.133 Chr15 (232441..235719) [3279 bp, 1092 aa] {ON} YOL034W
            (REAL)
          Length = 1092

 Score = 45.1 bits (105), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 26/83 (31%), Positives = 42/83 (50%), Gaps = 11/83 (13%)

Query: 1304 SGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERT---KNAQFIV 1360
            SGGE+ +S++  + AL ++   P  V+DEI+  +D RN  IV   + E       +Q+ +
Sbjct: 987  SGGERAVSTVLYMIALQEFTSAPFRVVDEINQGMDSRNERIVHKAMVENACAENTSQYFL 1046

Query: 1361 ISLRNNMFELTKQLVGIYKHENM 1383
            I+         K L  +Y HE M
Sbjct: 1047 IT--------PKLLTDLYYHEKM 1061

 Score = 42.0 bits (97), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 50/212 (23%), Positives = 101/212 (47%), Gaps = 18/212 (8%)

Query: 130 IHQLVLNDFKSYAGRQV-IGPFHTSFSAIVGPNGSGKSNVIDSMLFVFGFRANKM-RQDR 187
           I ++ L DF +Y   +  + P   S + I+GPNGSGKS  + ++      +   + R  +
Sbjct: 42  IIKIRLQDFVTYTLTEFNLSP---SLNMIIGPNGSGKSTFVCAVCLGLAGKPEYIGRSKK 98

Query: 188 LSDLIHKSETFPDLKSCSVEVHFKYVIDKDDGSTTIDET-KGNLVVTRKAFKNNASKYFV 246
           + D I   +   D     + +     I   +   T DET K   ++TR   +   S Y +
Sbjct: 99  VEDFIKNGQ---DTSRIEITLKNSPKIHDIEFINTHDETIKVTRIITRSKRR---SDYLI 152

Query: 247 NGKESNYTEVTTLLKKEGIDLDHKRFLILQGEVENIAQMKA-----KAEKENDDGLLEYL 301
           N ++ +   V TL+ +  I LD+    + Q  VE  A++K+     +  +  D  LL+ L
Sbjct: 153 NDEQVSENVVKTLVAQLNIQLDNLCQFLSQERVEEFARLKSVKLLVETIRSIDASLLDVL 212

Query: 302 EDIIGTSKYKESIEKLSMEIESLNEICVEKEN 333
           ++++     ++S++K  ++++ L  + + +E+
Sbjct: 213 DELMELQANEQSLQK-DLDVKKLKVVHLRQES 243

>Kpol_1044.13 s1044 complement(23616..26927) [3312 bp, 1103 aa] {ON}
            complement(23616..26927) [3312 nt, 1104 aa]
          Length = 1103

 Score = 45.1 bits (105), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 25/83 (30%), Positives = 41/83 (49%), Gaps = 11/83 (13%)

Query: 1304 SGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERT---KNAQFIV 1360
            SGGEK +S+   + +L  +   P  V+DEI+  +D RN  I+   + E       +Q+I+
Sbjct: 995  SGGEKAVSTALYIISLQNFTKAPFRVVDEINQGMDSRNEKIIHRIMVENACEDNTSQYIL 1054

Query: 1361 ISLRNNMFELTKQLVGIYKHENM 1383
            ++         K L  +Y HE M
Sbjct: 1055 VT--------PKLLTDLYYHEKM 1069

 Score = 40.0 bits (92), Expect = 0.047,   Method: Compositional matrix adjust.
 Identities = 34/137 (24%), Positives = 65/137 (47%), Gaps = 8/137 (5%)

Query: 153 SFSAIVGPNGSGKSNVIDSMLFVFGFRAN-KMRQDRLSDLIHKSETFPDLKSCSVEVHFK 211
           SF+ I+GPNGSGKS V+ ++      + +   R D ++  I   +T     S  +E+  K
Sbjct: 72  SFNMIIGPNGSGKSTVVCALGLGLASKLDITGRGDIVTQYIQNGKT-----SGKIEITLK 126

Query: 212 YVIDKDDGSTTIDETKGNLVVTRK-AFKNNASKYFVNGKESNYTEVTTLLKKEGIDLDHK 270
           Y  D+      ++  +  + + R+ +     S Y +N    N  +V  ++ K  I LD+ 
Sbjct: 127 YS-DRIKNVKGVNPNRETVTIKREISIDAKKSNYKINNTVVNEKDVRDIVSKLNIQLDNL 185

Query: 271 RFLILQGEVENIAQMKA 287
              + Q  +++ A++K 
Sbjct: 186 CQYLPQERLKDFARLKG 202

>KAFR0D01330 Chr4 complement(263879..267121) [3243 bp, 1080 aa] {ON}
            Anc_7.101 YOL034W
          Length = 1080

 Score = 44.7 bits (104), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 26/83 (31%), Positives = 42/83 (50%), Gaps = 11/83 (13%)

Query: 1304 SGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERT---KNAQFIV 1360
            SGGE+ +S++  + AL ++   P  V+DEI+  +D RN  IV   + E       +Q+ +
Sbjct: 975  SGGERAVSTVLYMIALQEFTAAPFRVVDEINQGMDQRNERIVHRAMVENACAENTSQYFL 1034

Query: 1361 ISLRNNMFELTKQLVGIYKHENM 1383
            I+         K L  +Y HE M
Sbjct: 1035 IT--------PKLLTDLYYHEKM 1049

 Score = 37.7 bits (86), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 38/158 (24%), Positives = 70/158 (44%), Gaps = 21/158 (13%)

Query: 153 SFSAIVGPNGSGKSNVIDSMLFVFGFRANKM-RQDRLSDLIHKSETFPDLKSCSVEVHFK 211
           S + +VGPNGSGKS  + ++      +   + R  ++ + I   E      +  ++   +
Sbjct: 58  SLNMLVGPNGSGKSTFVCAVCLGLAGKPEYIGRSKKIDNFIKNGEN-----TAQIDTFLR 112

Query: 212 YVIDKDDGSTTIDETKGNLVVTRKAFKNNASKYFVNGKESNYTEVTTLLKKEGIDLDHKR 271
                  G    +  K   ++TR   K   S+Y+++   S  T V  L  +  I LD+  
Sbjct: 113 -------GHMPNEVIKITRIMTRNKKK---SEYYIDDSPSTETAVRKLASELNIQLDNLC 162

Query: 272 FLILQGEVENIAQMKA-----KAEKENDDGLLEYLEDI 304
             + Q  VE+ A++K+     +  +  +  LLE LED+
Sbjct: 163 QFLSQEHVEDFAKLKSDKLLIETIRSINPSLLETLEDL 200

>ZYRO0B12122g Chr2 (972611..975940) [3330 bp, 1109 aa] {ON} similar to
            uniprot|Q12749 Saccharomyces cerevisiae YLR383W RHC18
            Protein involved in structural maintenance of chromosomes
            required for interchromosomal and sister chromatid
            recombination
          Length = 1109

 Score = 44.7 bits (104), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 26/78 (33%), Positives = 40/78 (51%), Gaps = 3/78 (3%)

