Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
CAGL0L12166g8.258ON42142122710.0
YLR085C (ARP6)8.258ON43843515380.0
Suva_10.1698.258ON43843315050.0
Skud_12.1538.258ON43843315050.0
Smik_12.1448.258ON43843314960.0
NCAS0B049908.258ON42041714940.0
ZYRO0C01738g8.258ON41441614770.0
KAFR0B027008.258ON42042414750.0
Kpol_543.368.258ON42742214740.0
TDEL0F038508.258ON41941914700.0
TBLA0H014608.258ON44244014530.0
KLTH0G13772g8.258ON42041614450.0
SAKL0H17138g8.258ON41942114450.0
NDAI0B019608.258ON43943414430.0
Kwal_56.238328.258ON41941914110.0
KNAG0G020108.258ON42442214020.0
Ecym_43128.258ON41141513900.0
TPHA0A018308.258ON42142713730.0
KLLA0F19063g8.258ON41542413570.0
AGR091W8.258ON41041513530.0
NCAS0C037008.23ON3754173097e-31
TBLA0C004408.23ON3754173089e-31
SAKL0B00968g8.23ON3754173071e-30
TPHA0D002508.23ON3754173062e-30
TDEL0C004708.23ON3754173062e-30
CAGL0K12694g8.23ON3754173062e-30
Suva_6.188.23ON3754173062e-30
Smik_6.398.23ON3754173062e-30
YFL039C (ACT1)8.23ON3754173062e-30
NDAI0G030408.23ON3754173052e-30
KNAG0L002508.23ON3754173052e-30
KAFR0D009408.23ON3754173052e-30
ABR222W8.23ON3764173052e-30
ZYRO0F02772g8.23ON3754173043e-30
KLLA0D05357g8.23ON3754173043e-30
Kpol_1058.158.23ON3754173026e-30
KLTH0G18832g8.23ON3754173026e-30
Ecym_15208.23ON3764172973e-29
KLLA0E22925g2.117ON3804182922e-28
SAKL0E11814g2.117ON3794182808e-27
Skud_6.318.23ON3603872762e-26
Kwal_14.11098.23ON3603872735e-26
Ecym_63852.117ON3774182729e-26
ZYRO0G05676g2.117ON3814162641e-24
AFR051W2.117ON4054212614e-24
TDEL0B048102.117ON3734162453e-22
TPHA0I013002.117ON3794202428e-22
Kpol_1023.188.23ON3193322372e-21
NDAI0B044602.117ON3814212384e-21
Smik_8.2102.117ON3844132332e-20
Skud_8.1902.117ON3844132313e-20
KLTH0B05940g2.117ON3834242243e-19
Suva_15.3262.117ON3844162215e-19
YHR129C (ARP1)2.117ON3844132153e-18
KNAG0H036502.117ON3874162129e-18
NCAS0B071302.117ON3814202102e-17
ZYRO0B04928g3.161ON3913902083e-17
KLTH0F06490g3.161ON3913712065e-17
Kwal_33.146422.117ON3834192049e-17
SAKL0C07370g3.161ON3913902022e-16
Suva_4.2203.161ON3913732022e-16
TBLA0F008703.161ON3913872003e-16
TBLA0B010702.117ON3834211994e-16
Smik_4.2063.161ON3913731969e-16
KAFR0F005902.117ON3864101969e-16
NDAI0G029003.161ON3913731951e-15
NCAS0C035503.161ON3923711942e-15
CAGL0K01595g3.161ON3913771933e-15
Skud_4.2223.161ON3913731923e-15
TDEL0D046103.161ON3913711923e-15
Kwal_33.141773.161ON3373001913e-15
ADR316W3.161ON3913711914e-15
KNAG0K01130na 1ON3933731915e-15
TDEL0C041402.248ON7491601935e-15
YDL029W (ARP2)3.161ON3913731906e-15
KLLA0C03850g3.161ON3913731889e-15
Ecym_52373.161ON3913651881e-14
Kpol_479.253.161ON3913731853e-14
SAKL0E08602g2.248ON7471571873e-14
NCAS0A122701.514ON4543731773e-13
Ecym_31531.514ON4583781764e-13
KAFR0C01040na 1ON3373001745e-13
SAKL0D12804g1.514ON4563731756e-13
TPHA0A009203.161ON3913711739e-13
KLLA0B13904g1.514ON4563801739e-13
Ecym_32852.248ON7461451732e-12
NDAI0A039701.514ON4623741702e-12
KNAG0I018602.248ON7531391722e-12
AFR419C1.514ON4552551702e-12
TPHA0O010401.514ON4583731702e-12
Kpol_1003.162.248ON7491551713e-12
TBLA0E038602.248ON7591571704e-12
CAGL0F00517g1.514ON4542511675e-12
YJR065C (ARP3)1.514ON4493731675e-12
Smik_10.3551.514ON4493731676e-12
TPHA0C031602.248ON7551561679e-12
Kwal_23.48482.248ON7451391679e-12
Skud_14.2722.248ON7551571661e-11
NDAI0D010602.248ON7531381661e-11
Skud_10.2891.514ON4493731641e-11
KAFR0D037001.514ON4493731632e-11
Suva_12.1541.514ON4493731632e-11
KNAG0B001701.514ON4533751622e-11
Kpol_1056.161.514ON4603721622e-11
ADL253C2.248ON7511351632e-11
ZYRO0A01584g2.248ON7481351632e-11
ZYRO0G01936g1.514ON4613871622e-11
TBLA0D036801.514ON4583741613e-11
KAFR0J011602.248ON7511561624e-11
YNL059C (ARP5)2.248ON7551561614e-11
CAGL0H09042g2.117ON3873701594e-11
Suva_14.2812.248ON7551561615e-11
TDEL0F004701.514ON4613691571e-10
Smik_14.2672.248ON7551561571e-10
KLTH0G09482g2.248ON7451581562e-10
CAGL0J10054g2.248ON7541601525e-10
KLTH0C02508g1.514ON4513731508e-10
KLLA0F03421g2.248ON7471441501e-09
Kwal_27.99581.514ON4453781472e-09
Kpol_282.41.287ON5011091401e-08
NCAS0G030502.248ON7431241349e-08
Ecym_63301.287ON4801071302e-07
AFR105C1.287ON4791071302e-07
Suva_6.1541.287ON4892191275e-07
KLLA0D02288g1.287ON5201071276e-07
TPHA0I010301.287ON5031131267e-07
Kwal_14.23771.287ON4812211241e-06
Skud_10.1321.287ON4882191222e-06
KAFR0A015601.287ON4851681222e-06
Smik_10.1611.287ON4892191222e-06
TDEL0D015501.287ON4801071195e-06
SAKL0D05874g1.287ON4971071195e-06
YJL081C (ARP4)1.287ON4892181179e-06
TBLA0D053601.287ON5961441179e-06
ZYRO0G21428g1.287ON4831071152e-05
KLTH0H09702g1.287ON4811081132e-05
CAGL0M03201g1.287ON4932331124e-05
NCAS0B060601.287ON4971051114e-05
NDAI0G055801.287ON5152281106e-05
ACR184C7.448ON4012671106e-05
KNAG0B019201.287ON5052381071e-04
TDEL0C031207.448ON438274860.054
SAKL0F13772g7.448ON422300810.20
KLTH0C05324g7.448ON399262770.61
Kpol_520.117.448ON488162770.67
TDEL0A044005.575ON43288722.1
Ecym_35058.251ON30545722.2
KAFR0K021507.448ON49080722.3
AGR099C8.251ON305110712.5
Smik_4.6875.519ON84866723.0
Kwal_27.105527.448ON35185703.5
CAGL0K05335g7.448ON52992704.1
KNAG0B021107.448ON48580704.4
TBLA0H028002.593ON48458686.6
NCAS0H030602.593ON47261686.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0L12166g
         (421 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0L12166g Chr12 complement(1308681..1309946) [1266 bp, 421 aa...   879   0.0  
YLR085C Chr12 complement(300673..301989) [1317 bp, 438 aa] {ON} ...   597   0.0  
Suva_10.169 Chr10 complement(305734..307050) [1317 bp, 438 aa] {...   584   0.0  
Skud_12.153 Chr12 complement(284046..285362) [1317 bp, 438 aa] {...   584   0.0  
Smik_12.144 Chr12 complement(280513..281829) [1317 bp, 438 aa] {...   580   0.0  
NCAS0B04990 Chr2 complement(916170..917432) [1263 bp, 420 aa] {O...   580   0.0  
ZYRO0C01738g Chr3 (135066..136310) [1245 bp, 414 aa] {ON} simila...   573   0.0  
KAFR0B02700 Chr2 complement(543626..544888) [1263 bp, 420 aa] {O...   572   0.0  
Kpol_543.36 s543 complement(80922..82205) [1284 bp, 427 aa] {ON}...   572   0.0  
TDEL0F03850 Chr6 complement(707880..709139) [1260 bp, 419 aa] {O...   570   0.0  
TBLA0H01460 Chr8 complement(323962..325290) [1329 bp, 442 aa] {O...   564   0.0  
KLTH0G13772g Chr7 (1188875..1190137) [1263 bp, 420 aa] {ON} simi...   561   0.0  
SAKL0H17138g Chr8 (1515123..1516382) [1260 bp, 419 aa] {ON} high...   561   0.0  
NDAI0B01960 Chr2 complement(477552..478871) [1320 bp, 439 aa] {O...   560   0.0  
Kwal_56.23832 s56 (726199..727458) [1260 bp, 419 aa] {ON} YLR085...   548   0.0  
KNAG0G02010 Chr7 complement(447621..448895) [1275 bp, 424 aa] {O...   544   0.0  
Ecym_4312 Chr4 (671413..672648) [1236 bp, 411 aa] {ON} similar t...   540   0.0  
TPHA0A01830 Chr1 (369897..371162) [1266 bp, 421 aa] {ON} Anc_8.2...   533   0.0  
KLLA0F19063g Chr6 complement(1756529..1757776) [1248 bp, 415 aa]...   527   0.0  
AGR091W Chr7 (907238..908470) [1233 bp, 410 aa] {ON} Syntenic ho...   525   0.0  
NCAS0C03700 Chr3 complement(745133..746250,746901..746910) [1128...   123   7e-31
TBLA0C00440 Chr3 complement(81591..82708,83412..83421) [1128 bp,...   123   9e-31
SAKL0B00968g Chr2 complement(89966..91083,91524..91533) [1128 bp...   122   1e-30
TPHA0D00250 Chr4 complement(34030..35147,35712..35721) [1128 bp,...   122   2e-30
TDEL0C00470 Chr3 complement(72546..73663,73929..73938) [1128 bp,...   122   2e-30
CAGL0K12694g Chr11 (1258451..1258460,1259340..1260457) [1128 bp,...   122   2e-30
Suva_6.18 Chr6 complement(26677..27794,28152..28161) [1128 bp, 3...   122   2e-30
Smik_6.39 Chr6 complement(68673..69790,70076..70085) [1128 bp, 3...   122   2e-30
YFL039C Chr6 complement(53260..54377,54687..54696) [1128 bp, 375...   122   2e-30
NDAI0G03040 Chr7 complement(708715..709832,710590..710599) [1128...   122   2e-30
KNAG0L00250 Chr12 complement(32595..33712,34194..34203) [1128 bp...   122   2e-30
KAFR0D00940 Chr4 complement(198280..199397,199945..199954) [1128...   122   2e-30
ABR222W Chr2 (818719..818728,819032..820152) [1131 bp, 376 aa] {...   122   2e-30
ZYRO0F02772g Chr6 complement(235322..236439,236524..236533) [112...   121   3e-30
KLLA0D05357g Chr4 (461726..461735,462516..463633) [1128 bp, 375 ...   121   3e-30
Kpol_1058.15 s1058 complement(49082..50199,50349..50358) [1128 b...   120   6e-30
KLTH0G18832g Chr7 (1626178..1626187,1626854..1627971) [1128 bp, ...   120   6e-30
Ecym_1520 Chr1 (1071497..1071506,1072543..1073663) [1131 bp, 376...   119   3e-29
KLLA0E22925g Chr5 complement(2040279..2041421) [1143 bp, 380 aa]...   117   2e-28
SAKL0E11814g Chr5 complement(984199..985338) [1140 bp, 379 aa] {...   112   8e-27
Skud_6.31 Chr6 complement(56454..57536) [1083 bp, 360 aa] {ON} Y...   110   2e-26
Kwal_14.1109 s14 complement(199181..200263) [1083 bp, 360 aa] {O...   109   5e-26
Ecym_6385 Chr6 complement(749508..750641) [1134 bp, 377 aa] {ON}...   109   9e-26
ZYRO0G05676g Chr7 (452257..453402) [1146 bp, 381 aa] {ON} simila...   106   1e-24
AFR051W Chr6 (522829..524046) [1218 bp, 405 aa] {ON} Syntenic ho...   105   4e-24
TDEL0B04810 Chr2 (849529..850650) [1122 bp, 373 aa] {ON} Anc_2.1...    99   3e-22
TPHA0I01300 Chr9 (295950..297089) [1140 bp, 379 aa] {ON} Anc_2.1...    98   8e-22
Kpol_1023.18 s1023 complement(36072..36143,36193..36201,36244..3...    96   2e-21
NDAI0B04460 Chr2 complement(1115478..1116623) [1146 bp, 381 aa] ...    96   4e-21
Smik_8.210 Chr8 complement(339093..340247) [1155 bp, 384 aa] {ON...    94   2e-20
Skud_8.190 Chr8 complement(336365..337519) [1155 bp, 384 aa] {ON...    94   3e-20
KLTH0B05940g Chr2 complement(485135..486286) [1152 bp, 383 aa] {...    91   3e-19
Suva_15.326 Chr15 complement(565392..566546) [1155 bp, 384 aa] {...    90   5e-19
YHR129C Chr8 complement(362999..364153) [1155 bp, 384 aa] {ON}  ...    87   3e-18
KNAG0H03650 Chr8 complement(678598..679761) [1164 bp, 387 aa] {O...    86   9e-18
NCAS0B07130 Chr2 complement(1354064..1355209) [1146 bp, 381 aa] ...    86   2e-17
ZYRO0B04928g Chr2 complement(398291..399444,399538..399559) [117...    85   3e-17
KLTH0F06490g Chr6 complement(561947..563100,563192..563213) [117...    84   5e-17
Kwal_33.14642 s33 (753758..754909) [1152 bp, 383 aa] {ON} YHR129...    83   9e-17
SAKL0C07370g Chr3 complement(680403..681556,681672..681693) [117...    82   2e-16
Suva_4.220 Chr4 (389822..389843,389967..391120) [1176 bp, 391 aa...    82   2e-16
TBLA0F00870 Chr6 complement(222947..224100,224325..224346) [1176...    82   3e-16
TBLA0B01070 Chr2 (236811..237962) [1152 bp, 383 aa] {ON} Anc_2.1...    81   4e-16
Smik_4.206 Chr4 (379506..379527,379652..380805) [1176 bp, 391 aa...    80   9e-16
KAFR0F00590 Chr6 (120359..121519) [1161 bp, 386 aa] {ON} Anc_2.1...    80   9e-16
NDAI0G02900 Chr7 (671423..671444,671694..672847) [1176 bp, 391 a...    80   1e-15
NCAS0C03550 Chr3 (709102..709123,709273..710429) [1179 bp, 392 a...    79   2e-15
CAGL0K01595g Chr11 (141618..141639,141971..143124) [1176 bp, 391...    79   3e-15
Skud_4.222 Chr4 (394174..394195,394321..395474) [1176 bp, 391 aa...    79   3e-15
TDEL0D04610 Chr4 complement(846092..847245,847317..847338) [1176...    79   3e-15
Kwal_33.14177 s33 complement(557522..558535) [1014 bp, 337 aa] {...    78   3e-15
ADR316W Chr4 (1261691..1262866) [1176 bp, 391 aa] {ON} Syntenic ...    78   4e-15
KNAG0K01130 Chr11 (220520..220541,220822..221981) [1182 bp, 393 ...    78   5e-15
TDEL0C04140 Chr3 (732580..734829) [2250 bp, 749 aa] {ON} Anc_2.2...    79   5e-15
YDL029W Chr4 (399340..399361,399485..400638) [1176 bp, 391 aa] {...    78   6e-15
KLLA0C03850g Chr3 complement(351772..352947) [1176 bp, 391 aa] {...    77   9e-15
Ecym_5237 Chr5 complement(489181..490356) [1176 bp, 391 aa] {ON}...    77   1e-14
Kpol_479.25 s479 complement(49227..50402) [1176 bp, 391 aa] {ON}...    76   3e-14
SAKL0E08602g Chr5 (702206..704449) [2244 bp, 747 aa] {ON} simila...    77   3e-14
NCAS0A12270 Chr1 complement(2428834..2430198) [1365 bp, 454 aa] ...    73   3e-13
Ecym_3153 Chr3 (288213..289589) [1377 bp, 458 aa] {ON} similar t...    72   4e-13
KAFR0C01040 Chr3 complement(212570..213583) [1014 bp, 337 aa] {O...    72   5e-13
SAKL0D12804g Chr4 complement(1066058..1067428) [1371 bp, 456 aa]...    72   6e-13
TPHA0A00920 Chr1 (181205..182380) [1176 bp, 391 aa] {ON} Anc_2.1...    71   9e-13
KLLA0B13904g Chr2 complement(1218228..1219598) [1371 bp, 456 aa]...    71   9e-13
Ecym_3285 Chr3 complement(539184..541424) [2241 bp, 746 aa] {ON}...    71   2e-12
NDAI0A03970 Chr1 (895219..896607) [1389 bp, 462 aa] {ON} Anc_1.514     70   2e-12
KNAG0I01860 Chr9 (364390..366651) [2262 bp, 753 aa] {ON} Anc_2.2...    71   2e-12
AFR419C Chr6 complement(1186951..1188318) [1368 bp, 455 aa] {ON}...    70   2e-12
TPHA0O01040 Chr15 (196178..197554) [1377 bp, 458 aa] {ON} Anc_1....    70   2e-12
Kpol_1003.16 s1003 complement(43655..45904) [2250 bp, 749 aa] {O...    70   3e-12
TBLA0E03860 Chr5 complement(969721..972000) [2280 bp, 759 aa] {O...    70   4e-12
CAGL0F00517g Chr6 (54743..56107) [1365 bp, 454 aa] {ON} highly s...    69   5e-12
YJR065C Chr10 complement(557809..559158) [1350 bp, 449 aa] {ON} ...    69   5e-12
Smik_10.355 Chr10 complement(546673..548022) [1350 bp, 449 aa] {...    69   6e-12
TPHA0C03160 Chr3 complement(699424..701691) [2268 bp, 755 aa] {O...    69   9e-12
Kwal_23.4848 s23 complement(892162..894399) [2238 bp, 745 aa] {O...    69   9e-12
Skud_14.272 Chr14 complement(502920..505187) [2268 bp, 755 aa] {...    69   1e-11
NDAI0D01060 Chr4 complement(238631..240892) [2262 bp, 753 aa] {O...    69   1e-11
Skud_10.289 Chr10 complement(515300..516649) [1350 bp, 449 aa] {...    68   1e-11
KAFR0D03700 Chr4 complement(718438..719787) [1350 bp, 449 aa] {O...    67   2e-11
Suva_12.154 Chr12 complement(235605..236954) [1350 bp, 449 aa] {...    67   2e-11
KNAG0B00170 Chr2 (18478..19839) [1362 bp, 453 aa] {ON} Anc_1.514...    67   2e-11
Kpol_1056.16 s1056 (36274..37656) [1383 bp, 460 aa] {ON} (36274....    67   2e-11
ADL253C Chr4 complement(255550..257805) [2256 bp, 751 aa] {ON} S...    67   2e-11
ZYRO0A01584g Chr1 complement(130119..132365) [2247 bp, 748 aa] {...    67   2e-11
ZYRO0G01936g Chr7 complement(144085..145470) [1386 bp, 461 aa] {...    67   2e-11
TBLA0D03680 Chr4 (914687..916063) [1377 bp, 458 aa] {ON} Anc_1.5...    67   3e-11
KAFR0J01160 Chr10 (212425..214680) [2256 bp, 751 aa] {ON} Anc_2....    67   4e-11
YNL059C Chr14 complement(512668..514935) [2268 bp, 755 aa] {ON} ...    67   4e-11
CAGL0H09042g Chr8 (884592..885755) [1164 bp, 387 aa] {ON} simila...    66   4e-11
Suva_14.281 Chr14 complement(511583..513850) [2268 bp, 755 aa] {...    67   5e-11
TDEL0F00470 Chr6 (80760..82145) [1386 bp, 461 aa] {ON} Anc_1.514...    65   1e-10
Smik_14.267 Chr14 complement(493008..495275) [2268 bp, 755 aa] {...    65   1e-10
KLTH0G09482g Chr7 complement(789233..791470) [2238 bp, 745 aa] {...    65   2e-10
CAGL0J10054g Chr10 complement(985402..987666) [2265 bp, 754 aa] ...    63   5e-10
KLTH0C02508g Chr3 (224722..226077) [1356 bp, 451 aa] {ON} highly...    62   8e-10
KLLA0F03421g Chr6 complement(321000..323243) [2244 bp, 747 aa] {...    62   1e-09
Kwal_27.9958 s27 (139638..140975) [1338 bp, 445 aa] {ON} YJR065C...    61   2e-09
Kpol_282.4 s282 (8483..9988) [1506 bp, 501 aa] {ON} (8483..9988)...    59   1e-08
NCAS0G03050 Chr7 complement(560525..562756) [2232 bp, 743 aa] {O...    56   9e-08
Ecym_6330 Chr6 (632900..634342) [1443 bp, 480 aa] {ON} similar t...    55   2e-07
AFR105C Chr6 complement(625098..626537) [1440 bp, 479 aa] {ON} S...    55   2e-07
Suva_6.154 Chr6 (266531..268000) [1470 bp, 489 aa] {ON} YJL081C ...    54   5e-07
KLLA0D02288g Chr4 complement(194724..196286) [1563 bp, 520 aa] {...    54   6e-07
TPHA0I01030 Chr9 complement(236150..237661) [1512 bp, 503 aa] {O...    53   7e-07
Kwal_14.2377 s14 complement(733179..734624) [1446 bp, 481 aa] {O...    52   1e-06
Skud_10.132 Chr10 complement(251748..253214) [1467 bp, 488 aa] {...    52   2e-06
KAFR0A01560 Chr1 complement(311746..313203) [1458 bp, 485 aa] {O...    52   2e-06
Smik_10.161 Chr10 complement(275455..276924) [1470 bp, 489 aa] {...    52   2e-06
TDEL0D01550 Chr4 complement(305973..307415) [1443 bp, 480 aa] {O...    50   5e-06
SAKL0D05874g Chr4 complement(479873..481366) [1494 bp, 497 aa] {...    50   5e-06
YJL081C Chr10 complement(283802..285271) [1470 bp, 489 aa] {ON} ...    50   9e-06
TBLA0D05360 Chr4 (1321243..1323033) [1791 bp, 596 aa] {ON} Anc_1...    50   9e-06
ZYRO0G21428g Chr7 (1766725..1768176) [1452 bp, 483 aa] {ON} high...    49   2e-05
KLTH0H09702g Chr8 complement(835255..836700) [1446 bp, 481 aa] {...    48   2e-05
CAGL0M03201g Chr13 complement(364771..366252) [1482 bp, 493 aa] ...    48   4e-05
NCAS0B06060 Chr2 complement(1146248..1147741) [1494 bp, 497 aa] ...    47   4e-05
NDAI0G05580 Chr7 complement(1374852..1376399) [1548 bp, 515 aa] ...    47   6e-05
ACR184C Chr3 complement(669411..670616) [1206 bp, 401 aa] {ON} S...    47   6e-05
KNAG0B01920 Chr2 complement(362300..363817) [1518 bp, 505 aa] {O...    46   1e-04
TDEL0C03120 Chr3 (558606..559922) [1317 bp, 438 aa] {ON} Anc_7.4...    38   0.054
SAKL0F13772g Chr6 (1099703..1100971) [1269 bp, 422 aa] {ON} simi...    36   0.20 
KLTH0C05324g Chr3 complement(458911..460110) [1200 bp, 399 aa] {...    34   0.61 
Kpol_520.11 s520 complement(26673..28139) [1467 bp, 488 aa] {ON}...    34   0.67 
TDEL0A04400 Chr1 (778465..779763) [1299 bp, 432 aa] {ON} Anc_5.5...    32   2.1  
Ecym_3505 Chr3 complement(941314..942231) [918 bp, 305 aa] {ON} ...    32   2.2  
KAFR0K02150 Chr11 (441832..443304) [1473 bp, 490 aa] {ON} Anc_7....    32   2.3  
AGR099C Chr7 complement(924366..925283) [918 bp, 305 aa] {ON} Sy...    32   2.5  
Smik_4.687 Chr4 (1219205..1221751) [2547 bp, 848 aa] {ON} YDR416...    32   3.0  
Kwal_27.10552 s27 complement(390650..391705) [1056 bp, 351 aa] {...    32   3.5  
CAGL0K05335g Chr11 (521914..523503) [1590 bp, 529 aa] {ON} simil...    32   4.1  
KNAG0B02110 Chr2 complement(399743..401200) [1458 bp, 485 aa] {O...    32   4.4  
TBLA0H02800 Chr8 (655357..656811) [1455 bp, 484 aa] {ON} Anc_2.5...    31   6.6  
NCAS0H03060 Chr8 (588900..590318) [1419 bp, 472 aa] {ON} Anc_2.5...    31   6.6  

>CAGL0L12166g Chr12 complement(1308681..1309946) [1266 bp, 421 aa]
           {ON} similar to uniprot|Q12509 Saccharomyces cerevisiae
           YLR085c Actin-related protein
          Length = 421

 Score =  879 bits (2271), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 421/421 (100%), Positives = 421/421 (100%)

Query: 1   MTADQAIVIDNGSYQVKFGLASEVRPRVALNALAKDKYGVTHLSNQVQNIKDISSVVFRR 60
           MTADQAIVIDNGSYQVKFGLASEVRPRVALNALAKDKYGVTHLSNQVQNIKDISSVVFRR
Sbjct: 1   MTADQAIVIDNGSYQVKFGLASEVRPRVALNALAKDKYGVTHLSNQVQNIKDISSVVFRR 60

Query: 61  PHELGQLTSWELESCIWDYCLYNPDEFGIDWQSLENRHVVLSETCMTLPELSKNTDQVLF 120
           PHELGQLTSWELESCIWDYCLYNPDEFGIDWQSLENRHVVLSETCMTLPELSKNTDQVLF
Sbjct: 61  PHELGQLTSWELESCIWDYCLYNPDEFGIDWQSLENRHVVLSETCMTLPELSKNTDQVLF 120

Query: 121 EEYEVDSLYKAPTAAYIPFYTTNENIKTISGKSDHGELDIEEKIEAGKEYNDFSLVIDSG 180
           EEYEVDSLYKAPTAAYIPFYTTNENIKTISGKSDHGELDIEEKIEAGKEYNDFSLVIDSG
Sbjct: 121 EEYEVDSLYKAPTAAYIPFYTTNENIKTISGKSDHGELDIEEKIEAGKEYNDFSLVIDSG 180

Query: 181 FNCTWVIPIVKGVPYYKAVKKLDVGGRFLNGLLKETISFRHYNVMDESILVNNIKEQCLY 240
           FNCTWVIPIVKGVPYYKAVKKLDVGGRFLNGLLKETISFRHYNVMDESILVNNIKEQCLY
Sbjct: 181 FNCTWVIPIVKGVPYYKAVKKLDVGGRFLNGLLKETISFRHYNVMDESILVNNIKEQCLY 240

Query: 241 VDPVSYFEAFKAKGKNKIDFVLPDFQTSFQGYVRDPKTALPDNAQILTLTDERFSVPEAF 300
           VDPVSYFEAFKAKGKNKIDFVLPDFQTSFQGYVRDPKTALPDNAQILTLTDERFSVPEAF
Sbjct: 241 VDPVSYFEAFKAKGKNKIDFVLPDFQTSFQGYVRDPKTALPDNAQILTLTDERFSVPEAF 300

Query: 301 FHPEISQSLKPGIIETVLESIYMLPELLRPLMASNIVCMGGNFNLPGFTDRLVSELQRQL 360
           FHPEISQSLKPGIIETVLESIYMLPELLRPLMASNIVCMGGNFNLPGFTDRLVSELQRQL
Sbjct: 301 FHPEISQSLKPGIIETVLESIYMLPELLRPLMASNIVCMGGNFNLPGFTDRLVSELQRQL 360

Query: 361 PTDWVCRAKISSGDKSLTGWTAMAKFAHTDAYKKARVTKEDYFEHGLDWTTKERFGYQNW 420
           PTDWVCRAKISSGDKSLTGWTAMAKFAHTDAYKKARVTKEDYFEHGLDWTTKERFGYQNW
Sbjct: 361 PTDWVCRAKISSGDKSLTGWTAMAKFAHTDAYKKARVTKEDYFEHGLDWTTKERFGYQNW 420

Query: 421 V 421
           V
Sbjct: 421 V 421

>YLR085C Chr12 complement(300673..301989) [1317 bp, 438 aa] {ON}
           ARP6Actin-related protein that binds nucleosomes; a
           component of the SWR1 complex, which exchanges histone
           variant H2AZ (Htz1p) for chromatin-bound histone H2A
          Length = 438

 Score =  597 bits (1538), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 275/435 (63%), Positives = 347/435 (79%), Gaps = 22/435 (5%)

Query: 7   IVIDNGSYQVKFGLASEVRPRVALNALAKDKYGVTHLSNQVQNIKDISSVVFRRPHELGQ 66
           IVIDNGSY++KFG ++  +P  ALNALAKDK+G ++LSN ++NIKDISS+ FRRPHELGQ
Sbjct: 6   IVIDNGSYEIKFGPSTNKKPFRALNALAKDKFGTSYLSNHIKNIKDISSITFRRPHELGQ 65

Query: 67  LTSWELESCIWDYCLYNPDEF-GIDWQSLENRHVVLSETCMTLPELSKNTDQVLFEEYEV 125
           LT WELESCIWDYCL+NP EF G D +  +  H+V SE+CMTLPELSK+ DQV+FEEYE 
Sbjct: 66  LTLWELESCIWDYCLFNPSEFDGFDLKEGKGHHLVASESCMTLPELSKHADQVIFEEYEF 125

Query: 126 DSLYKAPTAAYIPFYTTNEN-IKTISGKSDHGELDI---------------EEKIEAGKE 169
           DSL+K+P A ++PF  + +  ++TISGK +  ++DI               +   ++G +
Sbjct: 126 DSLFKSPVAVFVPFTKSYKGEMRTISGKDE--DIDIVRGNSDSTNSTSSESKNAQDSGSD 183

Query: 170 YNDFSLVIDSGFNCTWVIPIVKGVPYYKAVKKLDVGGRFLNGLLKETISFRHYNVMDESI 229
           Y+DF LVIDSGFNCTW+IP++KG+PYYKAVKKLD+GGRFL GLLKET+SFRHYN+MDE+I
Sbjct: 184 YHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETLSFRHYNMMDETI 243

Query: 230 LVNNIKEQCLYVDPVSYFEAFKAKGKNKIDFVLPDFQTSFQGYVRDPK---TALPDNAQI 286
           LVNNIKEQCL+V PVSYF++FK K K+ +++VLPDFQTSF GYVR+P+     LP++AQI
Sbjct: 244 LVNNIKEQCLFVSPVSYFDSFKTKDKHALEYVLPDFQTSFLGYVRNPRKENVPLPEDAQI 303

Query: 287 LTLTDERFSVPEAFFHPEISQSLKPGIIETVLESIYMLPELLRPLMASNIVCMGGNFNLP 346
           +TLTDE F++PE FFHPEISQ  KPGI+E +LES+ MLPE++RPLM  NIVC GGNFNLP
Sbjct: 304 ITLTDELFTIPETFFHPEISQITKPGIVEAILESLSMLPEIVRPLMVGNIVCTGGNFNLP 363

Query: 347 GFTDRLVSELQRQLPTDWVCRAKISSGDKSLTGWTAMAKFAHTDAYKKARVTKEDYFEHG 406
            F  RL +ELQRQLPTDW C   +  GD +L GW  M++FA TD+Y+KARVT+E+Y+EHG
Sbjct: 364 NFAQRLAAELQRQLPTDWTCHVSVPEGDCALFGWEVMSQFAKTDSYRKARVTREEYYEHG 423

Query: 407 LDWTTKERFGYQNWV 421
            DW TK RFGYQNW+
Sbjct: 424 PDWCTKHRFGYQNWI 438

>Suva_10.169 Chr10 complement(305734..307050) [1317 bp, 438 aa] {ON}
           YLR085C (REAL)
          Length = 438

 Score =  584 bits (1505), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 268/433 (61%), Positives = 341/433 (78%), Gaps = 18/433 (4%)

Query: 7   IVIDNGSYQVKFGLASEVRPRVALNALAKDKYGVTHLSNQVQNIKDISSVVFRRPHELGQ 66
           IVIDNGSY++KFG ++   P  ALNALAKDK+G ++LSN ++NIKDISSV FRRPHELGQ
Sbjct: 6   IVIDNGSYEIKFGPSTNKMPFRALNALAKDKFGTSYLSNHIKNIKDISSVTFRRPHELGQ 65

Query: 67  LTSWELESCIWDYCLYNPDEF-GIDWQSLENRHVVLSETCMTLPELSKNTDQVLFEEYEV 125
           LT WELESCIWDYCL+NP EF G D +  +  H+V SE+CMTLPELSK+ DQV+FEEYE 
Sbjct: 66  LTLWELESCIWDYCLFNPSEFDGFDLKEGKGHHLVASESCMTLPELSKHADQVIFEEYEF 125

Query: 126 DSLYKAPTAAYIPFYTTNEN-IKTISGKSDHGELDIEE-------------KIEAGKEYN 171
           DSL+K+P A ++PF  + +  ++TISGK +  ++ I +             +  +  +Y+
Sbjct: 126 DSLFKSPVAVFVPFTKSYKGKMRTISGKDEDADVAISDSDDKTFTSKEPVDETNSNNDYH 185

Query: 172 DFSLVIDSGFNCTWVIPIVKGVPYYKAVKKLDVGGRFLNGLLKETISFRHYNVMDESILV 231
           DF LVIDSGF+CTW+IP++KG+PYYKAVKKLD+GGRFL GLLKET+SFRHYN+MDE+ILV
Sbjct: 186 DFQLVIDSGFDCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETLSFRHYNMMDETILV 245

Query: 232 NNIKEQCLYVDPVSYFEAFKAKGKNKIDFVLPDFQTSFQGYVRDPK---TALPDNAQILT 288
           NNIKE+CL+V P SYF++FK+K K+ +++VLPDFQTSF GYVR P    + LP +AQ +T
Sbjct: 246 NNIKEKCLFVSPTSYFDSFKSKNKHVLEYVLPDFQTSFIGYVRHPNEEDSPLPTDAQSIT 305

Query: 289 LTDERFSVPEAFFHPEISQSLKPGIIETVLESIYMLPELLRPLMASNIVCMGGNFNLPGF 348
           LTDE F++PE FFHPEISQ +KPGI+E +LES+ MLPE++RPLM  NIVC GGNFNLP F
Sbjct: 306 LTDELFTIPETFFHPEISQIIKPGIVEAILESLSMLPEIVRPLMIGNIVCTGGNFNLPNF 365

Query: 349 TDRLVSELQRQLPTDWVCRAKISSGDKSLTGWTAMAKFAHTDAYKKARVTKEDYFEHGLD 408
             RL  ELQRQLPTDW C   +  GD +L GW  M++FA T++Y++ARVT+E+Y+EHG D
Sbjct: 366 AQRLARELQRQLPTDWTCNVSVPEGDCTLFGWEVMSQFAKTESYQRARVTREEYYEHGPD 425

Query: 409 WTTKERFGYQNWV 421
           W TK RFGYQNW+
Sbjct: 426 WCTKHRFGYQNWI 438

>Skud_12.153 Chr12 complement(284046..285362) [1317 bp, 438 aa] {ON}
           YLR085C (REAL)
          Length = 438

 Score =  584 bits (1505), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 265/433 (61%), Positives = 341/433 (78%), Gaps = 18/433 (4%)

Query: 7   IVIDNGSYQVKFGLASEVRPRVALNALAKDKYGVTHLSNQVQNIKDISSVVFRRPHELGQ 66
           IVIDNGSY++KF  ++   P  ALNALAKDK+G ++LSN ++NIKDISS+ FRRPHELGQ
Sbjct: 6   IVIDNGSYEIKFAPSTNEMPFRALNALAKDKFGTSYLSNHIKNIKDISSITFRRPHELGQ 65

Query: 67  LTSWELESCIWDYCLYNPDEF-GIDWQSLENRHVVLSETCMTLPELSKNTDQVLFEEYEV 125
           LT WELESCIWDYC +NP EF G D +  +  H+V SE+CMTLPELSK+ DQV+FEEYE 
Sbjct: 66  LTLWELESCIWDYCFFNPSEFRGFDLKEGKGHHLVASESCMTLPELSKHADQVIFEEYEF 125

Query: 126 DSLYKAPTAAYIPFYTTNEN-IKTISGKSDHGEL-------------DIEEKIEAGKEYN 171
           DSL+K+P A ++PF  + +  +KTISGK +  ++             +      +  +Y+
Sbjct: 126 DSLFKSPVAVFVPFTKSYKGKLKTISGKDEEADVVTSNSGITTFTSRECGSAQNSDSDYH 185

Query: 172 DFSLVIDSGFNCTWVIPIVKGVPYYKAVKKLDVGGRFLNGLLKETISFRHYNVMDESILV 231
           DF LVIDSGFNCTW+IP++KG+PYYKAVKKLD+GGRFL GLLKET+SFRHYN+MDE+ILV
Sbjct: 186 DFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETLSFRHYNMMDETILV 245

Query: 232 NNIKEQCLYVDPVSYFEAFKAKGKNKIDFVLPDFQTSFQGYVRDPK---TALPDNAQILT 288
           NN+KE+CL+V PVSYF++FKAK K+ +++VLPDFQTSF GYVR+P+   + LP++AQ + 
Sbjct: 246 NNVKEKCLFVSPVSYFDSFKAKDKHALEYVLPDFQTSFIGYVRNPREENSPLPEDAQTIA 305

Query: 289 LTDERFSVPEAFFHPEISQSLKPGIIETVLESIYMLPELLRPLMASNIVCMGGNFNLPGF 348
           LTDE F++PE FFHPEISQ  KPGI+E +LES+ MLPE++RPLM  NIVC GGNFNLP F
Sbjct: 306 LTDELFTIPETFFHPEISQITKPGIVEAILESLSMLPEIVRPLMVGNIVCTGGNFNLPNF 365

Query: 349 TDRLVSELQRQLPTDWVCRAKISSGDKSLTGWTAMAKFAHTDAYKKARVTKEDYFEHGLD 408
             RL +ELQRQLPTDW C   +  GD +L GW  M++FA T++Y++ARVT+++Y+EHG D
Sbjct: 366 AQRLAAELQRQLPTDWTCHVSVPIGDCALFGWEVMSQFAKTESYRRARVTRDEYYEHGPD 425

Query: 409 WTTKERFGYQNWV 421
           W TK+RFGYQNW+
Sbjct: 426 WCTKQRFGYQNWI 438

>Smik_12.144 Chr12 complement(280513..281829) [1317 bp, 438 aa] {ON}
           YLR085C (REAL)
          Length = 438

 Score =  580 bits (1496), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 267/433 (61%), Positives = 338/433 (78%), Gaps = 18/433 (4%)