Query: 1288 FSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVAN 1347
            F + P  +  RN+  LSGGEK+ S +AL+ A  K   + +  +DE D  +D  N  I   
Sbjct: 997  FILTPNDEKARNVDTLSGGEKSFSQMALLLATWKPMRSRIIALDEFDVFMDQVNRQIGTK 1056

Query: 1348 YIKERTKN---AQFIVIS 1362
             I  + K+    Q I+I+
Sbjct: 1057 LILNKLKDIARTQTIIIT 1074

 Score = 40.4 bits (93), Expect = 0.036,   Method: Compositional matrix adjust.
 Identities = 32/119 (26%), Positives = 57/119 (47%), Gaps = 14/119 (11%)

Query: 129 FIHQLVLNDFKSYAGRQV-IGPFHTSFSAIVGPNGSGKSNVIDSMLFVFGFRA-NKMRQD 186
           +I ++VL +F  +   ++ +GP     + IVG NGSGKS ++ ++    G RA +  R +
Sbjct: 74  YIKKVVLWNFMCHEHFELELGP---RLNFIVGNNGSGKSAILTAITVGLGARAMDTNRGN 130

Query: 187 RLSDLIHKSETFPDLKSCSVEVHFKYVIDKDDGSTTIDETKGNLVVTRKAFKNNASKYF 245
            L DLI +        S  + +H    +D  +       T GN ++  +  KN+ +  F
Sbjct: 131 SLKDLIREG-----CHSTKIRLH----LDNLNHGAYYQGTFGNEIIIERVIKNDGTSSF 180

>NDAI0A08450 Chr1 (1947452..1950811) [3360 bp, 1119 aa] {ON} Anc_7.101
            YOL034W
          Length = 1119

 Score = 43.1 bits (100), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 25/83 (30%), Positives = 42/83 (50%), Gaps = 11/83 (13%)

Query: 1304 SGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERT---KNAQFIV 1360
            SGGE+ +S++  + AL ++   P  V+DEI+  +D RN  IV   + E       +Q+ +
Sbjct: 1014 SGGERAVSTVLYMIALQEFTAAPFRVVDEINQGMDSRNERIVHKAMVENACAENTSQYFL 1073

Query: 1361 ISLRNNMFELTKQLVGIYKHENM 1383
            I+         K L  ++ HE M
Sbjct: 1074 IT--------PKLLTDLHYHEKM 1088

 Score = 39.3 bits (90), Expect = 0.086,   Method: Compositional matrix adjust.
 Identities = 50/206 (24%), Positives = 87/206 (42%), Gaps = 35/206 (16%)

Query: 153 SFSAIVGPNGSGKSNVIDSMLFVFGFRANKM-RQDRLSDLIHKSETFPDLKSCSVEVHFK 211
           S + I+GPNGSGKS  + +       +   + R  R+ D I   E         +E+  K
Sbjct: 73  SLNMIIGPNGSGKSTFVCAACLGLAGKPEYIGRSKRVDDYIKNGED-----RSKIEIFLK 127

Query: 212 YV--IDK------------------DDGSTTIDETKGNLVVTRKAFKNNASKYFVNGKES 251
            V  +DK                  D     +D  K   ++ R   K   S Y++N K  
Sbjct: 128 NVESMDKLKNFNNNNNKNNNNGAQVDLKCGQLDLIKFTRIIHRDKKK---SDYYINDKPV 184

Query: 252 NYTEVTTLLKKEGIDLDHKRFLILQGEVENIAQMKA-----KAEKENDDGLLEYLEDIIG 306
           +   V  L+K   I LD+    + Q  VE  A++K+     +  +  D  LL+ LE++  
Sbjct: 185 SELTVKNLVKALSIQLDNLCQFLSQERVEEFARLKSDKLLVETVRSIDPNLLDILEELKV 244

Query: 307 TSKYKESIE-KLSMEIESLNEICVEK 331
               ++++E +L ++ +   E+C E+
Sbjct: 245 LQNEEQTVEDELEIKQKRYTELCNER 270

>Kwal_26.9380 s26 (1189521..1192829) [3309 bp, 1102 aa] {ON} YLR383W
            (RHC18) - involved in recombination repair [contig 72]
            FULL
          Length = 1102

 Score = 43.1 bits (100), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 67/313 (21%), Positives = 133/313 (42%), Gaps = 44/313 (14%)

Query: 1080 SIKRYNDLLSELTIRDVTQVLNTIM------TEENASVDKSDPKL----ENTSAVINADD 1129
            ++  YN  L E+  + +T++++ ++      TE +AS+  S+ ++    E+ S++ +  D
Sbjct: 768  ALTSYNLALDEVNDK-ITEIMHKVLPLKERSTEASASLQASEMEISGLRESISSMSSKLD 826

Query: 1130 DGISAVSENQS----FNHNDENDDIDSNKMEIDSQGGFINPGIPVLSASELAKVDPQEVE 1185
              ++ + ++++    + H  E   I  +  E   +G   N  I     S  A   PQ  E
Sbjct: 827  TYLADIEKHKTSITAYEHKTEELRISISDFEKGIKGQISNAEIYCPRESAFAPDMPQGKE 886

Query: 1186 LLITSLDDFIT-----------SSEANVDVLEEYALRFVEFNKRKNDLNSAV-QSRDSVK 1233
              +  L+   T           S +  V + E    ++ +  K+  D++ A+ Q  +S++
Sbjct: 887  DTVNELERITTRIQMAENRVGLSQDEAVALFENAKTKYRDAEKKYADVDRAIIQLNESLR 946

Query: 1234 DRLEGIKRKRYDEFMEGFKIISMTLKEMYQMITLGGNAELELVDSLDPFSEG-VTFSVMP 1292
             RL+ +   + D  +          KE  +     G    +       FS+G +T  V  
Sbjct: 947  KRLQSLNYAKTDTCVTA----DTDFKESLRFRNFSGGLNFD-------FSKGALTMLVKT 995

Query: 1293 PKKSW-RNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSI----VAN 1347
            P     RN+  LSGGEK+ S  +L+ A  +   + +  +DE D  +D  N  I    + N
Sbjct: 996  PNDDQPRNVDTLSGGEKSFSQTSLLLATWRPMRSRIIALDEFDVFMDQVNRQIGTKLIMN 1055

Query: 1348 YIKERTKNAQFIV 1360
             + + T+    I+
Sbjct: 1056 KLSKETRTQTIII 1068

>CAGL0H05071g Chr8 (486899..490231) [3333 bp, 1110 aa] {ON} similar to
            uniprot|Q12749 Saccharomyces cerevisiae YLR383w RHC18
          Length = 1110

 Score = 42.7 bits (99), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 24/76 (31%), Positives = 40/76 (52%), Gaps = 3/76 (3%)

Query: 1290 VMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYI 1349
            + P    +R +S  SGGEK+ S +AL+ A  +   + +  +DE D  +D  N  I +  I
Sbjct: 1007 LTPNDDRYREVSTFSGGEKSYSQMALLLATWRPMRSRIIALDEFDVFMDQVNRKIGSKLI 1066

Query: 1350 KERTK---NAQFIVIS 1362
             ++ K   N Q I+I+
Sbjct: 1067 VKKLKDIPNTQTIIIT 1082

 Score = 37.7 bits (86), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 23/66 (34%), Positives = 37/66 (56%), Gaps = 5/66 (7%)

Query: 129 FIHQLVLNDFKSYAGRQV-IGPFHTSFSAIVGPNGSGKSNVIDSMLFVFGFRANKM-RQD 186
           +I +L L++F  +    V +GP     + IVG NGSGKS ++ ++    G +A++  R  
Sbjct: 79  YIKKLTLHNFMCHRNFDVELGP---GLNFIVGKNGSGKSAILTAITIGLGAKASETNRGS 135

Query: 187 RLSDLI 192
            L DLI
Sbjct: 136 SLKDLI 141

>TBLA0E02190 Chr5 complement(534078..537347) [3270 bp, 1089 aa] {ON}
            Anc_7.101 YOL034W
          Length = 1089

 Score = 42.7 bits (99), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 24/83 (28%), Positives = 42/83 (50%), Gaps = 11/83 (13%)

Query: 1304 SGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERT---KNAQFIV 1360
            SGGE+ +S++  + AL ++   P  V+DEI+  +D RN  I+   + E       +Q+ +
Sbjct: 984  SGGERAVSTVLYMIALQEFTSAPFRVVDEINQGMDSRNERIIHKAMVENACAENTSQYFL 1043

Query: 1361 ISLRNNMFELTKQLVGIYKHENM 1383
            I+         K L  ++ HE M
Sbjct: 1044 IT--------PKLLTNLHYHEKM 1058

 Score = 35.8 bits (81), Expect = 0.95,   Method: Compositional matrix adjust.
 Identities = 91/373 (24%), Positives = 155/373 (41%), Gaps = 65/373 (17%)

Query: 130 IHQLVLNDFKSYA-GRQVIGPFHTSFSAIVGPNGSGKSNVIDSMLFVFGFRANKM-RQDR 187
           I ++ L +F +Y+     + P   S + I+GPNGSGKS  + ++      +   + R  +
Sbjct: 44  IIKIKLWNFVTYSLAEFTLSP---SLNMIIGPNGSGKSTFVCAVCLGLAGKPEYIGRSSK 100

Query: 188 LSDLIHKSETFPDLKSCSVEVHFKYVIDKDDGSTTIDETKGNLVVTRKAFKNNASKYFVN 247
           L D I   E         VEV  K V + D  + TI      L+ T         +Y +N
Sbjct: 101 LEDYIKNGE-----DQSVVEVTLKNVPESDFNTDTI------LIKTTINRGKKKPEYAIN 149

Query: 248 GKESNYTEVTTLLKKEGIDLDHKRFLILQGEVENIAQMKAKAEKENDDGLLEYLEDIIGT 307
           G     T +   +KK  I LD+    + Q  VE  A++K+       D LLE     I +
Sbjct: 150 GSTVTETYIRAFVKKLNIQLDNLCQFLSQERVEEFARLKS-------DKLLEETIRSIDS 202

Query: 308 SKYKESIEKL----SMEIESLNEICVEKENRFSIVEREKNSLESGKEEALQFXXXXXXXX 363
           S    S+EKL    + EI SL +    K  +   +  ++  LE G  +AL+         
Sbjct: 203 SMLT-SLEKLKTLQTTEI-SLQKDVDLKNKKLQELTAQREKLE-GAVKALK--------- 250

Query: 364 XXXXXXYQYNLMQXXXXXXXXXXXXTNVQQEQTKQED---EFRKAN----SHISDITASL 416
                  +Y  ++              ++  ++K +    +FR+A     S + D    +
Sbjct: 251 -------EYEHLKKEIEIHQLLLPYVKIKDHKSKVQSYIRDFREAKQKLKSFLQDKKPFI 303

Query: 417 NVLKADLEKVHTEEVNLSK-TKRTLENKKVENEQIVNNLDSKRKE----------FEEQS 465
              K  LEK   +   L + T  +L N++ +   I+N+L   ++E          +E ++
Sbjct: 304 KA-KNSLEKKQAKYQALKQDTNSSLINERKKLNSILNDLGKGKEEIIKRKKQIEYYENRT 362

Query: 466 KILQDKINSTDQE 478
           K LQ+ I ST++E
Sbjct: 363 KKLQESIRSTEKE 375

>NCAS0J01390 Chr10 (242118..245408) [3291 bp, 1096 aa] {ON} Anc_4.237
          Length = 1096

 Score = 42.4 bits (98), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 24/68 (35%), Positives = 37/68 (54%), Gaps = 3/68 (4%)

Query: 1298 RNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN-- 1355
            RN+  LSGGEK+ S LAL+ A  K   + +  +DE D  +D  N  I    + ++ K+  
Sbjct: 992  RNVDTLSGGEKSFSQLALLLATWKPMRSRIIALDEFDVFMDQVNRRIGTTLVVKKLKDLA 1051

Query: 1356 -AQFIVIS 1362
              Q I+I+
Sbjct: 1052 RTQTIIIT 1059

>NDAI0J02180 Chr10 (529566..532892) [3327 bp, 1108 aa] {ON} Anc_4.237
            YLR383W
          Length = 1108

 Score = 42.4 bits (98), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 44/173 (25%), Positives = 71/173 (41%), Gaps = 31/173 (17%)

Query: 1228 SRDSVKDRLEGIKRKRYDEFMEGFKIISMTLKEMYQMITLGGN------------AELEL 1275
            S D V D  E   R +Y +  + F  +   L+++   I +               A+L+ 
Sbjct: 915  SHDKVVDLFEK-SRDKYKDAEKKFGSVDRALRQLQHSIEVRSQNYTNIQNNTCLEADLDF 973

Query: 1276 VDSLD--PFSEGVTFSVMPPK----------KSWRNISNLSGGEKTLSSLALVFALHKYK 1323
              SL    F+  +TF +   K          +  RN+  LSGGEK+ S LAL+ A  K  
Sbjct: 974  RASLKVRKFTGNLTFQIAERKLDMLILTANDEKARNVDTLSGGEKSFSQLALLLATWKPM 1033

Query: 1324 PTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELTKQLVG 1376
             + +  +DE D  +D  N  I    + ++ K+       LR     +T Q +G
Sbjct: 1034 RSRIIALDEFDVFMDQVNRRIGTTLVVKKLKDL------LRTQTIIITPQDIG 1080

>TPHA0B00840 Chr2 complement(194812..198171) [3360 bp, 1119 aa] {ON}
            Anc_4.237 YLR383W
          Length = 1119

 Score = 42.4 bits (98), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 24/68 (35%), Positives = 37/68 (54%), Gaps = 3/68 (4%)

Query: 1298 RNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN-- 1355
            R I NLSGGEK+ + +AL+ A  K   + +  +DE D  +D  N  I    + ++ KN  
Sbjct: 1019 RTIDNLSGGEKSFAQMALLLATWKPMRSRIIALDEFDVFMDQVNRKIGTGLLVKKLKNQT 1078