Query: 7   IVIDNGSYQVKFGLASEVRPRVALNALAKDKYGVTHLSNQVQNIKDISSVVFRRPHELGQ 66
           IVIDNGSY++KFG ++  +P  ALNALAKDK+G ++LSN ++NIKDISSV FRRPHELGQ
Sbjct: 6   IVIDNGSYEIKFGPSTNEKPFRALNALAKDKFGTSYLSNHIKNIKDISSVTFRRPHELGQ 65

Query: 67  LTSWELESCIWDYCLYNPDEF-GIDWQSLENRHVVLSETCMTLPELSKNTDQVLFEEYEV 125
           LT WELESCIWDYC +NP EF G D +  +  H+V SE+CMTLPELSK+ DQV+FEEYE 
Sbjct: 66  LTLWELESCIWDYCFFNPIEFDGFDLKEGKGHHLVASESCMTLPELSKHADQVIFEEYEF 125

Query: 126 DSLYKAPTAAYIPFYTT-NENIKTISGKSDHGELDIEEKIEAG-------------KEYN 171
           DSL+K+P AA++PF  +    +K ISGK +  ++ + +  EA               +Y+
Sbjct: 126 DSLFKSPVAAFVPFTKSYKSKMKAISGKDEDADIVVSKSNEADMPSNNPRDTQKFDSDYH 185

Query: 172 DFSLVIDSGFNCTWVIPIVKGVPYYKAVKKLDVGGRFLNGLLKETISFRHYNVMDESILV 231
           DF LVIDSGFNCTW+IP++KG+PYYKAVKKLDVGGRFL GLLKET+SFRHYN+MDE+ILV
Sbjct: 186 DFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDVGGRFLTGLLKETLSFRHYNMMDETILV 245

Query: 232 NNIKEQCLYVDPVSYFEAFKAKGKNKIDFVLPDFQTSFQGYVRDPK---TALPDNAQILT 288
           NNIKE+CL+V PVSYF++FK K K+ +++VLPDFQTSF GYVR+ +   + L ++AQ +T
Sbjct: 246 NNIKEKCLFVSPVSYFDSFKVKDKHALEYVLPDFQTSFLGYVRNRRKENSPLAEDAQTIT 305

Query: 289 LTDERFSVPEAFFHPEISQSLKPGIIETVLESIYMLPELLRPLMASNIVCMGGNFNLPGF 348
           LTDE F++PE FFHPEI+Q  KPGI+E +LES+ MLPE++RPLM  NIVC GGNFNLP F
Sbjct: 306 LTDELFTIPETFFHPEIAQITKPGIVEAILESLSMLPEIVRPLMVGNIVCTGGNFNLPNF 365

Query: 349 TDRLVSELQRQLPTDWVCRAKISSGDKSLTGWTAMAKFAHTDAYKKARVTKEDYFEHGLD 408
             RL +ELQRQLPTDW C   +   D +L GW  M++F+ T +Y+ ARVT+E+Y+EHG D
Sbjct: 366 AQRLAAELQRQLPTDWTCHVSVPESDCALFGWEVMSQFSSTASYRNARVTREEYYEHGSD 425

Query: 409 WTTKERFGYQNWV 421
           W TK RFGYQNW+
Sbjct: 426 WCTKHRFGYQNWI 438

>NCAS0B04990 Chr2 complement(916170..917432) [1263 bp, 420 aa] {ON}
           Anc_8.258 YLR085C
          Length = 420

 Score =  580 bits (1494), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 268/417 (64%), Positives = 331/417 (79%), Gaps = 4/417 (0%)

Query: 7   IVIDNGSYQVKFGLASEVRPRVALNALAKDKYGVTHLSNQVQNIKDISSVVFRRPHELGQ 66
           I IDNGSY++KFG      P  A+NA A DKY  T+LSNQ++NIKDI+SV FRRPHELGQ
Sbjct: 6   IAIDNGSYEIKFGTTDLSSPYRAINAFAIDKYHTTYLSNQIKNIKDITSVTFRRPHELGQ 65

Query: 67  LTSWELESCIWDYCLYNPDEF-GIDWQSLENRHVVLSETCMTLPELSKNTDQVLFEEYEV 125
           LTSWELES IWDY L+NPDEF G D   L+ +H++ SETCMTLPELSKN DQV+FEEYE 
Sbjct: 66  LTSWELESSIWDYALFNPDEFPGFDLNDLKGKHLIASETCMTLPELSKNMDQVVFEEYEF 125

Query: 126 DSLYKAPTAAYIPFYTTNENIKTISGKSDHG-ELDIEEKIEAGKEYNDFSLVIDSGFNCT 184
           DS YK+  A +I F   ++N K ISGK++    LD   ++   KEYND+ LVIDSGFNCT
Sbjct: 126 DSYYKSSIAGFIQF-ADDKNTKIISGKTEEDISLDSVNQVRE-KEYNDYQLVIDSGFNCT 183

Query: 185 WVIPIVKGVPYYKAVKKLDVGGRFLNGLLKETISFRHYNVMDESILVNNIKEQCLYVDPV 244
           W+IP++KGVPYYKAVKKLD+GGRFL+GLLKET+SFRHY+VMDE+ILVNNIKE CL+V P 
Sbjct: 184 WIIPVIKGVPYYKAVKKLDIGGRFLDGLLKETLSFRHYDVMDETILVNNIKENCLFVSPT 243

Query: 245 SYFEAFKAKGKNKIDFVLPDFQTSFQGYVRDPKTALPDNAQILTLTDERFSVPEAFFHPE 304
           SYF++FK K +  +++VLP+FQT+F G+VRD    LP+N Q + L DE FSVPE FFHPE
Sbjct: 244 SYFDSFKNKNETAVEYVLPNFQTTFLGHVRDKTKPLPENTQTIKLYDELFSVPETFFHPE 303

Query: 305 ISQSLKPGIIETVLESIYMLPELLRPLMASNIVCMGGNFNLPGFTDRLVSELQRQLPTDW 364
           I++ LKPG++ET+LES+ M+PELLRPL+  N+VC GGNFNLP F  RL SELQRQLPTDW
Sbjct: 304 IARILKPGLVETILESLSMVPELLRPLLVGNLVCTGGNFNLPHFATRLTSELQRQLPTDW 363

Query: 365 VCRAKISSGDKSLTGWTAMAKFAHTDAYKKARVTKEDYFEHGLDWTTKERFGYQNWV 421
           +CR  + + +  L GW AMA+FA T++Y+K RVT+E+Y+EHG DW TK RFGYQNW+
Sbjct: 364 ICRTSVPTKECELFGWKAMAQFASTESYRKTRVTREEYYEHGTDWLTKNRFGYQNWI 420

>ZYRO0C01738g Chr3 (135066..136310) [1245 bp, 414 aa] {ON} similar
           to uniprot|Q12509 Saccharomyces cerevisiae YLR085C ARP6
           Nuclear actin-related protein involved in chromatin
           remodeling component of chromatin-remodeling enzyme
           complexes
          Length = 414

 Score =  573 bits (1477), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 268/416 (64%), Positives = 320/416 (76%), Gaps = 8/416 (1%)

Query: 7   IVIDNGSYQVKFGLASEVRPRVALNALAKDKYGVTHLSNQVQNIKDISSVVFRRPHELGQ 66
           IV+DNGSY++KFG      P  A NALA+DK+G  +LSNQ++ IKDISSVVFRRPHE GQ
Sbjct: 6   IVVDNGSYEIKFGTPDLETPHRAFNALARDKFGSYYLSNQIKTIKDISSVVFRRPHEFGQ 65

Query: 67  LTSWELESCIWDYCLYNPDEF-GIDWQSLENRHVVLSETCMTLPELSKNTDQVLFEEYEV 125
           LTSWELES IWDYC +NPDEF G D +  + +H+V+SETCMT+PELSKN DQV+FEEYE 
Sbjct: 66  LTSWELESAIWDYCFFNPDEFNGFDLKDSKGQHLVVSETCMTIPELSKNMDQVVFEEYEF 125

Query: 126 DSLYKAPTAAYIPFYTTNENIKTISGKSDHGELDIEEKIEAGKEYNDFSLVIDSGFNCTW 185
            S++K+P A + PF         ISGK D    D   +      Y  F LVID GFNCTW
Sbjct: 126 ASMFKSPIAGFAPF---GRPSIAISGKGD----DQPNRKAEPDAYEPFQLVIDVGFNCTW 178

Query: 186 VIPIVKGVPYYKAVKKLDVGGRFLNGLLKETISFRHYNVMDESILVNNIKEQCLYVDPVS 245
           V+P++KG+PYYKAVKKLD+GGRFLNGLLKET+SFRHYNVMDE+ILVNNIKE CL+V PVS
Sbjct: 179 VVPVIKGIPYYKAVKKLDIGGRFLNGLLKETLSFRHYNVMDETILVNNIKENCLFVSPVS 238

Query: 246 YFEAFKAKGKNKIDFVLPDFQTSFQGYVRDPKTALPDNAQILTLTDERFSVPEAFFHPEI 305
           YFE+FK K +  +++VLPDFQTSF GYV+DPK  LP ++Q + L DE FSVPE FFHPEI
Sbjct: 239 YFESFKHKEQTAVEYVLPDFQTSFLGYVKDPKKPLPQDSQTVELKDELFSVPETFFHPEI 298

Query: 306 SQSLKPGIIETVLESIYMLPELLRPLMASNIVCMGGNFNLPGFTDRLVSELQRQLPTDWV 365
            Q LKPGIIET+LES+ +LPE LRPLM  NIVC GGNFNLP F  RL +ELQRQLPTDW 
Sbjct: 299 PQLLKPGIIETILESLSILPEQLRPLMLGNIVCTGGNFNLPNFATRLATELQRQLPTDWT 358

Query: 366 CRAKISSGDKSLTGWTAMAKFAHTDAYKKARVTKEDYFEHGLDWTTKERFGYQNWV 421
           C   + SG K L GW++MA F ++  Y  ARVT+E+YFEHG+DW T+ RFGYQNW+
Sbjct: 359 CTVHLPSGPKELYGWSSMASFTNSPLYSDARVTREEYFEHGVDWCTRHRFGYQNWM 414

>KAFR0B02700 Chr2 complement(543626..544888) [1263 bp, 420 aa] {ON}
           Anc_8.258 YLR085C
          Length = 420

 Score =  572 bits (1475), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 267/424 (62%), Positives = 331/424 (78%), Gaps = 12/424 (2%)

Query: 4   DQAIVIDNGSYQVKFGLASEVRPRVALNALAKDKYGVTHLSNQVQNIKDISSVVFRRPHE 63
           +  +VIDNGSY+VKFG AS   P  ALNA+A DKY  ++LSNQ+++IKDISSV  +RPH 
Sbjct: 3   ETPVVIDNGSYRVKFGPASLEAPYCALNAIANDKYDASYLSNQIKSIKDISSVSIKRPHT 62

Query: 64  LGQLTSWELESCIWDYCLYNPDEF-GIDWQSLENRHVVLSETCMTLPELSKNTDQVLFEE 122
           LGQLTSWE+++ IWDYCLYNPDEF G +    +++H++ SETCMTLPEL KN DQV+FEE
Sbjct: 63  LGQLTSWEMQTLIWDYCLYNPDEFNGFNIGDTKSKHLITSETCMTLPELGKNMDQVIFEE 122

Query: 123 YEVDSLYKAPTAAYIPFYTTNENIKTISGKSDHGELDIEEKIE--AGKEYNDFSLVIDSG 180
           YE  SL K+P A Y+PF    ++   I      GE D E  +E  + +EY DF LV+DSG
Sbjct: 123 YEFGSLMKSPVAGYMPFLRNTKDQIII------GERDTEPFVETPSTEEYRDFQLVVDSG 176

Query: 181 FNCTWVIPIVKGVPYYKAVKKLDVGGRFLNGLLKETISFRHYNVMDESILVNNIKEQCLY 240
           FNCTW+IP++KG+PYYKAVKKLD+GGRFLNGLLKET+SFRHYNVMDE+ILVNNIKE+CL+
Sbjct: 177 FNCTWIIPVIKGIPYYKAVKKLDIGGRFLNGLLKETLSFRHYNVMDETILVNNIKEKCLF 236

Query: 241 VDPVSYFEAFKAKGKNKIDFVLPDFQTSFQGYVR---DPKTALPDNAQILTLTDERFSVP 297
           V P SYF++FK K     ++VLPDFQTSF GYVR   +    LP+++Q +TL DE F+VP
Sbjct: 237 VSPASYFDSFKNKDITSREYVLPDFQTSFLGYVRPSNEQGKPLPEDSQSITLKDELFAVP 296

Query: 298 EAFFHPEISQSLKPGIIETVLESIYMLPELLRPLMASNIVCMGGNFNLPGFTDRLVSELQ 357
           E FFHPEISQ LKPG++ET+LES+ M+PE++RPLM SNI+C+GGNFNLP F  R+  ELQ
Sbjct: 297 ETFFHPEISQILKPGLVETILESLSMIPEVIRPLMVSNIMCIGGNFNLPHFASRVAKELQ 356

Query: 358 RQLPTDWVCRAKISSGDKSLTGWTAMAKFAHTDAYKKARVTKEDYFEHGLDWTTKERFGY 417
           RQLPTDW CR  IS G+  L+GW AM+ FA TD YK  RVT+E+Y+EHG+DW TK RFGY
Sbjct: 357 RQLPTDWKCRITISKGNSELSGWKAMSSFASTDIYKATRVTREEYYEHGIDWCTKHRFGY 416

Query: 418 QNWV 421
           QNWV
Sbjct: 417 QNWV 420

>Kpol_543.36 s543 complement(80922..82205) [1284 bp, 427 aa] {ON}
           complement(80922..82205) [1284 nt, 428 aa]
          Length = 427

 Score =  572 bits (1474), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 263/422 (62%), Positives = 335/422 (79%), Gaps = 7/422 (1%)

Query: 7   IVIDNGSYQVKFGLASEVRPRVALNALAKDKYGVTHLSNQVQNIKDISSVVFRRPHELGQ 66
           IVIDNGSY+VKFG +    P  ALNALAKDKYG  +LSNQ+ NIKDISSV  RRPHELGQ
Sbjct: 6   IVIDNGSYEVKFGYSDAKVPNRALNALAKDKYGAWYLSNQMNNIKDISSVTIRRPHELGQ 65

Query: 67  LTSWELESCIWDYCLYNPDEF-GIDWQSLENRHVVLSETCMTLPELSKNTDQVLFEEYEV 125
           L SWELE  +WDYC +NPDEF   + +  +  H+V+SETCMTLPELS N DQV+FEEYE 
Sbjct: 66  LVSWELEGTVWDYCFFNPDEFPNFNLKETKGHHLVVSETCMTLPELSANMDQVMFEEYEF 125

Query: 126 DSLYKAPTAAYIPFYTTNENIKTISGKSDHGELDIEEKIEA---GKEYNDFSLVIDSGFN 182
           +SL+K+P A ++PF    +N+K I GK D    D+   +++      Y+DF+LVIDSGFN
Sbjct: 126 ESLFKSPVAGFVPFLNLQDNMKMICGKGDDVMGDLISNMDSQNIKNPYSDFNLVIDSGFN 185

Query: 183 CTWVIPIVKGVPYYKAVKKLDVGGRFLNGLLKETISFRHYNVMDESILVNNIKEQCLYVD 242
           CTW+IPI+KGVPYYKAVKK+++GGRFLNGL KETIS+RHY+V DE+ILVNNIKE+CL++ 
Sbjct: 186 CTWIIPIIKGVPYYKAVKKMEMGGRFLNGLFKETISYRHYDVTDETILVNNIKEKCLFMS 245

Query: 243 PVSYFEAFKAKGKNKIDFVLPDFQTSFQGYVRDPK--TALPDNAQILTLTDERFSVPEAF 300
           P SY ++FK K +  +D+VLPDFQTSF GYV+D K  + LP+N+Q++TLTDE FSVPE  
Sbjct: 246 PTSYMDSFKNKDRYSVDYVLPDFQTSFIGYVKDKKSNSQLPENSQVITLTDELFSVPETI 305

Query: 301 FHPEISQSLKPGIIETVLESIYMLPELLRPLMASNIVCMGGNFNLPGFTDRLVSELQRQL 360
           FHPE+++ LKPGI+ET+LES+ ++PE +RPL+ +NIVC+GGNFN+P F  RL +ELQRQL
Sbjct: 306 FHPEMAKLLKPGIVETILESLSIVPETIRPLLVNNIVCVGGNFNMPNFGSRLATELQRQL 365

Query: 361 PTDWVCRAKISSGDKSLTGWTAMAKFA-HTDAYKKARVTKEDYFEHGLDWTTKERFGYQN 419
           PTDWVC   I   D  L GW +M++FA +TD YKKAR+++E+Y+EHG DWTTK+RFGYQN
Sbjct: 366 PTDWVCNIYIPEKDCELQGWKSMSQFAQNTDIYKKARISREEYYEHGTDWTTKKRFGYQN 425

Query: 420 WV 421
           W+
Sbjct: 426 WI 427

>TDEL0F03850 Chr6 complement(707880..709139) [1260 bp, 419 aa] {ON}
           Anc_8.258 YLR085C
          Length = 419

 Score =  570 bits (1470), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 262/419 (62%), Positives = 330/419 (78%), Gaps = 5/419 (1%)

Query: 5   QAIVIDNGSYQVKFGLASEVRPRVALNALAKDKYGVTHLSNQVQNIKDISSVVFRRPHEL 64
           + +V+DNGSY+VKFG ++  +P  ALNALA+DK+G T+LSNQ+  IKDISSV F+RPHE 
Sbjct: 4   EPLVVDNGSYEVKFGYSTTSQPFRALNALARDKFGATYLSNQINQIKDISSVSFKRPHEY 63

Query: 65  GQLTSWELESCIWDYCLYNPDEF-GIDWQSLENRHVVLSETCMTLPELSKNTDQVLFEEY 123
           GQLTSWEL+SC+WDYC +NP+EF G D +  + +H++ SETCMTLPELSKN DQV+FEEY
Sbjct: 64  GQLTSWELQSCVWDYCFFNPNEFDGFDLKDSKGQHLIASETCMTLPELSKNMDQVVFEEY 123

Query: 124 EVDSLYKAPTAAYIPFYTTNENIKTISGKSDHGELDIEEKIEAGKEYNDFSLVIDSGFNC 183
           E DSL KAP + ++PF    EN K ISGK   G+ +        K+Y  F +VIDSGFNC
Sbjct: 124 EFDSLLKAPISGFMPFSKHTENTKVISGK---GDSESGTSTSETKDYEPFQMVIDSGFNC 180

Query: 184 TWVIPIVKGVPYYKAVKKLDVGGRFLNGLLKETISFRHYNVMDESILVNNIKEQCLYVDP 243
           TWV+PI+KGVP+YKAVKKLD+GGRF+NGLLKET+SFRHYNVMDE+ILVNNIKE+CL++ P
Sbjct: 181 TWVVPIIKGVPFYKAVKKLDLGGRFINGLLKETLSFRHYNVMDETILVNNIKEKCLFMSP 240

Query: 244 VSYFEAFKAKGKNKIDFVLPDFQTSFQGYVRDPKTALPDNAQILTLTDERFSVPEAFFHP 303
           VSYF++F  K +  +++VLPDFQT+F GYV D K     +AQ +TL DE FSVPE FFHP
Sbjct: 241 VSYFDSFAKKDQTAVEYVLPDFQTTFLGYVADRKNPPSKDAQTVTLRDELFSVPETFFHP 300

Query: 304 EISQSLKPGIIETVLESIYMLPELLRPLMASNIVCMGGNFNLPGFTDRLVSELQRQLPTD 363
           EI+Q LKPGIIET+LES+ ++PE LRPLM SNI+C GGNFNLP F +RL +ELQRQLPTD
Sbjct: 301 EIAQLLKPGIIETILESLSLVPEPLRPLMVSNILCTGGNFNLPHFPERLATELQRQLPTD 360

Query: 364 WVCRAKISSGDK-SLTGWTAMAKFAHTDAYKKARVTKEDYFEHGLDWTTKERFGYQNWV 421
           W  +  +       L GW +M+ FA TD YK ARV++++Y+EHG++WTTK RFGYQNW+
Sbjct: 361 WSAKIYLPQPKSCELAGWCSMSAFASTDLYKAARVSRQEYYEHGVEWTTKNRFGYQNWI 419

>TBLA0H01460 Chr8 complement(323962..325290) [1329 bp, 442 aa] {ON}
           Anc_8.258 YLR085C
          Length = 442

 Score =  564 bits (1453), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 261/440 (59%), Positives = 333/440 (75%), Gaps = 22/440 (5%)

Query: 4   DQAIVIDNGSYQVKFGLASEVRPRVALNALAKDKYGVTHLSNQVQNIKDISSVVFRRPHE 63
           D  IVIDNGSY++KFG+++   P  A+NA+AKDKY   +LSNQ++ IKDISSV FRRP+E
Sbjct: 3   DLPIVIDNGSYEIKFGVSNSRIPFRAINAIAKDKYNTVYLSNQIKGIKDISSVNFRRPYE 62

Query: 64  LGQLTSWELESCIWDYCLYNPDEF-GIDWQSLENRHVVLSETCMTLPELSKNTDQVLFEE 122
           LGQLTSWELES IWDYC YNP+EF G   +    +H+V+SETC++LPE S+N D ++FEE
Sbjct: 63  LGQLTSWELESAIWDYCFYNPEEFDGFQLEDTSKKHLVISETCLSLPEFSRNIDHIIFEE 122

Query: 123 YEVDSLYKAPTAAYIPFYTTNENIKTISGKSDH---------------GELDI-----EE 162
           Y   S+YK+P A +IPF    +++ +ISGK+D                 +L+      E 
Sbjct: 123 YNYGSIYKSPVAGFIPFADLTKDVISISGKADDDDDDNNAKFQEQLVTNDLNTYISSEEP 182

Query: 163 KIEAGKEYNDFSLVIDSGFNCTWVIPIVKGVPYYKAVKKLDVGGRFLNGLLKETISFRHY 222
            +    EY DF L+IDSGFNCTW+IP++KG+PYYKA+KK+D+GGRFL GLLKET+SFRHY
Sbjct: 183 SVTKTAEYKDFQLIIDSGFNCTWIIPVIKGIPYYKAIKKMDIGGRFLTGLLKETLSFRHY 242

Query: 223 NVMDESILVNNIKEQCLYVDPVSYFEAFKAKGKNKIDFVLPDFQTSFQGYVRD-PKTALP 281
           NV DE+ILVNNIKE+CL+V P SY E+FK K K  +++VLPDF T+F GY++D  KT LP
Sbjct: 243 NVTDETILVNNIKEKCLFVAPKSYAESFKLKNKTAVEYVLPDFHTTFMGYIKDNSKTKLP 302

Query: 282 DNAQILTLTDERFSVPEAFFHPEISQSLKPGIIETVLESIYMLPELLRPLMASNIVCMGG 341
           DNAQ++TL DE FSV E  FHPEIS+ LKPGIIET++ES+ MLPE++RPLM +NIVC+GG
Sbjct: 303 DNAQLITLKDELFSVTETIFHPEISRILKPGIIETIIESLSMLPEVIRPLMVNNIVCIGG 362

Query: 342 NFNLPGFTDRLVSELQRQLPTDWVCRAKISSGDKSLTGWTAMAKFAHTDAYKKARVTKED 401
           NFNLP F+ RL SELQRQLPTDW     I   D  L GW AMA+F+ TD+Y+KAR+T+E+
Sbjct: 363 NFNLPNFSKRLTSELQRQLPTDWTTHVYIPKIDAELFGWKAMAQFSDTDSYRKARITREE 422

Query: 402 YFEHGLDWTTKERFGYQNWV 421
           Y EHG++W TK RFGYQNW+
Sbjct: 423 YMEHGVEWCTKHRFGYQNWI 442

>KLTH0G13772g Chr7 (1188875..1190137) [1263 bp, 420 aa] {ON} similar
           to uniprot|Q12509 Saccharomyces cerevisiae YLR085C ARP6
           Nuclear actin-related protein involved in chromatin
           remodeling component of chromatin-remodeling enzyme
           complexes
          Length = 420

 Score =  561 bits (1445), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 253/416 (60%), Positives = 321/416 (77%), Gaps = 2/416 (0%)

Query: 7   IVIDNGSYQVKFGLASEVRPRVALNALAKDKYGVTHLSNQVQNIKDISSVVFRRPHELGQ 66
           IVIDNGSY++KFG AS   P  ALN++AKDKYG  HLSNQV++IKDISSV F RPH+LGQ
Sbjct: 6   IVIDNGSYEIKFGTASSNEPFTALNSIAKDKYGNYHLSNQVRSIKDISSVTFNRPHKLGQ 65

Query: 67  LTSWELESCIWDYCLYNPDEF-GIDWQSLENRHVVLSETCMTLPELSKNTDQVLFEEYEV 125
           L SWELES IWDYCL+NPDEF G    + +N+H++ SE+CMTLPELSKN DQV+FEEYE 
Sbjct: 66  LVSWELESQIWDYCLFNPDEFDGWSLDTTKNKHLIASESCMTLPELSKNMDQVVFEEYEY 125

Query: 126 DSLYKAPTAAYIPFYTTNENIKTISGKSDHGELDIEEKIEAGKEYNDFSLVIDSGFNCTW 185
           DSL+KAP   ++PF    +    +  K D  ++   +     K+Y D+ LVIDSGFNCTW
Sbjct: 126 DSLFKAPVPVFVPFNAEGDTTHILVAKED-ADVVASDHPSDNKDYRDYELVIDSGFNCTW 184

Query: 186 VIPIVKGVPYYKAVKKLDVGGRFLNGLLKETISFRHYNVMDESILVNNIKEQCLYVDPVS 245
           V+P++KGVPYYKAVKKLD+GGRFLNG L+E +SFRHYNVMDE+ILVN+IKE+CL++ P S
Sbjct: 185 VVPVIKGVPYYKAVKKLDIGGRFLNGFLREALSFRHYNVMDETILVNSIKEKCLFMSPNS 244

Query: 246 YFEAFKAKGKNKIDFVLPDFQTSFQGYVRDPKTALPDNAQILTLTDERFSVPEAFFHPEI 305
           YF++F+++ K   ++VLPDF TSFQGY+R P   LP+++Q + L DE F+VPE FFHPEI
Sbjct: 245 YFDSFQSRLKTAKEYVLPDFSTSFQGYLRKPGQTLPEDSQTIILQDELFAVPETFFHPEI 304

Query: 306 SQSLKPGIIETVLESIYMLPELLRPLMASNIVCMGGNFNLPGFTDRLVSELQRQLPTDWV 365
           +  L PGIIE +LESI MLPE LRPL+  N+V  GGNFN+P F  RL +ELQRQ PTDW 
Sbjct: 305 ASLLNPGIIEAILESISMLPEALRPLLVGNVVVTGGNFNIPNFASRLATELQRQCPTDWS 364

Query: 366 CRAKISSGDKSLTGWTAMAKFAHTDAYKKARVTKEDYFEHGLDWTTKERFGYQNWV 421
           CR  + +GD  L GW  M KF+ T AY+++RV++E+Y+EHG+DW T +RFGYQ W+
Sbjct: 365 CRVSVPTGDARLYGWKCMQKFSETQAYRESRVSREEYYEHGVDWCTSKRFGYQAWL 420

>SAKL0H17138g Chr8 (1515123..1516382) [1260 bp, 419 aa] {ON} highly
           similar to uniprot|Q74ZV8 Ashbya gossypii AGR091W ARP6
           Actin-like protein ARP6 and similar to uniprot|Q12509
           Saccharomyces cerevisiae YLR085C ARP6 Nuclear actin-
           related protein involved in chromatin remodeling
           component of chromatin-remodeling enzyme complexes
          Length = 419

 Score =  561 bits (1445), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 262/421 (62%), Positives = 323/421 (76%), Gaps = 7/421 (1%)

Query: 4   DQAIVIDNGSYQVKFGLASEVRPRVALNALAKDKYGVTHLSNQVQNIKDISSVVFRRPHE 63
           D  I+IDNGSY+VKFG A+   P  ALNALA+DKYG  HLSNQV  +KDIS+V FRRPHE
Sbjct: 3   DTPIIIDNGSYEVKFGPATNSTPFRALNALARDKYGNPHLSNQVSRLKDISNVQFRRPHE 62

Query: 64  LGQLTSWELESCIWDYCLYNPDEFGIDWQSLENRHVVLSETCMTLPELSKNTDQVLFEEY 123
           LGQLTSWEL+SCIWDYCLYNPDEF  +  + + +H+VLSE CM++PELSK TDQV+FEEY
Sbjct: 63  LGQLTSWELQSCIWDYCLYNPDEFNWEIGNTKGKHLVLSEMCMSMPELSKGTDQVVFEEY 122

Query: 124 EVDSLYKAPTAAYIPFYTTNENIKTISGKSDHGELDIEEKIEAGK--EYNDFSLVIDSGF 181
           E  S +K P A ++PF         I  K D     +  K   G+  EYNDF LVIDSGF
Sbjct: 123 EFGSCFKGPVAGFVPFNWQALEHNMIYAKED----SVYRKDSTGERNEYNDFQLVIDSGF 178

Query: 182 NCTWVIPIVKGVPYYKAVKKLDVGGRFLNGLLKETISFRHYNVMDESILVNNIKEQCLYV 241
           NCTWV+PIVKG+PYYKA+KKLD+GGRFLNG LKET+SFRHYNVMDE+ILVNNIKE+CL++
Sbjct: 179 NCTWVVPIVKGIPYYKAIKKLDIGGRFLNGFLKETLSFRHYNVMDETILVNNIKEKCLFM 238

Query: 242 DPVSYFEAFKAKGKNKIDFVLPDFQTSFQGYVRDPKTALPDNAQILTLTDERFSVPEAFF 301
            PVSYF +F+ K     ++VLPDFQTSFQGYV+  K  +P+++Q + L DE FS+PE FF
Sbjct: 239 SPVSYFNSFQKKEDTTAEYVLPDFQTSFQGYVKQQKQKIPEDSQTIKLYDELFSIPETFF 298

Query: 302 HPEISQSLKPGIIETVLESIYMLPELLRPLMASNIVCMGGNFNLPGFTDRLVSELQRQLP 361
           HPEI+  LKPGI+ET+LESI MLPE +RPLM SN V  GGNFN+  F  RL +ELQRQ P
Sbjct: 299 HPEIASLLKPGIVETILESISMLPEAIRPLMVSNTVVTGGNFNIRNFARRLATELQRQCP 358

Query: 362 TDW-VCRAKISSGDKSLTGWTAMAKFAHTDAYKKARVTKEDYFEHGLDWTTKERFGYQNW 420
           TDW VC +  ++ D +L GW +M +F+ T AY++ RVT+E+Y+EHG+DW TK+RFGYQ W
Sbjct: 359 TDWDVCVSVPNASDTALFGWDSMRQFSQTTAYQQTRVTREEYYEHGVDWCTKQRFGYQKW 418

Query: 421 V 421
           +
Sbjct: 419 L 419

>NDAI0B01960 Chr2 complement(477552..478871) [1320 bp, 439 aa] {ON}
           Anc_8.258 YLR085C
          Length = 439

 Score =  560 bits (1443), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 257/434 (59%), Positives = 334/434 (76%), Gaps = 19/434 (4%)

Query: 7   IVIDNGSYQVKFGLASEVRPRVALNALAKDKYGVTHLSNQVQNIKDISSVVFRRPHELGQ 66
           +V+DNGSY++KFGL++  RP  ALN  A DKYG  +LSNQ++ I+++S V  RRPHELGQ
Sbjct: 6   LVLDNGSYEIKFGLSNSERPYRALNGFAVDKYGSAYLSNQMKKIQEVSEVTLRRPHELGQ 65

Query: 67  LTSWELESCIWDYCLYNPDEF-GIDWQSLENRHVVLSETCMTLPELSKNTDQVLFEEYEV 125
           LTSWELESCIWDYCLYNPDEF G +      +H+++SE CMTLPELSKN DQV+FEEYE 
Sbjct: 66  LTSWELESCIWDYCLYNPDEFDGFELGGSGKKHLIVSEPCMTLPELSKNMDQVIFEEYEF 125

Query: 126 DSLYKAPTAAYIPFYTTNENIK----TISGKSDHGELD-------------IEEKIEAGK 168
           DSL+KAPTA YIPF    ++ K    TISGK +  ++               ++K +   
Sbjct: 126 DSLFKAPTAGYIPFGVQADDRKVLLDTISGKKNDDDMIGQSENVTISTDNLKDDKKKFSN 185

Query: 169 EYNDFSLVIDSGFNCTWVIPIVKGVPYYKAVKKLDVGGRFLNGLLKETISFRHYNVMDES 228
           +Y D+ LVIDSGFNCTW+IP++KGVPYYKA+KKLD+GGRFL GLLKET+SFRHY++MDE+
Sbjct: 186 DYQDYELVIDSGFNCTWIIPMIKGVPYYKAIKKLDIGGRFLTGLLKETLSFRHYDLMDET 245

Query: 229 ILVNNIKEQCLYVDPVSYFEAFKAKGKNKIDFVLPDFQTSFQGYVRDPKTA-LPDNAQIL 287
           +LVNNIKE+CL+V P SYF++FKAK +  ++++LPD  +S+ GY R+ K+  LP+ +Q++
Sbjct: 246 LLVNNIKEKCLFVSPTSYFDSFKAKEETSVEYILPDISSSYLGYTRENKSKPLPEGSQVV 305

Query: 288 TLTDERFSVPEAFFHPEISQSLKPGIIETVLESIYMLPELLRPLMASNIVCMGGNFNLPG 347
            L DE FSVPE FFHPEIS+ LKPGI+ET+LES+ M+PE+LRPL+ +NIVC GGNFNLP 
Sbjct: 306 KLYDELFSVPETFFHPEISRILKPGIVETILESLSMIPEILRPLLVANIVCTGGNFNLPH 365

Query: 348 FTDRLVSELQRQLPTDWVCRAKISSGDKSLTGWTAMAKFAHTDAYKKARVTKEDYFEHGL 407
           F  RL +ELQRQLPTDW CR  +   +  L  W +M +FA+TD+YKK R++KE+Y+EHG 
Sbjct: 366 FAARLAAELQRQLPTDWTCRISVPKKECELFSWKSMCQFANTDSYKKTRISKEEYYEHGP 425

Query: 408 DWTTKERFGYQNWV 421
           DW TK +FGYQNW+
Sbjct: 426 DWLTKHKFGYQNWL 439

>Kwal_56.23832 s56 (726199..727458) [1260 bp, 419 aa] {ON} YLR085C
           (ARP6) - Actin-related protein [contig 172] FULL
          Length = 419

 Score =  548 bits (1411), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 247/419 (58%), Positives = 319/419 (76%), Gaps = 3/419 (0%)

Query: 4   DQAIVIDNGSYQVKFGLASEVRPRVALNALAKDKYGVTHLSNQVQNIKDISSVVFRRPHE 63
           +  ++IDNGSY++KFG  SE  P  ALN++AKDKYG  HLSNQV++IKDISSVVF RPHE
Sbjct: 3   ESPLIIDNGSYEIKFGSGSEKEPHRALNSIAKDKYGNYHLSNQVRSIKDISSVVFNRPHE 62

Query: 64  LGQLTSWELESCIWDYCLYNPDEF-GIDWQSLENRHVVLSETCMTLPELSKNTDQVLFEE 122
           LGQL SWELE+ IWDYCL+NPD+F G    + + +H++ SE+CMT+PELSKN DQV+FEE
Sbjct: 63  LGQLVSWELETQIWDYCLFNPDDFNGWSIDTTKGKHLITSESCMTIPELSKNMDQVVFEE 122

Query: 123 YEVDSLYKAPTAAYIPFYTTNENIKTISGKSDHGELDIEEKIEAGKEYNDFSLVIDSGFN 182
           YE ++++KAP   ++PF T  ++   +  K D      E ++   K YNDF LVIDSGFN
Sbjct: 123 YEFETMFKAPVPVFVPFNTGKKSTHMLVAKED--SEVEESEVAPAKNYNDFQLVIDSGFN 180

Query: 183 CTWVIPIVKGVPYYKAVKKLDVGGRFLNGLLKETISFRHYNVMDESILVNNIKEQCLYVD 242
           C+W++P++KGVPYYKAVKKLD+GGRFLNG L+E +SFRHYNVMDE+ILVN+IKE CL++ 
Sbjct: 181 CSWIVPVIKGVPYYKAVKKLDIGGRFLNGFLREALSFRHYNVMDETILVNSIKENCLFMS 240

Query: 243 PVSYFEAFKAKGKNKIDFVLPDFQTSFQGYVRDPKTALPDNAQILTLTDERFSVPEAFFH 302
           P +YFE+F+++ K   ++VLPDF TSFQGY+R P   LP  +Q + L DE F+VPE FFH
Sbjct: 241 PNAYFESFQSRSKTAKEYVLPDFNTSFQGYLRKPGQVLPAESQTIVLQDELFAVPETFFH 300

Query: 303 PEISQSLKPGIIETVLESIYMLPELLRPLMASNIVCMGGNFNLPGFTDRLVSELQRQLPT 362
           PEI+  L  GI+ET+LESI MLPE +RPLM  NIV  GGNFN+P F  RL +ELQRQ PT
Sbjct: 301 PEIASLLNSGIVETILESISMLPEAIRPLMVGNIVITGGNFNIPNFASRLATELQRQCPT 360

Query: 363 DWVCRAKISSGDKSLTGWTAMAKFAHTDAYKKARVTKEDYFEHGLDWTTKERFGYQNWV 421
           DW CR  +  GD  L GW  M KF+ T+ Y ++RVT+++Y+EHG+DW T +RFGYQ W+
Sbjct: 361 DWSCRVSLPKGDAGLYGWKCMQKFSETEDYHESRVTRQEYYEHGVDWCTAKRFGYQAWL 419

>KNAG0G02010 Chr7 complement(447621..448895) [1275 bp, 424 aa] {ON}
           Anc_8.258 YLR085C
          Length = 424

 Score =  544 bits (1402), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 253/422 (59%), Positives = 323/422 (76%), Gaps = 10/422 (2%)

Query: 8   VIDNGSYQVKFGLASEVRPRVALNALAKDKYGVTHLSNQVQNIKDISSVVFRRPHELGQL 67
           VIDNGSY++KFG A+ V P  A N +AKDKYG ++LSN ++ I+DISS   RRPHELGQL
Sbjct: 5   VIDNGSYEIKFGHANLVTPFRANNGIAKDKYGASYLSNHMKTIRDISSATIRRPHELGQL 64

Query: 68  TSWELESCIWDYCLYNPDEF-GIDW-QSLENRHVVLSETCMTLPELSKNTDQVLFEEYEV 125
            SWELE CIWDYCLYNPDEF G     +   + ++L+ETC TLPELSKN+DQV+FEEYE 
Sbjct: 65  VSWELEGCIWDYCLYNPDEFDGFHLGDNTREQDLILTETCFTLPELSKNSDQVVFEEYEF 124

Query: 126 DSLYKAPTAAYIPFYTT--NENIKTISGKSDHGELDIEEKIEAGKEYNDFSLVIDSGFNC 183
            +++K+P + ++PF     N+N++ + GK     ++ +      KEY DF LVIDSGFNC
Sbjct: 125 ATMFKSPASGFMPFANLIGNKNMEHLCGKDT--AVNTDYTTATTKEYRDFQLVIDSGFNC 182