Query: 1356 -AQFIVIS 1362
              Q I+I+
Sbjct: 1079 RTQTIIIT 1086

 Score = 33.1 bits (74), Expect = 6.2,   Method: Compositional matrix adjust.
 Identities = 21/65 (32%), Positives = 35/65 (53%), Gaps = 3/65 (4%)

Query: 129 FIHQLVLNDFKSYAGRQVIGPFHTSFSAIVGPNGSGKSNVIDSMLFVFGFRANKM-RQDR 187
           +I ++ L +F  +   ++   F    + IVG NGSGKS V+ ++    G +A+   R + 
Sbjct: 84  YIKKIKLRNFMCHENFEM--EFGPRLNFIVGNNGSGKSAVLTAITIGLGAKASDTNRGNS 141

Query: 188 LSDLI 192
           L DLI
Sbjct: 142 LKDLI 146

>Skud_12.468 Chr12 (825378..828740) [3363 bp, 1120 aa] {ON} YLR383W
            (REAL)
          Length = 1120

 Score = 42.0 bits (97), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 24/68 (35%), Positives = 37/68 (54%), Gaps = 3/68 (4%)

Query: 1298 RNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN-- 1355
            RN+  LSGGEK+ S +AL+ A  K   + +  +DE D  +D  N  I    I ++ K+  
Sbjct: 1020 RNVDTLSGGEKSFSQMALLLATWKPMRSRIIALDEFDVFMDQVNRKIGTTLIVKKLKDIA 1079

Query: 1356 -AQFIVIS 1362
              Q I+I+
Sbjct: 1080 RTQTIIIT 1087

 Score = 32.7 bits (73), Expect = 9.2,   Method: Compositional matrix adjust.
 Identities = 19/66 (28%), Positives = 36/66 (54%), Gaps = 3/66 (4%)

Query: 129 FIHQLVLNDFKSYAGRQVIGPFHTSFSAIVGPNGSGKSNVIDSMLFVFGFRANKM-RQDR 187
           +I +++L +F  +   ++     +  + IVG NGSGKS ++ ++    G +A++  R   
Sbjct: 87  YIKKVILRNFMCHEHFEL--ELGSRLNFIVGNNGSGKSAILTAITIGLGAKASETNRGSS 144

Query: 188 LSDLIH 193
           L DLI 
Sbjct: 145 LKDLIR 150

>Smik_12.470 Chr12 (824001..827345) [3345 bp, 1114 aa] {ON} YLR383W
            (REAL)
          Length = 1114

 Score = 42.0 bits (97), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 24/68 (35%), Positives = 37/68 (54%), Gaps = 3/68 (4%)

Query: 1298 RNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN-- 1355
            RN+  LSGGEK+ S +AL+ A  K   + +  +DE D  +D  N  I    I ++ K+  
Sbjct: 1014 RNVDTLSGGEKSFSQMALLLATWKPMRSRIIALDEFDVFMDQVNRKIGTTLIVKKLKDIA 1073

Query: 1356 -AQFIVIS 1362
              Q I+I+
Sbjct: 1074 RTQTIIIT 1081

 Score = 34.7 bits (78), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 30/127 (23%), Positives = 57/127 (44%), Gaps = 16/127 (12%)

Query: 129 FIHQLVLNDFKSYAGRQVIGPFHTSFSAIVGPNGSGKSNVIDSMLFVFGFRANKM-RQDR 187
           +I +++L +F  +   ++     +  + IVG NGSGKS ++ ++    G +A++  R   
Sbjct: 81  YIKKVILRNFMCHEHFEL--ELGSRLNFIVGNNGSGKSAILTAITIGLGAKASETNRGSS 138

Query: 188 LSDLIHKSETFPDLKSCSVEVHFKYVIDKDDGSTTIDETKGNLVVTRKAFKNNASKYFV- 246
           L DLI +        S  + +H    +D  +       T GN ++  +  K +    F  
Sbjct: 139 LKDLIREG-----CYSAKITLH----LDNSNYGAYQQGTFGNEIIVERIIKRDGPASFSL 189

Query: 247 ---NGKE 250
              NG+E
Sbjct: 190 KSENGRE 196

>Suva_10.500 Chr10 (850833..854180) [3348 bp, 1115 aa] {ON} YLR383W
            (REAL)
          Length = 1115

 Score = 42.0 bits (97), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 24/68 (35%), Positives = 37/68 (54%), Gaps = 3/68 (4%)

Query: 1298 RNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN-- 1355
            RN+  LSGGEK+ S +AL+ A  K   + +  +DE D  +D  N  I    I ++ K+  
Sbjct: 1015 RNVDTLSGGEKSFSQMALLLATWKPMRSRIIALDEFDVFMDQVNRKIGTTLIVKKLKDIA 1074

Query: 1356 -AQFIVIS 1362
              Q I+I+
Sbjct: 1075 RTQTIIIT 1082

 Score = 35.0 bits (79), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 31/127 (24%), Positives = 56/127 (44%), Gaps = 16/127 (12%)

Query: 129 FIHQLVLNDFKSYAGRQVIGPFHTSFSAIVGPNGSGKSNVIDSMLFVFGFRANKM-RQDR 187
           +I +++L +F  +   ++     +  + IVG NGSGKS ++ ++    G +A++  R   
Sbjct: 82  YIKKVILRNFMCHEHFEL--ELGSRLNFIVGNNGSGKSAILTAITIGLGAKASETNRGSS 139

Query: 188 LSDLIHKSETFPDLKSCSVEVHFKYVIDKDDGSTTIDETKGNLVVTRKAFKNNASKYFV- 246
           L DLI +        S  + +H    +D          T GN ++  +  K +    F  
Sbjct: 140 LKDLIREG-----CYSAKITLH----LDNSKYGAYQQGTFGNEIIVERTIKRDGPASFSL 190

Query: 247 ---NGKE 250
              NGKE
Sbjct: 191 KSENGKE 197

>YLR383W Chr12 (885288..888632) [3345 bp, 1114 aa] {ON}  SMC6Component
            of the SMC5-SMC6 complex; this complex plays a key role
            in the removal of X-shaped DNA structures that arise
            between sister chromatids during DNA replication and
            repair; homologous to S. pombe rad18
          Length = 1114

 Score = 42.0 bits (97), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 24/68 (35%), Positives = 37/68 (54%), Gaps = 3/68 (4%)

Query: 1298 RNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN-- 1355
            RN+  LSGGEK+ S +AL+ A  K   + +  +DE D  +D  N  I    I ++ K+  
Sbjct: 1014 RNVDTLSGGEKSFSQMALLLATWKPMRSRIIALDEFDVFMDQVNRKIGTTLIVKKLKDIA 1073

Query: 1356 -AQFIVIS 1362
              Q I+I+
Sbjct: 1074 RTQTIIIT 1081

 Score = 32.7 bits (73), Expect = 9.2,   Method: Compositional matrix adjust.
 Identities = 19/66 (28%), Positives = 36/66 (54%), Gaps = 3/66 (4%)

Query: 129 FIHQLVLNDFKSYAGRQVIGPFHTSFSAIVGPNGSGKSNVIDSMLFVFGFRANKM-RQDR 187
           +I +++L +F  +   ++     +  + IVG NGSGKS ++ ++    G +A++  R   
Sbjct: 81  YIKKVILRNFMCHEHFEL--ELGSRLNFIVGNNGSGKSAILTAITIGLGAKASETNRGSS 138

Query: 188 LSDLIH 193
           L DLI 
Sbjct: 139 LKDLIR 144

>AEL337C Chr5 complement(14613..17906) [3294 bp, 1097 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOL034W
           (SMC5)
          Length = 1097

 Score = 42.0 bits (97), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 41/159 (25%), Positives = 70/159 (44%), Gaps = 18/159 (11%)

Query: 135 LNDFKSYAGRQVIGPFHTS--FSAIVGPNGSGKSNVIDSMLFVFGFRANKM-RQDRLSDL 191
           L +F +Y+    +  FH S   + I+GPNGSGKS  + ++      +   + R  R+ D 
Sbjct: 51  LTNFVTYS----LAEFHMSPSLNMIIGPNGSGKSTFVCAICLGLAGKPEYIGRAKRVEDF 106

Query: 192 IHKSETFPDLKSCSVEVHFKYVIDKDDGSTTI---DETKGNLVVTRKAFKNNASKYFVNG 248
           I            ++E+  +   +   G   I   DE      V  KA +  A  Y++NG
Sbjct: 107 IKNGTA-----ESTIEIQLRNSRNVS-GLPMISAEDEAINVRTVLMKARRKCA--YYING 158

Query: 249 KESNYTEVTTLLKKEGIDLDHKRFLILQGEVENIAQMKA 287
           +  +  ++  L+    I LD+    + Q  VE  A++KA
Sbjct: 159 EPVSENQMRALVSMLNIQLDNLCQFLSQERVEEFARLKA 197

 Score = 39.7 bits (91), Expect = 0.061,   Method: Compositional matrix adjust.
 Identities = 39/154 (25%), Positives = 72/154 (46%), Gaps = 33/154 (21%)

Query: 1243 RYDEFMEGFKIISMTLKEMYQMITLGGNAELELVDSLDPFSEGVTFSVMPPKKSWRNISN 1302
            R DE +E    IS   ++++    +G   E+ L+   D +SE      +  +  +R+++ 
Sbjct: 933  RLDELVEN---ISQRFRKLFS--NVGSAGEICLLKP-DLYSEWK----IEIRVKFRDVAE 982

Query: 1303 L--------SGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFR-----NVSIVANYI 1349
            L        SGGE+ +S++  + AL  +   P  V+DEI+  +D R     + ++V N  
Sbjct: 983  LKKLDSHTQSGGERAVSTVLYMIALQHFTNAPFRVVDEINQGMDTRYERIVHKAMVENAC 1042

Query: 1350 KERTKNAQFIVISLRNNMFELTKQLVGIYKHENM 1383
             E T  +Q+ +I+         K L  ++ HE M
Sbjct: 1043 AENT--SQYFLIT--------PKLLTNLHYHERM 1066

>KNAG0B06010 Chr2 (1178430..1181783) [3354 bp, 1117 aa] {ON} Anc_4.237
            YLR383W
          Length = 1117

 Score = 41.6 bits (96), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 24/68 (35%), Positives = 37/68 (54%), Gaps = 3/68 (4%)

Query: 1298 RNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN-- 1355
            R++  LSGGEK+ S +AL+ A  K   + +  +DE D  +D  N  I    I ++ KN  
Sbjct: 1014 RDVDTLSGGEKSFSQMALLLATWKPMRSRIIALDEFDVFMDQVNRKIGTALIVKKLKNES 1073

Query: 1356 -AQFIVIS 1362
              Q I+I+
Sbjct: 1074 RTQTIIIT 1081

>CAGL0F01155g Chr6 complement(116762..120079) [3318 bp, 1105 aa] {ON}
            similar to uniprot|Q08204 Saccharomyces cerevisiae
            YOL034w SMC5
          Length = 1105

 Score = 41.2 bits (95), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 26/85 (30%), Positives = 44/85 (51%), Gaps = 15/85 (17%)

Query: 1304 SGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALD-----FRNVSIVANYIKERTKNAQF 1358
            SGGE+ +S++  + AL K+   P  V+DEI+  +D       + ++V N  +E T  +Q+
Sbjct: 1000 SGGERAVSTVLYMIALQKFTQAPFRVVDEINQGMDTNFERLVHKAMVQNACEEGT--SQY 1057

Query: 1359 IVISLRNNMFELTKQLVGIYKHENM 1383
             +I+         K L G+  HE M
Sbjct: 1058 FLIT--------PKLLTGLNYHEKM 1074

 Score = 33.9 bits (76), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 36/159 (22%), Positives = 63/159 (39%), Gaps = 34/159 (21%)

Query: 153 SFSAIVGPNGSGKSNVIDSMLFVFGFRANKM-RQDRLSDLIHKSETFPDLKSCSVEVHFK 211
           S + I+GPNGSGKS  + ++      +   + R  ++ D I   +    ++         
Sbjct: 59  SLNMIIGPNGSGKSTYVCAVCLGLAGKPEYIGRSKQVEDFIKNGQDTSKIE--------- 109

Query: 212 YVIDKDDGSTTID-------------ETKGNLVVTRKAFKNN----------ASKYFVNG 248
            ++ KDD +  I+               KG L +TR   K              +Y +NG
Sbjct: 110 -IVLKDDPNIDIEFLGSSFHRIRNNGNYKGLLTITRNLEKRTKIGRNLEKRRTQEYSING 168

Query: 249 KESNYTEVTTLLKKEGIDLDHKRFLILQGEVENIAQMKA 287
             +  + V  L+ K  I LD+    + Q  VE  A+++ 
Sbjct: 169 LPTTESNVRNLVSKFHIQLDNLCQFLSQERVEEFAKLRP 207

>KLLA0E05303g Chr5 complement(472583..475879) [3297 bp, 1098 aa] {ON}
            similar to uniprot|Q12749 Saccharomyces cerevisiae
            YLR383W RHC18 Protein involved in structural maintenance
            of chromosomes required for interchromosomal and sister
            chromatid recombination
          Length = 1098

 Score = 40.0 bits (92), Expect = 0.045,   Method: Compositional matrix adjust.
 Identities = 28/92 (30%), Positives = 46/92 (50%), Gaps = 7/92 (7%)

Query: 1298 RNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYI-----KER 1352
            RN+  LSGGEK+ S +AL+ A      + +  +DE D  +D  N  I  N I     K+ 
Sbjct: 997  RNVDTLSGGEKSFSQIALLLATWLTMRSRIIALDEFDVFMDQVNRKIGTNLIIRRLGKDV 1056

Query: 1353 TKNAQFIVISLRN--NMFELTKQLVGIYKHEN 1382
              + Q I+I+ ++   M  +  +   I+K +N
Sbjct: 1057 KSDTQTIIITPQDIGKMANIDDKYFNIHKMKN 1088