Query: 184 TWVIPIVKGVPYYKAVKKLDVGGRFLNGLLKETISFRHYNVMDESILVNNIKEQCLYVDP 243
           TWV+PI+KGVP+YKA+KK+D+GGRFLNGLLKET+SFRHYN+MDE+IL+NNIKE+CL+V P
Sbjct: 183 TWVVPIIKGVPFYKAIKKMDIGGRFLNGLLKETLSFRHYNMMDETILLNNIKEKCLFVSP 242

Query: 244 VSYFEAFKAKGKNKIDFVLPDFQTSFQGYVRDP---KTALPDNAQILTLTDERFSVPEAF 300
           VSYF++FK K +  +++VLPDFQTSF GY+ D    K     + Q +TLTDERF+VPE F
Sbjct: 243 VSYFDSFKTKQQQAVEYVLPDFQTSFLGYLVDESNRKGIDRGSVQTITLTDERFAVPETF 302

Query: 301 FHPEISQSLKPGIIETVLESIYMLPELLRPLMASNIVCMGGNFNLPGFTDRLVSELQRQL 360
           FHPE++  LKPG++ET+LE+I M+PE LRP++ SNIVC+GGNF LP  + RL SELQRQL
Sbjct: 303 FHPEMANILKPGLVETILEAISMVPEPLRPILVSNIVCVGGNFKLPHMSSRLTSELQRQL 362

Query: 361 PTDWVCRAKI-SSGDKSLTGWTAMAKFAHTDAYKKARVTKEDYFEHGLDWTTKERFGYQN 419
           PTDW CR  + SS D  L  W AMA+F+ TD YK  RVT+E+Y EHG DW +K RF YQN
Sbjct: 363 PTDWTCRVTVPSSSDCELAAWNAMAQFSSTDVYKTTRVTREEYLEHGTDWCSKHRFTYQN 422

Query: 420 WV 421
           W+
Sbjct: 423 WI 424

>Ecym_4312 Chr4 (671413..672648) [1236 bp, 411 aa] {ON} similar to
           Ashbya gossypii AGR091W
          Length = 411

 Score =  540 bits (1390), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 249/415 (60%), Positives = 315/415 (75%), Gaps = 8/415 (1%)

Query: 7   IVIDNGSYQVKFGLASEVRPRVALNALAKDKYGVTHLSNQVQNIKDISSVVFRRPHELGQ 66
           I+IDNGSY++KFG +S   P  ALN LA+DKYG  HLSNQ++ I+++S+   RRP ELGQ
Sbjct: 5   IIIDNGSYEIKFGPSSLKSPYRALNCLARDKYGRYHLSNQMKQIREVSNCHVRRPFELGQ 64

Query: 67  LTSWELESCIWDYCLYNPDEFGIDWQSLENRHVVLSETCMTLPELSKNTDQVLFEEYEVD 126
           L SWELE  IWDYCL+N DEF  D +  ++  +++SETCM++PE+SK+ DQV+FEEYE  
Sbjct: 65  LVSWELEEHIWDYCLFNSDEFSWDLKDSKDVDLIVSETCMSIPEISKHMDQVVFEEYEFG 124

Query: 127 SLYKAPTAAYIPFYTTNENIKTISGKSDHGELDIEEKIEAGKEYNDFSLVIDSGFNCTWV 186
           SL K P A YIPF    +N+         G   + +K     +YNDF LV+DSGFNCTWV
Sbjct: 125 SLMKCPVAQYIPF----DNMADYKVYGSDGLPVVRKK----DDYNDFQLVVDSGFNCTWV 176

Query: 187 IPIVKGVPYYKAVKKLDVGGRFLNGLLKETISFRHYNVMDESILVNNIKEQCLYVDPVSY 246
           IP++KGVPYYKAVKKLD+GGRFL GLLKET+SFRHYN+MDE+IL NNIKEQC ++ PVSY
Sbjct: 177 IPVIKGVPYYKAVKKLDIGGRFLTGLLKETVSFRHYNLMDETILANNIKEQCCFMPPVSY 236

Query: 247 FEAFKAKGKNKIDFVLPDFQTSFQGYVRDPKTALPDNAQILTLTDERFSVPEAFFHPEIS 306
           F++F+ K + +ID+VLPDFQTS  GYVR PK A+P+++Q L L DE F++PE FFHPEI+
Sbjct: 237 FDSFQKKAETRIDYVLPDFQTSLIGYVRQPKQAIPEDSQTLNLEDELFTIPETFFHPEIA 296

Query: 307 QSLKPGIIETVLESIYMLPELLRPLMASNIVCMGGNFNLPGFTDRLVSELQRQLPTDWVC 366
             LKPG+IETVLESI MLPEL+RPLM SNI  +GGNFN+  F  RL +ELQRQ PTDW  
Sbjct: 297 NILKPGLIETVLESISMLPELIRPLMVSNIAVIGGNFNISNFASRLATELQRQCPTDWSV 356

Query: 367 RAKISSGDKSLTGWTAMAKFAHTDAYKKARVTKEDYFEHGLDWTTKERFGYQNWV 421
           R  +  GD  L GW AM +F++TD+YK+ RVT+ +Y EHG+DW TK RFGY+ W+
Sbjct: 357 RVHLPKGDTELQGWKAMMRFSNTDSYKQGRVTRAEYLEHGVDWCTKYRFGYEQWI 411

>TPHA0A01830 Chr1 (369897..371162) [1266 bp, 421 aa] {ON} Anc_8.258
           YLR085C
          Length = 421

 Score =  533 bits (1373), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 254/427 (59%), Positives = 322/427 (75%), Gaps = 15/427 (3%)

Query: 3   ADQAIVIDNGSYQVKFGLASEVRPRVALNALAKDKYGVTHLSNQVQNIKDISSVVFRRPH 62
            +  ++IDNGSY++KFG +++  P VALNALAKDKY   +LSNQ+ NIKDISSV  +RPH
Sbjct: 2   GEAPLLIDNGSYEIKFGYSNQETPFVALNALAKDKYETYYLSNQINNIKDISSVSIKRPH 61

Query: 63  ELGQLTSWELESCIWDYCLYNPDEF-GIDWQSLENRHVVLSETCMTLPELSKNTDQVLFE 121
           +LGQL SWELE  IWDYC YN D+F G +       H+VL+ET MTLPELS+NTDQV+FE
Sbjct: 62  QLGQLVSWELEHEIWDYCFYNGDDFKGFEVNEDSENHLVLTETPMTLPELSRNTDQVVFE 121

Query: 122 EYEVDSLYKAPTAAYIPFYTTNEN-IKTISGKSDHGELDIEEKIEAGKE--YNDFSLVID 178
           EY  DSLYKAP A +IPF   ++N    +SGKS       +  ++  KE  Y DF+LVID
Sbjct: 122 EYGFDSLYKAPAANFIPFIKNDDNSFIRLSGKS-------KTYLDGSKENNYQDFNLVID 174

Query: 179 SGFNCTWVIPIVKGVPYYKAVKKLDVGGRFLNGLLKETISFRHYNVMDESILVNNIKEQC 238
           SG+NC+W+IP++KGVPYYKAVKK+D+GGRFLNGLLKETIS+RHY+V DES+LVNNIKE C
Sbjct: 175 SGYNCSWIIPMIKGVPYYKAVKKMDMGGRFLNGLLKETISYRHYDVTDESMLVNNIKENC 234

Query: 239 LYVDPVSYFEAFKAKGKNKIDFVLPDFQTSFQGYVRDPK--TALPDNAQILTLTDERFSV 296
           +++ PVSY E+FK K   K+++VLPDFQTSF GYVRD K  + LP+++Q + L DE FSV
Sbjct: 235 MFISPVSYIESFKKKALTKVEYVLPDFQTSFMGYVRDMKKHSTLPEHSQSIILEDELFSV 294

Query: 297 PEAFFHPEISQSLKPGIIETVLESIYMLPELLRPLMASNIVCMGGNFNLPGFTDRLVSEL 356
           PE FFHPE++  LKPGIIET+LES+++LPE LR LM +NIVC GGNFN+P F  R+ +EL
Sbjct: 295 PEGFFHPEMANVLKPGIIETILESLFILPESLRSLMVNNIVCTGGNFNIPNFGSRIYTEL 354

Query: 357 QRQLPTDWVCRAKISSGDKSLTGWTAMAKFAHTDA--YKKARVTKEDYFEHGLDWTTKER 414
           Q+Q+ T+WVC   I   +  L  W AM  F   +   YK  RVTK++Y EHG +WTTK+R
Sbjct: 355 QKQVQTEWVCDVSIPKANAELQNWKAMKSFTENNEELYKHTRVTKQEYNEHGFEWTTKQR 414

Query: 415 FGYQNWV 421
           FGYQNW+
Sbjct: 415 FGYQNWL 421

>KLLA0F19063g Chr6 complement(1756529..1757776) [1248 bp, 415 aa]
           {ON} similar to uniprot|Q12509 Saccharomyces cerevisiae
           YLR085C ARP6 Nuclear actin-related protein involved in
           chromatin remodeling component of chromatin-remodeling
           enzyme complexes
          Length = 415

 Score =  527 bits (1357), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 249/424 (58%), Positives = 308/424 (72%), Gaps = 15/424 (3%)

Query: 3   ADQAIVIDNGSYQVKFGLASEVRPRVALNALAKDKYGVTHLSNQVQNIKDISSVVFRRPH 62
           ++  +VIDNGSY++KFG +   +P  ALN L KDKY   HLSNQ + ++DIS  + RRPH
Sbjct: 2   SEPVLVIDNGSYEIKFGESGWDQPLRALNCLTKDKYSRFHLSNQTKKMRDISQALIRRPH 61

Query: 63  ELGQLTSWELESCIWDYCLYNPDEFGIDW---QSLENRHVVLSETCMTLPELSKNTDQVL 119
           ELGQL SWELES +WDYC YN D+F  +       ++ H+V+SET MT+PELSKN DQV+
Sbjct: 62  ELGQLVSWELESEVWDYCFYNEDDFHWNLTHDNDTKDHHLVVSETLMTIPELSKNMDQVI 121

Query: 120 FEEYEVDSLYKAPTAAYIPFYTTNENIKTISGKSDHGELDIEEKIEAGKEYNDFSLVIDS 179
           FEEY+  S++K P A YIPFY        ++   D          +    Y DF LVIDS
Sbjct: 122 FEEYDFKSMFKGPVAQYIPFYQGQYQDDAMTAAED----------KKTSSYKDFQLVIDS 171

Query: 180 GFNCTWVIPIVKGVPYYKAVKKLDVGGRFLNGLLKETISFRHYNVMDESILVNNIKEQCL 239
           GFNCTW +PI+KGVPYYKA+KKLD+GGRFL GLL+ETISFRHYNVM+E+ILVNNIKEQC 
Sbjct: 172 GFNCTWAVPIIKGVPYYKAIKKLDIGGRFLTGLLQETISFRHYNVMEETILVNNIKEQCT 231

Query: 240 YVDPVSYFEAFKAKGKNKIDFVLPDFQTSFQGYVRDP-KTALPDNAQILTLTDERFSVPE 298
           +V P SYF +F  K   K+++VLPDFQTSF GYV+ P K  L D+AQ L LTDE FSVPE
Sbjct: 232 FVPPESYFSSFHNKMNTKVEYVLPDFQTSFLGYVKKPGKEKLTDDAQTLLLTDEVFSVPE 291

Query: 299 AFFHPEISQSLKPGIIETVLESIYMLPELLRPLMASNIVCMGGNFNLPGFTDRLVSELQR 358
            FFHPEI+Q LKPGI+ET+LE I M PE++RPL+ +NIVC GGNFN+P F +RL +ELQR
Sbjct: 292 TFFHPEIAQILKPGIVETILECINMCPEVVRPLLVANIVCTGGNFNIPNFHERLQTELQR 351

Query: 359 QLPTDWVCRAKI-SSGDKSLTGWTAMAKFAHTDAYKKARVTKEDYFEHGLDWTTKERFGY 417
           Q P DW C+       DKSL GW +M  FA++D ++ ARVT+E+Y EHGLDW TK RFGY
Sbjct: 352 QCPIDWSCKVHSPQEKDKSLHGWESMKDFANSDQFRSARVTREEYLEHGLDWCTKNRFGY 411

Query: 418 QNWV 421
           Q W+
Sbjct: 412 QQWL 415

>AGR091W Chr7 (907238..908470) [1233 bp, 410 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YLR085C (ARP6)
          Length = 410

 Score =  525 bits (1353), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 239/415 (57%), Positives = 308/415 (74%), Gaps = 9/415 (2%)

Query: 7   IVIDNGSYQVKFGLASEVRPRVALNALAKDKYGVTHLSNQVQNIKDISSVVFRRPHELGQ 66
           ++++NGSY++KFG A+   P  A N L +D+YG  HLSNQ+  I+DIS    RRP ELGQ
Sbjct: 5   LLMENGSYEIKFGPANLETPYRARNCLTRDRYGRYHLSNQMDQIRDISHCHIRRPSELGQ 64

Query: 67  LTSWELESCIWDYCLYNPDEFGIDWQSLENRHVVLSETCMTLPELSKNTDQVLFEEYEVD 126
           L SWELE  IWDYCL+NPDEFG + +  ++  ++ SETCMT+PE+SKN DQV+FEEYE  
Sbjct: 65  LISWELEEQIWDYCLFNPDEFGWELKDSKDVDLIASETCMTIPEISKNMDQVVFEEYEFG 124

Query: 127 SLYKAPTAAYIPFYTTNENIKTISGKSDHGELDIEEKIEAGKEYNDFSLVIDSGFNCTWV 186
           S+ K P A ++PF     +   + G          E +EA   YN+F LV+DSGFNCTWV
Sbjct: 125 SMMKCPVAQFVPF-DRARDYDIVGGAG--------EVVEAKSGYNNFQLVVDSGFNCTWV 175

Query: 187 IPIVKGVPYYKAVKKLDVGGRFLNGLLKETISFRHYNVMDESILVNNIKEQCLYVDPVSY 246
           +P++KGVPYYKA KKLD+GGRFLNGLLKETISFRHYNVMDE+IL+NNIKEQC ++ PVSY
Sbjct: 176 MPVIKGVPYYKATKKLDIGGRFLNGLLKETISFRHYNVMDETILINNIKEQCCFMPPVSY 235

Query: 247 FEAFKAKGKNKIDFVLPDFQTSFQGYVRDPKTALPDNAQILTLTDERFSVPEAFFHPEIS 306
           F++F+ K + +++++LPDFQTS  GYVR PK A+P  +QIL L DE F+VPE FFHPEIS
Sbjct: 236 FDSFQRKEETRVEYILPDFQTSLIGYVRQPKQAIPKTSQILRLEDELFTVPETFFHPEIS 295

Query: 307 QSLKPGIIETVLESIYMLPELLRPLMASNIVCMGGNFNLPGFTDRLVSELQRQLPTDWVC 366
             LKPG++ET+LE + M+PE+LRPL+ SNIV +GGNFN+  F  RL +ELQRQ PTDW  
Sbjct: 296 NILKPGLVETILECVSMVPEVLRPLLVSNIVAVGGNFNIANFATRLATELQRQCPTDWKV 355

Query: 367 RAKISSGDKSLTGWTAMAKFAHTDAYKKARVTKEDYFEHGLDWTTKERFGYQNWV 421
           R      D +L GW +M +F+ TD+YK +RVT+ +Y EHG DW TK RFGY+ W+
Sbjct: 356 RVHQPKLDAALQGWKSMRQFSQTDSYKNSRVTRSEYLEHGADWCTKHRFGYEQWI 410

>NCAS0C03700 Chr3 complement(745133..746250,746901..746910) [1128
           bp, 375 aa] {ON} Anc_8.23 YFL039C
          Length = 375

 Score =  123 bits (309), Expect = 7e-31,   Method: Compositional matrix adjust.
 Identities = 110/417 (26%), Positives = 179/417 (42%), Gaps = 73/417 (17%)

Query: 6   AIVIDNGSYQVKFGLASEVRPRVALNALA--------------KDKYGVTHLSNQVQNIK 51
           A+VIDNGS   K G A +  PR    ++               KD Y    + ++ Q+ +
Sbjct: 7   ALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQKDSY----VGDEAQSKR 62

Query: 52  DISSVVFRRPHELGQLTSWELESCIWDYCLYNPDEFGIDWQSLENRHVVLSETCMTLPEL 111
            I  +  R P E G +T+W+    IW +  YN  E  +   + E   V+L+E  M     
Sbjct: 63  GI--LTLRYPIEHGIVTNWDDMEKIWHHTFYN--ELRV---APEEHPVLLTEAPMNPKSN 115

Query: 112 SKNTDQVLFEEYEVDSLYKAPTAAYIPFYTTNENIKTISGKSDHGELDIEEKIEAGKEYN 171
            +   Q++FE + V + Y +   A +  Y+        SG++                  
Sbjct: 116 REKMTQIMFETFNVPAFYVS-IQAVLSLYS--------SGRTT----------------- 149

Query: 172 DFSLVIDSGFNCTWVIPIVKGVPYYKAVKKLDVGGRFLNGLLKETISFRHYN--VMDESI 229
              +V+DSG   T V+PI  G     A+ ++D+ GR L   L + +S R Y+     E  
Sbjct: 150 --GIVLDSGDGVTHVVPIYAGFSLPHAILRIDLAGRDLTDYLMKILSERGYSFSTTAERE 207

Query: 230 LVNNIKEQCLYVDPVSYFEAFKAKGKNKIDFVLPDFQTSFQGYVRDPKTALPDNAQILTL 289
           +V +IKE+  YV                +DF   + QT+ Q    +    LPD  Q++T+
Sbjct: 208 IVRDIKEKLCYV---------------ALDFE-QEMQTAAQSSSIEKSYELPD-GQVITI 250

Query: 290 TDERFSVPEAFFHPEISQSLKPGIIETVLESIYMLPELLRPLMASNIVCMGGNFNLPGFT 349
            +ERF  PEA FHP I      GI +T   SI      +R  +  NIV  GG    PG  
Sbjct: 251 GNERFRAPEALFHPSILSLESAGIDQTTYNSIMKCDVDVRKELYGNIVMSGGTTMFPGIA 310

Query: 350 DRLVSELQRQLPTDWVCRAKISSGDKSLTGWTAMAKFAHTDAYKKARVTKEDYFEHG 406
           +R+  E+    P+    +  I+  ++  + W   +  A    +++  ++K++Y E G
Sbjct: 311 ERMQKEITALAPSSMKVKI-IAPPERKYSVWIGGSILASLTTFQQMWISKQEYDESG 366

>TBLA0C00440 Chr3 complement(81591..82708,83412..83421) [1128 bp,
           375 aa] {ON} Anc_8.23 YFL039C
          Length = 375

 Score =  123 bits (308), Expect = 9e-31,   Method: Compositional matrix adjust.
 Identities = 109/417 (26%), Positives = 179/417 (42%), Gaps = 73/417 (17%)

Query: 6   AIVIDNGSYQVKFGLASEVRPRVALNALA--------------KDKYGVTHLSNQVQNIK 51
           A+VIDNGS   K G A +  PR    ++               KD Y    + ++ Q+ +
Sbjct: 7   ALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQKDSY----VGDEAQSKR 62

Query: 52  DISSVVFRRPHELGQLTSWELESCIWDYCLYNPDEFGIDWQSLENRHVVLSETCMTLPEL 111
            I  +  R P E G +T+W+    IW +  YN  E  +   + E   V+L+E  M     
Sbjct: 63  GI--LTLRYPIEHGIVTNWDDMEKIWHHTFYN--ELRV---APEEHPVLLTEAPMNPKSN 115

Query: 112 SKNTDQVLFEEYEVDSLYKAPTAAYIPFYTTNENIKTISGKSDHGELDIEEKIEAGKEYN 171
            +   Q++FE + V + Y +   A +  Y+        SG++                  
Sbjct: 116 REKMTQIMFETFNVPAFYVS-IQAVLSLYS--------SGRTT----------------- 149

Query: 172 DFSLVIDSGFNCTWVIPIVKGVPYYKAVKKLDVGGRFLNGLLKETISFRHYN--VMDESI 229
              +V+DSG   T V+PI  G     A+ ++D+ GR L   L + +S R Y+     E  
Sbjct: 150 --GIVLDSGDGVTHVVPIYAGFSLPHAIMRIDLAGRDLTDYLMKILSERGYSFSTTAERE 207

Query: 230 LVNNIKEQCLYVDPVSYFEAFKAKGKNKIDFVLPDFQTSFQGYVRDPKTALPDNAQILTL 289
           +V +IKE+  YV                +DF   + QT+ Q    +    LPD  Q++T+
Sbjct: 208 IVRDIKEKLCYV---------------ALDFE-QEMQTAAQSSSIEKSYELPD-GQVITI 250

Query: 290 TDERFSVPEAFFHPEISQSLKPGIIETVLESIYMLPELLRPLMASNIVCMGGNFNLPGFT 349
            +ERF  PEA FHP +      GI +T   SI      +R  +  NIV  GG    PG  
Sbjct: 251 GNERFRAPEALFHPSVLSLESAGIDQTTYNSIMKCDVDVRKELYGNIVMSGGTTMFPGIA 310

Query: 350 DRLVSELQRQLPTDWVCRAKISSGDKSLTGWTAMAKFAHTDAYKKARVTKEDYFEHG 406
           +R+  E+    P+    +  I+  ++  + W   +  A    +++  ++K++Y E G
Sbjct: 311 ERMQKEITALAPSSMEVKI-IAPPERKYSVWIGGSILASLTTFQQMWISKQEYDESG 366

>SAKL0B00968g Chr2 complement(89966..91083,91524..91533) [1128 bp,
           375 aa] {ON} highly similar to uniprot|P02579
           Saccharomyces cerevisiae YFL039C ACT1 Actin
          Length = 375

 Score =  122 bits (307), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 109/417 (26%), Positives = 179/417 (42%), Gaps = 73/417 (17%)

Query: 6   AIVIDNGSYQVKFGLASEVRPRVALNALA--------------KDKYGVTHLSNQVQNIK 51
           A+VIDNGS   K G A +  PR    ++               KD Y    + ++ Q+ +
Sbjct: 7   ALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQKDSY----VGDEAQSKR 62

Query: 52  DISSVVFRRPHELGQLTSWELESCIWDYCLYNPDEFGIDWQSLENRHVVLSETCMTLPEL 111
            I  +  R P E G +T+W+    IW +  YN  E  +   + E   V+L+E  M     
Sbjct: 63  GI--LTLRYPIEHGIVTNWDDMEKIWHHTFYN--ELRV---APEEHPVLLTEAPMNPKSN 115

Query: 112 SKNTDQVLFEEYEVDSLYKAPTAAYIPFYTTNENIKTISGKSDHGELDIEEKIEAGKEYN 171
            +   Q+LFE + V + Y +   A +  Y+        SG++                  
Sbjct: 116 REKMTQILFETFNVPAFYVS-IQAVLSLYS--------SGRTT----------------- 149

Query: 172 DFSLVIDSGFNCTWVIPIVKGVPYYKAVKKLDVGGRFLNGLLKETISFRHYN--VMDESI 229
              +V+DSG   T V+PI  G     A+ ++D+ GR +   L + +S R Y+     E  
Sbjct: 150 --GIVLDSGDGVTHVVPIYAGFSLPHAILRIDLAGRDMTDYLMKILSERGYSFSTTAERE 207

Query: 230 LVNNIKEQCLYVDPVSYFEAFKAKGKNKIDFVLPDFQTSFQGYVRDPKTALPDNAQILTL 289
           +V +IKE+  YV                +DF   + QT+ Q    +    LPD  Q++T+
Sbjct: 208 IVRDIKEKLCYV---------------ALDFE-QEMQTAAQSSAIEKSYELPD-GQVITI 250

Query: 290 TDERFSVPEAFFHPEISQSLKPGIIETVLESIYMLPELLRPLMASNIVCMGGNFNLPGFT 349
            +ERF  PEA FHP +      GI +T   SI      +R  +  NIV  GG    PG  
Sbjct: 251 GNERFRAPEALFHPSVLGLEAAGIDQTTYNSIMKCDVDVRKELYGNIVMSGGTTMFPGIA 310

Query: 350 DRLVSELQRQLPTDWVCRAKISSGDKSLTGWTAMAKFAHTDAYKKARVTKEDYFEHG 406
           +R+  E+    P+    +  I+  ++  + W   +  A    +++  ++K++Y E G
Sbjct: 311 ERMQKEITALAPSSMKVKI-IAPPERKYSVWIGGSILASLTTFQQMWISKQEYDESG 366

>TPHA0D00250 Chr4 complement(34030..35147,35712..35721) [1128 bp,
           375 aa] {ON} Anc_8.23 YFL039C
          Length = 375

 Score =  122 bits (306), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 109/417 (26%), Positives = 179/417 (42%), Gaps = 73/417 (17%)

Query: 6   AIVIDNGSYQVKFGLASEVRPRVALNALA--------------KDKYGVTHLSNQVQNIK 51
           A+VIDNGS   K G A +  PR    ++               KD Y    + ++ Q+ +
Sbjct: 7   ALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQKDSY----VGDEAQSKR 62

Query: 52  DISSVVFRRPHELGQLTSWELESCIWDYCLYNPDEFGIDWQSLENRHVVLSETCMTLPEL 111
            I  +  R P E G +T+W+    IW +  YN  E  +   + E   V+L+E  M     
Sbjct: 63  GI--LTLRYPIEHGIVTNWDDMEKIWHHTFYN--ELRV---APEEHPVLLTEAPMNPKSN 115

Query: 112 SKNTDQVLFEEYEVDSLYKAPTAAYIPFYTTNENIKTISGKSDHGELDIEEKIEAGKEYN 171
            +   Q++FE + V + Y +   A +  Y+        SG++                  
Sbjct: 116 REKMTQIMFETFNVPAFYVS-IQAVLSLYS--------SGRTT----------------- 149

Query: 172 DFSLVIDSGFNCTWVIPIVKGVPYYKAVKKLDVGGRFLNGLLKETISFRHYN--VMDESI 229
              +V+DSG   T V+PI  G     A+ ++D+ GR L   L + +S R Y+     E  
Sbjct: 150 --GIVLDSGDGVTHVVPIYAGFSLPHAILRIDLAGRDLTDYLMKILSERGYSFSTTAERE 207

Query: 230 LVNNIKEQCLYVDPVSYFEAFKAKGKNKIDFVLPDFQTSFQGYVRDPKTALPDNAQILTL 289
           +V +IKE+  YV                +DF   + QT+ Q    +    LPD  Q++T+
Sbjct: 208 IVRDIKEKLCYV---------------ALDFE-QEMQTAAQSSSIEKSYELPD-GQVITI 250

Query: 290 TDERFSVPEAFFHPEISQSLKPGIIETVLESIYMLPELLRPLMASNIVCMGGNFNLPGFT 349
            +ERF  PEA FHP +      GI +T   SI      +R  +  NIV  GG    PG  
Sbjct: 251 GNERFRAPEALFHPSVLSLESAGIDQTTYNSIMKCDIDVRKELYGNIVMSGGTTMFPGIA 310

Query: 350 DRLVSELQRQLPTDWVCRAKISSGDKSLTGWTAMAKFAHTDAYKKARVTKEDYFEHG 406
           +R+  E+    P+    +  I+  ++  + W   +  A    +++  ++K++Y E G
Sbjct: 311 ERMQKEITALAPSSMKVKI-IAPPERKYSVWIGGSILASLTTFQQMWISKQEYDESG 366

>TDEL0C00470 Chr3 complement(72546..73663,73929..73938) [1128 bp,
           375 aa] {ON} 
          Length = 375

 Score =  122 bits (306), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 109/417 (26%), Positives = 179/417 (42%), Gaps = 73/417 (17%)

Query: 6   AIVIDNGSYQVKFGLASEVRPRVALNALA--------------KDKYGVTHLSNQVQNIK 51
           A+VIDNGS   K G A +  PR    ++               KD Y    + ++ Q+ +
Sbjct: 7   ALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQKDSY----VGDEAQSKR 62

Query: 52  DISSVVFRRPHELGQLTSWELESCIWDYCLYNPDEFGIDWQSLENRHVVLSETCMTLPEL 111
            I  +  R P E G +T+W+    IW +  YN  E  +   + E   V+L+E  M     
Sbjct: 63  GI--LTLRYPIEHGIVTNWDDMEKIWHHTFYN--ELRV---APEEHPVLLTEAPMNPKSN 115

Query: 112 SKNTDQVLFEEYEVDSLYKAPTAAYIPFYTTNENIKTISGKSDHGELDIEEKIEAGKEYN 171
            +   Q++FE + V + Y +   A +  Y+        SG++                  
Sbjct: 116 REKMTQIMFETFNVPAFYVS-IQAVLSLYS--------SGRTT----------------- 149

Query: 172 DFSLVIDSGFNCTWVIPIVKGVPYYKAVKKLDVGGRFLNGLLKETISFRHYN--VMDESI 229
              +V+DSG   T V+PI  G     A+ ++D+ GR L   L + +S R Y+     E  
Sbjct: 150 --GIVLDSGDGVTHVVPIYAGFSLPHAILRIDLAGRDLTDYLMKILSERGYSFSTTAERE 207

Query: 230 LVNNIKEQCLYVDPVSYFEAFKAKGKNKIDFVLPDFQTSFQGYVRDPKTALPDNAQILTL 289
           +V +IKE+  YV                +DF   + QT+ Q    +    LPD  Q++T+
Sbjct: 208 IVRDIKEKLCYV---------------ALDFE-QEMQTAAQSSSIEKSYELPD-GQVITI 250

Query: 290 TDERFSVPEAFFHPEISQSLKPGIIETVLESIYMLPELLRPLMASNIVCMGGNFNLPGFT 349
            +ERF  PEA FHP +      GI +T   SI      +R  +  NIV  GG    PG  
Sbjct: 251 GNERFRAPEALFHPSVLGLESAGIDQTTYNSIMKCDVDVRKELYGNIVMSGGTTMFPGIA 310

Query: 350 DRLVSELQRQLPTDWVCRAKISSGDKSLTGWTAMAKFAHTDAYKKARVTKEDYFEHG 406
           +R+  E+    P+    +  I+  ++  + W   +  A    +++  ++K++Y E G
Sbjct: 311 ERMQKEITALAPSSMKVKI-IAPPERKYSVWIGGSILASLTTFQQMWISKQEYDESG 366

>CAGL0K12694g Chr11 (1258451..1258460,1259340..1260457) [1128 bp,
           375 aa] {ON} highly similar to uniprot|P02579
           Saccharomyces cerevisiae YFL039c ACT1 actin
          Length = 375

 Score =  122 bits (306), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 109/417 (26%), Positives = 179/417 (42%), Gaps = 73/417 (17%)

Query: 6   AIVIDNGSYQVKFGLASEVRPRVALNALA--------------KDKYGVTHLSNQVQNIK 51
           A+VIDNGS   K G A +  PR    ++               KD Y    + ++ Q+ +
Sbjct: 7   ALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQKDSY----VGDEAQSKR 62

Query: 52  DISSVVFRRPHELGQLTSWELESCIWDYCLYNPDEFGIDWQSLENRHVVLSETCMTLPEL 111
            I  +  R P E G +T+W+    IW +  YN  E  +   + E   V+L+E  M     
Sbjct: 63  GI--LTLRYPIEHGIVTNWDDMEKIWHHTFYN--ELRV---APEEHPVLLTEAPMNPKSN 115

Query: 112 SKNTDQVLFEEYEVDSLYKAPTAAYIPFYTTNENIKTISGKSDHGELDIEEKIEAGKEYN 171
            +   Q++FE + V + Y +   A +  Y+        SG++                  
Sbjct: 116 REKMTQIMFETFNVPAFYVS-IQAVLSLYS--------SGRTT----------------- 149

Query: 172 DFSLVIDSGFNCTWVIPIVKGVPYYKAVKKLDVGGRFLNGLLKETISFRHYN--VMDESI 229
              +V+DSG   T V+PI  G     A+ ++D+ GR L   L + +S R Y+     E  
Sbjct: 150 --GIVLDSGDGVTHVVPIYAGFSLPHAILRIDLAGRDLTDYLMKILSERGYSFSTTAERE 207

Query: 230 LVNNIKEQCLYVDPVSYFEAFKAKGKNKIDFVLPDFQTSFQGYVRDPKTALPDNAQILTL 289
           +V +IKE+  YV                +DF   + QT+ Q    +    LPD  Q++T+
Sbjct: 208 IVRDIKEKLCYV---------------ALDFE-QEMQTAAQSSSIEKSYELPD-GQVITI 250

Query: 290 TDERFSVPEAFFHPEISQSLKPGIIETVLESIYMLPELLRPLMASNIVCMGGNFNLPGFT 349
            +ERF  PEA FHP +      GI +T   SI      +R  +  NIV  GG    PG  
Sbjct: 251 GNERFRAPEALFHPSVLGLESAGIDQTTYNSIMKCDVDVRKELYGNIVMSGGTTMFPGIA 310

Query: 350 DRLVSELQRQLPTDWVCRAKISSGDKSLTGWTAMAKFAHTDAYKKARVTKEDYFEHG 406
           +R+  E+    P+    +  I+  ++  + W   +  A    +++  ++K++Y E G
Sbjct: 311 ERMQKEITALAPSSMKVKI-IAPPERKYSVWIGGSILASLTTFQQMWISKQEYDESG 366

>Suva_6.18 Chr6 complement(26677..27794,28152..28161) [1128 bp, 375
           aa] {ON} YFL039C (REAL)
          Length = 375

 Score =  122 bits (306), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 109/417 (26%), Positives = 179/417 (42%), Gaps = 73/417 (17%)

Query: 6   AIVIDNGSYQVKFGLASEVRPRVALNALA--------------KDKYGVTHLSNQVQNIK 51
           A+VIDNGS   K G A +  PR    ++               KD Y    + ++ Q+ +
Sbjct: 7   ALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQKDSY----VGDEAQSKR 62

Query: 52  DISSVVFRRPHELGQLTSWELESCIWDYCLYNPDEFGIDWQSLENRHVVLSETCMTLPEL 111
            I  +  R P E G +T+W+    IW +  YN  E  +   + E   V+L+E  M     
Sbjct: 63  GI--LTLRYPIEHGIVTNWDDMEKIWHHTFYN--ELRV---APEEHPVLLTEAPMNPKSN 115

Query: 112 SKNTDQVLFEEYEVDSLYKAPTAAYIPFYTTNENIKTISGKSDHGELDIEEKIEAGKEYN 171
            +   Q++FE + V + Y +   A +  Y+        SG++                  
Sbjct: 116 REKMTQIMFETFNVPAFYVS-IQAVLSLYS--------SGRTT----------------- 149

Query: 172 DFSLVIDSGFNCTWVIPIVKGVPYYKAVKKLDVGGRFLNGLLKETISFRHYN--VMDESI 229
              +V+DSG   T V+PI  G     A+ ++D+ GR L   L + +S R Y+     E  
Sbjct: 150 --GIVLDSGDGVTHVVPIYAGFSLPHAILRIDLAGRDLTDYLMKILSERGYSFSTTAERE 207

Query: 230 LVNNIKEQCLYVDPVSYFEAFKAKGKNKIDFVLPDFQTSFQGYVRDPKTALPDNAQILTL 289
           +V +IKE+  YV                +DF   + QT+ Q    +    LPD  Q++T+
Sbjct: 208 IVRDIKEKLCYV---------------ALDFE-QEMQTAAQSSSIEKSYELPD-GQVITI 250

Query: 290 TDERFSVPEAFFHPEISQSLKPGIIETVLESIYMLPELLRPLMASNIVCMGGNFNLPGFT 349
            +ERF  PEA FHP +      GI +T   SI      +R  +  NIV  GG    PG  
Sbjct: 251 GNERFRAPEALFHPSVLGLESAGIDQTTYNSIMKCDVDVRKELYGNIVMSGGTTMFPGIA 310

Query: 350 DRLVSELQRQLPTDWVCRAKISSGDKSLTGWTAMAKFAHTDAYKKARVTKEDYFEHG 406
           +R+  E+    P+    +  I+  ++  + W   +  A    +++  ++K++Y E G
Sbjct: 311 ERMQKEITALAPSSMKVKI-IAPPERKYSVWIGGSILASLTTFQQMWISKQEYDESG 366

>Smik_6.39 Chr6 complement(68673..69790,70076..70085) [1128 bp, 375
           aa] {ON} YFL039C (REAL)
          Length = 375

 Score =  122 bits (306), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 109/417 (26%), Positives = 179/417 (42%), Gaps = 73/417 (17%)

Query: 6   AIVIDNGSYQVKFGLASEVRPRVALNALA--------------KDKYGVTHLSNQVQNIK 51
           A+VIDNGS   K G A +  PR    ++               KD Y    + ++ Q+ +
Sbjct: 7   ALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQKDSY----VGDEAQSKR 62

Query: 52  DISSVVFRRPHELGQLTSWELESCIWDYCLYNPDEFGIDWQSLENRHVVLSETCMTLPEL 111
            I  +  R P E G +T+W+    IW +  YN  E  +   + E   V+L+E  M     
Sbjct: 63  GI--LTLRYPIEHGIVTNWDDMEKIWHHTFYN--ELRV---APEEHPVLLTEAPMNPKSN 115

Query: 112 SKNTDQVLFEEYEVDSLYKAPTAAYIPFYTTNENIKTISGKSDHGELDIEEKIEAGKEYN 171
            +   Q++FE + V + Y +   A +  Y+        SG++                  
Sbjct: 116 REKMTQIMFETFNVPAFYVS-IQAVLSLYS--------SGRTT----------------- 149

Query: 172 DFSLVIDSGFNCTWVIPIVKGVPYYKAVKKLDVGGRFLNGLLKETISFRHYN--VMDESI 229
              +V+DSG   T V+PI  G     A+ ++D+ GR L   L + +S R Y+     E  
Sbjct: 150 --GIVLDSGDGVTHVVPIYAGFSLPHAILRIDLAGRDLTDYLMKILSERGYSFSTTAERE 207

Query: 230 LVNNIKEQCLYVDPVSYFEAFKAKGKNKIDFVLPDFQTSFQGYVRDPKTALPDNAQILTL 289
           +V +IKE+  YV                +DF   + QT+ Q    +    LPD  Q++T+
Sbjct: 208 IVRDIKEKLCYV---------------ALDFE-QEMQTAAQSSSIEKSYELPD-GQVITI 250

Query: 290 TDERFSVPEAFFHPEISQSLKPGIIETVLESIYMLPELLRPLMASNIVCMGGNFNLPGFT 349
            +ERF  PEA FHP +      GI +T   SI      +R  +  NIV  GG    PG  
Sbjct: 251 GNERFRAPEALFHPSVLGLESAGIDQTTYNSIMKCDVDVRKELYGNIVMSGGTTMFPGIA 310

Query: 350 DRLVSELQRQLPTDWVCRAKISSGDKSLTGWTAMAKFAHTDAYKKARVTKEDYFEHG 406
           +R+  E+    P+    +  I+  ++  + W   +  A    +++  ++K++Y E G
Sbjct: 311 ERMQKEITALAPSSMKVKI-IAPPERKYSVWIGGSILASLTTFQQMWISKQEYDESG 366

>YFL039C Chr6 complement(53260..54377,54687..54696) [1128 bp, 375
           aa] {ON}  ACT1Actin, structural protein involved in cell
           polarization, endocytosis, and other cytoskeletal
           functions
          Length = 375

 Score =  122 bits (306), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 109/417 (26%), Positives = 179/417 (42%), Gaps = 73/417 (17%)