>TBLA0I02890 Chr9 (683688..686984) [3297 bp, 1098 aa] {ON} Anc_4.237
            YLR383W
          Length = 1098

 Score = 40.0 bits (92), Expect = 0.057,   Method: Compositional matrix adjust.
 Identities = 24/71 (33%), Positives = 37/71 (52%), Gaps = 3/71 (4%)

Query: 1295 KSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTK 1354
            K  RN+  LSGGEK+ S +AL+ A  K   + +  +DE D  +D  N       I ++ K
Sbjct: 995  KEPRNVDTLSGGEKSFSQIALLLATWKPMRSRIIALDEYDVFMDQVNRKTSTQLIVQKLK 1054

Query: 1355 N---AQFIVIS 1362
            +    Q I+I+
Sbjct: 1055 DDSRTQTIIIT 1065

>TBLA0A05300 Chr1 (1297764..1299887) [2124 bp, 707 aa] {ON} Anc_1.67
            YLR188W
          Length = 707

 Score = 39.3 bits (90), Expect = 0.092,   Method: Compositional matrix adjust.
 Identities = 28/63 (44%), Positives = 38/63 (60%), Gaps = 5/63 (7%)

Query: 1301 SNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIV 1360
            + LSGG+K   +LA  F L   +PT L V+DE  +ALD R+ SIVA  +K+R     F  
Sbjct: 600  TQLSGGQKQRVALARAFLL---EPT-LLVLDEATSALDPRSESIVAQTLKQRCAKG-FTT 654

Query: 1361 ISL 1363
            IS+
Sbjct: 655  ISI 657

>ZYRO0F16038g Chr6 complement(1315669..1319583) [3915 bp, 1304 aa]
           {ON} similar to uniprot|P12753 Saccharomyces cerevisiae
           YNL250W RAD50 Subunit of MRX complex with Mre11p and
           Xrs2p involved in processing double-strand DNA breaks in
           vegetative cells initiation of meiotic DSBs telomere
           maintenance and nonhomologous end joining
          Length = 1304

 Score = 38.1 bits (87), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 44/159 (27%), Positives = 80/159 (50%), Gaps = 8/159 (5%)

Query: 518 TEHLTIQIAEYEKELSPWNEQSQQLKKEIKITESELSIIEENRKGLENDIAGLENAILSQ 577
           +E    Q+ E EK+L    EQS +L K  +  +  LS +E  +   ++ +  ++   LS 
Sbjct: 233 SEEYQAQVKEVEKQLKDITEQSDKLFKSNQDFQKVLSKLESLKNSQQSKLEQIDR--LSN 290

Query: 578 KRD-LEVQEQEIKSLLEQKTKVIQERE----LGERECKNAQATLANVREKVEALRQKAIE 632
             D +++ ++E+++LL   +  + E+E      E+  + ++A  A ++ K  +L Q+  E
Sbjct: 291 SIDPIDLGKEELENLLSNFSSSLTEKEEELRSMEKSLRESKAKAAGIQNKCNSLMQRQGE 350

Query: 633 IRSTYSATENNNKVLSALLR-LQKSGRLNGFHGRLGDLA 670
           + ++    E N  VL  L R LQ S  L+GF   L D A
Sbjct: 351 LSASKENHERNKSVLRELQRELQTSYALSGFTENLDDFA 389

>Kpol_483.10 s483 (21646..25002) [3357 bp, 1118 aa] {ON}
           (21646..25002) [3357 nt, 1119 aa]
          Length = 1118

 Score = 38.1 bits (87), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 31/118 (26%), Positives = 54/118 (45%), Gaps = 23/118 (19%)

Query: 129 FIHQLVLNDFKSYAGRQV-IGPFHTSFSAIVGPNGSGKSNVIDSMLFVFGFRANKM-RQD 186
           +I +++L +F  +    V + P   + + IVG NGSGKS ++ +++   G +A++  R  
Sbjct: 72  YIRKVILRNFMCHENFSVELTP---NLNFIVGNNGSGKSAILTAIIVALGVKASETSRGS 128

Query: 187 RLSDLIHKSETFPDLKSCSVEVHFKYVIDKDDGSTTIDETKGNLVVTRKAFKNNASKY 244
            L +LI K        S  V +H             +D  KG+L +  K F     +Y
Sbjct: 129 SLKELIRKG-----CNSSKVTLH-------------LDNNKGDLDINGKDFAYKHDQY 168

 Score = 38.1 bits (87), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 28/47 (59%)

Query: 1298 RNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSI 1344
            R++  LSGGEK+ S +AL+ A  K   + +  +DE D  +D  N ++
Sbjct: 1018 RSVDTLSGGEKSFSQMALLLATWKPMKSRIIALDEFDVFMDQVNRTV 1064

>SAKL0H03322g Chr8 complement(314365..317700) [3336 bp, 1111 aa] {ON}
            similar to uniprot|Q12749 Saccharomyces cerevisiae
            YLR383W RHC18 Protein involved in structural maintenance
            of chromosomes required for interchromosomal and sister
            chromatid recombination
          Length = 1111

 Score = 38.1 bits (87), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 29/52 (55%)

Query: 1298 RNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYI 1349
            RN+  LSGGEK+ S ++L+ A  +   + +  +DE D  +D  N +I    I
Sbjct: 1010 RNVDTLSGGEKSFSQISLLLATWRPMRSRIIALDEFDVFMDQVNRTIGTKLI 1061

>KAFR0A06040 Chr1 complement(1222239..1225547) [3309 bp, 1102 aa] {ON}
            Anc_4.237 YLR383W
          Length = 1102

 Score = 37.0 bits (84), Expect = 0.51,   Method: Compositional matrix adjust.
 Identities = 22/68 (32%), Positives = 35/68 (51%), Gaps = 3/68 (4%)

Query: 1298 RNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN-- 1355
            R++  LSGGEK+ S +AL+ A      + +  +DE D  +D  N  I    I +  K+  
Sbjct: 1002 RDVDTLSGGEKSFSQMALLLATWAPMRSRITALDEFDVFMDQVNRKIGTGLIVKTLKDNA 1061

Query: 1356 -AQFIVIS 1362
              Q I+I+
Sbjct: 1062 RTQTIIIT 1069

>KLTH0D14080g Chr4 (1149555..1152863) [3309 bp, 1102 aa] {ON} similar
            to uniprot|Q12749 Saccharomyces cerevisiae YLR383W RHC18
            Protein involved in structural maintenance of chromosomes
            required for interchromosomal and sister chromatid
            recombination
          Length = 1102

 Score = 36.6 bits (83), Expect = 0.53,   Method: Compositional matrix adjust.
 Identities = 29/110 (26%), Positives = 48/110 (43%), Gaps = 17/110 (15%)

Query: 1257 TLKEMYQMITLGGN-----AELELVDSLD--PFSEGVTFSV----------MPPKKSWRN 1299
            +LK  +Q +T         A+ +  +SL    FS G+ F+            P  +  RN
Sbjct: 944  SLKRRWQSLTYAKTDTCVTADTDFKESLRFRNFSGGLNFNFSKETLNMLVKTPNDEKPRN 1003