Query: 6   AIVIDNGSYQVKFGLASEVRPRVALNALA--------------KDKYGVTHLSNQVQNIK 51
           A+VIDNGS   K G A +  PR    ++               KD Y    + ++ Q+ +
Sbjct: 7   ALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQKDSY----VGDEAQSKR 62

Query: 52  DISSVVFRRPHELGQLTSWELESCIWDYCLYNPDEFGIDWQSLENRHVVLSETCMTLPEL 111
            I  +  R P E G +T+W+    IW +  YN  E  +   + E   V+L+E  M     
Sbjct: 63  GI--LTLRYPIEHGIVTNWDDMEKIWHHTFYN--ELRV---APEEHPVLLTEAPMNPKSN 115

Query: 112 SKNTDQVLFEEYEVDSLYKAPTAAYIPFYTTNENIKTISGKSDHGELDIEEKIEAGKEYN 171
            +   Q++FE + V + Y +   A +  Y+        SG++                  
Sbjct: 116 REKMTQIMFETFNVPAFYVS-IQAVLSLYS--------SGRTT----------------- 149

Query: 172 DFSLVIDSGFNCTWVIPIVKGVPYYKAVKKLDVGGRFLNGLLKETISFRHYN--VMDESI 229
              +V+DSG   T V+PI  G     A+ ++D+ GR L   L + +S R Y+     E  
Sbjct: 150 --GIVLDSGDGVTHVVPIYAGFSLPHAILRIDLAGRDLTDYLMKILSERGYSFSTTAERE 207

Query: 230 LVNNIKEQCLYVDPVSYFEAFKAKGKNKIDFVLPDFQTSFQGYVRDPKTALPDNAQILTL 289
           +V +IKE+  YV                +DF   + QT+ Q    +    LPD  Q++T+
Sbjct: 208 IVRDIKEKLCYV---------------ALDFE-QEMQTAAQSSSIEKSYELPD-GQVITI 250

Query: 290 TDERFSVPEAFFHPEISQSLKPGIIETVLESIYMLPELLRPLMASNIVCMGGNFNLPGFT 349
            +ERF  PEA FHP +      GI +T   SI      +R  +  NIV  GG    PG  
Sbjct: 251 GNERFRAPEALFHPSVLGLESAGIDQTTYNSIMKCDVDVRKELYGNIVMSGGTTMFPGIA 310

Query: 350 DRLVSELQRQLPTDWVCRAKISSGDKSLTGWTAMAKFAHTDAYKKARVTKEDYFEHG 406
           +R+  E+    P+    +  I+  ++  + W   +  A    +++  ++K++Y E G
Sbjct: 311 ERMQKEITALAPSSMKVKI-IAPPERKYSVWIGGSILASLTTFQQMWISKQEYDESG 366

>NDAI0G03040 Chr7 complement(708715..709832,710590..710599) [1128
           bp, 375 aa] {ON} Anc_8.23 YFL039C
          Length = 375

 Score =  122 bits (305), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 109/417 (26%), Positives = 180/417 (43%), Gaps = 73/417 (17%)

Query: 6   AIVIDNGSYQVKFGLASEVRPRVALNALA--------------KDKYGVTHLSNQVQNIK 51
           A+VIDNGS   K G A +  PR    ++               KD Y    + ++ Q+ +
Sbjct: 7   ALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQKDSY----VGDEAQSKR 62

Query: 52  DISSVVFRRPHELGQLTSWELESCIWDYCLYNPDEFGIDWQSLENRHVVLSETCMTLPEL 111
            I  +  R P E G +T+W+    IW +  YN  E  +   + E   V+L+E  M     
Sbjct: 63  GI--LTLRYPIEHGIVTNWDDMEKIWHHTFYN--ELRV---APEEHPVLLTEAPMNPKSN 115

Query: 112 SKNTDQVLFEEYEVDSLYKAPTAAYIPFYTTNENIKTISGKSDHGELDIEEKIEAGKEYN 171
            +   Q++FE + V + Y +   A +  Y+        SG++                  
Sbjct: 116 REKMTQIMFETFNVPAFYVS-IQAVLSLYS--------SGRTT----------------- 149

Query: 172 DFSLVIDSGFNCTWVIPIVKGVPYYKAVKKLDVGGRFLNGLLKETISFRHYN--VMDESI 229
              +V+DSG   T V+PI  G     A+ ++D+ GR L   L + +S R Y+     E  
Sbjct: 150 --GIVLDSGDGVTHVVPIYAGFSLPHAILRIDLAGRDLTDYLMKILSERGYSFSTTAERE 207

Query: 230 LVNNIKEQCLYVDPVSYFEAFKAKGKNKIDFVLPDFQTSFQGYVRDPKTALPDNAQILTL 289
           +V +IKE+  YV                +DF   + QT+ Q    +    LPD  Q++T+
Sbjct: 208 IVRDIKEKLCYV---------------ALDFE-QEMQTASQSSSIEKSYELPD-GQVITI 250

Query: 290 TDERFSVPEAFFHPEISQSLKPGIIETVLESIYMLPELLRPLMASNIVCMGGNFNLPGFT 349
            +ERF  PEA FHP +      GI +T   SI      +R  +  NIV  GG+   PG  
Sbjct: 251 GNERFRAPEALFHPSVLGLESSGIDQTTYNSIMKCDVDVRKELYGNIVMSGGSTMFPGIA 310

Query: 350 DRLVSELQRQLPTDWVCRAKISSGDKSLTGWTAMAKFAHTDAYKKARVTKEDYFEHG 406
           +R+  E+    P+    +  I+  ++  + W   +  A    +++  ++K++Y E G
Sbjct: 311 ERMQKEITALAPSSMKVKI-IAPPERKYSVWIGGSILASLTTFQQMWISKQEYDESG 366

>KNAG0L00250 Chr12 complement(32595..33712,34194..34203) [1128 bp,
           375 aa] {ON} Anc_8.23 YFL039C
          Length = 375

 Score =  122 bits (305), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 109/417 (26%), Positives = 179/417 (42%), Gaps = 73/417 (17%)

Query: 6   AIVIDNGSYQVKFGLASEVRPRVALNALA--------------KDKYGVTHLSNQVQNIK 51
           A+VIDNGS   K G A +  PR    ++               KD Y    + ++ Q+ +
Sbjct: 7   ALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQKDSY----VGDEAQSKR 62

Query: 52  DISSVVFRRPHELGQLTSWELESCIWDYCLYNPDEFGIDWQSLENRHVVLSETCMTLPEL 111
            I  +  R P E G +T+W+    IW +  YN  E  +   + E   V+L+E  M     
Sbjct: 63  GI--LTLRYPIEHGIVTNWDDMEKIWHHTFYN--ELRV---APEEHPVLLTEAPMNPKSN 115

Query: 112 SKNTDQVLFEEYEVDSLYKAPTAAYIPFYTTNENIKTISGKSDHGELDIEEKIEAGKEYN 171
            +   Q++FE + V + Y +   A +  Y+        SG++                  
Sbjct: 116 REKMTQIMFETFNVPAFYVS-IQAVLSLYS--------SGRTT----------------- 149

Query: 172 DFSLVIDSGFNCTWVIPIVKGVPYYKAVKKLDVGGRFLNGLLKETISFRHYN--VMDESI 229
              +V+DSG   T V+PI  G     A+ ++D+ GR L   L + +S R Y+     E  
Sbjct: 150 --GIVLDSGDGVTHVVPIYAGFSLPHAILRIDLAGRDLTDYLMKILSERGYSFSTTAERE 207

Query: 230 LVNNIKEQCLYVDPVSYFEAFKAKGKNKIDFVLPDFQTSFQGYVRDPKTALPDNAQILTL 289
           +V +IKE+  YV                +DF   + QT+ Q    +    LPD  Q++T+
Sbjct: 208 IVRDIKEKLCYV---------------ALDFE-QEMQTAAQSSSIEKSYELPD-GQVITI 250

Query: 290 TDERFSVPEAFFHPEISQSLKPGIIETVLESIYMLPELLRPLMASNIVCMGGNFNLPGFT 349
            +ERF  PEA FHP +      GI +T   SI      +R  +  NIV  GG    PG  
Sbjct: 251 GNERFRAPEALFHPSVLGLESSGIDQTTYNSIMKCDVDVRKELYGNIVMSGGTTMFPGIA 310

Query: 350 DRLVSELQRQLPTDWVCRAKISSGDKSLTGWTAMAKFAHTDAYKKARVTKEDYFEHG 406
           +R+  E+    P+    +  I+  ++  + W   +  A    +++  ++K++Y E G
Sbjct: 311 ERMQKEITALAPSSMKVKI-IAPPERKYSVWIGGSILASLTTFQQMWISKQEYDESG 366

>KAFR0D00940 Chr4 complement(198280..199397,199945..199954) [1128
           bp, 375 aa] {ON} Anc_8.23 YFL039C
          Length = 375

 Score =  122 bits (305), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 109/417 (26%), Positives = 179/417 (42%), Gaps = 73/417 (17%)

Query: 6   AIVIDNGSYQVKFGLASEVRPRVALNALA--------------KDKYGVTHLSNQVQNIK 51
           A+VIDNGS   K G A +  PR    ++               KD Y    + ++ Q+ +
Sbjct: 7   ALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQKDSY----VGDEAQSKR 62

Query: 52  DISSVVFRRPHELGQLTSWELESCIWDYCLYNPDEFGIDWQSLENRHVVLSETCMTLPEL 111
            I  +  R P E G +T+W+    IW +  YN  E  +   + E   V+L+E  M     
Sbjct: 63  GI--LTLRYPIEHGIVTNWDDMEKIWHHTFYN--ELRV---APEEHPVLLTEAPMNPKSN 115

Query: 112 SKNTDQVLFEEYEVDSLYKAPTAAYIPFYTTNENIKTISGKSDHGELDIEEKIEAGKEYN 171
            +   Q++FE + V + Y +   A +  Y+        SG++                  
Sbjct: 116 REKMTQIMFETFNVPAFYVS-IQAVLSLYS--------SGRTT----------------- 149

Query: 172 DFSLVIDSGFNCTWVIPIVKGVPYYKAVKKLDVGGRFLNGLLKETISFRHYN--VMDESI 229
              +V+DSG   T V+PI  G     A+ ++D+ GR L   L + +S R Y+     E  
Sbjct: 150 --GIVLDSGDGVTHVVPIYAGFSLPHAILRIDLAGRDLTDYLMKILSERGYSFSTTAERE 207

Query: 230 LVNNIKEQCLYVDPVSYFEAFKAKGKNKIDFVLPDFQTSFQGYVRDPKTALPDNAQILTL 289
           +V +IKE+  YV                +DF   + QT+ Q    +    LPD  Q++T+
Sbjct: 208 IVRDIKEKLCYV---------------ALDFE-QEMQTAAQSSSIEKSYELPD-GQVITI 250

Query: 290 TDERFSVPEAFFHPEISQSLKPGIIETVLESIYMLPELLRPLMASNIVCMGGNFNLPGFT 349
            +ERF  PEA FHP +      GI +T   SI      +R  +  NIV  GG    PG  
Sbjct: 251 GNERFRAPEALFHPSVLGLESSGIDQTTYNSIMKCDVDVRKELYGNIVMSGGTTMFPGIA 310

Query: 350 DRLVSELQRQLPTDWVCRAKISSGDKSLTGWTAMAKFAHTDAYKKARVTKEDYFEHG 406
           +R+  E+    P+    +  I+  ++  + W   +  A    +++  ++K++Y E G
Sbjct: 311 ERMQKEITALAPSSMKVKI-IAPPERKYSVWIGGSILASLTTFQQMWISKQEYDESG 366

>ABR222W Chr2 (818719..818728,819032..820152) [1131 bp, 376 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YFL039C
           (ACT1); 1-intron
          Length = 376

 Score =  122 bits (305), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 108/417 (25%), Positives = 179/417 (42%), Gaps = 73/417 (17%)

Query: 6   AIVIDNGSYQVKFGLASEVRPRVALNALA--------------KDKYGVTHLSNQVQNIK 51
           A+VIDNGS   K G A +  PR    ++               KD Y    + ++ Q+ +
Sbjct: 8   ALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQKDSY----VGDEAQSKR 63

Query: 52  DISSVVFRRPHELGQLTSWELESCIWDYCLYNPDEFGIDWQSLENRHVVLSETCMTLPEL 111
            I  +  R P E G +T+W+    IW +  YN  E  +   + E   V+L+E  M     
Sbjct: 64  GI--LTLRYPIEHGIVTNWDDMEKIWHHTFYN--ELRV---APEEHPVLLTEAPMNPKSN 116

Query: 112 SKNTDQVLFEEYEVDSLYKAPTAAYIPFYTTNENIKTISGKSDHGELDIEEKIEAGKEYN 171
            +   Q++FE + V + Y +   A +  Y+        SG++                  
Sbjct: 117 REKMTQIMFETFNVPAFYVS-IQAVLSLYS--------SGRTT----------------- 150

Query: 172 DFSLVIDSGFNCTWVIPIVKGVPYYKAVKKLDVGGRFLNGLLKETISFRHYN--VMDESI 229
              +V+DSG   T V+PI  G     A+ ++D+ GR +   L + +S R Y+     E  
Sbjct: 151 --GIVLDSGDGVTHVVPIYAGFSLPHAILRIDLAGRDMTDYLMKILSERGYSFSTTAERE 208

Query: 230 LVNNIKEQCLYVDPVSYFEAFKAKGKNKIDFVLPDFQTSFQGYVRDPKTALPDNAQILTL 289
           +V +IKE+  YV                +DF   + QT+ Q    +    LPD  Q++T+
Sbjct: 209 IVRDIKEKLCYV---------------ALDFE-QEMQTAAQSSAIEKSYELPD-GQVITI 251

Query: 290 TDERFSVPEAFFHPEISQSLKPGIIETVLESIYMLPELLRPLMASNIVCMGGNFNLPGFT 349
            +ERF  PEA FHP +      GI +T   SI      +R  +  NIV  GG    PG  
Sbjct: 252 GNERFRAPEALFHPSVLGLEAAGIDQTTYNSIMKCDVDVRKELYGNIVMSGGTTMFPGIA 311

Query: 350 DRLVSELQRQLPTDWVCRAKISSGDKSLTGWTAMAKFAHTDAYKKARVTKEDYFEHG 406
           +R+  E+    P+    +  I+  ++  + W   +  A    +++  ++K++Y E G
Sbjct: 312 ERMQKEITALAPSSMKVKI-IAPPERKYSVWIGGSILASLTTFQQMWISKQEYDESG 367

>ZYRO0F02772g Chr6 complement(235322..236439,236524..236533) [1128
           bp, 375 aa] {ON} uniprot|Q2HWE7 Zygosaccharomyces rouxii
           ACT1 Actin
          Length = 375

 Score =  121 bits (304), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 108/417 (25%), Positives = 179/417 (42%), Gaps = 73/417 (17%)

Query: 6   AIVIDNGSYQVKFGLASEVRPRVALNALA--------------KDKYGVTHLSNQVQNIK 51
           A+VIDNGS   K G A +  PR    ++               KD Y    + ++ Q+ +
Sbjct: 7   ALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQKDSY----VGDEAQSKR 62

Query: 52  DISSVVFRRPHELGQLTSWELESCIWDYCLYNPDEFGIDWQSLENRHVVLSETCMTLPEL 111
            I  +  R P E G +T+W+    IW +  YN  E  +   + E   V+L+E  M     
Sbjct: 63  GI--LTLRYPIEHGIVTNWDDMEKIWHHTFYN--ELRV---APEEHPVLLTEAPMNPKSN 115

Query: 112 SKNTDQVLFEEYEVDSLYKAPTAAYIPFYTTNENIKTISGKSDHGELDIEEKIEAGKEYN 171
            +   Q++FE + V + Y +   A +  Y+        SG++                  
Sbjct: 116 REKMTQIMFETFNVPAFYVS-IQAVLSLYS--------SGRTT----------------- 149

Query: 172 DFSLVIDSGFNCTWVIPIVKGVPYYKAVKKLDVGGRFLNGLLKETISFRHYN--VMDESI 229
              +V+DSG   T V+PI  G     A+ ++D+ GR L   L + +S R Y+     E  
Sbjct: 150 --GIVLDSGDGVTHVVPIYAGFSMPHAILRIDLAGRDLTDYLMKILSERGYSFSTTAERE 207

Query: 230 LVNNIKEQCLYVDPVSYFEAFKAKGKNKIDFVLPDFQTSFQGYVRDPKTALPDNAQILTL 289
           +V +IKE+  YV                +DF   + QT+ Q    +    LPD  Q++T+
Sbjct: 208 IVRDIKEKLCYV---------------ALDFE-QEMQTAAQSSSVEKSYELPD-GQVITI 250

Query: 290 TDERFSVPEAFFHPEISQSLKPGIIETVLESIYMLPELLRPLMASNIVCMGGNFNLPGFT 349
            +ERF  PEA FHP +      G+ +T   SI      +R  +  NIV  GG    PG  
Sbjct: 251 GNERFRAPEALFHPSVLSLESSGVDQTTYNSIMKCDVDVRKDLYGNIVMSGGTTMFPGIA 310

Query: 350 DRLVSELQRQLPTDWVCRAKISSGDKSLTGWTAMAKFAHTDAYKKARVTKEDYFEHG 406
           +R+  E+    P+    +  I+  ++  + W   +  A    +++  ++K++Y E G
Sbjct: 311 ERMQKEITALAPSSMKVKI-IAPPERKYSVWIGGSILASLTTFQQMWISKQEYDESG 366

>KLLA0D05357g Chr4 (461726..461735,462516..463633) [1128 bp, 375 aa]
           {ON} highly similar to uniprot|P60010 Saccharomyces
           cerevisiae YFL039C ACT1 Actin structural protein
           involved in cell polarization endocytosis and other
           cytoskeletal functions
          Length = 375

 Score =  121 bits (304), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 108/417 (25%), Positives = 179/417 (42%), Gaps = 73/417 (17%)

Query: 6   AIVIDNGSYQVKFGLASEVRPRVALNALA--------------KDKYGVTHLSNQVQNIK 51
           A+VIDNGS   K G A +  PR    ++               KD Y    + ++ Q+ +
Sbjct: 7   ALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQKDSY----VGDEAQSKR 62

Query: 52  DISSVVFRRPHELGQLTSWELESCIWDYCLYNPDEFGIDWQSLENRHVVLSETCMTLPEL 111
            I  +  R P E G +T+W+    IW +  YN  E  +   + E   V+L+E  M     
Sbjct: 63  GI--LTLRYPIEHGIVTNWDDMEKIWHHTFYN--ELRV---APEEHPVLLTEAPMNPKNN 115

Query: 112 SKNTDQVLFEEYEVDSLYKAPTAAYIPFYTTNENIKTISGKSDHGELDIEEKIEAGKEYN 171
            +   Q+LFE + V + Y +   A +  Y+        SG++                  
Sbjct: 116 REKMTQILFETFNVPAFYVS-IQAVLSLYS--------SGRTT----------------- 149

Query: 172 DFSLVIDSGFNCTWVIPIVKGVPYYKAVKKLDVGGRFLNGLLKETISFRHYN--VMDESI 229
              +V+DSG   T V+PI  G     A+ ++D+ GR +   L + ++ R Y+     E  
Sbjct: 150 --GIVLDSGDGVTHVVPIYAGFSLPHAILRIDLAGRDITDYLMKILAERGYSFSTTAERE 207

Query: 230 LVNNIKEQCLYVDPVSYFEAFKAKGKNKIDFVLPDFQTSFQGYVRDPKTALPDNAQILTL 289
           +V +IKE+  YV                +DF   + QT+ Q    +    LPD  Q++T+
Sbjct: 208 IVRDIKEKLCYV---------------ALDFE-QEMQTASQSSAVEKSYELPD-GQVITI 250

Query: 290 TDERFSVPEAFFHPEISQSLKPGIIETVLESIYMLPELLRPLMASNIVCMGGNFNLPGFT 349
            +ERF  PEA FHP +      GI +T   SI      +R  +  NIV  GG    PG  
Sbjct: 251 GNERFRAPEALFHPSVLSLEAAGIDQTTYNSIMKCDVDVRKELYGNIVMSGGTTMFPGIA 310

Query: 350 DRLVSELQRQLPTDWVCRAKISSGDKSLTGWTAMAKFAHTDAYKKARVTKEDYFEHG 406
           +R+  E+    P+    +  I+  ++  + W   +  A    +++  ++K++Y E G
Sbjct: 311 ERMQKEITALAPSSMKVKI-IAPPERKYSVWIGGSILASLTTFQQMWISKQEYDESG 366

>Kpol_1058.15 s1058 complement(49082..50199,50349..50358) [1128 bp,
           375 aa] {ON} complement(49082..50199,50349..50358) [1128
           nt, 376 aa]
          Length = 375

 Score =  120 bits (302), Expect = 6e-30,   Method: Compositional matrix adjust.
 Identities = 108/417 (25%), Positives = 178/417 (42%), Gaps = 73/417 (17%)

Query: 6   AIVIDNGSYQVKFGLASEVRPRVALNALA--------------KDKYGVTHLSNQVQNIK 51
           A+VIDNGS   K G A +  PR    ++               KD Y    + ++ Q+ +
Sbjct: 7   ALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQKDSY----VGDEAQSKR 62

Query: 52  DISSVVFRRPHELGQLTSWELESCIWDYCLYNPDEFGIDWQSLENRHVVLSETCMTLPEL 111
            I  +  R P E G +T+W+    IW +  YN  E  +   + E   V+L+E  M     
Sbjct: 63  GI--LTLRYPIEHGIVTNWDDMEKIWHHTFYN--ELRV---APEEHPVLLTEAPMNPKSN 115

Query: 112 SKNTDQVLFEEYEVDSLYKAPTAAYIPFYTTNENIKTISGKSDHGELDIEEKIEAGKEYN 171
            +   Q++FE + V + Y +   A +  Y+        SG++                  
Sbjct: 116 REKMTQIMFETFNVPAFYVS-IQAVLSLYS--------SGRTT----------------- 149

Query: 172 DFSLVIDSGFNCTWVIPIVKGVPYYKAVKKLDVGGRFLNGLLKETISFRHYN--VMDESI 229
              +V+DSG   T V+PI  G      + ++D+ GR L   L + +S R Y+     E  
Sbjct: 150 --GIVLDSGDGVTHVVPIYAGFSMPHGILRIDLAGRDLTDYLMKILSERGYSFSTTAERE 207

Query: 230 LVNNIKEQCLYVDPVSYFEAFKAKGKNKIDFVLPDFQTSFQGYVRDPKTALPDNAQILTL 289
           +V +IKE+  YV                +DF   + QT+ Q    +    LPD  Q++T+
Sbjct: 208 IVRDIKEKLCYV---------------ALDFE-QEMQTAAQSSSIEKSYELPD-GQVITI 250

Query: 290 TDERFSVPEAFFHPEISQSLKPGIIETVLESIYMLPELLRPLMASNIVCMGGNFNLPGFT 349
            +ERF  PEA FHP +      GI +T   SI      +R  +  NIV  GG    PG  
Sbjct: 251 GNERFRAPEALFHPSVLGLESSGIDQTTYNSIMKCDVDVRKELYGNIVMSGGTTMFPGIA 310

Query: 350 DRLVSELQRQLPTDWVCRAKISSGDKSLTGWTAMAKFAHTDAYKKARVTKEDYFEHG 406
           +R+  E+    P+    +  I+  ++  + W   +  A    +++  ++K++Y E G
Sbjct: 311 ERMQKEITALAPSSMKVKI-IAPPERKYSVWIGGSILASLTTFQQMWISKQEYDESG 366

>KLTH0G18832g Chr7 (1626178..1626187,1626854..1627971) [1128 bp, 375
           aa] {ON} highly similar to uniprot|P60010 Saccharomyces
           cerevisiae YFL039C ACT1 Actin structural protein
           involved in cell polarization endocytosis and other
           cytoskeletal functions
          Length = 375

 Score =  120 bits (302), Expect = 6e-30,   Method: Compositional matrix adjust.
 Identities = 108/417 (25%), Positives = 178/417 (42%), Gaps = 73/417 (17%)

Query: 6   AIVIDNGSYQVKFGLASEVRPRVALNALA--------------KDKYGVTHLSNQVQNIK 51
           A+VIDNGS   K G A +  PR    ++               KD Y    + ++ Q+ +
Sbjct: 7   ALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQKDSY----VGDEAQSKR 62

Query: 52  DISSVVFRRPHELGQLTSWELESCIWDYCLYNPDEFGIDWQSLENRHVVLSETCMTLPEL 111
            I  +  R P E G +T+W+    IW +  YN  E  +   + E   V+L+E  M     
Sbjct: 63  GI--LTLRYPIEHGIVTNWDDMEKIWHHTFYN--ELRV---APEEHPVLLTEAPMNPKSN 115

Query: 112 SKNTDQVLFEEYEVDSLYKAPTAAYIPFYTTNENIKTISGKSDHGELDIEEKIEAGKEYN 171
            +   Q+LFE + V + Y +   A +  Y+        SG++                  
Sbjct: 116 REKMTQILFETFNVPAFYVS-IQAVLSLYS--------SGRTT----------------- 149

Query: 172 DFSLVIDSGFNCTWVIPIVKGVPYYKAVKKLDVGGRFLNGLLKETISFRHYN--VMDESI 229
              +V+DSG   T V+PI  G      + ++D+ GR +   L + +S R Y+     E  
Sbjct: 150 --GIVLDSGDGVTHVVPIYAGFSLPHGILRIDLAGRDMTDYLMKILSERGYSFSTTAERE 207

Query: 230 LVNNIKEQCLYVDPVSYFEAFKAKGKNKIDFVLPDFQTSFQGYVRDPKTALPDNAQILTL 289
           +V +IKE+  YV                +DF   + QT+ Q    +    LPD  Q++T+
Sbjct: 208 IVRDIKEKLCYV---------------ALDFE-QEMQTAAQSSAIEKSYELPD-GQVITI 250

Query: 290 TDERFSVPEAFFHPEISQSLKPGIIETVLESIYMLPELLRPLMASNIVCMGGNFNLPGFT 349
            +ERF  PEA FHP +      GI +T   SI      +R  +  NIV  GG    PG  
Sbjct: 251 GNERFRAPEALFHPSLLGLEAAGIDQTAYNSIMKCDVDVRKELYGNIVMSGGTTMFPGIA 310

Query: 350 DRLVSELQRQLPTDWVCRAKISSGDKSLTGWTAMAKFAHTDAYKKARVTKEDYFEHG 406
           +R+  E+    P+    +  I+  ++  + W   +  A    +++  ++K++Y E G
Sbjct: 311 ERMQKEITALAPSSMKVKI-IAPPERKYSVWIGGSILASLTTFQQMWISKQEYDESG 366

>Ecym_1520 Chr1 (1071497..1071506,1072543..1073663) [1131 bp, 376
           aa] {ON} similar to Ashbya gossypii ABR222W  1-intron
          Length = 376

 Score =  119 bits (297), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 107/417 (25%), Positives = 179/417 (42%), Gaps = 73/417 (17%)

Query: 6   AIVIDNGSYQVKFGLASEVRPRVALNALA--------------KDKYGVTHLSNQVQNIK 51
           A+VIDNGS   K G A +  PR    ++               KD Y    + ++ Q+ +
Sbjct: 8   ALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQKDCY----VGDEAQSKR 63

Query: 52  DISSVVFRRPHELGQLTSWELESCIWDYCLYNPDEFGIDWQSLENRHVVLSETCMTLPEL 111
            I  +  R P E G +T+W+    IW +  YN  E  +   + E   V+L+E  M     
Sbjct: 64  GI--LTLRYPIEHGIVTNWDDMEKIWHHTFYN--ELRV---APEEHPVLLTEAPMNPKSN 116

Query: 112 SKNTDQVLFEEYEVDSLYKAPTAAYIPFYTTNENIKTISGKSDHGELDIEEKIEAGKEYN 171
            +   Q++FE + V + Y +   A +  Y+        SG++                  
Sbjct: 117 REKMTQIMFETFNVPAFYVS-IQAVLSLYS--------SGRTT----------------- 150

Query: 172 DFSLVIDSGFNCTWVIPIVKGVPYYKAVKKLDVGGRFLNGLLKETISFRHYN--VMDESI 229
              +V+DSG   T V+PI  G     A+ ++D+ GR +   L + +S R Y+     E  
Sbjct: 151 --GIVLDSGDGVTHVVPIYAGFSLPHAILRIDLAGRDMTDYLMKILSERGYSFSTTAERE 208

Query: 230 LVNNIKEQCLYVDPVSYFEAFKAKGKNKIDFVLPDFQTSFQGYVRDPKTALPDNAQILTL 289
           +V +IKE+  YV                +D+   + QT+ Q    +    LPD  Q++T+
Sbjct: 209 IVRDIKEKLCYV---------------ALDYD-QEMQTAAQSSAIEKSYELPD-GQVITI 251

Query: 290 TDERFSVPEAFFHPEISQSLKPGIIETVLESIYMLPELLRPLMASNIVCMGGNFNLPGFT 349
            +ERF  PEA FHP +      GI +T   SI      +R  +  NIV  GG    PG  
Sbjct: 252 GNERFRAPEALFHPSVLGLEAAGIDQTTYNSIMKCDVDVRKELYGNIVMSGGTTMFPGIA 311

Query: 350 DRLVSELQRQLPTDWVCRAKISSGDKSLTGWTAMAKFAHTDAYKKARVTKEDYFEHG 406
           +R+  E+    P+    +  I+  ++  + W   +  A    +++  ++K++Y E G
Sbjct: 312 ERMQKEITALAPSSMKVKI-IAPPERKYSVWIGGSILASLTTFQQMWISKQEYDESG 367

>KLLA0E22925g Chr5 complement(2040279..2041421) [1143 bp, 380 aa]
           {ON} similar to uniprot|P38696 Saccharomyces cerevisiae
           YHR129C ARP1 Actin-related protein of the dynactin
           complex required for spindle orientation and nuclear
           migration putative ortholog of mammalian centractin
          Length = 380

 Score =  117 bits (292), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 111/418 (26%), Positives = 188/418 (44%), Gaps = 72/418 (17%)

Query: 4   DQAIVIDNGSYQVKFGLASEVRPRVALNALAK-DKY---------GVTHLSNQVQNIKDI 53
           +Q IV+DNGS  +K G   E +P+   ++L    KY         G T + NQ Q I+ +
Sbjct: 10  NQPIVLDNGSGLIKAGFGGEDKPKCYEHSLVGIPKYSKVMAGRFDGNTFVGNQAQEIRGL 69

Query: 54  SSVVFRRPHELGQLTSWELESCIWDYCLYNPDEFGIDWQSLENRHVVLSETCMTLPELSK 113
             +  R P E G +T W     +W +      E G+   SL++  V+++E  +   +  +
Sbjct: 70  --LKLRHPLEHGVVTDWNALEQLWGHVF----EKGLQLSSLQDHPVLVTEAPLNPKKNRE 123

Query: 114 NTDQVLFEEYEVDSLYKAPTAAYIPFYTTNENIKTISGKSDHGELDIEEKIEAGKEYNDF 173
              ++LFE + V ++Y +   A +  Y         SG++                    
Sbjct: 124 QMCELLFETFSVPAVYVS-IQAVLSLYA--------SGRTT------------------- 155

Query: 174 SLVIDSGFNCTWVIPIVKGVPYYKAVKKLDVGGRFLNGLLKETISFRHYNVM---DESIL 230
             V+DSG  C+  +P+  G     A++++D+ GR ++ LL+  I       +    E  +
Sbjct: 156 GCVLDSGDGCSHAVPVYDGYTLPSAIRRIDIAGRDISELLQVLIRKSTGVSLLSSSEREI 215

Query: 231 VNNIKEQCLYV--DPVSYFEAFKAKGKNKIDFVLPDFQTSFQGYVRDPKTALPDNAQILT 288
           V  IKE+  Y+  DP    + +   GK          QT F+         LPD  QI  
Sbjct: 216 VRIIKEKACYIALDPKEEEKNYTMHGK----------QTMFR---------LPDGKQI-E 255

Query: 289 LTDERFSVPEAFFHPEISQSLKPGIIETVLESIYMLPELLRPLMASNIVCMGGNFNLPGF 348
           L +E+F  PE  F+P++  S    + E + ESI  +   LR  + SNIV  GG   +PGF
Sbjct: 256 LDNEKFRAPEILFNPQLIGSEFQSLPEILYESIQKVDLDLRTSLFSNIVFSGGTTMIPGF 315

Query: 349 TDRLVSELQRQLPTDWVCRAKI-SSGDKSLTGWTAMAKFAHTDAYKKARVTKEDYFEH 405
            DR++ EL  +L  +   + KI +  ++  + W   +  +    +KK  VTK+++ E+
Sbjct: 316 GDRVLKEL--KLSCEPQTKIKIFAPPERKYSTWIGGSILSGLSTFKKIWVTKKEWEEN 371

>SAKL0E11814g Chr5 complement(984199..985338) [1140 bp, 379 aa] {ON}
           highly similar to gnl|GLV|KLLA0E23012g Kluyveromyces
           lactis KLLA0E23012g and similar to uniprot|P38696
           Saccharomyces cerevisiae YHR129C ARP1 Actin- related
           protein of the dynactin complex required for spindle
           orientation and nuclear migration putative ortholog of
           mammalian centractin
          Length = 379

 Score =  112 bits (280), Expect = 8e-27,   Method: Compositional matrix adjust.
 Identities = 105/418 (25%), Positives = 178/418 (42%), Gaps = 72/418 (17%)

Query: 4   DQAIVIDNGSYQVKFGLASEVRPRV-ALNALAKDKY---------GVTHLSNQVQNIKDI 53
           +Q IV+DNGS  +K G + E RP+    + +   KY         G   + NQ Q ++ +
Sbjct: 9   NQPIVLDNGSGIIKAGFSGEERPKCFEYSLIGTPKYNKVMAGGLEGEQFIGNQAQELRGL 68

Query: 54  SSVVFRRPHELGQLTSWELESCIWDYCLYNPDEFGIDWQSLENRHVVLSETCMTLPELSK 113
             +  R P E G + +W     IW++  +      +   ++E   V+ +E  +   +  +
Sbjct: 69  --LKLRYPLEHGIVKNWSDMELIWNHVFHK----SLQLNNIEEHPVLATEAPLNPLKNRE 122

Query: 114 NTDQVLFEEYEVDSLYKAPTAAYIPFYTTNENIKTISGKSDHGELDIEEKIEAGKEYNDF 173
              ++LFE + V ++Y +   A +  Y         SG++                    
Sbjct: 123 AMCEMLFETFNVPAVYVS-IQAVLSLYA--------SGRTT------------------- 154

Query: 174 SLVIDSGFNCTWVIPIVKGVPYYKAVKKLDVGGR----FLNGLLKETISFRHYNVMDESI 229
             V+D G  C   +P+  G     +++++DV GR    FL  LL++T      +  +  I
Sbjct: 155 GCVLDCGDGCCHSVPVFDGFSLPSSIRRIDVAGRDVTEFLQLLLRKTTGVSLLSSSEREI 214

Query: 230 LVNNIKEQCLYV--DPVSYFEAFKAKGKNKIDFVLPDFQTSFQGYVRDPKTALPDNAQIL 287
            V  IKE+  YV  DP++  + +     + I F LPD                    ++L
Sbjct: 215 -VRIIKEKACYVARDPLTEEQTYHLTPTSTI-FKLPD-------------------GKVL 253

Query: 288 TLTDERFSVPEAFFHPEISQSLKPGIIETVLESIYMLPELLRPLMASNIVCMGGNFNLPG 347
            L +E+F  PE  F P++  S    I E   +SI  +   LRP + SNIV  GG    PG
Sbjct: 254 DLKNEKFRAPEVLFQPQLIGSEFESIPEMCHQSISKVDLDLRPALLSNIVLSGGTTMFPG 313

Query: 348 FTDRLVSELQRQLPTDWVCRAKISSGDKSLTGWTAMAKFAHTDAYKKARVTKEDYFEH 405
           F DRL++EL R L          +  ++  + W   +  +    +KK  VTK ++ E+
Sbjct: 314 FGDRLLTEL-RNLSEPQTKIKIFAPPERKYSTWIGGSILSGLSTFKKIWVTKSEWQEN 370

>Skud_6.31 Chr6 complement(56454..57536) [1083 bp, 360 aa] {ON}
           YFL039C (REAL)
          Length = 360

 Score =  110 bits (276), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 100/387 (25%), Positives = 168/387 (43%), Gaps = 62/387 (16%)

Query: 25  RPR---VALNALAKDKYGVTHLSNQVQNIKDISSVVFRRPHELGQLTSWELESCIWDYCL 81
           RPR   + +    KD Y    + ++ Q+ + I  +  R P E G +T+W+    IW +  
Sbjct: 22  RPRHQGIMVGMGQKDSY----VGDEAQSKRGI--LTLRYPIEHGIVTNWDDMEKIWHHTF 75

Query: 82  YNPDEFGIDWQSLENRHVVLSETCMTLPELSKNTDQVLFEEYEVDSLYKAPTAAYIPFYT 141
           YN  E  +   + E   V+L+E  M      +   Q++FE + V + Y +   A +  Y+
Sbjct: 76  YN--ELRV---APEEHPVLLTEAPMNPKSNREKMTQIMFETFNVPAFYVS-IQAVLSLYS 129

Query: 142 TNENIKTISGKSDHGELDIEEKIEAGKEYNDFSLVIDSGFNCTWVIPIVKGVPYYKAVKK 201
                   SG++                     +V+DSG   T V+PI  G     A+ +
Sbjct: 130 --------SGRTT-------------------GIVLDSGDGVTHVVPIYAGFSLPHAILR 162

Query: 202 LDVGGRFLNGLLKETISFRHYN--VMDESILVNNIKEQCLYVDPVSYFEAFKAKGKNKID 259
           +D+ GR L   L + +S R Y+     E  +V +IKE+  YV                +D
Sbjct: 163 IDLAGRDLTDYLMKILSERGYSFSTTAEREIVRDIKEKLCYV---------------ALD 207

Query: 260 FVLPDFQTSFQGYVRDPKTALPDNAQILTLTDERFSVPEAFFHPEISQSLKPGIIETVLE 319
           F   + QT+ Q    +    LPD  Q++T+ +ERF  PEA FHP +      GI +T   
Sbjct: 208 FE-QEMQTAAQSSSIEKSYELPD-GQVITIGNERFRAPEALFHPSVLGLESAGIDQTTYN 265

Query: 320 SIYMLPELLRPLMASNIVCMGGNFNLPGFTDRLVSELQRQLPTDWVCRAKISSGDKSLTG 379
           SI      +R  +  NIV  GG    PG  +R+  E+    P+    +  I+  ++  + 
Sbjct: 266 SIMKCDVDVRKELYGNIVMSGGTTMFPGIAERMQKEITALAPSSMKVKI-IAPPERKYSV 324

Query: 380 WTAMAKFAHTDAYKKARVTKEDYFEHG 406
           W   +  A    +++  ++K++Y E G
Sbjct: 325 WIGGSILASLTTFQQMWISKQEYDESG 351

>Kwal_14.1109 s14 complement(199181..200263) [1083 bp, 360 aa] {ON}
           YFL039C (ACT1) - Actin [contig 244] FULL
          Length = 360

 Score =  109 bits (273), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 99/387 (25%), Positives = 167/387 (43%), Gaps = 62/387 (16%)

Query: 25  RPR---VALNALAKDKYGVTHLSNQVQNIKDISSVVFRRPHELGQLTSWELESCIWDYCL 81
           RPR   + +    KD Y    + ++ Q+ + I  +  R P E G +T+W+    IW +  
Sbjct: 22  RPRHQGIMVGMGQKDSY----VGDEAQSKRGI--LTLRYPIEHGIVTNWDDMEKIWHHTF 75

Query: 82  YNPDEFGIDWQSLENRHVVLSETCMTLPELSKNTDQVLFEEYEVDSLYKAPTAAYIPFYT 141
           YN  E  +   + E   V+L+E  M      +   Q+LFE + V + Y +   A +  Y+
Sbjct: 76  YN--ELRV---APEEHPVLLTEAPMNPKSNREKMTQILFETFNVPAFYVS-IQAVLSLYS 129

Query: 142 TNENIKTISGKSDHGELDIEEKIEAGKEYNDFSLVIDSGFNCTWVIPIVKGVPYYKAVKK 201
                   SG++                     +V+DSG   T V+PI  G      + +
Sbjct: 130 --------SGRTT-------------------GIVLDSGDGVTHVVPIYAGFSLPHGILR 162

Query: 202 LDVGGRFLNGLLKETISFRHYN--VMDESILVNNIKEQCLYVDPVSYFEAFKAKGKNKID 259
           +D+ GR +   L + +S R Y+     E  +V +IKE+  YV                +D
Sbjct: 163 IDLAGRDMTDYLMKILSERGYSFSTTAEREIVRDIKEKLCYV---------------ALD 207

Query: 260 FVLPDFQTSFQGYVRDPKTALPDNAQILTLTDERFSVPEAFFHPEISQSLKPGIIETVLE 319
           F   + QT+ Q    +    LPD  Q++T+ +ERF  PEA FHP +      GI +T   
Sbjct: 208 FE-QEMQTAAQSSAIEKSYELPD-GQVITIGNERFRAPEALFHPSLLGLEAAGIDQTAYN 265

Query: 320 SIYMLPELLRPLMASNIVCMGGNFNLPGFTDRLVSELQRQLPTDWVCRAKISSGDKSLTG 379
           SI      +R  +  NIV  GG    PG  +R+  E+    P+    +  I+  ++  + 
Sbjct: 266 SIMKCDVDVRKELYGNIVMSGGTTMFPGIAERMQKEITALAPSSMKVKI-IAPPERKYSV 324

Query: 380 WTAMAKFAHTDAYKKARVTKEDYFEHG 406
           W   +  A    +++  ++K++Y E G
Sbjct: 325 WIGGSILASLTTFQQMWISKQEYDESG 351

>Ecym_6385 Chr6 complement(749508..750641) [1134 bp, 377 aa] {ON}
           similar to Ashbya gossypii AFR051W
          Length = 377

 Score =  109 bits (272), Expect = 9e-26,   Method: Compositional matrix adjust.
 Identities = 107/418 (25%), Positives = 182/418 (43%), Gaps = 74/418 (17%)

Query: 4   DQAIVIDNGSYQVKFGLASEVRPR---------VALN-ALAKDKYGVTHLSNQVQNIKDI 53
           +Q IV+DNGS  +K G + E +P+         V  N  +A    G T + NQ Q ++ +
Sbjct: 7   NQPIVLDNGSGIIKAGFSGEEKPKCFEYSLIGTVKYNKVMAGGLEGDTFIGNQAQELRGL 66

Query: 54  SSVVFRRPHELGQLTSWELESCIWDYCLYNPDEFGIDWQSLENRHVVLSETCMTLPELSK 113
             +  R P E G + +W     IW Y ++N     +  Q++E+  ++++E  +      +
Sbjct: 67  --LKLRHPVEHGIVKNWSDMEHIWSY-VFNKS---LQLQNVEDHPILITEAPLNPRNNRE 120

Query: 114 NTDQVLFEEYEVDSLYKAPTAAYIPFYTTNENIKTISGKSDHGELDIEEKIEAGKEYNDF 173
              ++LFE + V +LY +   A +  Y         SG++                    
Sbjct: 121 RMCELLFESFNVPALYVS-IQAVLSLYA--------SGRTT------------------- 152

Query: 174 SLVIDSGFNCTWVIPIVKGVPYYKAVKKLDVGGR----FLNGLLKETISFRHYNVMDESI 229
             V+D G  C   +P+  G     +++++D+ GR    FL  LL++T      +  +  +
Sbjct: 153 GCVVDCGDGCCHAVPVFDGFSIPSSIRRIDIAGRDITEFLQLLLRKTTGVSLLSSSEREV 212

Query: 230 LVNNIKEQCLYV--DPVSYFEAFKAKGKNKIDFVLPDFQTSFQGYVRDPKTALPDNAQIL 287
            V  IKE+  YV  DP    + F     N   F LPD +T                   +
Sbjct: 213 -VRIIKEKACYVAKDPHIEEQNFSIN-PNYTKFKLPDGKT-------------------I 251

Query: 288 TLTDERFSVPEAFFHPEISQSLKPGIIETVLESIYMLPELLRPLMASNIVCMGGNFNLPG 347
            L  E+F  PE  F PE+  S    + +   +SI  +   LR L+ SN++  GG   LPG
Sbjct: 252 DLGQEKFRAPEILFQPELIGSEFESLPDMCYQSIEKVDLDLRSLLFSNVLLSGGTSILPG 311

Query: 348 FTDRLVSELQRQLPTDWVCRAKI-SSGDKSLTGWTAMAKFAHTDAYKKARVTKEDYFE 404
           F DRL+SEL+    +D   + KI +  ++  + W   +  +    +KK  VT+ ++ E
Sbjct: 312 FGDRLLSELKSL--SDSQTKIKIFAPPERKYSTWIGGSILSGLSTFKKLWVTRAEWEE 367

>ZYRO0G05676g Chr7 (452257..453402) [1146 bp, 381 aa] {ON} similar
           to uniprot|P38696 Saccharomyces cerevisiae YHR129C ARP1
           Actin-related protein of the dynactin complex required
           for spindle orientation and nuclear migration putative
           ortholog of mammalian centractin
          Length = 381

 Score =  106 bits (264), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 107/416 (25%), Positives = 177/416 (42%), Gaps = 71/416 (17%)

Query: 5   QAIVIDNGSYQVKFGLASEVRPRVA------------LNALAKDKYGVTHLSNQVQNIKD 52
           Q +V+DNGS  +K G + E RP+              +N  +KD   V +L+ + ++I  
Sbjct: 11  QPVVLDNGSAILKAGYSGEDRPKFLEHSIVGSPRHGYVNDSSKDDTFVGNLAQERRSI-- 68

Query: 53  ISSVVFRRPHELGQLTSWELESCIWDYCLYNPDEFGIDWQSLENRHVVLSETCMTLPELS 112
              +  R P + G + +W     IWDY   +     +  + ++   V+++E  +      
Sbjct: 69  ---LQLRHPVDHGVVKNWNDMELIWDYMFKDK----LKLKDVDEHPVLITEAPLNPVSNR 121

Query: 113 KNTDQVLFEEYEVDSLYKAPTAAYIPFYTTNENIKTISGKSDHGELDIEEKIEAGKEYND 172
                +LFE + V +LY A   A +  Y + +    ISG                     
Sbjct: 122 DEMCDLLFESFGVQALYVA-NPAVLSLYASGK----ISG--------------------- 155

Query: 173 FSLVIDSGFNCTWVIPIVKGVPYYKAVKKLDVGGRFLNGLLKETI---SFRHYNVMDESI 229
              V+D G   +  +P+ +G     A+K++D+GGR L   L+  +   +        E  
Sbjct: 156 --CVLDCGDGYSCSVPVYQGYTLKSAIKRIDLGGRDLTEQLQLQLRKSTGLSLTTSGEME 213

Query: 230 LVNNIKEQCLYVDPVSYFEAFKAKGKNKIDFVLPDFQTSFQGYVRDPKTALPDNAQILTL 289
           LV  IKE+  YV                +D  + + + +++G     K  LPD  + +TL
Sbjct: 214 LVRMIKEKSCYV---------------AVDLDIEEEKCNYEGDQVGLKFKLPD-GKFITL 257

Query: 290 TDERFSVPEAFFHPEISQSLKPGIIETVLESIYMLPELLRPLMASNIVCMGGNFNLPGFT 349
           + +RF VPE  F P +  S    I E + +S+  L   LRP M S+I+  GG   L GF 
Sbjct: 258 SKDRFQVPEILFQPSVISSEVSSIPEIIWQSVSKLDTDLRPQMWSDILLSGGTTMLKGFG 317

Query: 350 DRLVSELQRQLPTDWVCRAKI-SSGDKSLTGWTAMAKFAHTDAYKKARVTKEDYFE 404
           +RLV EL +        R KI +  ++  T W   +  A    ++K  VTK  + E
Sbjct: 318 NRLVQELDKL--NQAQSRVKIWAPPERKYTSWIGGSILAELSTFQKIIVTKSQWQE 371

>AFR051W Chr6 (522829..524046) [1218 bp, 405 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YHR129C (ARP1)
          Length = 405

 Score =  105 bits (261), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 106/421 (25%), Positives = 180/421 (42%), Gaps = 80/421 (19%)

Query: 4   DQAIVIDNGSYQVKFGLASEVRPRV-ALNALAKDKY---------GVTHLSNQVQNIKDI 53
           +Q +V+DNGS  +K G + E +P+    + +   KY         G T + NQ Q ++ +
Sbjct: 35  NQPVVLDNGSGIIKAGFSGEEKPKCFEYSLIGTTKYNKVMAGGLEGDTFIGNQAQELRGL 94

Query: 54  SSVVFRRPHELGQLTSWELESCIWDYCLYNPDEFGIDWQSLENRHVVLSETCMTLPELSK 113
             +  R P + G +T+W     +W Y ++N     +  Q++E+   +++E  +   +  +
Sbjct: 95  --LKLRYPLQHGIVTNWADMEQVWGY-VFNKS---LQLQNVEDHPNLVTEAPLNPHKNRE 148

Query: 114 NTDQVLFEEYEVDSLYKAPTAAYIPFYTTNENIKTISGKSDHGELDIEEKIEAGKEYNDF 173
              ++LFE + V +LY +   A +  Y         SG++                    
Sbjct: 149 KMCELLFESFNVPALYVS-VQAVLSLYA--------SGRTT------------------- 180

Query: 174 SLVIDSGFNCTWVIPIVKGVPYYKAVKKLDVGGR----FLNGLLKETISFRHYNVMDESI 229
             V+D G  C   +P+  G     +++++D+ GR    FL  LL++T      +  +  I
Sbjct: 181 GCVVDCGDGCCHAVPVFDGFSVPSSIRRIDIAGRDITEFLQLLLRKTTGVSLLSSSEREI 240

Query: 230 LVNNIKEQCLYVDPVSYFEAFKAKGKNKIDFVLPDFQTSFQGYVRDP---KTALPDNAQI 286
            V  IKE                    K  FV  D +   Q +  +P   K  LPD   I
Sbjct: 241 -VRTIKE--------------------KACFVTKDPKLEEQNFPMNPSFSKFKLPDGKTI 279

Query: 287 LTLTDERFSVPEAFFHPEISQSLKPGIIETVLESIYMLPELLRPLMASNIVCMGGNFNLP 346
             L  ER+  PE  F PE+  S    + +   +SI  +   LR L+ SNI+  GG   LP
Sbjct: 280 -ELGQERYRAPEILFQPELIGSEFESLPDMCYQSIGKVDLDLRSLLYSNILLSGGTSMLP 338

Query: 347 GFTDRLVSELQRQLPTDWVCRAKI---SSGDKSLTGWTAMAKFAHTDAYKKARVTKEDYF 403
           GF DRL+ EL+    +    R KI   +  ++  + W   +  +    +KK  VTK ++ 
Sbjct: 339 GFGDRLLKELKSLSGS----RTKIKIFAPPERKYSTWIGGSILSGLSTFKKLWVTKSEWE 394

Query: 404 E 404
           E
Sbjct: 395 E 395

>TDEL0B04810 Chr2 (849529..850650) [1122 bp, 373 aa] {ON} Anc_2.117
           YHR129C
          Length = 373

 Score = 99.0 bits (245), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 99/416 (23%), Positives = 170/416 (40%), Gaps = 66/416 (15%)

Query: 4   DQAIVIDNGSYQVKFGLASEVRPRVALNALAKD----KYGVTHL------SNQVQNIKDI 53
           +Q +VIDNGS  VK G   E +PR    +L  D    K  V  L       N+ Q ++ +
Sbjct: 9   NQPVVIDNGSAVVKAGFCGEEKPRCMEYSLIGDANYNKIMVGGLECDSFVGNKAQRLRGL 68

Query: 54  SSVVFRRPHELGQLTSWELESCIWDYCLYNPDEFGIDWQSLENRHVVLSETCMTLPELSK 113
             +  + P E G ++ W+    +W + L++     +   S     ++++E  +      +
Sbjct: 69  --LKLKHPMERGVVSDWDDMELLWSHILFD----SLQLTSGMEHPLLITEAPLNPESNKE 122

Query: 114 NTDQVLFEEYEVDSLYKAPTAAYIPFYTTNENIKTISGKSDHGELDIEEKIEAGKEYNDF 173
              +V FE + + ++  +     +  Y         SG++                    
Sbjct: 123 KMLEVFFETFNIPAICVS-IPGVLSLYA--------SGRTT------------------- 154

Query: 174 SLVIDSGFNCTWVIPIVKGVPYYKAVKKLDVGG----RFLNGLLKETISFRHYNVMDESI 229
             V+D G      +P+ +G     ++K++++GG    + L   L++      ++   E  
Sbjct: 155 GCVVDCGEGYCSSVPVCEGYTLASSIKRINLGGIDVTKQLQFQLRKESGVWLFSS-GERE 213

Query: 230 LVNNIKEQCLYVDPVSYFEAFKAKGKNKIDFVLPDFQTSFQGYVRDPKTALPDNAQILTL 289
           LV  +KE+  YV         + K + K  F      T+F+         LPD   +LTL
Sbjct: 214 LVRTMKEKSCYVS------LNQLKDEEKFTFEPGKMNTNFK---------LPD-GNMLTL 257

Query: 290 TDERFSVPEAFFHPEISQSLKPGIIETVLESIYMLPELLRPLMASNIVCMGGNFNLPGFT 349
           +  RF  PE  F P+I  S +P + E  L+SI  +   LRP + S I   GG     GF 
Sbjct: 258 SKSRFRAPEILFQPQIIASEEPSLPEMCLQSILSVDVELRPRLMSRITLSGGTTMFRGFG 317

Query: 350 DRLVSELQRQLPTDWVCRAKISSGDKSLTGWTAMAKFAHTDAYKKARVTKEDYFEH 405
           DR + ELQ         R  ++  ++  T W   +  A    ++K   TK D+ EH
Sbjct: 318 DRFLQELQISTCKKSNIRI-LAPPERKYTAWIGGSMLAGLTTFRKMLTTKSDWREH 372

>TPHA0I01300 Chr9 (295950..297089) [1140 bp, 379 aa] {ON} Anc_2.117
           YHR129C
          Length = 379

 Score = 97.8 bits (242), Expect = 8e-22,   Method: Compositional matrix adjust.
 Identities = 92/420 (21%), Positives = 175/420 (41%), Gaps = 76/420 (18%)

Query: 4   DQAIVIDNGSYQVKFGLASEVRP--------------RVALNALAKDKYGVTHLSNQVQN 49
           +Q +VIDNG+  +K G   + +P              +V +  L  + Y    + N+ Q 
Sbjct: 8   NQPVVIDNGTGVLKVGFVGDDKPKCFQHNIVGTPKFDKVMIGGLDDNMY----IGNKAQE 63

Query: 50  IKDISSVVFRRPHELGQLTSWELESCIWDYCLYNPDEFGIDWQSLENRHVVLSETCMTLP 109
            + +  +  R P E G++  W+    +W + L +     ++ Q +E   ++++E  +   
Sbjct: 64  NRGL--LRLRHPMEHGEVKHWDEMEAVWKHTLLHD----LNIQHIEEHPILITEAPLNSS 117

Query: 110 ELSKNTDQVLFEEYEVDSLYKAPTAAYIPFYTTNENIKTISGKSDHGELDIEEKIEAGKE 169
           +  ++  ++LFE + + +++     A +  Y         SG    G             
Sbjct: 118 KNREHMCEILFESFNIPAIH-VENPAVLALY---------SGGRTTG------------- 154

Query: 170 YNDFSLVIDSGFNCTWVIPIVKGVPYYKAVKKLDVGGRFLNGLLKETISFRHYNVMDESI 229
                 VID G      +PI +G     +++++D+GGR +     E + F+    +  S+
Sbjct: 155 -----CVIDCGEGYCSAVPIYEGFALTPSIRRIDIGGREIT----EQLQFQIRKSVGMSL 205

Query: 230 LVNNIKEQCLYVDPVSYFEAFKAKGKNKIDFVLPDFQTSFQGYVRD-----PKTALPDNA 284
             +N KE    +             K +  +V  D       Y+ D      K  LPD  
Sbjct: 206 FSSNEKEIVRTI-------------KERACYVADDISKEEHKYILDSESNSSKFKLPD-G 251

Query: 285 QILTLTDERFSVPEAFFHPEISQSLKPGIIETVLESIYMLPELLRPLMASNIVCMGGNFN 344
           + L++ + RF   E  F+P +       + E V +++  +   LRP++  ++V  GG   
Sbjct: 252 KSLSIGNVRFRATELLFNPRLIGCESDSVPEIVFQTLSRVDIDLRPMLYKSLVLNGGTTV 311

Query: 345 LPGFTDRLVSELQRQLPTDWVCRAKISSGDKSLTGWTAMAKFAHTDAYKKARVTKEDYFE 404
           LPGF +R++ ELQ     D   R  I+S ++  T W   +  A    ++K  VTK ++ E
Sbjct: 312 LPGFGNRILKELQILTKQDTKLRI-IASPERKYTTWIGGSILAGLSTFQKILVTKSNWNE 370

>Kpol_1023.18 s1023
           complement(36072..36143,36193..36201,36244..37112,
           37854..37863) [960 bp, 319 aa] {ON}
           complement(36072..36143,36193..36201,36244..37112,
           37854..37863) [960 nt, 320 aa]
          Length = 319

 Score = 95.9 bits (237), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 90/332 (27%), Positives = 141/332 (42%), Gaps = 72/332 (21%)

Query: 6   AIVIDNGSYQVKFGLASEVRPRVALNALA--------------KDKYGVTHLSNQVQNIK 51
           A+VIDNGS   K G A +  PR    ++               KD Y    + ++ Q+ +
Sbjct: 7   ALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQKDSY----VGDEAQSKR 62

Query: 52  DISSVVFRRPHELGQLTSWELESCIWDYCLYNPDEFGIDWQSLENRHVVLSETCMTLPEL 111
            I  +  R P E G +T+W+    IW +  YN  E  +   + E   V+L+E  M     
Sbjct: 63  GI--LTLRYPIEHGIVTNWDDMEKIWHHTFYN--ELRV---APEEHPVLLTEAPMNPKSN 115

Query: 112 SKNTDQVLFEEYEVDSLYKAPTAAYIPFYTTNENIKTISGKSDHGELDIEEKIEAGKEYN 171
            +   Q++FE + V + Y +   A +  Y+        SG++                  
Sbjct: 116 REKMTQIMFETFNVPAFYVS-IQAVLSLYS--------SGRTT----------------- 149

Query: 172 DFSLVIDSGFNCTWVIPIVKGVPYYKAVKKLDVGGRFLNGLLKETISFRHYN--VMDESI 229
              +V+DSG   T V+PI  G      + ++D+ GR L   L + +S R Y+     E  
Sbjct: 150 --GIVLDSGDGVTHVVPIYAGFSMPHGILRIDLAGRDLTDYLMKILSERGYSFSTTAERE 207

Query: 230 LVNNIKEQCLYVDPVSYFEAFKAKGKNKIDFVLPDFQTSFQGYVRDPKTALPDNAQILTL 289
           +V +IKE+  YV                +DF   + QT+ Q    +    LPD  Q++T+
Sbjct: 208 IVRDIKEKLCYV---------------ALDFE-QEMQTAAQSSSIEKSYELPD-GQVITI 250

Query: 290 TDERFSVPEAFFHPEISQSLKPGIIETVLESI 321
            +ERF  PEA FHP +      GI +T   SI
Sbjct: 251 GNERFRAPEALFHPSVLGLESSGIDQTTYNSI 282

>NDAI0B04460 Chr2 complement(1115478..1116623) [1146 bp, 381 aa]
           {ON} Anc_2.117
          Length = 381

 Score = 96.3 bits (238), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 104/421 (24%), Positives = 179/421 (42%), Gaps = 76/421 (18%)

Query: 4   DQAIVIDNGSYQVKFGLASEVRP---RVALNALAK-DKYGVT--------HLSNQVQNIK 51
           +Q IVIDNGS  +K G + + +P      L  + K DK  +T        ++ N+ Q+I+
Sbjct: 9   NQPIVIDNGSCIIKSGFSRQDKPAGFEYNLTGMPKYDKIMITGQLENLDKYIGNRAQSIR 68

Query: 52  DISSVVFRRPHELGQLTSWELESCIWDYCLYNPDEFGIDWQSLENRHVVLSETCMTLPEL 111
            +  +  + P   G + +W+    +W + ++N     ++ Q++E   ++++E  +T+ + 
Sbjct: 69  GL--LRLQHPMNRGVVDNWDDMELLW-WHIFNDT---LNVQNIEEHPLLITEAPLTIEKQ 122

Query: 112 SKNTDQVLFEEYEVDSLYKAPTAAYIPFYTTNENIKTISGKSDHGELDIEEKIEAGKEYN 171
                + LFE + + SLY A   + +  Y +                            N
Sbjct: 123 RHIMCERLFETFNIPSLYVA-NPSVLSLYASG---------------------------N 154

Query: 172 DFSLVIDSGFNCTWVIPIVKGVPYYKAVKKLDVGGRFLNGLLKETISFRHYNVMDESILV 231
               V+D G       PI +G     +++K++VGGR +     E + F+       S+  
Sbjct: 155 TTGCVVDCGDGYCSSTPIYEGFVLPASIRKMEVGGRDIT----EHLQFQIRKSSGISLYS 210

Query: 232 NNIKEQCLYVDPVSYFEAFKAKGKNKIDFVLPDFQTSFQGYV-----RDPKTALPDNAQI 286
           +N KE    +             K K+ ++  DF  S + Y         K  LPD  + 
Sbjct: 211 SNEKEIVRTI-------------KEKVCYISEDFNKSEESYYLRQDEMSCKFKLPDGKE- 256

Query: 287 LTLTDERFSVPEAFFHPEISQSLKPGIIETVLESIYMLPELLRPLMASNIVCMGGNFNLP 346
           LTL  ERF  PE  F+P++       +     ESI  +   LRP + SNI+  GG+    
Sbjct: 257 LTLNKERFRSPEVLFNPQLMGLENENVSAMCFESISKVDLELRPKLFSNILLTGGSTLFK 316

Query: 347 GFTDRLVSELQRQLPTDWVCRAKI---SSGDKSLTGWTAMAKFAHTDAYKKARVTKEDYF 403
           GF  RL+ +LQ +L  +   RAKI   +  ++  T W   +       +K   VTK D+ 
Sbjct: 317 GFGSRLLGDLQ-ELTNN---RAKIKILAPPERKYTSWIGGSILTGLSTFKNLWVTKSDWE 372

Query: 404 E 404
           E
Sbjct: 373 E 373

>Smik_8.210 Chr8 complement(339093..340247) [1155 bp, 384 aa] {ON}
           YHR129C (REAL)
          Length = 384

 Score = 94.4 bits (233), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 94/413 (22%), Positives = 174/413 (42%), Gaps = 62/413 (15%)

Query: 4   DQAIVIDNGSYQVKFGLASEVRPR-VALNALAKDKY---------GVTHLSNQVQNIKDI 53
           +Q IVIDNGS  +K G + E RP+ +  + +   KY         G T + N+ Q ++ +
Sbjct: 12  NQPIVIDNGSGIIKAGFSGEERPKALEYSLVGHTKYDKVMLEGLQGDTFVGNKAQKLRGL 71

Query: 54  SSVVFRRPHELGQLTSWELESCIWDYCLYNPDEFGIDWQSLENRHVVLSETCMTLPELSK 113
             +  R P + G +  W+    IW Y L       +  Q++E   ++++E  M   +  +
Sbjct: 72  --LRLRYPMKHGVVEDWDSMELIWSYVLNEV----LQLQNIEEHPLLITEAPMNPLKNRE 125

Query: 114 NTDQVLFEEYEVDSLYKAPTAAYIPFYTTNENIKTISGKSDHGELDIEEKIEAGKEYNDF 173
              QV+FE + + ++Y     A +  Y         SG++                    
Sbjct: 126 MIAQVMFETFNLSAIY-VSDPAVLSLYA--------SGRTT------------------- 157

Query: 174 SLVIDSGFNCTWVIPIVKGVPYYKAVKKLDVGGRFLNGLLKETISFRHYNVMDESILVNN 233
             V+D G      +PI  G     ++ ++D+GG    G + E + F+       S+  ++
Sbjct: 158 GCVVDCGEGYCSSVPIYDGFALPASIMRMDIGG----GDITEQLQFQIRKSAGVSLFSSS 213

Query: 234 IKEQCLYV-DPVSYFEAFKAKGKNKIDFVLPDFQTSFQGYVRDPKTALPDNAQILTLTDE 292
            +E    + + V Y      K ++K      D  ++F+         LPD   I  + ++
Sbjct: 214 EREIVRTIKEKVCYLAKDAKKEEDKYLQGTQDLISAFK---------LPDGKSI-EVGND 263

Query: 293 RFSVPEAFFHPEISQSLKPGIIETVLESIYMLPELLRPLMASNIVCMGGNFNLPGFTDRL 352
           R+  PE  F P+I  S   G+    ++SI+ +   LR  + S+++  GG   L GF DR+
Sbjct: 264 RYRAPEILFSPQIIGSGYDGLSNMCMQSIWKVDLDLRKNLLSSVILSGGTTTLKGFGDRM 323

Query: 353 VSELQRQLPTDWVCRAK-ISSGDKSLTGWTAMAKFAHTDAYKKARVTKEDYFE 404
           + +L+    T    + K I+  ++  T W   +       ++K    K D+ E
Sbjct: 324 LHDLEAL--TKGTSKIKIIAPPERKYTAWIGGSILTGLSTFQKLWTKKSDWLE 374

>Skud_8.190 Chr8 complement(336365..337519) [1155 bp, 384 aa] {ON}
           YHR129C (REAL)
          Length = 384

 Score = 93.6 bits (231), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 95/413 (23%), Positives = 174/413 (42%), Gaps = 62/413 (15%)

Query: 4   DQAIVIDNGSYQVKFGLASEVRPRVALNALAKD-KY---------GVTHLSNQVQNIKDI 53
           +Q IVIDNGS  +K G + E RP+    +L    KY         G T + N+ Q ++ +
Sbjct: 12  NQPIVIDNGSGIIKVGFSGEERPKALEYSLVGHVKYEKVMLEGLQGDTFVGNKAQKLRGL 71

Query: 54  SSVVFRRPHELGQLTSWELESCIWDYCLYNPDEFGIDWQSLENRHVVLSETCMTLPELSK 113
             +  R P   G +  W+    IW Y L       +  Q++E   ++++E  M   +  +
Sbjct: 72  --LRLRYPMTHGVVEDWDSMELIWSYMLNEV----LQLQNIEEHPLLITEAPMNPLKNRE 125

Query: 114 NTDQVLFEEYEVDSLYKAPTAAYIPFYTTNENIKTISGKSDHGELDIEEKIEAGKEYNDF 173
              QVLFE + + +LY +   A +  Y         SG++                    
Sbjct: 126 VMAQVLFETFNLPALYIS-NPAVLSLYA--------SGRTT------------------- 157

Query: 174 SLVIDSGFNCTWVIPIVKGVPYYKAVKKLDVGGRFLNGLLKETISFRHYNVMDESILVNN 233
             V+D G      +PI  G     ++ ++D+GGR +     E + F+       S+  ++
Sbjct: 158 GCVVDCGEGYCSTVPIYDGFALPASIMRMDIGGRDIT----EQLQFQLRKSAGISLFSSS 213

Query: 234 IKEQCLYV-DPVSYFEAFKAKGKNKIDFVLPDFQTSFQGYVRDPKTALPDNAQILTLTDE 292
             E    + + V Y      K +++      D  + F+         LPD  + + + ++
Sbjct: 214 ELEVVRMIKEKVCYLAKNIKKEEDRYLQGHHDLGSVFK---------LPD-GKCIEIGND 263

Query: 293 RFSVPEAFFHPEISQSLKPGIIETVLESIYMLPELLRPLMASNIVCMGGNFNLPGFTDRL 352
           R+  PE  F P+I  S   G+ +  ++SI+ +   LR  + S+I+  GG   L GF +R+
Sbjct: 264 RYRAPEILFSPQIIGSGYDGLSDMCMQSIWKVDLDLRKTLLSSIILSGGTTTLRGFGERM 323

Query: 353 VSELQRQLPTDWVCRAK-ISSGDKSLTGWTAMAKFAHTDAYKKARVTKEDYFE 404
           + +L+    +   C+ K I+  ++  T W   +       ++K    K D+ E
Sbjct: 324 LHDLEAL--SKGTCKIKIIAPPERKYTTWVGGSILTGLSTFQKLWTKKSDWLE 374

>KLTH0B05940g Chr2 complement(485135..486286) [1152 bp, 383 aa] {ON}
           similar to uniprot|P38696 Saccharomyces cerevisiae
           YHR129C ARP1 Actin-related protein of the dynactin
           complex required for spindle orientation and nuclear
           migration putative ortholog of mammalian centractin
          Length = 383

 Score = 90.9 bits (224), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 101/424 (23%), Positives = 176/424 (41%), Gaps = 80/424 (18%)

Query: 4   DQAIVIDNGSYQVKFGLASEVRPR--------------VALNALAKDKYGVTHLSNQVQN 49
           +Q +V+DNGS  +K G + E +P+              V    LA D      + N+ Q 
Sbjct: 9   NQPVVLDNGSGIIKAGFSGEEQPKCFEYSLIGTPKYNKVMAGGLASDS---QLIGNEAQK 65

Query: 50  IKDISSVVFRRPHELGQLTSWELESCIWDYCLYNPDEFGIDWQSLENRHVVLSETCMTLP 109
           ++ +  + +  P E G +  W     +W +  YN     +   ++E   ++++E  +   
Sbjct: 66  MRGLLKLHY--PLEHGVVQDWPGLEQLWTHVFYN----SLKLANIEEHPMLITEAPLNPM 119

Query: 110 ELSKNTDQVLFEEYEVDSLY---KAPTAAYIPFYTTNENIKTISGKSDHGELDIEEKIEA 166
           +      ++LFE +   ++Y   +A  A Y    TT                        
Sbjct: 120 KNRNKMCEMLFETFGSPAVYVSIQAVLALYAGGRTTG----------------------- 156

Query: 167 GKEYNDFSLVIDSGFNCTWVIPIVKGVPYYKAVKKLDVGGR----FLNGLLKETISFRHY 222
                    VID G  C   +P+  G     A++++DV GR    FL  LL+++      
Sbjct: 157 --------CVIDCGDGCCQSVPVYDGFTLPSAIQRIDVAGRDITEFLQLLLRKSSGVTLS 208

Query: 223 NVMDESILVNNIKEQCLYVDPVSYFEAFKAKGKNKIDFVLPDFQTSFQGYVRDPKTALPD 282
           +  +  I V  IKE+  +V      E    +G N       + +T F+         LPD
Sbjct: 209 SSSEREI-VRMIKEKACFVATDVGNEEQNYEGANS-----AELETRFK---------LPD 253

Query: 283 NAQILTLTDERFSVPEAFFHPEISQSLKPGIIETVLESIYMLPELLRPLMASNIVCMGGN 342
             +ILTL  E+F  PE  F P +  S    I E   +SI  +   LR  + S+IV  GG+
Sbjct: 254 -GKILTLGAEKFRAPEVLFQPHLIGSEFCSIQEMCQQSISKVDLDLRSSLYSSIVLSGGS 312

Query: 343 FNLPGFTDRLVSELQRQLPTDWVCRAKI-SSGDKSLTGWTAMAKFAHTDAYKKARVTKED 401
               GF DRL+SE+++   ++   + KI +  ++  + W   +  A    ++K  VT+ +
Sbjct: 313 TMFSGFGDRLLSEIRKT--SEPNTKIKIFAPPERKYSTWIGGSILAGLSTFEKLWVTRAE 370

Query: 402 YFEH 405
           + E+
Sbjct: 371 WQEN 374

>Suva_15.326 Chr15 complement(565392..566546) [1155 bp, 384 aa] {ON}
           YHR129C (REAL)
          Length = 384

 Score = 89.7 bits (221), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 97/416 (23%), Positives = 175/416 (42%), Gaps = 68/416 (16%)

Query: 4   DQAIVIDNGSYQVKFGLASEVRPR-VALNALAKDKY---------GVTHLSNQVQNIKDI 53
           +Q IVIDNGS  +K G + E +P+ +  + +   KY         G T + N+ Q ++ +
Sbjct: 12  NQPIVIDNGSGIIKAGFSGEEKPKSLEYSLVGHAKYDKVMLEGLQGDTFVGNKAQRLRGL 71

Query: 54  SSVVFRRPHELGQLTSWELESCIWDYCLYNPDEFGIDWQSLENRHVVLSETCMTLPELSK 113
             +  + P E G +  W+    IW + L       +  Q++E   ++++E  M   +  +
Sbjct: 72  --LRLQYPIEHGVVEDWDSMELIWAHILNEV----LQLQNIEEHPLLITEAPMNPLKNRE 125

Query: 114 NTDQVLFEEYEVDSLYKAPTAAYIPFYTTNENIKTISGKSDHGELDIEEKIEAGKEYNDF 173
              QVLFE + + +LY     A +  Y         SG++                    
Sbjct: 126 VMAQVLFETFNLPALY-VSNPAVLSLYA--------SGRTT------------------- 157

Query: 174 SLVIDSGFNCTWVIPIVKGVPYYKAVKKLDVGGR----FLNGLLKETISFRHYNVMDESI 229
             VID G      +PI  G     ++ ++D+GGR     L   L+++     ++  +  I
Sbjct: 158 GCVIDCGEGYCSTVPIYDGFALPASMMRMDIGGRDITKQLQFQLRKSAGVSLFSSSEREI 217

Query: 230 LVNNIKEQCLYVDPVSYFEAFKAKGKNKIDFVLPDFQTSFQGYVRDPKTALPDNAQILTL 289
            V  IKE+      V Y      K +N       D  + F+         LPD  + + +
Sbjct: 218 -VRTIKEK------VCYLATDIKKEENTYMQESQDLTSVFK---------LPD-GKCIEI 260

Query: 290 TDERFSVPEAFFHPEISQSLKPGIIETVLESIYMLPELLRPLMASNIVCMGGNFNLPGFT 349
            ++R+  PE  F P+I  S   G+ +  ++SI+ +   LR  + S+I+  GG   L GF 
Sbjct: 261 GNDRYRAPEILFSPQIIGSGYDGLSDMCMQSIWKVDLDLRTTLLSSIILSGGTTTLRGFG 320

Query: 350 DRLVSELQRQLPTDWVCRAK-ISSGDKSLTGWTAMAKFAHTDAYKKARVTKEDYFE 404
           DR++ +L+    T    + K I+  ++  T W   +       +++    K D+ E
Sbjct: 321 DRMLHDLEAF--TKGTSKIKIIAPPERKYTTWVGGSILTGLSTFQRLWTKKSDWLE 374

>YHR129C Chr8 complement(362999..364153) [1155 bp, 384 aa] {ON}
           ARP1Actin-related protein of the dynactin complex;
           required for spindle orientation and nuclear migration;
           putative ortholog of mammalian centractin
          Length = 384

 Score = 87.4 bits (215), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 93/413 (22%), Positives = 171/413 (41%), Gaps = 62/413 (15%)

Query: 4   DQAIVIDNGSYQVKFGLASEVRPRVALNALAKD-KY---------GVTHLSNQVQNIKDI 53
           +Q +VIDNGS  +K G + E RP+     L  + KY         G T + N  Q ++ +
Sbjct: 12  NQPVVIDNGSGIIKAGFSGEERPKALEYCLVGNTKYDKVMLEGLQGDTFIGNNAQKLRGL 71

Query: 54  SSVVFRRPHELGQLTSWELESCIWDYCLYNPDEFGIDWQSLENRHVVLSETCMTLPELSK 113
             +  R P + G +  W+    IW Y L       +  Q++    ++++E  M   +  +
Sbjct: 72  --LKLRYPIKHGVVEDWDSMELIWSYVLNEV----LQLQNIGEHPLLITEAPMNPLKNRE 125

Query: 114 NTDQVLFEEYEVDSLYKAPTAAYIPFYTTNENIKTISGKSDHGELDIEEKIEAGKEYNDF 173
              QVLFE ++V +LY     A +  Y         SG++                    
Sbjct: 126 QMAQVLFETFDVSALY-VSNPAVLSLYA--------SGRTT------------------- 157

Query: 174 SLVIDSGFNCTWVIPIVKGVPYYKAVKKLDVGGRFLNGLLKETISFRHYNVMDESILVNN 233
             V+D G      +PI  G     ++ ++D+GG  +     E + F+       S+  ++
Sbjct: 158 GCVVDCGEGYCSTVPIYDGFALPASMMRMDIGGADIT----EQLQFQLRKSAGVSLFSSS 213

Query: 234 IKEQCLYV-DPVSYFEAFKAKGKNKIDFVLPDFQTSFQGYVRDPKTALPDNAQILTLTDE 292
            +E    + + V Y      K + K      D  ++F+         LPD  + + + ++
Sbjct: 214 EREIVRTMKEKVCYLAKNIKKEEEKYLQGTQDLISTFK---------LPD-GRCIEVGND 263

Query: 293 RFSVPEAFFHPEISQSLKPGIIETVLESIYMLPELLRPLMASNIVCMGGNFNLPGFTDRL 352
           R+  PE  F P+I      G+ +  ++SI+ +   LR  + S+I+  GG   L GF DR+
Sbjct: 264 RYRAPEILFSPQIIGLGYDGLSDMCMQSIWKVDLDLRKPLLSSIILSGGTTTLKGFGDRM 323

Query: 353 VSELQRQLPTDWVCRAK-ISSGDKSLTGWTAMAKFAHTDAYKKARVTKEDYFE 404
           + +L+    T    + K I+  ++  T W   +       +++    K D+ E
Sbjct: 324 LWDLEAL--TKGTSKIKIIAPSERKYTTWIGGSILTGLSTFQRLWTKKSDWLE 374

>KNAG0H03650 Chr8 complement(678598..679761) [1164 bp, 387 aa] {ON}
           Anc_2.117 YHR129C
          Length = 387

 Score = 86.3 bits (212), Expect = 9e-18,   Method: Compositional matrix adjust.
 Identities = 95/416 (22%), Positives = 181/416 (43%), Gaps = 64/416 (15%)

Query: 4   DQAIVIDNGSYQVKFGLASEVRPRVALNALA-KDKY------GV---THLSNQVQNIKDI 53
           +Q +V+DNGS  +K G + +  P +    +A K +Y      G+   T + N+ Q ++ +
Sbjct: 11  NQPVVLDNGSAILKAGFSGDETPAILEYTMAGKPRYKKVMTTGLEDRTFVGNEAQRLRGL 70