Query: 1300 ISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYI 1349
            +   SGGEK+ S ++L+ A  +   + +  +DE D  +D  N  I    I
Sbjct: 1004 VDTFSGGEKSFSQISLLLATWRPMRSRIIALDEFDVFMDQVNRQIGTKLI 1053

>TDEL0G02810 Chr7 (540540..543824) [3285 bp, 1094 aa] {ON} Anc_2.351
            YDL102W
          Length = 1094

 Score = 36.6 bits (83), Expect = 0.55,   Method: Compositional matrix adjust.
 Identities = 24/71 (33%), Positives = 37/71 (52%), Gaps = 9/71 (12%)

Query: 1326 PLYVMD---EIDAALDFRN------VSIVANYIKERTKNAQFIVISLRNNMFELTKQLVG 1376
            PLYV++   +ID+     N      +SI+A  I E+  NA F+V S++ N  E+   L+G
Sbjct: 939  PLYVLEHNIQIDSRYYLTNQLQNPLISIIAPIIGEKQANAMFVVKSIKINTGEMKGGLMG 998

Query: 1377 IYKHENMTKSA 1387
              K  +  KS 
Sbjct: 999  FIKKVDSCKSC 1009

>Ecym_2625 Chr2 (1208550..1211843) [3294 bp, 1097 aa] {ON} similar
           to Ashbya gossypii AEL337
          Length = 1097

 Score = 36.6 bits (83), Expect = 0.66,   Method: Compositional matrix adjust.
 Identities = 46/164 (28%), Positives = 77/164 (46%), Gaps = 18/164 (10%)

Query: 130 IHQLVLNDFKSYAGRQVIGPFH--TSFSAIVGPNGSGKSNVIDSMLFVFGFRANKM-RQD 186
           I +L L +F +Y+    +  FH   S + I+GPNGSGKS+ + ++      +   + R  
Sbjct: 46  IIKLRLVNFVTYS----LTEFHLSPSLNMIIGPNGSGKSSFVCAICLGLAGKPEYIGRAK 101

Query: 187 RLSDLIHKSETFPDLKSCSVEVHFKYVIDKDDGSTTI---DETKGNLVVTRKAFKNNASK 243
           ++ D I K+ T   +   +V+ + K V     G + I   DE      V  KA K     
Sbjct: 102 KVEDFI-KNGTEESVIELTVK-NSKAV----SGYSMIGGSDEVINIKTVIMKAKKKCI-- 153

Query: 244 YFVNGKESNYTEVTTLLKKEGIDLDHKRFLILQGEVENIAQMKA 287
           Y++NG+     +V  L+    I LD+    + Q  VE  A++K+
Sbjct: 154 YYINGQSVGENQVKALVCLLNIQLDNLCQFLSQERVEEFARLKS 197

 Score = 35.4 bits (80), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 89/421 (21%), Positives = 183/421 (43%), Gaps = 73/421 (17%)

Query: 1002 KNAENADIESKEIESKLLDIKESIENLKENEVKLEHEIEMKH----NELESHQKVVSDYK 1057
            KN E      K+  S L DI++ +++L+     L H+  M H    +E+E+ +  + +++
Sbjct: 680  KNIEELIEGKKKYNSPLADIRQKLKDLQHEMHDLNHK-RMIHSRTTSEIENIKHKLEEFR 738

Query: 1058 SISLEYNNKL-EKLEASEASLKKSIKRYNDLLSELT-----IRDVTQVLNTIMTEENASV 1111
                + N  + E +   E+ +++S+   + LL+++      I+DV + + TI+  +    
Sbjct: 739  R---DMNKDVSEAIATCESQIQQSVDAQSKLLAQMVKNLKDIQDVQKEI-TILAIKYIEA 794

Query: 1112 DKSDPKLENTSAVINADDDGISAVSENQSFNHNDENDDIDSNKMEIDSQGGFINPGIPVL 1171
               +  L +     N  ++ +         N+    D+  S    +     F N    + 
Sbjct: 795  RNRERSLNDIIGFFNDKEEELRG-------NY----DEAKSAYASVKDTTEFKNWMKEIR 843

Query: 1172 SA--------SELAKVDPQEVELLITSLDDFITSSEANVDVL--EEYALRFV-----EFN 1216
            S         SE A     E    +T++ + I   E  + ++  +E A++ +     +  
Sbjct: 844  SYTDDERTELSEWANKYEDESSFTLTTVLETIAKLETEIQIINHDESAIKILKQTLSDIK 903

Query: 1217 KRKNDLNSAVQSRDSVKDRLEGIKRK---RYDEFMEGFKIISMTLKEMYQMITLGGNAEL 1273
              +  L   V+   S++ ++  I+ +   R DE +E    IS   ++++  + +G   E+
Sbjct: 904  YLQEKLPGQVKRLSSIRRKMWSIRSELEPRLDEIVEN---ISTRFRKLF--LNVGSAGEV 958

Query: 1274 ELVDSLDPFSEGVTFSVMPPKKSWRNISNL--------SGGEKTLSSLALVFALHKYKPT 1325
             LV   D +SE      +  K  +R+++ L        SGGE+ +S++  + +L ++   
Sbjct: 959  CLVKP-DLYSEW----KIEIKVKFRDVAELKKLDSHIQSGGERAVSTVLYMISLQEFTNA 1013

Query: 1326 PLYVMDEIDAALDFRNVSIVANYIKER--TKN-AQFIVISLRNNMFELTKQLVGIYKHEN 1382
            P  V+DEI+  +D RN  IV   + E    KN +Q+ +I+         K L  ++ HE 
Sbjct: 1014 PFRVVDEINQGMDARNERIVHKAMVENACAKNTSQYFLIT--------PKLLTDLHYHER 1065

Query: 1383 M 1383
            M
Sbjct: 1066 M 1066

>NCAS0B08700 Chr2 (1674262..1676409) [2148 bp, 715 aa] {ON} Anc_1.67
          Length = 715

 Score = 35.4 bits (80), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 28/72 (38%), Positives = 37/72 (51%), Gaps = 10/72 (13%)

Query: 1282 FSEGVTFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRN 1341
            F EGV   V P     R  + LSGG+K   +LA  F LH      L ++DE  +ALD ++
Sbjct: 572  FPEGVNTLVGP-----RG-TQLSGGQKQRIALARAFLLHP----ALLILDEATSALDSQS 621

Query: 1342 VSIVANYIKERT 1353
              IVA  + ER 
Sbjct: 622  EEIVAKNLSERV 633

>AER044W Chr5 (714355..717666) [3312 bp, 1103 aa] {ON} Syntenic
            homolog of Saccharomyces cerevisiae YLR383W (RHC18)
          Length = 1103

 Score = 35.0 bits (79), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 17/52 (32%), Positives = 26/52 (50%)

Query: 1298 RNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYI 1349
            RN+  LSGGEK+ S + L+ +        +  +DE D  +D  N +I    I
Sbjct: 1002 RNVDTLSGGEKSFSQITLLLSTWSTMRARIIALDEFDVFMDQVNRTIGTRMI 1053