Query: 54  SSVVFRRPHELGQLTSWELESCIWDYCLYNPDEFGIDWQSLENRHVVLSETCMTLPELSK 113
            ++   RP   G++T+W+    +W +  Y+  + G     + +  ++++E  +   +  +
Sbjct: 71  LALR--RPISRGEVTNWDDMELLWSHIFYSKLQLGQGNSQIGDHPLLITEAPLNSTKNRE 128

Query: 114 NTDQVLFEEYEVDSLYKAPTAAYIPFYTTNENIKTISGKSDHGELDIEEKIEAGKEYNDF 173
              ++L+E +  D+LY A  A  +  Y T +    +              +E G+ Y+  
Sbjct: 129 TMCEILYETFNFDALYVAHPAV-LSLYATGQTTGCV--------------LECGEGYSAS 173

Query: 174 SLVIDSGFNCTWVIPIVKGVPYYKAVKKLDVGGR----FLNGLLKETISFRHYNVMDESI 229
           +             P+ +G     +++++D+GGR     L   ++++     ++  ++ I
Sbjct: 174 T-------------PVYQGFALPSSIRRIDIGGRDITQELQFYIRKSTGLSLFSNSEQEI 220

Query: 230 LVNNIKEQCLYVDPVSYFEAFKAKGKNKIDFVLPDFQTSFQGYVRDPKTALPDNAQILTL 289
            V  IKE+  YV       A   K + +  F+     TS           LPD  Q LT 
Sbjct: 221 -VRTIKEKANYV-------ALDYKFEEEKFFIHERENTS--------TVKLPD-GQELTF 263

Query: 290 TDERFSVPEAFFHPEISQSLKPGIIETVLESIYMLPELLRPLMASNIVCMGGNFNLPGFT 349
              ++   E  F P++  S    + E +LESI  +   LR  +  NIV  GG   L GF 
Sbjct: 264 GKGKYRTSEILFQPQLIGSECVSVPEMLLESINKVDMDLRTQLLENIVLSGGTTMLKGFD 323

Query: 350 DRLVSELQRQLPTDWVCRAKISS-GDKSLTGWTAMAKFAHTDAYKKARVTKEDYFE 404
            R +SE ++ LP     + KI S  ++S   W   +  +    ++   +T+E Y E
Sbjct: 324 QRTMSETKKMLPKH--TKVKIRSLAERSYIAWIGGSILSGLYGFRNLWLTREMYEE 377

>NCAS0B07130 Chr2 complement(1354064..1355209) [1146 bp, 381 aa]
           {ON} Anc_2.117
          Length = 381

 Score = 85.5 bits (210), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 96/420 (22%), Positives = 171/420 (40%), Gaps = 73/420 (17%)

Query: 4   DQAIVIDNGSYQVKFGLASEVRPRV-ALNALAKDKYGVTHLSNQVQN----------IKD 52
           +Q +V+DNGS  +K G + + +P+    N +   KY    L+N + N           K 
Sbjct: 8   NQPVVLDNGSSVIKSGFSGQNKPQCFEYNLIGTPKYEKVMLTNAISNNDLTYIGNRAQKS 67

Query: 53  ISSVVFRRPHELGQLTSWELESCIWDYCLYNPDEFGIDWQSLENRHVVLSETCMTLPELS 112
              +  R P   G + +W+    +W +   +     +     +   ++++E  +  PE  
Sbjct: 68  RGLLRLRHPMNRGIVENWDDMETLWSHTFNDI----LKINDFDEHPLLITEAPLN-PE-- 120

Query: 113 KNTD---QVLFEEYEVDSLYKAPTAAYIPFYTTNENIKTISGKSDHGELDIEEKIEAGKE 169
           KN D   +V FE+++  ++Y A   + +  Y         SG++                
Sbjct: 121 KNRDKMCEVFFEKFDFAAVYIA-NPSTLSLYA--------SGRTT--------------- 156

Query: 170 YNDFSLVIDSGFNCTWVIPIVKGVPYYKAVKKLDVGGRFLNGLLKETISFRHYNVMD--- 226
                 V+D G      +PI +G     +++++DVGGR +   L+  I  R Y  +    
Sbjct: 157 ----GCVLDCGDGYCSSVPIYEGFALPSSIRRIDVGGRDVTEQLQFQI--RKYTGISLYS 210

Query: 227 --ESILVNNIKEQCLYVDPVSYFEAFKAKGKNKIDFVLPDFQTSFQGYVRDPKTALPDNA 284
             E  +V N+KE+  YV                 DF   +  ++        +  LPD  
Sbjct: 211 SSEHEIVKNVKEKACYV---------------STDFAHDEDMSNLNPEKIRCQFKLPD-G 254

Query: 285 QILTLTDERFSVPEAFFHPEISQSLKPGIIETVLESIYMLPELLRPLMASNIVCMGGNFN 344
           + L L   RF  PE  F P+I       + +   ESI  +   LRP + S+I+  GG+  
Sbjct: 255 KDLILDKARFRAPEILFRPQIMGLEYDSVSDMCFESISKVDLELRPKLFSSIILNGGSTM 314

Query: 345 LPGFTDRLVSELQRQLPTDWVCRAKISSGDKSLTGWTAMAKFAHTDAYKKARVTKEDYFE 404
             GF DRL+ ELQ +     + +  I+  ++  T W   +       +K+  +TK ++ E
Sbjct: 315 FRGFGDRLLKELQIRTGNKNLIKI-IAPPERKYTSWIGGSILTGLSTFKQLWMTKAEWQE 373

>ZYRO0B04928g Chr2 complement(398291..399444,399538..399559) [1176
           bp, 391 aa] {ON} highly similar to uniprot|P32381
           Saccharomyces cerevisiae YDL029W ARP2 Essential
           component of the Arp2/3 complex which is a highly
           conserved actin nucleation center required for the
           motility and integrity of actin patches involved in
           endocytosis and membrane growth and polarity
          Length = 391

 Score = 84.7 bits (208), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 98/390 (25%), Positives = 161/390 (41%), Gaps = 67/390 (17%)

Query: 1   MTADQAIVIDNGSYQVKFGLASEVRPR------VALNALAKDKYGVTHLSNQVQNI---- 50
           M     IV+D G+  VK G A E  P       V    L  ++ G   +S  +++I    
Sbjct: 1   MDPHSPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERG--SISTPLKDIMIGE 58

Query: 51  --KDISSVV-FRRPHELGQLTSWELESCIWDYCLYNPDEFGIDWQSLENRHVVLSETCMT 107
              D+ S +    P E G + +W+    +WDY  YN  +F     S     ++L+E  M 
Sbjct: 59  EASDVRSYLQISYPMENGIIRNWQDMEHLWDYAFYNQMKF----PSTSGGKILLTEPPMN 114

Query: 108 LPELSKNTDQVLFEEYEVDSLYKAPTAAYIPFYTTNENIKTISGKSDHGELDIEEKIEAG 167
             +  +   +V+FE+Y+   +Y A   A +  Y                     + + +G
Sbjct: 115 PLKNRELMCEVMFEKYDFGGVYVA-IQAVLALYA--------------------QGLSSG 153

Query: 168 KEYNDFSLVIDSGFNCTWVIPIVKGVPYYKAVKKLDVGGRFLNGLLKETISFRHY--NVM 225
                  +V+DSG   T ++P+ + V      ++LDV GR +   L + +S R Y  N  
Sbjct: 154 -------VVVDSGDGVTHIVPVYESVVLNHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRS 206

Query: 226 DESILVNNIKEQCLYVDPVSYFEAFKAKGKNKIDFVLPDFQTSFQGYVRDPKTALPDNAQ 285
            +   V  IKE+  YV   SY      K   +   ++ +++             LPD  +
Sbjct: 207 ADFETVRQIKEKLSYV---SYDLNLDTKLARETTVLVENYE-------------LPD-GR 249

Query: 286 ILTLTDERFSVPEAFFHPEISQSLKPGIIETVLESIYMLPELLRPLMASNIVCMGGNFNL 345
           ++ +  ERF  PE  F P++    +PGI E +  +I      +R  +   IV  GG+   
Sbjct: 250 VIKVGQERFEAPECLFQPDLVDVEQPGIGELLFNTIQSADVDIRSSLYRAIVLSGGSSMY 309

Query: 346 PGFTDRLVSELQRQLPTDWVCRAKISSGDK 375
           PG   RL  EL +QL    + R   +  DK
Sbjct: 310 PGLPSRLEKEL-KQLWYTRILRGDAARLDK 338

>KLTH0F06490g Chr6 complement(561947..563100,563192..563213) [1176
           bp, 391 aa] {ON} highly similar to uniprot|P32381
           Saccharomyces cerevisiae YDL029W ARP2 Essential
           component of the Arp2/3 complex which is a highly
           conserved actin nucleation center required for the
           motility and integrity of actin patches involved in
           endocytosis and membrane growth and polarity
          Length = 391

 Score = 84.0 bits (206), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 90/371 (24%), Positives = 148/371 (39%), Gaps = 62/371 (16%)

Query: 1   MTADQAIVIDNGSYQVKFGLASEVRPRVALNAL-AKDKYGVTHLSNQVQNIKDI------ 53
           M     IV+D G+  VK G A E  P     ++  +        +N V  +KDI      
Sbjct: 1   MDLRTPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERANVVTPLKDIMIGDEA 60

Query: 54  ----SSVVFRRPHELGQLTSWELESCIWDYCLYNPDEFGIDWQSLENRHVVLSETCMTLP 109
               S +    P E G + +W     +WDY  Y+     +   S     V+L+E  M   
Sbjct: 61  SAVRSYLQISYPMENGVIKNWSDMELLWDYAFYDQ----MKLPSTSGGKVMLTEPPMNPL 116

Query: 110 ELSKNTDQVLFEEYEVDSLYKAPTAAYIPFYTTNENIKTISGKSDHGELDIEEKIEAGKE 169
              +   +V+FE+Y+   +Y A   A +  Y                     + + +G  
Sbjct: 117 RNREQMCEVMFEKYDFGGVYVA-IQAVLALYA--------------------QGLSSG-- 153

Query: 170 YNDFSLVIDSGFNCTWVIPIVKGVPYYKAVKKLDVGGRFLNGLLKETISFRHY--NVMDE 227
                +V+DSG   T ++P+ + V      ++LDV GR +   L + +S R Y  N   +
Sbjct: 154 -----VVVDSGDGVTHIVPVYESVVLNHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRSAD 208

Query: 228 SILVNNIKEQCLYVDPVSYFEAFKAKGKNKIDFVLPDFQTSFQGYVRDPKTALPDNAQIL 287
              V  IKE+  YV   SY      K   +   ++ +++             LPD  +++
Sbjct: 209 FETVRQIKEKLSYV---SYDLDLDTKLARETTTLVENYE-------------LPD-GRVI 251

Query: 288 TLTDERFSVPEAFFHPEISQSLKPGIIETVLESIYMLPELLRPLMASNIVCMGGNFNLPG 347
            +  ERF  PE  F P +    +PG+ E +  +I      +R  +   IV  GG+   PG
Sbjct: 252 KVGSERFEAPECLFQPNLVDVEQPGVGEMLFNTIQAADVDVRSALYRAIVLSGGSSMYPG 311

Query: 348 FTDRLVSELQR 358
              RL  EL++
Sbjct: 312 LPSRLEKELKQ 322

>Kwal_33.14642 s33 (753758..754909) [1152 bp, 383 aa] {ON} YHR129C
           (ARP1) - Centractin [contig 388] FULL
          Length = 383

 Score = 83.2 bits (204), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 101/419 (24%), Positives = 176/419 (42%), Gaps = 70/419 (16%)

Query: 4   DQAIVIDNGSYQVKFGLASEVRPRVALNALAK----DKYGVTHLSNQVQNI-----KDIS 54
           +Q +V+DNGS  +K G + E +P+    +L      DK     LS++ Q +     K   
Sbjct: 9   NQPVVLDNGSGIIKAGFSGEEKPKCFEYSLIGTPKYDKIMAGGLSSRGQLVGNEAQKQRG 68

Query: 55  SVVFRRPHELGQLTSWELESCIWDYCLYNPDEFGIDWQSLENRHVVLSETCMTLPELSKN 114
            +  + P E G +  W     +W +  Y+     +   ++ +  ++++E  +   E    
Sbjct: 69  LLRLQYPVEHGIVQDWSGLEQLWTHVFYS----SLKLNNIGDHPMLVTEAPLNPLENRDK 124

Query: 115 TDQVLFEEYEVDSLY---KAPTAAYIPFYTTNENIKTISGKSDHGELDIEEKIEAGKEYN 171
             ++L+E + V ++Y   +A  A Y    TT                             
Sbjct: 125 MCEMLYETFNVPAVYVSIQAVLALYAGGRTTG---------------------------- 156

Query: 172 DFSLVIDSGFNCTWVIPIVKGVPYYKAVKKLDVGGR----FLNGLLKETISFRHYNVMDE 227
               VID G  C   +P+  G     A++++DV GR    FL  LL+++I     +  + 
Sbjct: 157 ---CVIDCGDGCCQSVPVYDGFSIPSAIRRIDVAGRDVTEFLQLLLRKSIGVTLLSSSER 213

Query: 228 SILVNNIKEQCLYVDPVSYFEAFKAKGKNKIDFVLPDFQTSFQGYVRDPKTALPDNAQIL 287
            I V  IKE+  YV P    E  K                S +G     K  LPD  +IL
Sbjct: 214 EI-VRMIKEKACYVAPEVAAEEQK--------------YASSRGSEELTKFKLPD-GKIL 257

Query: 288 TLTDERFSVPEAFFHPEISQSLKPGIIETVLESIYMLPELLRPLMASNIVCMGGNFNLPG 347
           +L  E+F  PE  F P++  S    I +   +SI  +   LR  + S++V  GG+    G
Sbjct: 258 SLGAEKFRAPEILFQPQLIGSEFNSIQDMCFQSISKVDLDLRSSLYSSLVLSGGSTLFAG 317

Query: 348 FTDRLVSELQRQLPTDWVCRAKI-SSGDKSLTGWTAMAKFAHTDAYKKARVTKEDYFEH 405
           F DRL++EL+ +   +   + KI +  ++  + W   +  A    ++K  VT+ ++ E+
Sbjct: 318 FGDRLLNELRSRCEPN--VKIKIFAPPERKYSVWIGGSILAGLSTFEKIWVTRSEWQEN 374

>SAKL0C07370g Chr3 complement(680403..681556,681672..681693) [1176
           bp, 391 aa] {ON} highly similar to uniprot|P32381
           Saccharomyces cerevisiae YDL029W ARP2 Essential
           component of the Arp2/3 complex which is a highly
           conserved actin nucleation center required for the
           motility and integrity of actin patches involved in
           endocytosis and membrane growth and polarity
          Length = 391

 Score = 82.4 bits (202), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 92/390 (23%), Positives = 157/390 (40%), Gaps = 67/390 (17%)

Query: 1   MTADQAIVIDNGSYQVKFGLASEVRPRVALNAL-------AKDKYGVT------HLSNQV 47
           M     IV+D G+  VK G A E  P     ++       A+++  +T       + ++ 
Sbjct: 1   MDPHTPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASITTPLKDIMIGDEA 60

Query: 48  QNIKDISSVVFRRPHELGQLTSWELESCIWDYCLYNPDEFGIDWQSLENRHVVLSETCMT 107
            +++    + +  P E G + +W     +WDY  Y      +   S     V+L+E  M 
Sbjct: 61  SDVRSYLQISY--PMENGIIKNWADMELLWDYAFYE----QMKLPSTSGGKVLLTEPPMN 114

Query: 108 LPELSKNTDQVLFEEYEVDSLYKAPTAAYIPFYTTNENIKTISGKSDHGELDIEEKIEAG 167
                +   +V+FE+Y+   +Y A   A +  Y                     + + +G
Sbjct: 115 PLRNREQMCEVMFEKYDFGGVYVA-IQAVLALYA--------------------QGLSSG 153

Query: 168 KEYNDFSLVIDSGFNCTWVIPIVKGVPYYKAVKKLDVGGRFLNGLLKETISFRHY--NVM 225
                  +V+DSG   T ++P+ + V      K+LDV GR +   L + +S R Y  N  
Sbjct: 154 -------VVVDSGDGVTHIVPVYESVVLSHLTKRLDVAGRDVTRHLIDLLSRRGYAFNRS 206

Query: 226 DESILVNNIKEQCLYVDPVSYFEAFKAKGKNKIDFVLPDFQTSFQGYVRDPKTALPDNAQ 285
            +   V  IKE+  YV   SY      K   +   ++ +++             LPD  +
Sbjct: 207 ADFETVRQIKEKLCYV---SYDLDLDTKLARETTTLVENYE-------------LPD-GR 249

Query: 286 ILTLTDERFSVPEAFFHPEISQSLKPGIIETVLESIYMLPELLRPLMASNIVCMGGNFNL 345
           ++ +  ERF  PE  F P +    +PG+ E +  ++      +R  +   +V  GG+   
Sbjct: 250 VIKVGSERFEAPECLFQPSLVDVEQPGVGEMLFNTVQAADVDVRTALYRAVVLSGGSSMY 309

Query: 346 PGFTDRLVSELQRQLPTDWVCRAKISSGDK 375
           PG   RL  EL +QL    V R   S  DK
Sbjct: 310 PGLPSRLEKEL-KQLWFTRVLRNDPSRLDK 338

>Suva_4.220 Chr4 (389822..389843,389967..391120) [1176 bp, 391 aa]
           {ON} YDL029W (REAL)
          Length = 391

 Score = 82.4 bits (202), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 86/373 (23%), Positives = 152/373 (40%), Gaps = 66/373 (17%)

Query: 1   MTADQAIVIDNGSYQVKFGLASEVRPRVALNAL-------AKDKYGVT------HLSNQV 47
           M     IV+D G+  VK G A E  P     ++       A+++  VT       + ++ 
Sbjct: 1   MDPHNPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASVTTPLKDIMIGDEA 60

Query: 48  QNIKDISSVVFRRPHELGQLTSWELESCIWDYCLYNPDEFGIDWQSLENRHVVLSETCMT 107
            +++    + +  P E G + +W     +WDY  +      +  QS  N  ++L+E  M 
Sbjct: 61  SDVRSYLQISY--PMENGIIKNWTDMELLWDYAFFEQ----MKLQSTSNGKILLTEPPMN 114

Query: 108 LPELSKNTDQVLFEEYEVDSLYKAPTAAYIPFYTTNENIKTISGKSDHGELDIEEKIEAG 167
             +  +   +V+FE+Y+   +Y A   A +  Y                     + + +G
Sbjct: 115 PLKNREKMCEVMFEKYDFGGVYVA-IQAVLALYA--------------------QGLSSG 153

Query: 168 KEYNDFSLVIDSGFNCTWVIPIVKGVPYYKAVKKLDVGGRFLNGLLKETISFRHY--NVM 225
                  +V+DSG   T ++P+ + V      ++LDV GR +   L + +S R Y  N  
Sbjct: 154 -------VVVDSGDGVTHIVPVYESVVLNHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRT 206

Query: 226 DESILVNNIKEQCLYVDPVSYFEAFKAKGKNKIDFVLPDFQTSFQGYVRDPKTALPDNAQ 285
            +   V  IKE+  YV   SY      K   +   ++  ++             LPD  +
Sbjct: 207 ADFETVRQIKEKLCYV---SYDLDLDTKLARETTTLVESYE-------------LPD-GR 249

Query: 286 ILTLTDERFSVPEAFFHPEISQSLKPGIIETVLESIYMLPELLRPLMASNIVCMGGNFNL 345
            + +  ERF  PE  F P +    +PG+ E +  ++      +R  +   IV  GG+   
Sbjct: 250 TIKVGQERFEAPECLFQPGLVDVEQPGVGELLFNTVQSADVDIRSSLYKAIVLSGGSSMY 309

Query: 346 PGFTDRLVSELQR 358
           PG   RL  EL++
Sbjct: 310 PGLPSRLEKELKQ 322

>TBLA0F00870 Chr6 complement(222947..224100,224325..224346) [1176
           bp, 391 aa] {ON} Anc_3.161 YDL029W
          Length = 391

 Score = 81.6 bits (200), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 97/387 (25%), Positives = 153/387 (39%), Gaps = 68/387 (17%)

Query: 1   MTADQAIVIDNGSYQVKFGLASEVRPR------VALNALAKDKYGVTHLSNQVQNIKDIS 54
           M     IV+D G+  VK G A E  P       V    L  ++ G      +   I D +
Sbjct: 1   MDPHSPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERGTISTPLKDIMIGDEA 60

Query: 55  SVV-----FRRPHELGQLTSWELESCIWDYCLYNPDEFGIDWQSLENRHVVLSETCMTLP 109
           S V        P E G + +W     +WDY  +N     +   +     V+L+E  M   
Sbjct: 61  SEVRSYLQISYPMENGIIKNWTDMELLWDYAFFNQ----MKLPTTSGGKVLLTEPPMNPV 116

Query: 110 ELSKNTDQVLFEEYEVDSLYKAPTAAYIPFYTTNENIKTISGKSDHGELDIEEKIEAGKE 169
           +  +   +V+FE Y+   +Y A   A +  Y                     + + +G  
Sbjct: 117 KNRERMCEVMFERYDFGGVYVA-IQAVLALYA--------------------QGLSSG-- 153

Query: 170 YNDFSLVIDSGFNCTWVIPIVKGVPYYKAVKKLDVGGRFLNGLLKETISFRHY--NVMDE 227
                +V+DSG   T ++P+ + V      ++LDV GR +   L + +S R Y  N   +
Sbjct: 154 -----VVVDSGDGVTHIVPVYESVVLNHLTRRLDVAGRDVTRHLIDLLSRRGYSFNRTAD 208

Query: 228 SILVNNIKEQCLYVDPVSYFEAFKAKGKNKIDFVLPDFQTSFQGYVRDPKTALPDNAQIL 287
              V  IKE+  YV   SY      K   +   ++ +++             LPD  +I+
Sbjct: 209 FETVRQIKEKVCYV---SYDLNLDTKLARETTTLVQEYE-------------LPD-GRII 251

Query: 288 TLTDERFSVPEAFFHPEISQSLKPGIIETVLESIYMLPELLRPLMASNIVCMGGNFNLPG 347
            +  ERF  PE  F P++     PG+ E +  +I      +R  +   IV  GG+   PG
Sbjct: 252 KVGQERFEAPECLFQPDLVDVESPGVGELLFNTIQSADIDVRSSLYKAIVLSGGSSMYPG 311

Query: 348 FTDRLVSELQRQLPTDWVCRAKISSGD 374
               L S L+R+L   W  R  I  GD
Sbjct: 312 ----LPSRLERELKQLWFTR--ILKGD 332

>TBLA0B01070 Chr2 (236811..237962) [1152 bp, 383 aa] {ON} Anc_2.117
           YHR129C
          Length = 383

 Score = 81.3 bits (199), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 92/421 (21%), Positives = 172/421 (40%), Gaps = 82/421 (19%)

Query: 4   DQAIVIDNGSYQVKFGLASEVRPR--------------VALNALAKDKYGVTHLSNQVQN 49
           +Q IV+DNGS  +K G   + +P+              V +  + K K+ V +L+ + + 
Sbjct: 11  NQPIVLDNGSALLKAGFGGDDKPKCFEYSLIGTPKYDKVMVGGVEKGKF-VGNLAQEYRG 69

Query: 50  IKDISSVVFRRPHELGQLTSWELESCIWDYCLYNPDEFGIDWQSLENRHVVLSETCMTLP 109
           +     +  R P + G + +WE    +WD+   +     +   +L    +V++E  +   
Sbjct: 70  L-----LKLRYPMDHGIIENWEHMETVWDHIFKD----CLKVSNLGEHPLVVTEAPLNPK 120

Query: 110 ELSKNTDQVLFEEYEVDSLYKAPTAAYIPFYTTNENIKTISGKSDHGELDIEEKIEAGKE 169
              +   + LFE + + +LY A   A +  Y +      +              +EAG  
Sbjct: 121 PNREKMCETLFESFNIPALYIA-NPAVLSLYASGRTTGCV--------------VEAGDG 165

Query: 170 YNDFSLVIDSGFNCTWVIPIVKGVPYYKAVKKLDVGGR----FLNGLLKETISFRHYNVM 225
           Y            C+ V PI +G     +++++D+GGR     L   L+++     Y+  
Sbjct: 166 Y------------CSSV-PIYEGFALTPSIRRIDIGGRDITKHLQLQLRKSTGMWLYSSS 212

Query: 226 DESILVNNIKEQCLYVDPVSYFEAFK---AKGKNKIDFVLPDFQTSFQGYVRDPKTALPD 282
           ++ I V  IKE   Y+      E  K    + K  I F LPD                  
Sbjct: 213 EQEI-VRLIKENGCYICSNHKKEEEKFLLDQEKKSISFKLPD------------------ 253

Query: 283 NAQILTLTDERFSVPEAFFHPEISQSLKPGIIETVLESIYMLPELLRPLMASNIVCMGGN 342
             + L +   RF  PE  F+P +  S    + + +++SI  +   LR  + +NI   GG+
Sbjct: 254 -GKNLVIGPGRFRAPEILFNPLLIGSEDSSLPDMIMQSISKVDIDLRSKLLNNITLSGGS 312

Query: 343 FNLPGFTDRLVSELQRQLPTDWVCRAKI-SSGDKSLTGWTAMAKFAHTDAYKKARVTKED 401
               GF DRL++EL      D   + +I +  ++  + +   +  A+   ++   VTK+ 
Sbjct: 313 TMFQGFCDRLITEL--DFSVDKTTKVRILAPPERKYSAFIGGSILANLSTFRNMWVTKDQ 370

Query: 402 Y 402
           +
Sbjct: 371 W 371

>Smik_4.206 Chr4 (379506..379527,379652..380805) [1176 bp, 391 aa]
           {ON} YDL029W (REAL)
          Length = 391

 Score = 80.1 bits (196), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 85/373 (22%), Positives = 151/373 (40%), Gaps = 66/373 (17%)

Query: 1   MTADQAIVIDNGSYQVKFGLASEVRPRVALNAL-------AKDKYGVT------HLSNQV 47
           M     IV+D G+  VK G A E  P     ++       A+++  VT       + ++ 
Sbjct: 1   MDPHNPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASVTTPLKDIMIGDEA 60

Query: 48  QNIKDISSVVFRRPHELGQLTSWELESCIWDYCLYNPDEFGIDWQSLENRHVVLSETCMT 107
            +++    + +  P E G + +W     +WDY  +      +   S  N  ++L+E  M 
Sbjct: 61  SDVRSYLQISY--PMENGIIKNWTDMELLWDYAFFE----QMKLPSTSNGKILLTEPPMN 114

Query: 108 LPELSKNTDQVLFEEYEVDSLYKAPTAAYIPFYTTNENIKTISGKSDHGELDIEEKIEAG 167
             +  +   +V+FE+Y+   +Y A   A +  Y                     + + +G
Sbjct: 115 PLKNREKMCEVMFEKYDFGGVYVA-IQAVLALYA--------------------QGLSSG 153

Query: 168 KEYNDFSLVIDSGFNCTWVIPIVKGVPYYKAVKKLDVGGRFLNGLLKETISFRHY--NVM 225
                  +V+DSG   T ++P+ + V      ++LDV GR +   L + +S R Y  N  
Sbjct: 154 -------VVVDSGDGVTHIVPVYESVVLSHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRT 206

Query: 226 DESILVNNIKEQCLYVDPVSYFEAFKAKGKNKIDFVLPDFQTSFQGYVRDPKTALPDNAQ 285
            +   V  IKE+  YV   SY      K   +   ++  ++             LPD  +
Sbjct: 207 ADFETVRQIKEKLCYV---SYDLDLDTKLARETTALVESYE-------------LPD-GR 249

Query: 286 ILTLTDERFSVPEAFFHPEISQSLKPGIIETVLESIYMLPELLRPLMASNIVCMGGNFNL 345
            + +  ERF  PE  F P +    +PG+ E +  ++      +R  +   IV  GG+   
Sbjct: 250 TIKVGQERFEAPECLFQPGLVDVEQPGVGELLFNTVQSADVDIRSSLYKAIVLSGGSSMY 309

Query: 346 PGFTDRLVSELQR 358
           PG   RL  EL++
Sbjct: 310 PGLPSRLEKELKQ 322

>KAFR0F00590 Chr6 (120359..121519) [1161 bp, 386 aa] {ON} Anc_2.117
           YHR129C
          Length = 386

 Score = 80.1 bits (196), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 94/410 (22%), Positives = 163/410 (39%), Gaps = 65/410 (15%)

Query: 4   DQAIVIDNGSYQVKFGLASEVRPR-VALNALAKDKYGVTHLSNQVQNIKDISS------- 55
           +Q IVIDNG+  +K G   E +PR +  + +   KY     SN +++   I +       
Sbjct: 12  NQPIVIDNGTNVIKGGFTGETKPRCLEYSIVGTPKYDKIMQSNGIESDSFIGNKAQKYRG 71

Query: 56  -VVFRRPHELGQLTSWELESCIWDYCLYNPDEFGIDWQSLENRHVVLSETCMTLPELSKN 114
            +  R P   G + +W+    IW Y   +     +  ++L    ++++E  +      + 
Sbjct: 72  ILKLRHPMLRGVVQNWDDMETIWQYVFDDT----LYLENLNEHPILITEPPLNNMANRQK 127

Query: 115 TDQVLFEEYEVDSLYKAPTAAYIPFYTTNENIKTISGKSDHGELDIEEKIEAGKEYNDFS 174
             + LFE +   ++Y +  +  +  Y + +                   ++ G  Y    
Sbjct: 128 MCEALFEIFGFPAVYIS-VSPVLSLYASGQTTGC--------------AVDCGDGY---- 168

Query: 175 LVIDSGFNCTWVIPIVKGVPYYKAVKKLDVGG-----RFLNGLLKETISFRHYNVMDESI 229
                   CT  IP+  G     +VKK+D+GG     +    +LK T  F + +   E  
Sbjct: 169 --------CT-SIPVYNGFSLASSVKKIDIGGCDITEQLQFSILKNTGLFMYSS--SERE 217

Query: 230 LVNNIKEQCLYVDPVSYFEAFKAKGKNKIDFVLPDFQTSFQGYVRDPKTALPDNAQILTL 289
           +V  IKE+  Y+                 D+ L   +  F       +  LPD  ++L +
Sbjct: 218 IVRTIKEKVCYI---------------ATDYNLETEKYLFNEEKMASQFKLPD-GKMLNI 261

Query: 290 TDERFSVPEAFFHPEISQSLKPGIIETVLESIYMLPELLRPLMASNIVCMGGNFNLPGFT 349
           +  +++  E  F PE+  S    + E   +SI  +   LR  + SNIV  GG    PGF 
Sbjct: 262 SQGKYTSTEILFRPELIGSEFDSLPEICYQSIKKVDSDLRLPLYSNIVLSGGTTMCPGFG 321

Query: 350 DRLVSELQRQLPTDWVCRAKISSGDKSLTGWTAMAKFAHTDAYKKARVTK 399
            RL+ ELQ     D   R  I+  ++  T W   +  +    + K  VTK
Sbjct: 322 SRLLKELQTLTGYDTKIRI-IAPPERKYTSWIGGSILSGLSTFSKIWVTK 370

>NDAI0G02900 Chr7 (671423..671444,671694..672847) [1176 bp, 391 aa]
           {ON} Anc_3.161 YDL029W
          Length = 391

 Score = 79.7 bits (195), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 84/373 (22%), Positives = 151/373 (40%), Gaps = 66/373 (17%)

Query: 1   MTADQAIVIDNGSYQVKFGLASEVRPRVALNAL-------AKDKYGVT------HLSNQV 47
           M     IV+D G+  VK G A E  P     ++       A+++  +T       + ++ 
Sbjct: 1   MDPHSPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERANITTPLRDIMIGDEA 60

Query: 48  QNIKDISSVVFRRPHELGQLTSWELESCIWDYCLYNPDEFGIDWQSLENRHVVLSETCMT 107
            +++    + +  P E G + +W     +WDY  +N     +   +     ++L+E  M 
Sbjct: 61  SDVRSYLQISY--PMENGIIKNWTDMELLWDYAFFNQ----MKLNNTSGGKILLTEPPMN 114

Query: 108 LPELSKNTDQVLFEEYEVDSLYKAPTAAYIPFYTTNENIKTISGKSDHGELDIEEKIEAG 167
             +  +   +V+FE+Y+   +Y A   A +  Y                     + + +G
Sbjct: 115 PLKNREKMCEVMFEKYDFGGVYVA-IQAVLALYA--------------------QGLSSG 153

Query: 168 KEYNDFSLVIDSGFNCTWVIPIVKGVPYYKAVKKLDVGGRFLNGLLKETISFRHY--NVM 225
                  +V+DSG   T ++P+ + V      ++LDV GR +   L + +S R Y  N  
Sbjct: 154 -------VVVDSGDGVTHIVPVYESVVLNHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRT 206

Query: 226 DESILVNNIKEQCLYVDPVSYFEAFKAKGKNKIDFVLPDFQTSFQGYVRDPKTALPDNAQ 285
            +   V  IKE+  YV   SY      K   +   ++  ++             LPD  +
Sbjct: 207 ADFETVRQIKEKLCYV---SYDLDLDTKLARETTTLVESYE-------------LPD-GR 249

Query: 286 ILTLTDERFSVPEAFFHPEISQSLKPGIIETVLESIYMLPELLRPLMASNIVCMGGNFNL 345
            + +  ERF  PE  F P +    +PG+ E +  +I      +R  +   IV  GG+   
Sbjct: 250 TIKVGQERFEAPECLFQPGLVDVEQPGVGELLFNTIQSADVDVRSALYKAIVLSGGSSMY 309

Query: 346 PGFTDRLVSELQR 358
           PG   RL  EL++
Sbjct: 310 PGLPSRLEKELKQ 322

>NCAS0C03550 Chr3 (709102..709123,709273..710429) [1179 bp, 392 aa]
           {ON} Anc_3.161
          Length = 392

 Score = 79.3 bits (194), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 86/371 (23%), Positives = 147/371 (39%), Gaps = 62/371 (16%)

Query: 1   MTADQAIVIDNGSYQVKFGLASEVRPRVALNAL-AKDKYGVTHLSNQVQNIKDI------ 53
           M     IV+D G+  VK G A E  P     ++  +        +N    +KDI      
Sbjct: 1   MDPHSPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERANITTPLKDIMIGDEA 60

Query: 54  ----SSVVFRRPHELGQLTSWELESCIWDYCLYNPDEFGIDWQSLENRHVVLSETCMTLP 109
               S +    P E G + +W     +WDY  +      +   +  N  ++L+E  M   
Sbjct: 61  SEVRSYLQISYPMENGIIKNWTDMELLWDYAFFEQ----MKLPTTSNGKILLTEPPMNPT 116

Query: 110 ELSKNTDQVLFEEYEVDSLYKAPTAAYIPFYTTNENIKTISGKSDHGELDIEEKIEAGKE 169
           +  +   +V+FE+Y+   +Y A   A +  Y                     + + +G  
Sbjct: 117 KNREKMCEVMFEKYDFGGVYVA-IQAVLALYA--------------------QGLSSG-- 153

Query: 170 YNDFSLVIDSGFNCTWVIPIVKGVPYYKAVKKLDVGGRFLNGLLKETISFRHY--NVMDE 227
                +V+DSG   T ++P+ + V      ++LDV GR +   L + +S R Y  N   +
Sbjct: 154 -----VVVDSGDGVTHIVPVYESVVLGHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRTAD 208

Query: 228 SILVNNIKEQCLYVDPVSYFEAFKAKGKNKIDFVLPDFQTSFQGYVRDPKTALPDNAQIL 287
              V  IKE+  YV   SY      K   +   ++  ++             LPD  + +
Sbjct: 209 FETVRQIKEKLCYV---SYDLDLDTKLARETTTLVESYE-------------LPD-GRTI 251

Query: 288 TLTDERFSVPEAFFHPEISQSLKPGIIETVLESIYMLPELLRPLMASNIVCMGGNFNLPG 347
            +  ERF  PE  F P +    +PG+ E + +++      +R  +   IV  GG+   PG
Sbjct: 252 KVGQERFEAPECLFQPGLVDVEQPGMGELLFDTVQSADVDVRSALYKAIVLSGGSSMYPG 311

Query: 348 FTDRLVSELQR 358
              RL  EL++
Sbjct: 312 LPSRLEKELKQ 322

>CAGL0K01595g Chr11 (141618..141639,141971..143124) [1176 bp, 391
           aa] {ON} highly similar to uniprot|P32381 Saccharomyces
           cerevisiae YDL029w ACT2
          Length = 391

 Score = 79.0 bits (193), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 87/377 (23%), Positives = 149/377 (39%), Gaps = 74/377 (19%)

Query: 1   MTADQAIVIDNGSYQVKFGLASEVRP-----------------RVALNALAKDKYGVTHL 43
           M     IV+D G+  VK G A E  P                 R  +N   KD      +
Sbjct: 1   MDPHNPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERATINKPLKD----IMI 56

Query: 44  SNQVQNIKDISSVVFRRPHELGQLTSWELESCIWDYCLYNPDEFGIDWQSLENRHVVLSE 103
            ++  +++    + +  P E G + +W     +WDY  +N     +   +     ++L+E
Sbjct: 57  GDEASDVRSYLQISY--PMENGIIKNWTDMELLWDYAFFNQ----MQLPTTSGGKILLTE 110

Query: 104 TCMTLPELSKNTDQVLFEEYEVDSLYKAPTAAYIPFYTTNENIKTISGKSDHGELDIEEK 163
             M   +  +   +V+FE+Y+   +Y A   A +  Y                     + 
Sbjct: 111 PPMNPVKNREQMCEVMFEKYDFGGVYVA-IQAVLALYA--------------------QG 149

Query: 164 IEAGKEYNDFSLVIDSGFNCTWVIPIVKGVPYYKAVKKLDVGGRFLNGLLKETISFRHY- 222
           + +G       +V+DSG   T ++P+ + V      ++LDV GR +   L + +S R Y 
Sbjct: 150 LSSG-------VVVDSGDGVTHIVPVYESVVLNHLTRRLDVAGRDVTRHLIDLLSRRGYA 202

Query: 223 -NVMDESILVNNIKEQCLYVDPVSYFEAFKAKGKNKIDFVLPDFQTSFQGYVRDPKTALP 281
            N   +   V  IKE+  YV   SY      K   +   ++ +++             LP
Sbjct: 203 FNRSADFETVRQIKEKLCYV---SYDLDLDTKLARETTTLVENYE-------------LP 246

Query: 282 DNAQILTLTDERFSVPEAFFHPEISQSLKPGIIETVLESIYMLPELLRPLMASNIVCMGG 341
           D  +I+ +  ERF  PE  F P +    + GI E +  +I      +R  +   IV  GG
Sbjct: 247 D-GRIIKVGQERFEAPECLFQPNLVDVEQAGIGELLFNTIQSADVDVRSSLYKAIVLSGG 305

Query: 342 NFNLPGFTDRLVSELQR 358
           +   PG   RL  EL++
Sbjct: 306 SSMYPGLPSRLEKELKQ 322

>Skud_4.222 Chr4 (394174..394195,394321..395474) [1176 bp, 391 aa]
           {ON} YDL029W (REAL)
          Length = 391

 Score = 78.6 bits (192), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 84/373 (22%), Positives = 150/373 (40%), Gaps = 66/373 (17%)

Query: 1   MTADQAIVIDNGSYQVKFGLASEVRPRVALNAL-------AKDKYGVT------HLSNQV 47
           M     IV+D G+  VK G A E  P     ++       A+++  V        + ++ 
Sbjct: 1   MDPHNPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASVATPLKDIMIGDEA 60

Query: 48  QNIKDISSVVFRRPHELGQLTSWELESCIWDYCLYNPDEFGIDWQSLENRHVVLSETCMT 107
            +++    + +  P E G + +W     +WDY  +      +   S  N  ++L+E  M 
Sbjct: 61  SDVRSYLQISY--PMENGIIKNWTDMELLWDYAFFE----QMKLPSTSNGKILLTEPPMN 114

Query: 108 LPELSKNTDQVLFEEYEVDSLYKAPTAAYIPFYTTNENIKTISGKSDHGELDIEEKIEAG 167
             +  +   +V+FE+Y+   +Y A   A +  Y                     + + +G
Sbjct: 115 PLKNREKMCEVMFEKYDFGGVYVA-IQAVLALYA--------------------QGLSSG 153

Query: 168 KEYNDFSLVIDSGFNCTWVIPIVKGVPYYKAVKKLDVGGRFLNGLLKETISFRHY--NVM 225
                  +V+DSG   T ++P+ + V      ++LDV GR +   L + +S R Y  N  
Sbjct: 154 -------VVVDSGDGVTHIVPVYESVVLSHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRT 206

Query: 226 DESILVNNIKEQCLYVDPVSYFEAFKAKGKNKIDFVLPDFQTSFQGYVRDPKTALPDNAQ 285
            +   V  IKE+  YV   SY      K   +   ++  ++             LPD  +
Sbjct: 207 ADFETVRQIKEKLCYV---SYDLDLDTKLARETTVLVESYE-------------LPD-GR 249

Query: 286 ILTLTDERFSVPEAFFHPEISQSLKPGIIETVLESIYMLPELLRPLMASNIVCMGGNFNL 345
            + +  ERF  PE  F P +    +PG+ E +  ++      +R  +   IV  GG+   
Sbjct: 250 TIKVGQERFEAPECLFQPGLVDVEQPGVGELLFNTVQSADVDIRSSLYRAIVLSGGSSMY 309

Query: 346 PGFTDRLVSELQR 358
           PG   RL  EL++
Sbjct: 310 PGLPSRLEKELKQ 322

>TDEL0D04610 Chr4 complement(846092..847245,847317..847338) [1176
           bp, 391 aa] {ON} Anc_3.161 YDL029W
          Length = 391

 Score = 78.6 bits (192), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 86/371 (23%), Positives = 148/371 (39%), Gaps = 62/371 (16%)

Query: 1   MTADQAIVIDNGSYQVKFGLASEVRPRVALNAL-AKDKYGVTHLSNQVQNIKDI------ 53
           M     IV+D G+  VK G A E  P     ++  +        +N    +KDI      
Sbjct: 1   MDPHNPIVLDQGTGFVKIGRAGENFPDHTFPSIVGRPILRAEERANVSTPLKDIMIGDEA 60

Query: 54  ----SSVVFRRPHELGQLTSWELESCIWDYCLYNPDEFGIDWQSLENRHVVLSETCMTLP 109
               S +    P E G + +W     +WDY  ++     +   +  N  ++L+E  M   
Sbjct: 61  SDVRSYLQISYPMENGIIKNWTDMELLWDYAFFDQ----MKLPTTSNGKILLTEPPMNPV 116

Query: 110 ELSKNTDQVLFEEYEVDSLYKAPTAAYIPFYTTNENIKTISGKSDHGELDIEEKIEAGKE 169
           +  +   +V+FE+Y+   +Y A   A +  Y                     + + +G  
Sbjct: 117 KNREQMCEVMFEKYDFGGVYVA-IQAVLALYA--------------------QGLSSG-- 153

Query: 170 YNDFSLVIDSGFNCTWVIPIVKGVPYYKAVKKLDVGGRFLNGLLKETISFRHY--NVMDE 227
                +V+DSG   T ++P+ + V      ++LDV GR +   L + +S R Y  N   +
Sbjct: 154 -----VVVDSGDGVTHIVPVYESVVLNHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRSAD 208

Query: 228 SILVNNIKEQCLYVDPVSYFEAFKAKGKNKIDFVLPDFQTSFQGYVRDPKTALPDNAQIL 287
              V  IKE+  YV   SY      K   +   ++ +++             LPD  +++
Sbjct: 209 FETVRQIKEKVCYV---SYDLDLDTKLARETTTLVENYE-------------LPD-GRVI 251

Query: 288 TLTDERFSVPEAFFHPEISQSLKPGIIETVLESIYMLPELLRPLMASNIVCMGGNFNLPG 347
            +  ERF  PE  F P +    + G+ E +  +I      +R  +   IV  GG+   PG
Sbjct: 252 KVGQERFEAPECLFQPSLVDVEQAGVGELLFNTIQTADVDIRSALYRAIVLSGGSSMYPG 311

Query: 348 FTDRLVSELQR 358
              RL  EL++
Sbjct: 312 LPSRLEKELKQ 322

>Kwal_33.14177 s33 complement(557522..558535) [1014 bp, 337 aa] {ON}
           YDL029W (ARP2) - actin-related protein [contig 105] FULL
          Length = 337

 Score = 78.2 bits (191), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 73/300 (24%), Positives = 124/300 (41%), Gaps = 51/300 (17%)

Query: 61  PHELGQLTSWELESCIWDYCLYNPDEFGIDWQSLENRHVVLSETCMTLPELSKNTDQVLF 120
           P E G + +W     +WDY  Y+     +   S     V+L+E  M   +  +   +V+F
Sbjct: 18  PMENGVIKNWSDMELLWDYAFYDQ----MQLPSTSGGKVMLTEPPMNPVKNREQMCEVMF 73

Query: 121 EEYEVDSLYKAPTAAYIPFYTTNENIKTISGKSDHGELDIEEKIEAGKEYNDFSLVIDSG 180
           E+Y+   +Y A   A +  Y                     + + +G       +V+DSG
Sbjct: 74  EKYDFGGVYVA-IQAVLALYA--------------------QGLSSG-------VVVDSG 105

Query: 181 FNCTWVIPIVKGVPYYKAVKKLDVGGRFLNGLLKETISFRHY--NVMDESILVNNIKEQC 238
              T ++P+ + V      ++LDV GR +   L + +S R Y  N   +   V  IKE+ 
Sbjct: 106 DGVTHIVPVYESVVLNHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRSADFETVRQIKEKL 165

Query: 239 LYVDPVSYFEAFKAKGKNKIDFVLPDFQTSFQGYVRDPKTALPDNAQILTLTDERFSVPE 298
            YV   SY      K   +   ++ +++             LPD  +++ +  ERF  PE
Sbjct: 166 SYV---SYDLDLDTKLARETTTLVENYE-------------LPD-GRVIKVGSERFEAPE 208

Query: 299 AFFHPEISQSLKPGIIETVLESIYMLPELLRPLMASNIVCMGGNFNLPGFTDRLVSELQR 358
             F P +    +PG+ E +  +I      +R  +   IV  GG+   PG   RL  EL++
Sbjct: 209 CLFQPSLVDVEQPGVGEMLFNTIQSADVDVRSALYRAIVLSGGSSMYPGLPSRLEKELKQ 268

>ADR316W Chr4 (1261691..1262866) [1176 bp, 391 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDL029W (ARP2)
          Length = 391

 Score = 78.2 bits (191), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 87/371 (23%), Positives = 143/371 (38%), Gaps = 62/371 (16%)

Query: 1   MTADQAIVIDNGSYQVKFGLASEVRPRVALNAL-AKDKYGVTHLSNQVQNIKDI------ 53
           M   + IV+D G+  VK G A E  P     ++  +        +N    +KDI      
Sbjct: 1   MDPQKPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRADERANVSTPLKDIMIGDEA 60

Query: 54  ----SSVVFRRPHELGQLTSWELESCIWDYCLYNPDEFGIDWQSLENRHVVLSETCMTLP 109
               S +    P E G +  W     +WDY  Y      +   S     V+L+E  M   
Sbjct: 61  SQVRSYLQISYPMENGIIRDWADMELLWDYAFYEQ----MKLPSTSGGKVLLTEPPMNPL 116

Query: 110 ELSKNTDQVLFEEYEVDSLYKAPTAAYIPFYTTNENIKTISGKSDHGELDIEEKIEAGKE 169
              +   +V+FE+Y+   +Y     A +  Y                     + + +G  
Sbjct: 117 RNREQMCEVMFEKYDFGGVYVG-IQAVLALYA--------------------QGLSSG-- 153

Query: 170 YNDFSLVIDSGFNCTWVIPIVKGVPYYKAVKKLDVGGRFLNGLLKETISFRHY--NVMDE 227
                +V+DSG   T ++P+ + V      ++LDV GR +   L + +S R Y  N   +
Sbjct: 154 -----VVVDSGDGVTHIVPVYESVVLNHLTRRLDVAGRDMTRYLIDLLSRRGYAFNKTAD 208

Query: 228 SILVNNIKEQCLYVDPVSYFEAFKAKGKNKIDFVLPDFQTSFQGYVRDPKTALPDNAQIL 287
              V  IKE+  YV   SY      +   +   ++  ++             LPD  +++
Sbjct: 209 FETVRQIKEKLCYV---SYDLDLDTRLAQETTTLVEQYE-------------LPD-GRVI 251

Query: 288 TLTDERFSVPEAFFHPEISQSLKPGIIETVLESIYMLPELLRPLMASNIVCMGGNFNLPG 347
            +  ERF  PE  F P +    +PGI E +  +I      +   +   IV  GG+   PG
Sbjct: 252 KVGSERFEAPECLFQPSLVDVEQPGIGEMLFNTIQSADVDIVSTLYKAIVLSGGSSMYPG 311

Query: 348 FTDRLVSELQR 358
              RL  EL++
Sbjct: 312 LPSRLEKELKQ 322

>KNAG0K01130 Chr11 (220520..220541,220822..221981) [1182 bp, 393 aa]
           {ON} 
          Length = 393

 Score = 78.2 bits (191), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 89/373 (23%), Positives = 146/373 (39%), Gaps = 64/373 (17%)

Query: 1   MTADQAIVIDNGSYQVKFGLASEVRPRVALNALAKD---KYGVTHLSNQVQNIKDI---- 53
           M     IV+D G+  VK G A E  P     ++      +       +    IKDI    
Sbjct: 1   MDPHSPIVLDQGTGFVKIGRAGENFPDFTFPSIVGRPILRAEERSFMDSKTPIKDIMVGE 60

Query: 54  ------SSVVFRRPHELGQLTSWELESCIWDYCLYNPDEFGIDWQSLENRHVVLSETCMT 107
                 S +    P E G +  W     +WD+  +      +   S     ++L+E  M 
Sbjct: 61  EASDVRSYLQISYPMENGIIKHWTDMELLWDHAFFEK----MKLPSTSGGKILLTEPPMN 116

Query: 108 LPELSKNTDQVLFEEYEVDSLYKAPTAAYIPFYTTNENIKTISGKSDHGELDIEEKIEAG 167
             +  +   QV+FE+Y+   +Y A   A +  Y                     + + +G
Sbjct: 117 PLKNREMMCQVMFEKYDFGGVYVA-IQAVLALYA--------------------QGLSSG 155

Query: 168 KEYNDFSLVIDSGFNCTWVIPIVKGVPYYKAVKKLDVGGRFLNGLLKETISFRHY--NVM 225
                  +V+DSG   T ++P+ + V      ++LDV GR +   L + +S R Y  N  
Sbjct: 156 -------VVVDSGDGVTHIVPVYESVVLNHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRS 208

Query: 226 DESILVNNIKEQCLYVDPVSYFEAFKAKGKNKIDFVLPDFQTSFQGYVRDPKTALPDNAQ 285
            +   V  IKE+  YV   SY   F  K   +   ++ +++             LPD  +
Sbjct: 209 ADFETVRQIKEKLSYV---SYDLDFDTKLARETTTLVENYE-------------LPD-GR 251

Query: 286 ILTLTDERFSVPEAFFHPEISQSLKPGIIETVLESIYMLPELLRPLMASNIVCMGGNFNL 345
           I+ +  ERF  PE  F P +    +PG+ E +  +I      +R  +   IV  GG+   
Sbjct: 252 IIKVGQERFEAPECLFQPNLVDVEQPGVGELLFNTIQSADVDIRSSLYKAIVLSGGSSMY 311

Query: 346 PGFTDRLVSELQR 358
           PG   RL  EL++
Sbjct: 312 PGLPSRLEKELKQ 324

>TDEL0C04140 Chr3 (732580..734829) [2250 bp, 749 aa] {ON} Anc_2.248
           YNL059C
          Length = 749

 Score = 79.0 bits (193), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 50/160 (31%), Positives = 79/160 (49%), Gaps = 12/160 (7%)

Query: 272 YVRDPKTALPDNAQ---ILTLTDERFSVPEAFFHPEISQSLKPGIIE----TVLESIYML 324
           ++R P+    +N+     + L  ER  VPE FF P +    + G+ E     +L      
Sbjct: 589 FLRGPRPHDSENSHEQHQMHLNVERIRVPEVFFQPTMCGEDQAGVSELCERVLLSKFGAS 648

Query: 325 PELLRPL---MASNIVCMGGNFNLPGFTDRLVSELQRQLPTDWVCRAKISSGDKSLTGWT 381
           P  +  +   MA N+   GGN  +PG  +R+V E    LP +      ISS D SL  W 
Sbjct: 649 PRQMSSITSEMAKNVWVTGGNAKIPGLRERIVKEFTGFLPVNTSFNVNISS-DPSLDAWR 707

Query: 382 AMAKFAHTDA-YKKARVTKEDYFEHGLDWTTKERFGYQNW 420
            MAK+A  +  YKK+ ++K++Y E+G D+  + + G  N+
Sbjct: 708 GMAKYAQNETDYKKSFISKKEYEEYGPDYIKEHKLGNMNY 747

>YDL029W Chr4 (399340..399361,399485..400638) [1176 bp, 391 aa] {ON}
            ARP2Essential component of the Arp2/3 complex, which is
           a highly conserved actin nucleation center required for
           the motility and integrity of actin patches; involved in
           endocytosis and membrane growth and polarity
          Length = 391

 Score = 77.8 bits (190), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 84/373 (22%), Positives = 149/373 (39%), Gaps = 66/373 (17%)

Query: 1   MTADQAIVIDNGSYQVKFGLASEVRPRVALNAL-------AKDKYGVT------HLSNQV 47
           M     IV+D G+  VK G A E  P     ++       A+++  V        + ++ 
Sbjct: 1   MDPHNPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASVATPLKDIMIGDEA 60

Query: 48  QNIKDISSVVFRRPHELGQLTSWELESCIWDYCLYNPDEFGIDWQSLENRHVVLSETCMT 107
             ++    + +  P E G + +W     +WDY  +      +   S  N  ++L+E  M 
Sbjct: 61  SEVRSYLQISY--PMENGIIKNWTDMELLWDYAFFE----QMKLPSTSNGKILLTEPPMN 114

Query: 108 LPELSKNTDQVLFEEYEVDSLYKAPTAAYIPFYTTNENIKTISGKSDHGELDIEEKIEAG 167
             +  +   +V+FE+Y+   +Y A   A +  Y                     + + +G
Sbjct: 115 PLKNREKMCEVMFEKYDFGGVYVA-IQAVLALYA--------------------QGLSSG 153

Query: 168 KEYNDFSLVIDSGFNCTWVIPIVKGVPYYKAVKKLDVGGRFLNGLLKETISFRHY--NVM 225
                  +V+DSG   T ++P+ + V      ++LDV GR +   L + +S R Y  N  
Sbjct: 154 -------VVVDSGDGVTHIVPVYESVVLSHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRT 206

Query: 226 DESILVNNIKEQCLYVDPVSYFEAFKAKGKNKIDFVLPDFQTSFQGYVRDPKTALPDNAQ 285
            +   V  IKE+  YV   SY      K   +   ++  ++             LPD  +
Sbjct: 207 ADFETVRQIKEKLCYV---SYDLDLDTKLARETTALVESYE-------------LPD-GR 249

Query: 286 ILTLTDERFSVPEAFFHPEISQSLKPGIIETVLESIYMLPELLRPLMASNIVCMGGNFNL 345
            + +  ERF  PE  F P +    +PG+ E +  ++      +R  +   IV  GG+   
Sbjct: 250 TIKVGQERFEAPECLFQPGLVDVEQPGVGELLFNTVQSADVDIRSSLYKAIVLSGGSSMY 309

Query: 346 PGFTDRLVSELQR 358
           PG   RL  EL++
Sbjct: 310 PGLPSRLEKELKQ 322

>KLLA0C03850g Chr3 complement(351772..352947) [1176 bp, 391 aa] {ON}
           highly similar to uniprot|P32381 Saccharomyces
           cerevisiae YDL029W ARP2 Essential component of the
           Arp2/3 complex which is a highly conserved actin
           nucleation center required for the motility and
           integrity of actin patches involved in endocytosis and
           membrane growth and polarity
          Length = 391

 Score = 77.0 bits (188), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 91/373 (24%), Positives = 149/373 (39%), Gaps = 66/373 (17%)

Query: 1   MTADQAIVIDNGSYQVKFGLASEVRPR------VALNALAKDKYGVTHLSNQVQNI--KD 52
           M     IV+D G+  VK G A E  P       V    L  ++ G  H S  +++I   D
Sbjct: 1   MDPHTPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERG--HASTPLKDIMIGD 58

Query: 53  ISSVV-----FRRPHELGQLTSWELESCIWDYCLYNPDEFGIDWQSLENRHVVLSETCMT 107
            +S V        P E G + +W     +WDY  +      +   +     V+L+E  M 
Sbjct: 59  EASEVRSYLQISYPMENGIIRNWADMELLWDYAFFE----QMKLPTTSGGKVLLTEPPMN 114

Query: 108 LPELSKNTDQVLFEEYEVDSLYKAPTAAYIPFYTTNENIKTISGKSDHGELDIEEKIEAG 167
             +  +   +V+FE+Y+    Y A   A +  Y                     + + +G
Sbjct: 115 PIKNREQMCEVMFEKYDFGGTYVA-IQAVLALYA--------------------QGLSSG 153

Query: 168 KEYNDFSLVIDSGFNCTWVIPIVKGVPYYKAVKKLDVGGRFLNGLLKETISFRHY--NVM 225
                  +V+DSG   T ++P+ + V      ++LDV GR +   L + +S R Y  N  
Sbjct: 154 -------VVVDSGDGVTHIVPVYESVVLNHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRT 206

Query: 226 DESILVNNIKEQCLYVDPVSYFEAFKAKGKNKIDFVLPDFQTSFQGYVRDPKTALPDNAQ 285
            +   V  IKE+  YV   SY      K   +   ++  ++             LPD  +
Sbjct: 207 ADFETVRQIKEKLCYV---SYDLDLDTKLARETTTLVESYE-------------LPD-GR 249

Query: 286 ILTLTDERFSVPEAFFHPEISQSLKPGIIETVLESIYMLPELLRPLMASNIVCMGGNFNL 345
           ++ +  ERF  PE  F P +    +PG+ E +  +I      +R  +   IV  GG+   
Sbjct: 250 VIKVGPERFEAPECLFQPSLVDVEQPGVGELLFNTIQAADVDIRTSLYKAIVLSGGSSMY 309

Query: 346 PGFTDRLVSELQR 358
           PG   RL  EL++
Sbjct: 310 PGLPSRLEKELKQ 322

>Ecym_5237 Chr5 complement(489181..490356) [1176 bp, 391 aa] {ON}
           similar to Ashbya gossypii ADR316W
          Length = 391

 Score = 77.0 bits (188), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 90/365 (24%), Positives = 146/365 (40%), Gaps = 62/365 (16%)

Query: 7   IVIDNGSYQVKFGLASEVRPRVALNAL-AKDKYGVTHLSNQVQNIKDI----------SS 55
           IV+D G+  VK G A E  P     ++  +        SN    +KDI          S 
Sbjct: 7   IVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAGERSNISTPLKDIMIGDEASNVRSY 66

Query: 56  VVFRRPHELGQLTSWELESCIWDYCLYNPDEFGIDWQSLENRHVVLSETCMTLPELSKNT 115
           +    P E G + +W     +WDY  Y  D+  I   S     V+L+E  M   +  +  
Sbjct: 67  LQISYPMENGIIKNWADMEQLWDYAFY--DQMKI--PSTAGHKVLLTEPPMNPLKNREQM 122

Query: 116 DQVLFEEYEVDSLYKAPTAAYIPFYTTNENIKTISGKSDHGELDIEEKIEAGKEYNDFSL 175
            +V+FE+Y+   +Y A   A +  Y                     + + +G       +
Sbjct: 123 CEVMFEKYDFGGVYVA-IQAVLALYA--------------------QGLSSG-------V 154

Query: 176 VIDSGFNCTWVIPIVKGVPYYKAVKKLDVGGRFLNGLLKETISFRHY--NVMDESILVNN 233
           V+DSG   T ++P+ + V      ++LDV GR +   L + +S R Y  N   +   V  
Sbjct: 155 VVDSGDGVTHIVPVYESVVLNHLTRRLDVAGRDVTRYLIDLLSRRGYAFNKTADFETVRQ 214

Query: 234 IKEQCLYVDPVSYFEAFKAKGKNKIDFVLPDFQTSFQGYVRDPKTALPDNAQILTLTDER 293
           IKE+  Y   VSY      K  ++   ++  ++             LPD  +++ +  ER
Sbjct: 215 IKEKLCY---VSYDLDLDTKLAHETTTLVETYE-------------LPD-GRVIKVGSER 257

Query: 294 FSVPEAFFHPEISQSLKPGIIETVLESIYMLPELLRPLMASNIVCMGGNFNLPGFTDRLV 353
           F  PE  F P +    + GI E +  +I      +   +   IV  GG+   PG   RL 
Sbjct: 258 FEAPECLFQPSLVDVEQQGIGEMLFSTIQSADVDIISALYRAIVLSGGSSMYPGLPSRLE 317

Query: 354 SELQR 358
            EL++
Sbjct: 318 KELKQ 322

>Kpol_479.25 s479 complement(49227..50402) [1176 bp, 391 aa] {ON}
           complement(49227..50402) [1176 nt, 392 aa]
          Length = 391

 Score = 75.9 bits (185), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 87/373 (23%), Positives = 149/373 (39%), Gaps = 66/373 (17%)

Query: 1   MTADQAIVIDNGSYQVKFGLASEVRPRVALNAL-------AKDKYGVT------HLSNQV 47
           M     IV+D G+  VK G A E  P     ++       A+++  ++       + ++ 
Sbjct: 1   MDPHSPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASISTPLKDIMIGDEA 60

Query: 48  QNIKDISSVVFRRPHELGQLTSWELESCIWDYCLYNPDEFGIDWQSLENRHVVLSETCMT 107
             ++    + +  P E G + +W     +WDY  Y      +   S     V+L+E  M 
Sbjct: 61  SEVRSYLQISY--PMENGIIKNWTDMELLWDYAFYEQ----MKLPSTSGGKVLLTEPPMN 114

Query: 108 LPELSKNTDQVLFEEYEVDSLYKAPTAAYIPFYTTNENIKTISGKSDHGELDIEEKIEAG 167
             +  +   +V+FE+Y+   +Y A   A +  Y                     + + +G
Sbjct: 115 PLKNREQMCEVMFEKYDFGGVYVA-IQAVLALYA--------------------QGLSSG 153

Query: 168 KEYNDFSLVIDSGFNCTWVIPIVKGVPYYKAVKKLDVGGRFLNGLLKETISFRHY--NVM 225
                  +V+DSG   T ++P+ + V      ++LDV GR +   L + +S R Y  N  
Sbjct: 154 -------VVVDSGDGVTHIVPVYESVVLNHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRT 206

Query: 226 DESILVNNIKEQCLYVDPVSYFEAFKAKGKNKIDFVLPDFQTSFQGYVRDPKTALPDNAQ 285
            +   V  IKE+  YV   SY           +D    D + + +      K  LPD  +
Sbjct: 207 ADFETVRQIKEKLCYV---SY----------DLDL---DTRLARETTTLVEKYELPD-GR 249

Query: 286 ILTLTDERFSVPEAFFHPEISQSLKPGIIETVLESIYMLPELLRPLMASNIVCMGGNFNL 345
           I+ +  ERF  PE  F P +      G+ E +  +I      +R  +   IV  GG+   
Sbjct: 250 IIKVGQERFEAPECLFQPNLVDVESAGVGELLFNTIQSADVDVRSSLYKAIVLSGGSSMY 309

Query: 346 PGFTDRLVSELQR 358
           PG   RL  EL++
Sbjct: 310 PGLPSRLEKELKQ 322

>SAKL0E08602g Chr5 (702206..704449) [2244 bp, 747 aa] {ON} similar
           to uniprot|P53946 Saccharomyces cerevisiae YNL059C ARP5
           Nuclear actin-related protein involved in chromatin
           remodeling component of chromatin-remodeling enzyme
           complexes
          Length = 747

 Score = 76.6 bits (187), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 53/157 (33%), Positives = 79/157 (50%), Gaps = 14/157 (8%)

Query: 272 YVRDPKTALPDNAQ---ILTLTDERFSVPEAFFHPEISQSLKPGIIETVLESIYM--LPE 326
           ++R P+    ++A     + L  ER  VPE  F P +    + GIIE + E+I M     
Sbjct: 587 FLRGPRPHDSEDAHEQHQMHLNVERIRVPEVIFQPPMGGLDQAGIIE-LSETIIMNKFGS 645

Query: 327 LLRPL------MASNIVCMGGNFNLPGFTDRLVSELQRQLPTDWVCRAKISSGDKSLTGW 380
             R L      MA+N+   GGN  +PG  DR+V E    LP       K++S D ++  W
Sbjct: 646 SRRQLSSVSQEMANNVFLTGGNVRVPGLRDRIVREFTEFLPVGTKYNIKVAS-DPAIDAW 704

Query: 381 TAMAKFAHTDA-YKKARVTKEDYFEHGLDWTTKERFG 416
             MAKFA +   YK + VTK++Y E+G D+  + + G
Sbjct: 705 KGMAKFAQSSTDYKGSYVTKKEYEEYGPDYIKEHKLG 741

>NCAS0A12270 Chr1 complement(2428834..2430198) [1365 bp, 454 aa]
           {ON} Anc_1.514
          Length = 454

 Score = 72.8 bits (177), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 92/373 (24%), Positives = 154/373 (41%), Gaps = 78/373 (20%)

Query: 61  PHELGQLTSWELESCIWDYCLYNPDEFGIDWQSLENRHVVLSETCMTLPELSKNTDQVLF 120
           P   GQ+ +W+     W+  +     F       E+   +L+E  +  PE  +   ++ F
Sbjct: 120 PIRHGQVENWDHMERFWENSI-----FKYLRTEPEDHFFLLTEPPLNPPENREQIAEIFF 174

Query: 121 EEYEVDSLY---KAPTAAYIPFYTTNENIKTISGKSDHGELDIEEKIEAGKEYNDFSLVI 177
           E +    LY   +A  A    + ++    ++++G                        VI
Sbjct: 175 ESFNCAGLYIAVQAVLALAASWTSSKVTDRSLTGT-----------------------VI 211

Query: 178 DSGFNCTWVIPIVKGVPYYKAVKKLDVGGR----FLNGLLKETISFRHYNVMDESI-LVN 232
           DSG   T VIP+ +G     A+K + + GR    F+  LL+E          D S+    
Sbjct: 212 DSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDITLFIQSLLRER------GEADTSLRTAE 265

Query: 233 NIKEQCLYVDP--VSYFEAFKAKGKNKIDFVLPDFQTSFQGYVRDPKTALPDNAQILTLT 290
            IK++  YV P  V  F  F   G+    FV+ + +++                +I+ + 
Sbjct: 266 RIKQEYCYVCPDIVKEFNKFDRDGEKFAQFVVENQEST--------------RKKIVDVG 311

Query: 291 DERFSVPEAFFHPEISQS--LKPGIIETVLESIYMLPELLRPLMASNIVCMGGNFNLPGF 348
            ERF  PE FF+PEI+ S  L P +   V ++I   P  +R  + +NIV  GG+     F
Sbjct: 312 YERFLAPEIFFNPEIASSDFLTP-LPTVVDQTIQACPIDVRKGLYNNIVLSGGSTMFKDF 370

Query: 349 TDRLVSELQRQLPTDWVCRAKISSGDKSLTG---------------WTAMAKFAHTDAYK 393
             RL  +L + +  + + ++++ SG KS TG               W   +  A T  +K
Sbjct: 371 GRRLQRDL-KGIVNNRIAQSEMLSGTKS-TGVNVQVISHRKQRNAVWFGGSLLAQTAEFK 428

Query: 394 KARVTKEDYFEHG 406
               TK+DY E+G
Sbjct: 429 GYCHTKKDYDEYG 441

>Ecym_3153 Chr3 (288213..289589) [1377 bp, 458 aa] {ON} similar to
           Ashbya gossypii AFR419C
          Length = 458

 Score = 72.4 bits (176), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 97/378 (25%), Positives = 153/378 (40%), Gaps = 88/378 (23%)

Query: 61  PHELGQLTSWE-----LESCIWDYCLYNPDEFGIDWQSLENRHVVLSETCMTLPELSKNT 115
           P + GQ+ +W       E+ I+ Y    P          E+   +L+E  +  PE  +  
Sbjct: 124 PIKHGQVENWNHMERFWENSIFKYLRTEP----------EDHFFLLTEPPLNPPENREQV 173

Query: 116 DQVLFEEYEVDSLY---KAPTAAYIPFYTTNENIKTISGKSDHGELDIEEKIEAGKEYND 172
            ++ FE +    LY   +A  A    + ++    ++++G                     
Sbjct: 174 AEIFFESFNCAGLYIAVQAVLALAASWTSSKVTDRSLTGT-------------------- 213

Query: 173 FSLVIDSGFNCTWVIPIVKGVPYYKAVKKLDVGGR----FLNGLLKETISFRHYNVMDES 228
              VIDSG   T VIP+ +G     A+K + + GR    F+  LL+E         +D S
Sbjct: 214 ---VIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDITLFIQSLLRER------GEVDTS 264

Query: 229 I-LVNNIKEQCLYVDP--VSYFEAFKAKGKNKIDFVLPDFQTSFQGYVRDPKTALPDNAQ 285
           +     IK++  YV P  V  F  F         F++ +     QG  +          +
Sbjct: 265 LKTAERIKQEYCYVCPDIVKEFNKFDRDVGKFSQFIIEN-----QGKTQK---------K 310

Query: 286 ILTLTDERFSVPEAFFHPEISQS--LKPGIIETVLESIYMLPELLRPLMASNIVCMGGNF 343
           I+ +  ERF  PE FF+PEI+ S  L P +   V  +I   P  +R  + SNIV  GG+ 
Sbjct: 311 IVDVGYERFLAPEIFFNPEIASSDFLTP-LPTIVDHTIQACPIDVRKGLYSNIVLSGGST 369

Query: 344 NLPGFTDRLVSELQRQLPTDWVCRAKISSGDKSLTG---------------WTAMAKFAH 388
               F  RL  +L R +  D + ++++ SG KS TG               W   +  A 
Sbjct: 370 MFKDFGRRLQRDL-RSIVNDRIAQSELLSGTKS-TGVDVQVISHRRQRNAVWFGGSLLAQ 427

Query: 389 TDAYKKARVTKEDYFEHG 406
           T  +K    TK DY E+G
Sbjct: 428 TAEFKSYCHTKRDYEEYG 445

>KAFR0C01040 Chr3 complement(212570..213583) [1014 bp, 337 aa] {ON} 
          Length = 337

 Score = 71.6 bits (174), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 71/300 (23%), Positives = 120/300 (40%), Gaps = 51/300 (17%)

Query: 61  PHELGQLTSWELESCIWDYCLYNPDEFGIDWQSLENRHVVLSETCMTLPELSKNTDQVLF 120
           P E G + +W     +WDY  Y      +      N  ++L+E  M   +  +   +V+F
Sbjct: 18  PMENGIIKNWTDMELLWDYAFYEQ----MKLPDTSNGKILLTEPPMNPIKNREKMCEVMF 73

Query: 121 EEYEVDSLYKAPTAAYIPFYTTNENIKTISGKSDHGELDIEEKIEAGKEYNDFSLVIDSG 180
           E+Y    +Y A   A +  Y                     + + +G       +V+DSG
Sbjct: 74  EKYNFGGVYVA-IQAVLALYA--------------------QGLSSG-------VVVDSG 105

Query: 181 FNCTWVIPIVKGVPYYKAVKKLDVGGRFLNGLLKETISFRHY--NVMDESILVNNIKEQC 238
              T ++P+ + V      ++LDV GR +   L + +S R Y  N   +   V  IKE+ 
Sbjct: 106 DGVTHIVPVYESVVLNHLTRRLDVAGRDVTRNLIDLLSRRGYAFNRTADFETVRQIKEKL 165

Query: 239 LYVDPVSYFEAFKAKGKNKIDFVLPDFQTSFQGYVRDPKTALPDNAQILTLTDERFSVPE 298
            YV   SY      K   +   ++  ++             LPD  +++ +  ERF  PE
Sbjct: 166 CYV---SYDLDLDTKLARETTTLVESYE-------------LPD-GRVIKVGSERFEAPE 208

Query: 299 AFFHPEISQSLKPGIIETVLESIYMLPELLRPLMASNIVCMGGNFNLPGFTDRLVSELQR 358
             F P +    + G+ E +  +I      +R  +   IV  GG+   PG   RL  EL++
Sbjct: 209 CLFQPNLVDVEQAGVGELLFNTIQSADVDIRSTLFKAIVLSGGSSMYPGLPSRLEKELKQ 268

>SAKL0D12804g Chr4 complement(1066058..1067428) [1371 bp, 456 aa]
           {ON} highly similar to uniprot|P47117 Saccharomyces
           cerevisiae YJR065C ARP3 Essential component of the
           Arp2/3 complex which is a highly conserved actin
           nucleation center required for the motility and
           integrity of actin patches involved in endocytosis and
           membrane growth and polarity
          Length = 456

 Score = 72.0 bits (175), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 90/373 (24%), Positives = 153/373 (41%), Gaps = 78/373 (20%)

Query: 61  PHELGQLTSWELESCIWDYCLYNPDEFGIDWQSLENRHVVLSETCMTLPELSKNTDQVLF 120
           P   GQ+ +W+     W+  +     F       E+   +L+E  +  PE  +   ++ F
Sbjct: 122 PIRHGQVENWDHMERFWENSI-----FKYLRTEPEDHFFLLTEPPLNPPENREQVAEIFF 176

Query: 121 EEYEVDSLY---KAPTAAYIPFYTTNENIKTISGKSDHGELDIEEKIEAGKEYNDFSLVI 177
           E +    LY   +A  A    + ++    ++++G                        VI
Sbjct: 177 ESFNCAGLYIAVQAVLALAASWTSSKVTDRSLTGT-----------------------VI 213

Query: 178 DSGFNCTWVIPIVKGVPYYKAVKKLDVGGR----FLNGLLKETISFRHYNVMDESI-LVN 232
           DSG   T VIP+ +G     A+K + + GR    F+  LL+E         +D S+    
Sbjct: 214 DSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDITLFIQSLLRER------GEVDTSLRTAE 267

Query: 233 NIKEQCLYVDP--VSYFEAFKAKGKNKIDFVLPDFQTSFQGYVRDPKTALPDNAQILTLT 290
            IK++  YV P  V  F  F         F++ + +++                +I+ + 
Sbjct: 268 RIKQEYCYVCPDIVKEFNKFDRDAGKFAQFIVENSEST--------------KKKIVDVG 313

Query: 291 DERFSVPEAFFHPEISQS--LKPGIIETVLESIYMLPELLRPLMASNIVCMGGNFNLPGF 348
            ERF  PE FF+PEI+ S  L P +   V ++I   P  +R  + +NIV  GG+     F
Sbjct: 314 YERFLAPEIFFNPEIASSDFLTP-LPTVVDQTIQACPIDVRKGLYNNIVLSGGSTMFKDF 372

Query: 349 TDRLVSELQRQLPTDWVCRAKISSGDKSLTG---------------WTAMAKFAHTDAYK 393
             RL  +L + +  + + ++++ SG KS TG               W   +  A T  +K
Sbjct: 373 GRRLQRDL-KSIVNNRIAQSELLSGTKS-TGVDVQVISHRRQRNAVWFGGSLLAQTAEFK 430

Query: 394 KARVTKEDYFEHG 406
               TK+DY E+G
Sbjct: 431 SYCHTKQDYEEYG 443

>TPHA0A00920 Chr1 (181205..182380) [1176 bp, 391 aa] {ON} Anc_2.117
           YHR129C
          Length = 391

 Score = 71.2 bits (173), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 87/371 (23%), Positives = 146/371 (39%), Gaps = 62/371 (16%)

Query: 1   MTADQAIVIDNGSYQVKFGLASEVRPR------VALNALAKDKYGVTHLSNQVQNIKDIS 54
           M     IV+D G+  VK G A E  P       V    L  ++ G  ++  +   I + +
Sbjct: 1   MDPHSPIVLDQGTGFVKIGRAGENFPDHTFPSIVGRPILRAEERGNLNIPLKDVMIGEEA 60

Query: 55  SVV-----FRRPHELGQLTSWELESCIWDYCLYNPDEFGIDWQSLENRHVVLSETCMTLP 109
           S V        P E G + +W     +WDY  Y      +   S     V+L+E  +   
Sbjct: 61  SAVRSYLQISYPMENGIIKNWTDMELLWDYAFYEQ----MKLPSTSGGKVLLTEPPLNPL 116

Query: 110 ELSKNTDQVLFEEYEVDSLYKAPTAAYIPFYTTNENIKTISGKSDHGELDIEEKIEAGKE 169
           +  +   +V+FE+Y+   +Y A   A +  Y                     + + +G  
Sbjct: 117 KNREKMCEVMFEKYDFGGVYVA-IQAVLALYA--------------------QGLSSG-- 153

Query: 170 YNDFSLVIDSGFNCTWVIPIVKGVPYYKAVKKLDVGGRFLNGLLKETISFRHY--NVMDE 227
                +VIDSG   T ++P+ + V      ++LDV GR +   L + +S R Y  N   +
Sbjct: 154 -----VVIDSGDGVTHIVPVYESVVLNHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRTAD 208

Query: 228 SILVNNIKEQCLYVDPVSYFEAFKAKGKNKIDFVLPDFQTSFQGYVRDPKTALPDNAQIL 287
              V  IKE+  YV   SY      K   +   ++ +++             LPD  +++
Sbjct: 209 FETVRQIKEKLCYV---SYDLELDTKLARETTTLVENYE-------------LPD-GRVI 251

Query: 288 TLTDERFSVPEAFFHPEISQSLKPGIIETVLESIYMLPELLRPLMASNIVCMGGNFNLPG 347
            +  ERF   E  F P +      G+ E +  +I      +R  +   IV  GG+   PG
Sbjct: 252 KVGQERFEAAECLFQPNLVDVESAGVGELLFNTIQSADIDVRSSLYKAIVLSGGSSMYPG 311

Query: 348 FTDRLVSELQR 358
              R+  EL++
Sbjct: 312 LPSRIEKELKQ 322

>KLLA0B13904g Chr2 complement(1218228..1219598) [1371 bp, 456 aa]
           {ON} highly similar to uniprot|P47117 Saccharomyces
           cerevisiae YJR065C ARP3 Essential component of the
           Arp2/3 complex which is a highly conserved actin
           nucleation center required for the motility and
           integrity of actin patches involved in endocytosis and
           membrane growth and polarity
          Length = 456