 Score = 32.7 bits (73), Expect = 8.9,   Method: Compositional matrix adjust.
 Identities = 34/135 (25%), Positives = 68/135 (50%), Gaps = 24/135 (17%)

Query: 523 IQIAEYEKELSPWNEQSQQLKKEIKITESELSIIEENRKGLENDIAGLENAILSQKRDLE 582
           I+  E E+EL  + E+ + LK+E              R+ +E +IA LE ++ + ++ ++
Sbjct: 358 IKFEEAEQELGQFREKHEVLKEE--------------RRKVEREIASLEVSLKAHRQQVK 403

Query: 583 VQEQEI-KSLLEQKTKVIQERELGERECKNAQATLANVREKVEALRQKAIEIRSTYSATE 641
             EQE+ ++L   K +++ E+   + E K  +  L ++ +K +  R + +E    YS   
Sbjct: 404 QLEQELAEALGGSKEQMVTEKRQVDEEIKTLKGNLPSLEDKFQQCRDRELE----YSHQR 459

Query: 642 NNNKVLSALLRLQKS 656
           N     +A+ +LQ S
Sbjct: 460 N-----TAIQQLQTS 469

>Ecym_5344 Chr5 (696147..699455) [3309 bp, 1102 aa] {ON} similar to
            Ashbya gossypii AER044W
          Length = 1102

 Score = 35.0 bits (79), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 20/68 (29%), Positives = 34/68 (50%), Gaps = 3/68 (4%)

Query: 1298 RNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN-- 1355
            RN+  LSGGEK+ S + L+ +        +  +DE D  +D  N +I    I ++  +  
Sbjct: 1001 RNVDTLSGGEKSFSQITLLLSTWSTMRARVIALDEFDVFMDQVNRTIGTKMIMKKLSSNI 1060

Query: 1356 -AQFIVIS 1362
              Q I+I+
Sbjct: 1061 RTQTIIIT 1068

>TPHA0H01420 Chr8 complement(318539..320650) [2112 bp, 703 aa] {ON}
           Anc_5.696 YIL144W
          Length = 703

 Score = 34.3 bits (77), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 28/100 (28%), Positives = 47/100 (47%)

Query: 394 EQTKQEDEFRKANSHISDITASLNVLKADLEKVHTEEVNLSKTKRTLENKKVENEQIVNN 453
           E+  +ED+ R  +  IS I   L      ++ +  + +   K  + L+ KK E  + V++
Sbjct: 405 EKALREDDIRDISEEISSIKKFLKDKNISIDVISNKNLEFEKLSKDLDQKKDEVNKFVSS 464

Query: 454 LDSKRKEFEEQSKILQDKINSTDQEIQTIIEEQSSLAEGT 493
             S + EFE   K L D +   D   +T+I E+ SL   T
Sbjct: 465 TQSLKIEFESIMKALNDTLRQYDLSTETLINERISLGHST 504

>TPHA0O01930 Chr15 (382854..386099) [3246 bp, 1081 aa] {ON} Anc_2.16
           YNL225C
          Length = 1081

 Score = 34.3 bits (77), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 34/110 (30%), Positives = 60/110 (54%), Gaps = 12/110 (10%)

Query: 542 LKKEIKITESELSIIEENRKGLENDIAGLENAILSQKRDLEVQEQEIKSLLEQKTKVIQE 601
           L+ E+ I + +LS  E + K L+NDI  LE+      R+L   E ++K+L          
Sbjct: 245 LQDEVNILKDKLSYFEADNKILKNDIYSLESNYDELHRELNEWETKVKTL---------N 295

Query: 602 RELGERECKNAQ--ATLANVREKVEAL-RQKAIEIRSTYSATENNNKVLS 648
           +++   +  NAQ  AT A + E+ EAL ++K I + +  S T++NN +++
Sbjct: 296 KDIQYLQGTNAQLSATNATLSEEKEALTKEKEILLNNNDSVTKSNNNLIA 345

>KLTH0C09966g Chr3 (823260..825542) [2283 bp, 760 aa] {ON} conserved
            hypothetical protein
          Length = 760

 Score = 33.9 bits (76), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 21/67 (31%), Positives = 34/67 (50%), Gaps = 2/67 (2%)

Query: 1137 ENQSFNHNDENDDIDSNKMEIDSQGGFINPGIPVLSASELAKVDPQEVELLITSLDDFIT 1196
            E     H DEN+D++S+    D Q    +  +P+   S + K+   E+++  TSL+ F T
Sbjct: 153  ERHGSEHVDENNDVESDAFASDKQAICTDATVPLRHGSNIEKL--SELQIENTSLEIFET 210

Query: 1197 SSEANVD 1203
              E N D
Sbjct: 211  DREGNPD 217

>ZYRO0F17050g Chr6 complement(1417445..1419589) [2145 bp, 714 aa] {ON}
            similar to uniprot|P33310 Saccharomyces cerevisiae
            YLR188W MDL1 Half-type ATP-binding cassette (ABC)
            transporter of the inner mitochondrial membrane mediates
            export of peptides generated upon proteolysis of
            mitochondrial proteins plays a role in the regulation of
            cellular resistance to oxidative stress
          Length = 714

 Score = 33.1 bits (74), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 31/56 (55%), Gaps = 4/56 (7%)

Query: 1301 SNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNA 1356
            + LSGG+K   +LA  F L       L V+DE  +ALD ++  IVA  ++ER +  
Sbjct: 588  AQLSGGQKQRVALARAFLLDP----ALLVLDEATSALDSQSEEIVARTLQERVRRG 639

>Kwal_33.15561 s33 (1157299..1161192) [3894 bp, 1297 aa] {ON} YKL209C
            (STE6) - ABC transporter, glycoprotein, component of
            a-factor secretory pathway [contig 290] FULL
          Length = 1297

 Score = 32.7 bits (73), Expect = 8.5,   Method: Compositional matrix adjust.
 Identities = 25/79 (31%), Positives = 43/79 (54%), Gaps = 4/79 (5%)

Query: 1303 LSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVIS 1362
            LSGG+  +  LA+V AL + KP  L V+DE  +ALD R+  I++ ++K    +   +V++
Sbjct: 1197 LSGGQ--VQRLAIVRALLR-KPQ-LLVLDECTSALDARHSFIMSEFVKHHLYHTTTLVVT 1252

Query: 1363 LRNNMFELTKQLVGIYKHE 1381
                M     +++   K E
Sbjct: 1253 HSEQMMRSCHRILTFNKGE 1271

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.310    0.129    0.340 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 135,656,729
Number of extensions: 6044633
Number of successful extensions: 43372
Number of sequences better than 10.0: 1324
Number of HSP's gapped: 42627
Number of HSP's successfully gapped: 2936
Length of query: 1398
Length of database: 53,481,399
Length adjustment: 122
Effective length of query: 1276
Effective length of database: 39,492,147
Effective search space: 50391979572
Effective search space used: 50391979572
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.7 bits)
S2: 72 (32.3 bits)