 Score = 71.2 bits (173), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 93/380 (24%), Positives = 155/380 (40%), Gaps = 88/380 (23%)

Query: 61  PHELGQLTSWE-----LESCIWDYCLYNPDEFGIDWQSLENRHVVLSETCMTLPELSKNT 115
           P   GQ+ +W+      E+ I+ Y    P          E+   +L+E  +  PE  +  
Sbjct: 122 PIRHGQVENWDHMERFWENSIFKYLRTEP----------EDHFFLLTEPPLNPPENRQQV 171

Query: 116 DQVLFEEYEVDSLY---KAPTAAYIPFYTTNENIKTISGKSDHGELDIEEKIEAGKEYND 172
            ++ FE +    LY   +A  A    + ++    ++++G                     
Sbjct: 172 AEIFFESFNCAGLYIAVQAVLALAASWTSSKVTDRSLTGT-------------------- 211

Query: 173 FSLVIDSGFNCTWVIPIVKGVPYYKAVKKLDVGGR----FLNGLLKETISFRHYNVMDES 228
              VIDSG   T VIP+ +G     A+K + + GR    F+  LL+E          D S
Sbjct: 212 ---VIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDITLFIQSLLRER------GEQDAS 262

Query: 229 I-LVNNIKEQCLYVDP--VSYFEAFKAKGKNKIDFVLPDFQTSFQGYVRDPKTALPDNAQ 285
           +     IK++  YV P  V  F  F    +    F++ + + + +              +
Sbjct: 263 LRTAERIKQEYCYVCPDIVKEFNKFDRDSEKFAQFIVENKERTTK--------------K 308

Query: 286 ILTLTDERFSVPEAFFHPEISQS--LKPGIIETVLESIYMLPELLRPLMASNIVCMGGNF 343
           ++ +  ERF  PE FF+PEI+ S  L P +   V E+I   P  +R  + +NIV  GG+ 
Sbjct: 309 VVDVGYERFLAPEIFFNPEIASSDFLTP-LPVVVDETIQACPIDVRKGLYNNIVLSGGST 367

Query: 344 NLPGFTDRLVSELQRQLPTDWVCRAKISSGDKSLTG---------------WTAMAKFAH 388
               F  RL  +L + +  D + +++  SG +S TG               W   +  A 
Sbjct: 368 MFKDFGRRLQRDL-KGIVNDRISQSEKLSGTRS-TGVDVSVISHKRQRNAVWFGGSLLAQ 425

Query: 389 TDAYKKARVTKEDYFEHGLD 408
           T  +K    TK+DY E+G D
Sbjct: 426 TGEFKSYCHTKQDYEEYGPD 445

>Ecym_3285 Chr3 complement(539184..541424) [2241 bp, 746 aa] {ON}
           similar to Ashbya gossypii ADL253C
          Length = 746

 Score = 71.2 bits (173), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 48/145 (33%), Positives = 74/145 (51%), Gaps = 13/145 (8%)

Query: 287 LTLTDERFSVPEAFFHPEISQSLKPGIIETVLESIYM---------LPELLRPLMASNIV 337
           + L  ER  VPE  F P I    + GI+E + E++ +         L E+ + +MA NI 
Sbjct: 604 MHLNVERIRVPEVIFQPSIGGLDQAGIVE-LCETLLLKKFGSNRRELSEISK-MMAKNIF 661

Query: 338 CMGGNFNLPGFTDRLVSELQRQLPTDWVCRAKISSGDKSLTGWTAMAKFA-HTDAYKKAR 396
             GGN  LPG  +R+V E    LP       K++  D S++ W  MAKFA +T  Y+ + 
Sbjct: 662 ITGGNAKLPGIRERVVREFTGFLPVGTNLNVKLAE-DPSMSAWRGMAKFANNTSLYETSI 720

Query: 397 VTKEDYFEHGLDWTTKERFGYQNWV 421
           +TK++Y E G ++  +   G   +V
Sbjct: 721 MTKKEYEELGPEYIKEHNLGNAKFV 745

>NDAI0A03970 Chr1 (895219..896607) [1389 bp, 462 aa] {ON} Anc_1.514
          Length = 462

 Score = 70.1 bits (170), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 91/374 (24%), Positives = 155/374 (41%), Gaps = 80/374 (21%)

Query: 61  PHELGQLTSWELESCIWDYCLYNPDEFGIDWQSLENRHVVLSETCMTLPELSKNTDQVLF 120
           P   GQ+ +W+     W+  +     F       E+   +L+E  +  PE  +   ++ F
Sbjct: 128 PIRHGQVENWDHMERFWENSI-----FKYLRTEPEDHFFLLTEPPLNPPENREQIAEIFF 182

Query: 121 EEYEVDSLY---KAPTAAYIPFYTTNENIKTISGKSDHGELDIEEKIEAGKEYNDFSLVI 177
           E +    LY   +A  A    + ++    ++++G                        VI
Sbjct: 183 ESFNCAGLYIAVQAVLALAASWTSSKVTDRSLTGT-----------------------VI 219

Query: 178 DSGFNCTWVIPIVKGVPYYKAVKKLDVGGR----FLNGLLKETISFRHYNVMDESI-LVN 232
           DSG   T VIP+ +G     A+K + + GR    F+  LL+E         +D S+    
Sbjct: 220 DSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDITLFIQSLLRER------GEVDTSLKTAE 273

Query: 233 NIKEQCLYVDP--VSYFEAFKAKGKNKIDFVLPDFQTSFQGYVRDPKTALPDNAQILTLT 290
            IK++  YV P  V  F  F   G     F++ + + +                +++ + 
Sbjct: 274 RIKQEYCYVCPDIVKEFNKFDRDGSKFAQFIVENQEQT--------------RKKVVDVG 319

Query: 291 DERFSVPEAFFHPEISQS--LKPGIIETVLE-SIYMLPELLRPLMASNIVCMGGNFNLPG 347
            ERF  PE FF+PEI+ S  L P  + TV++ +I   P  +R  + +NIV  GG+     
Sbjct: 320 YERFLAPEIFFNPEIASSDFLTP--LPTVVDHTIQACPIDVRKGLYNNIVLSGGSTMFKD 377

Query: 348 FTDRLVSELQRQLPTDWVCRAKISSGDKSLTG---------------WTAMAKFAHTDAY 392
           F  RL  +L + + ++ + +++  SG KS TG               W   +  A T  +
Sbjct: 378 FGRRLQRDL-KSIVSNRIAQSERLSGTKS-TGVDVQVISHRKQRNAVWFGGSLLAQTAEF 435

Query: 393 KKARVTKEDYFEHG 406
           K    TK+DY E+G
Sbjct: 436 KSYCHTKKDYEEYG 449

>KNAG0I01860 Chr9 (364390..366651) [2262 bp, 753 aa] {ON} Anc_2.248
           YNL059C
          Length = 753

 Score = 70.9 bits (172), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 46/139 (33%), Positives = 67/139 (48%), Gaps = 11/139 (7%)

Query: 287 LTLTDERFSVPEAFFHPEISQSLKPGIIETVLESIYMLPELLRP--------LMASNIVC 338
           L L  ER  VPE  F P I+   + GI E + E+I +     +P         M +N+  
Sbjct: 608 LHLNTERIRVPEILFEPSIAGQDQAGIAE-LCETILLKKFGSKPGNLSAASSRMVNNVWI 666

Query: 339 MGGNFNLPGFTDRLVSELQRQLPTDWVCRAKISSGDKSLTGWTAMAKFAHTDA-YKKARV 397
            GGN  +PG  +R+V E    LP        +S  D SL  W  MAK A+ +  YK   V
Sbjct: 667 TGGNARIPGIKNRIVKEFTEFLPAGTPLSVHMSE-DPSLDAWKGMAKLANNETDYKNTAV 725

Query: 398 TKEDYFEHGLDWTTKERFG 416
           T+++Y E+G D+  + + G
Sbjct: 726 TRKEYEEYGPDYIKEHKLG 744

>AFR419C Chr6 complement(1186951..1188318) [1368 bp, 455 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YJR065C
           (ARP3)
          Length = 455

 Score = 70.1 bits (170), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 72/255 (28%), Positives = 113/255 (44%), Gaps = 47/255 (18%)

Query: 176 VIDSGFNCTWVIPIVKGVPYYKAVKKLDVGGR----FLNGLLKETISFRHYNVMDESI-L 230
           VIDSG   T VIP+ +G     A+K + + GR    F+  LL+E         +D S+  
Sbjct: 211 VIDSGDGVTHVIPVAEGYVIGSAIKHIPIAGRDITLFIQSLLRER------GEVDTSLRT 264

Query: 231 VNNIKEQCLYVDP--VSYFEAFKAKGKNKIDFVLPDFQTSFQGYVRDPKTALPDNAQILT 288
              IK++  YV P  V  F  F         F++ + + +                +++ 
Sbjct: 265 AERIKQEYCYVCPDIVKEFNKFDRDATKFAQFIVENKEKT--------------QKKVVD 310

Query: 289 LTDERFSVPEAFFHPEISQS--LKPGIIETVLESIYMLPELLRPLMASNIVCMGGNFNLP 346
           +  ERF  PE FF+PEI+ S  L P +   V ++I   P  +R  + +NIV  GG+    
Sbjct: 311 VGYERFLAPEIFFNPEIASSDFLTP-LPTVVDQTIQACPIDVRKGLYNNIVLSGGSTMFK 369

Query: 347 GFTDRLVSELQRQLPTDWVCRAKISSGDKSLTG---------------WTAMAKFAHTDA 391
            F  RL  +L R +  + + ++++ SG KS TG               W   +  A T  
Sbjct: 370 DFGRRLQRDL-RSIVNNRIAQSELLSGTKS-TGVEVQVISHRRQRNAVWFGGSLLAQTAE 427

Query: 392 YKKARVTKEDYFEHG 406
           +K    TK+DY E+G
Sbjct: 428 FKSYCHTKKDYEEYG 442

>TPHA0O01040 Chr15 (196178..197554) [1377 bp, 458 aa] {ON} Anc_1.514
           YJR065C
          Length = 458

 Score = 70.1 bits (170), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 90/373 (24%), Positives = 153/373 (41%), Gaps = 78/373 (20%)

Query: 61  PHELGQLTSWELESCIWDYCLYNPDEFGIDWQSLENRHVVLSETCMTLPELSKNTDQVLF 120
           P   GQ+ +W+     W+  +     F       E+   +L+E  +  PE  +   ++ F
Sbjct: 124 PIRHGQVENWDHMERFWENSI-----FKYLRAEPEDHFFLLTEPPLNPPENREQVAEIFF 178

Query: 121 EEYEVDSLY---KAPTAAYIPFYTTNENIKTISGKSDHGELDIEEKIEAGKEYNDFSLVI 177
           E +    LY   +A  A    + +     ++++G                        VI
Sbjct: 179 ESFNCAGLYIAVQAVLALAASWTSAQVTDRSLTGT-----------------------VI 215

Query: 178 DSGFNCTWVIPIVKGVPYYKAVKKLDVGGR----FLNGLLKETISFRHYNVMDESI-LVN 232
           DSG   T VIP+ +G     A+K + + GR    F+  LL+E          D S+    
Sbjct: 216 DSGDGVTHVIPVAEGYVVGSAIKNIPIAGRDITLFIQSLLRER------GEADSSLKTAE 269

Query: 233 NIKEQCLYVDP--VSYFEAFKAKGKNKIDFVLPDFQTSFQGYVRDPKTALPDNAQILTLT 290
            IK++  YV P  V  F  F  + +    F++ +         +D  T      +++ + 
Sbjct: 270 RIKQEYCYVCPDIVKEFNKFDRQPEKFAQFIIEN---------QDKTT-----KKVIDIG 315

Query: 291 DERFSVPEAFFHPEISQS--LKPGIIETVLESIYMLPELLRPLMASNIVCMGGNFNLPGF 348
            ERF  PE FF+PEI+ S  L P +   V ++I   P  +R  + +NIV  GG+     F
Sbjct: 316 YERFLAPEIFFNPEIASSDFLTP-LPTVVDQTIQACPIDVRKGLYNNIVLSGGSTMFKDF 374

Query: 349 TDRLVSELQRQLPTDWVCRAKISSGDKSLTG---------------WTAMAKFAHTDAYK 393
           + RL  ++ + + ++ + + +  +G KS TG               W   +  A T  +K
Sbjct: 375 SRRLQRDV-KSIVSNRIAQNEALTGTKS-TGVDVQVISHRKQRNAVWFGGSLLAQTAEFK 432

Query: 394 KARVTKEDYFEHG 406
               TK+DY EHG
Sbjct: 433 GYCHTKKDYEEHG 445

>Kpol_1003.16 s1003 complement(43655..45904) [2250 bp, 749 aa] {ON}
           complement(43655..45904) [2250 nt, 750 aa]
          Length = 749

 Score = 70.5 bits (171), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 47/155 (30%), Positives = 74/155 (47%), Gaps = 11/155 (7%)

Query: 272 YVRDPKTALPDNAQ---ILTLTDERFSVPEAFFHPEISQSLKPGIIE----TVLESIYML 324
           ++R P+    D+      + L  ER  VPE  F P +    + G+ E     +L+     
Sbjct: 590 FLRGPRPHDSDDVHEQHQMHLNIERIRVPEVLFQPTMGGCDQAGVAELCETILLKKFGSS 649

Query: 325 PELLRPL---MASNIVCMGGNFNLPGFTDRLVSELQRQLPTDWVCRAKISSGDKSLTGWT 381
           P  L      MA+NI   GGN  +PG  +R+V E    LP        +SS D  L  W 
Sbjct: 650 PNQLSKTAEDMANNIWLSGGNAKVPGLKNRIVKEFTSFLPVGTKLSVNMSS-DPLLDSWK 708

Query: 382 AMAKFAHTDAYKKARVTKEDYFEHGLDWTTKERFG 416
            MAK+A ++ Y K+ +TK++Y E+G ++  + + G
Sbjct: 709 GMAKWAKSEDYNKSFITKKEYEEYGPEYIKEHKMG 743

>TBLA0E03860 Chr5 complement(969721..972000) [2280 bp, 759 aa] {ON}
           Anc_2.248 YNL059C
          Length = 759

 Score = 70.1 bits (170), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 51/157 (32%), Positives = 77/157 (49%), Gaps = 14/157 (8%)

Query: 272 YVRDPK---TALPDNAQILTLTDERFSVPEAFFHPEISQSLKPGIIETVLESIYML---- 324
           ++R P+   +  P     + +  ER  VPE  F P I    + GI E + E++++     
Sbjct: 599 FLRGPRPHDSEDPHQQHQIHMNVERIRVPEVMFQPSIGGCDQAGISE-LSETLFLRKFNS 657

Query: 325 -PELLRPL---MASNIVCMGGNFNLPGFTDRLVSELQRQLPTDWVCRAKISSGDKSLTGW 380
            P  L  +   M +N+   GG+  LPG  +R+V E    LP        IS+ D SL  W
Sbjct: 658 SPRKLSSISERMLNNVWLTGGHAKLPGLKERIVKEYTEFLPVGTKMSINISN-DPSLDTW 716

Query: 381 TAMAKFA-HTDAYKKARVTKEDYFEHGLDWTTKERFG 416
             MAK A +TD  KK +VTK+DY E+G ++  +   G
Sbjct: 717 KGMAKLASNTDYLKKIQVTKKDYEEYGPEYMMEHNLG 753

 Score = 50.1 bits (118), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 64/252 (25%), Positives = 103/252 (40%), Gaps = 43/252 (17%)

Query: 4   DQAIVIDNGSYQVKFGLASEVRP-RVALNALAKDK-----YGVTHLSNQVQNIKDISSVV 57
           D  I ID GSY VK G  ++  P  V  N L + +       +T + N   N+     + 
Sbjct: 36  DIPIAIDFGSYNVKAGYTNQSLPTHVFTNKLTRYRDRKLAKTMTFIGNDT-NLDQPLRIQ 94

Query: 58  FRRPHELGQLTSWELESCIWDYCLYNPDEFGIDWQ--SLENRHVVLSETCMTLPELSKNT 115
            +RP++   + +WE    I+DY L++    G+     S+ N  ++L+E    L     N 
Sbjct: 95  AKRPYDGLFIANWEYAEEIFDYTLHH---LGVQTTNGSISN-PIILTEKMACLQSQRANW 150

Query: 116 DQVLFEEYEVDSLYKAPTAAYIPFYTTNENIKTISGKSDHGELDIEEKIEAGKEYNDFSL 175
            Q+LFE ++V S      + Y  FY    N     G                       L
Sbjct: 151 YQLLFETFDVPSATFGLDSLYA-FYNNCANPFESDG-----------------------L 186

Query: 176 VIDSGFNCTWVIPIVKGVPYYKAVKKLDVGGR----FLNGLLKETISFRHYNVMDESILV 231
           VI+ G   T ++PIV+G       K+++ GGR    +L+ LL  T+ + ++         
Sbjct: 187 VINCGHEDTNIVPIVQGKGILTEAKRINWGGRHSTEYLSSLL--TLKYPYFPTKLSEFQY 244

Query: 232 NNIKEQCLYVDP 243
             + E   YV P
Sbjct: 245 QTMYEDFCYVSP 256

>CAGL0F00517g Chr6 (54743..56107) [1365 bp, 454 aa] {ON} highly
           similar to uniprot|P47117 Saccharomyces cerevisiae
           YJR065c ACT4 actin related protein
          Length = 454

 Score = 68.9 bits (167), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 70/251 (27%), Positives = 110/251 (43%), Gaps = 39/251 (15%)

Query: 176 VIDSGFNCTWVIPIVKGVPYYKAVKKLDVGGRFLNGLLKETISFRHYNVMDESI-LVNNI 234
           VIDSG   T VIP+ +G     A+K + + GR +   +++ +  R     D S+     I
Sbjct: 210 VIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDITLFIQQLL--RERGEQDTSLKTAERI 267

Query: 235 KEQCLYVDP--VSYFEAFKAKGKNKIDFVLPDFQTSFQGYVRDPKTALPDNAQILTLTDE 292
           K++  YV P  V  F  F         FV+   + +                +I+ +  E
Sbjct: 268 KQEYCYVCPDIVKEFNKFDRDASKFAQFVVESQEKT--------------RKKIVDVGYE 313

Query: 293 RFSVPEAFFHPEISQS--LKPGIIETVLESIYMLPELLRPLMASNIVCMGGNFNLPGFTD 350
           RF  PE FF+PEI+ S  L P +   V E+I   P  +R  + +NIV  GG+     F  
Sbjct: 314 RFLAPEIFFNPEIASSDFLTP-LPTVVDETIQACPIDVRKGLYNNIVLSGGSTMFKDFGR 372

Query: 351 RLVSELQRQLPTDWVCRAKISSGDKSLTG---------------WTAMAKFAHTDAYKKA 395
           RL  ++ + +  + + +++  SG KS TG               W   +  A T  +K  
Sbjct: 373 RLQRDM-KSIVNNRIAQSEALSGTKS-TGVDVQVISHRKQRNAVWFGGSLLAQTAEFKSY 430

Query: 396 RVTKEDYFEHG 406
             TK+DY E+G
Sbjct: 431 CHTKKDYDEYG 441

>YJR065C Chr10 complement(557809..559158) [1350 bp, 449 aa] {ON}
           ARP3Essential component of the Arp2/3 complex, which is
           a highly conserved actin nucleation center required for
           the motility and integrity of actin patches; involved in
           endocytosis and membrane growth and polarity
          Length = 449

 Score = 68.9 bits (167), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 90/373 (24%), Positives = 152/373 (40%), Gaps = 78/373 (20%)

Query: 61  PHELGQLTSWELESCIWDYCLYNPDEFGIDWQSLENRHVVLSETCMTLPELSKNTDQVLF 120
           P   GQ+ +W+     W+  +     F       E+   +L+E  +  PE  +   ++ F
Sbjct: 115 PIRHGQVENWDHMERFWENSI-----FKYLRTEPEDHFFLLTEPPLNPPENREQVAEIFF 169

Query: 121 EEYEVDSLY---KAPTAAYIPFYTTNENIKTISGKSDHGELDIEEKIEAGKEYNDFSLVI 177
           E +    LY   +A  A    + ++    ++++G                        VI
Sbjct: 170 ESFNCAGLYIAVQAVLALAASWTSSKVTDRSLTGT-----------------------VI 206

Query: 178 DSGFNCTWVIPIVKGVPYYKAVKKLDVGGR----FLNGLLKETISFRHYNVMDESI-LVN 232
           DSG   T VIP+ +G     A+K + + GR    F+  LL+E          D S+    
Sbjct: 207 DSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDITLFIQSLLRER------GEADTSLRTAE 260

Query: 233 NIKEQCLYVDP--VSYFEAFKAKGKNKIDFVLPDFQTSFQGYVRDPKTALPDNAQILTLT 290
            IK++  YV P  V  F  F         FV+ + + + +              +++ + 
Sbjct: 261 KIKQEYCYVCPDIVKEFNKFDKDPSKFAQFVVENQEKTRR--------------KVVDIG 306

Query: 291 DERFSVPEAFFHPEISQS--LKPGIIETVLESIYMLPELLRPLMASNIVCMGGNFNLPGF 348
            ERF  PE FF+PEI+ S  L P +   V ++I   P  +R  + +NIV  GG+     F
Sbjct: 307 YERFLAPEIFFNPEIASSDFLTP-LPTVVDQTIQACPIDVRKGLYNNIVLSGGSTMFKDF 365

Query: 349 TDRLVSELQRQLPTDWVCRAKISSGDKSLTG---------------WTAMAKFAHTDAYK 393
             RL  +L + +  + + ++++ SG KS TG               W   +  A T  +K
Sbjct: 366 GRRLQRDL-KSIVNNRIAQSELLSGTKS-TGVDVSVISHRKQRNAVWFGGSLLAQTAEFK 423

Query: 394 KARVTKEDYFEHG 406
               TK+DY E+G
Sbjct: 424 GYCHTKKDYEEYG 436

>Smik_10.355 Chr10 complement(546673..548022) [1350 bp, 449 aa] {ON}
           YJR065C (REAL)
          Length = 449

 Score = 68.9 bits (167), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 90/373 (24%), Positives = 152/373 (40%), Gaps = 78/373 (20%)

Query: 61  PHELGQLTSWELESCIWDYCLYNPDEFGIDWQSLENRHVVLSETCMTLPELSKNTDQVLF 120
           P   GQ+ +W+     W+  +     F       E+   +L+E  +  PE  +   ++ F
Sbjct: 115 PIRHGQVENWDHMERFWENSI-----FKYLRTEPEDHFFLLTEPPLNPPENREQVAEIFF 169

Query: 121 EEYEVDSLY---KAPTAAYIPFYTTNENIKTISGKSDHGELDIEEKIEAGKEYNDFSLVI 177
           E +    LY   +A  A    + ++    ++++G                        VI
Sbjct: 170 ESFNCAGLYIAVQAVLALAASWTSSKVTDRSLTGT-----------------------VI 206

Query: 178 DSGFNCTWVIPIVKGVPYYKAVKKLDVGGR----FLNGLLKETISFRHYNVMDESI-LVN 232
           DSG   T VIP+ +G     A+K + + GR    F+  LL+E          D S+    
Sbjct: 207 DSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDITLFIQSLLRER------GEADTSLRTAE 260

Query: 233 NIKEQCLYVDP--VSYFEAFKAKGKNKIDFVLPDFQTSFQGYVRDPKTALPDNAQILTLT 290
            IK++  YV P  V  F  F         FV+ + + + +              +++ + 
Sbjct: 261 KIKQEYCYVCPDIVKEFNKFDRDPSKFAQFVVENQEKTRR--------------KVVDIG 306

Query: 291 DERFSVPEAFFHPEISQS--LKPGIIETVLESIYMLPELLRPLMASNIVCMGGNFNLPGF 348
            ERF  PE FF+PEI+ S  L P +   V ++I   P  +R  + +NIV  GG+     F
Sbjct: 307 YERFLAPEIFFNPEIASSDFLTP-LPTVVDQTIQACPIDVRKGLYNNIVLSGGSTMFKDF 365

Query: 349 TDRLVSELQRQLPTDWVCRAKISSGDKSLTG---------------WTAMAKFAHTDAYK 393
             RL  +L + +  + + ++++ SG KS TG               W   +  A T  +K
Sbjct: 366 GRRLQRDL-KSIVNNRIAQSELLSGTKS-TGVDVSVISHRKQRNAVWFGGSLLAQTAEFK 423

Query: 394 KARVTKEDYFEHG 406
               TK+DY E+G
Sbjct: 424 GYCHTKKDYEEYG 436

>TPHA0C03160 Chr3 complement(699424..701691) [2268 bp, 755 aa] {ON}
           Anc_2.248 YNL059C
          Length = 755

 Score = 68.9 bits (167), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 49/156 (31%), Positives = 74/156 (47%), Gaps = 12/156 (7%)

Query: 272 YVRDPKTALPDNAQ---ILTLTDERFSVPEAFFHPEISQSLKPGIIE----TVLESIYML 324
           ++R P+    +N+     + +  ER  VPE  F P +    + GIIE     +L+     
Sbjct: 595 FLRGPRPFDSENSHEQHQMHMNIERPRVPEILFQPRMGGCDQAGIIELSETMLLKKFGSK 654

Query: 325 PELLR---PLMASNIVCMGGNFNLPGFTDRLVSELQRQLPTDWVCRAKISSGDKSLTGWT 381
           P  L      MA N+   GG+  LPG   R+V E    LP D      IS    SL  W 
Sbjct: 655 PSKLSDQAEAMAKNVWITGGHAQLPGLKTRIVKEFTSFLPNDAKFSVNISKH-PSLDAWK 713

Query: 382 AMAKFAHTDA-YKKARVTKEDYFEHGLDWTTKERFG 416
            MAKF+  DA +K + ++K++Y E+G ++  + R G
Sbjct: 714 GMAKFSSDDADFKSSLISKKEYEEYGPEYIKEHRLG 749

>Kwal_23.4848 s23 complement(892162..894399) [2238 bp, 745 aa] {ON}
           YNL059C (ARP5) - Actin-related protein [contig 5] FULL
          Length = 745

 Score = 68.9 bits (167), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 42/139 (30%), Positives = 70/139 (50%), Gaps = 11/139 (7%)

Query: 287 LTLTDERFSVPEAFFHPEISQSLKPGIIETVLESIYM--------LPELLRPLMASNIVC 338
           + L  ER  VPE  F P +    + GIIE + E+ ++            +   +ASN+  
Sbjct: 604 MHLNVERIRVPEVIFQPSMGGLDQAGIIE-ICETNFLKKFGSSRSELSSISRSLASNVFL 662

Query: 339 MGGNFNLPGFTDRLVSELQRQLPTDWVCRAKISSGDKSLTGWTAMAKFAHTDA-YKKARV 397
            GGN  LPG  +R+V E +  LP       ++++ D +L  W  MAK + TD+ ++   V
Sbjct: 663 TGGNMRLPGMRERVVREFRGLLPIGTELNVRMAN-DCALDAWRGMAKLSRTDSLFRDTYV 721

Query: 398 TKEDYFEHGLDWTTKERFG 416
           T+++Y E+G D+  +   G
Sbjct: 722 TRQEYHEYGPDYIKEHNLG 740

 Score = 43.9 bits (102), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 56/223 (25%), Positives = 89/223 (39%), Gaps = 50/223 (22%)

Query: 6   AIVIDNGSYQVKFGLASEVRP------RVALNALAKDKYGVTHLSNQVQNIKDISSVVFR 59
           AI ID GS +V+ G  ++ RP      R+A     K    +T + N   N+        R
Sbjct: 38  AIAIDFGSSEVRAGYGNQERPSHIFPNRIARWRDRKLNRNLTFIGNDT-NLDLSVRSQSR 96

Query: 60  RPHELGQLTSWELESCIWDYCLYNPDEFGIDWQSLENRHVVLSETCMTLPELSKNTDQVL 119
            P++   +T+W+    I +Y  ++    G D   + N  ++++E    L     N  Q+L
Sbjct: 97  SPYDGALVTNWDYTEDIMEYTFHHLGVKGTD--GIPN-PIIMTEKLGALHSQRDNWYQLL 153

Query: 120 FEEYEVDSLYKAPTAAY-----IPFYTTNENIKTISGKSDHGELDIEEKIEAGKEYNDFS 174
           FE       + AP   +       FY  N+   + SG                       
Sbjct: 154 FE------CFGAPQVTFGLDSLFSFYANND--ASASG----------------------- 182

Query: 175 LVIDSGFNCTWVIPIVKGVPYYKAVKKLDVGGR----FLNGLL 213
           LVI SG   T +IP+V G       K+++ GGR    +L+ LL
Sbjct: 183 LVISSGNEDTHIIPVVDGKGVLGEAKRINWGGRQSVDYLSNLL 225

>Skud_14.272 Chr14 complement(502920..505187) [2268 bp, 755 aa] {ON}
           YNL059C (REAL)
          Length = 755

 Score = 68.6 bits (166), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 50/157 (31%), Positives = 72/157 (45%), Gaps = 14/157 (8%)

Query: 272 YVRDPKTALPDN---AQILTLTDERFSVPEAFFHPEISQSLKPGIIETVLESIYMLP--- 325
           ++R P+    +N      + L  ER  VPE  F P +    + GI E + E+I M     
Sbjct: 594 FLRGPRPHDSENIHEQHQMHLNVERIRVPEVVFQPTMGGQDQAGICE-LSETILMKKFGS 652

Query: 326 -----ELLRPLMASNIVCMGGNFNLPGFTDRLVSELQRQLPTDWVCRAKISSGDKSLTGW 380
                      M +NI+  GGN  +PG  +R+V E    LP        ISS + SL  W
Sbjct: 653 QRGKLSSTSLDMVNNILITGGNAKVPGLRERIVKEFTEFLPVGTNVAVNISS-NPSLDAW 711

Query: 381 TAMAKFAHTDA-YKKARVTKEDYFEHGLDWTTKERFG 416
             MA  A   A YKK  ++KE+Y E+G D+  + + G
Sbjct: 712 RGMAALARNKAEYKKTVISKEEYEEYGPDYIKEHKLG 748

 Score = 40.8 bits (94), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 58/227 (25%), Positives = 86/227 (37%), Gaps = 59/227 (25%)

Query: 7   IVIDNGSYQVKFGLASEVRP-RVALNALAKDK-----YGVTHLSNQV---QNIKDISSVV 57
           I ID GS +++ G  ++  P  +  N L K +        T + N     Q ++  S   
Sbjct: 40  IAIDFGSSRLRAGFVNQATPTHIFPNVLTKFRDRKLNKNFTFVGNDTLLDQAVRSQSRSP 99

Query: 58  FRRPHELGQLTSWELESCIWDYCLYNPDEFGIDWQSLENRHVVLSETCMTLPELSKNTDQ 117
           F  P     +T+W     I DY  ++    G+   +  +  ++L+E   T+     N  Q
Sbjct: 100 FDGPF----VTNWNFTEEIMDYTFHH---LGVLPNNGISNPILLTERMATVQSQRANWYQ 152

Query: 118 VLFEEYEV-------DSLYKAPTAAYIPFYTTNENIKTISGKSDHGELDIEEKIEAGKEY 170
           +LFE Y V       DSLY         FY  N      SG                   
Sbjct: 153 ILFETYNVPGVTFGIDSLYS--------FYNNNP-----SG------------------- 180

Query: 171 NDFSLVIDSGFNCTWVIPIVKGVPYYKAVKKLDVGGR----FLNGLL 213
           N   LVID     T V+PIV G       K+++ GG     +LN L+
Sbjct: 181 NKTGLVIDCSHEDTSVVPIVDGAGILTDAKRINWGGHQAVDYLNDLM 227

>NDAI0D01060 Chr4 complement(238631..240892) [2262 bp, 753 aa] {ON}
           Anc_2.248 YNL059C
          Length = 753

 Score = 68.6 bits (166), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 44/138 (31%), Positives = 68/138 (49%), Gaps = 9/138 (6%)

Query: 287 LTLTDERFSVPEAFFHPEISQSLKPGIIE----TVLESIYMLPELLRPL---MASNIVCM 339
           + L  ER  VPE  F P +    + GI E     +L      P+ L  L   MA+NI   
Sbjct: 611 IHLNVERIRVPEIVFQPSMGGLDQAGIAELSETILLRKFGSEPKHLSELSLTMANNIWLT 670

Query: 340 GGNFNLPGFTDRLVSELQRQLPTDWVCRAKISSGDKSLTGWTAMAKFAHTDA-YKKARVT 398
           GGN  +PG  +R+V E +  LP +      ++S D +   W  MAK A  +  YKK  ++
Sbjct: 671 GGNSKIPGLRERIVKEFREFLPVNTQFNVNMTS-DPTFDAWNGMAKLAQNETDYKKTIIS 729

Query: 399 KEDYFEHGLDWTTKERFG 416
           K++Y E+G ++  + + G
Sbjct: 730 KKEYEEYGPEYIKEHKLG 747

 Score = 39.7 bits (91), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 53/222 (23%), Positives = 82/222 (36%), Gaps = 48/222 (21%)

Query: 7   IVIDNGSYQVKFGLASEVRP------RVALNALAKDKYGVTHLSNQVQNIKDISSVVFRR 60
           I ID GS  V+ G  +E RP      ++      K     T   N     + I S + + 
Sbjct: 39  IAIDFGSSTVRAGYTNEARPSHIFPTKLTRYRDRKINKTFTFTGNDCSLDQTIRSQM-KS 97

Query: 61  PHELGQLTSWELESCIWDYCLYNPDEFGIDWQSLENRHVVLSETCMTLPELSKNTDQVLF 120
           P +   +T+W+    + D   Y  +  G+         ++++E   T+     N  Q+LF
Sbjct: 98  PFDGALITNWDY---VEDILQYTFNHLGVVPDHGVQNPIIITEKLATIQSQRSNWYQLLF 154

Query: 121 EEYEVDSLYKAPTAAY-----IPFYTTNENIKTISGKSDHGELDIEEKIEAGKEYNDFSL 175
           E Y V      P A +       FY  N    T +G                       +
Sbjct: 155 ETYNV------PKATFGIDSLFAFYNNNNGSATSTG-----------------------M 185

Query: 176 VIDSGFNCTWVIPIVKGVPYYKAVKKLDVGGR----FLNGLL 213
           VID     T +IPIV G       K+++ GGR    +L+ LL
Sbjct: 186 VIDCSHEETNIIPIVDGQGILTDAKRINWGGRHAIDYLSNLL 227

>Skud_10.289 Chr10 complement(515300..516649) [1350 bp, 449 aa] {ON}
           YJR065C (REAL)
          Length = 449

 Score = 67.8 bits (164), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 90/373 (24%), Positives = 151/373 (40%), Gaps = 78/373 (20%)

Query: 61  PHELGQLTSWELESCIWDYCLYNPDEFGIDWQSLENRHVVLSETCMTLPELSKNTDQVLF 120
           P   GQ+ +W+     W+  +     F       E+   +L+E  +  PE  +   ++ F
Sbjct: 115 PIRHGQVENWDHMERFWENSI-----FKYLRTEPEDHFFLLTEPPLNPPENREQVAEIFF 169

Query: 121 EEYEVDSLY---KAPTAAYIPFYTTNENIKTISGKSDHGELDIEEKIEAGKEYNDFSLVI 177
           E +    LY   +A  A    + ++    ++++G                        VI
Sbjct: 170 ESFNCAGLYIAVQAVLALAASWTSSKVTDRSLTGT-----------------------VI 206

Query: 178 DSGFNCTWVIPIVKGVPYYKAVKKLDVGGR----FLNGLLKETISFRHYNVMDESI-LVN 232
           DSG   T VIP+ +G     A+K + + GR    F+  LL+E          D S+    
Sbjct: 207 DSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDITLFIQSLLRER------GEADTSLRTAE 260

Query: 233 NIKEQCLYVDP--VSYFEAFKAKGKNKIDFVLPDFQTSFQGYVRDPKTALPDNAQILTLT 290
            IK++  YV P  V  F  F         FV+ + + + +              +++ + 
Sbjct: 261 KIKQEYCYVCPDIVKEFNKFDRDPSKFAQFVVENQEKTRR--------------KVVDIG 306

Query: 291 DERFSVPEAFFHPEISQS--LKPGIIETVLESIYMLPELLRPLMASNIVCMGGNFNLPGF 348
            ERF  PE FF+PEI+ S  L P +   V ++I   P  +R  + +NIV  GG+     F
Sbjct: 307 YERFLAPEIFFNPEIASSDFLTP-LPMVVDQTIQACPIDVRKGLYNNIVLSGGSTMFKDF 365

Query: 349 TDRLVSELQRQLPTDWVCRAKISSGDKSLTG---------------WTAMAKFAHTDAYK 393
             RL  +L + +    + ++++ SG KS TG               W   +  A T  +K
Sbjct: 366 GRRLQRDL-KSIVNSRIAQSELLSGTKS-TGVDVSVISHRKQRNAVWFGGSLLAQTAEFK 423

Query: 394 KARVTKEDYFEHG 406
               TK+DY E+G
Sbjct: 424 GYCHTKKDYEEYG 436

>KAFR0D03700 Chr4 complement(718438..719787) [1350 bp, 449 aa] {ON}
           Anc_1.514 YJR065C
          Length = 449

 Score = 67.4 bits (163), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 89/373 (23%), Positives = 150/373 (40%), Gaps = 78/373 (20%)

Query: 61  PHELGQLTSWELESCIWDYCLYNPDEFGIDWQSLENRHVVLSETCMTLPELSKNTDQVLF 120
           P   GQ+ +W+     W+  +     F       E+   +L+E  +  PE  +   ++ F
Sbjct: 115 PIRHGQIENWDHMERFWENSI-----FKYLRTEPEDHFFLLTEPPLNPPENREQVAEIFF 169

Query: 121 EEYEVDSLY---KAPTAAYIPFYTTNENIKTISGKSDHGELDIEEKIEAGKEYNDFSLVI 177
           E +    LY   +A  A    + ++    ++++G                        VI
Sbjct: 170 ESFNCAGLYIAVQAVLALAASWTSSKVTDRSLTGT-----------------------VI 206

Query: 178 DSGFNCTWVIPIVKGVPYYKAVKKLDVGGR----FLNGLLKETISFRHYNVMDESI-LVN 232
           DSG   T VIP+ +G     A+K + + GR    F+  LL+E          D S+    
Sbjct: 207 DSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDITLFIQSLLRER------GETDTSLRTAE 260

Query: 233 NIKEQCLYVDP--VSYFEAFKAKGKNKIDFVLPDFQTSFQGYVRDPKTALPDNAQILTLT 290
            IK++  YV P  V  F  F         F++ + + +                +I+ + 
Sbjct: 261 RIKQEYCYVCPDIVKEFNKFDRNPDKFAQFIVENQEKT--------------QKKIVDVG 306

Query: 291 DERFSVPEAFFHPEISQS--LKPGIIETVLESIYMLPELLRPLMASNIVCMGGNFNLPGF 348
            ERF  PE FF+PEI+ S  L P +   V  +I   P  +R  + +NIV  GG+     F
Sbjct: 307 YERFLAPEIFFNPEIASSDFLTP-LPTIVDHTIQACPIDVRKGLYNNIVLSGGSTMFKDF 365

Query: 349 TDRLVSELQRQLPTDWVCRAKISSGDKSLTG---------------WTAMAKFAHTDAYK 393
             RL  ++ + +  + + ++++ SG KS TG               W   +  A T  +K
Sbjct: 366 GRRLQRDI-KSIVNNRIAQSELLSGTKS-TGVDVNVITHRKQRNAVWFGGSLLAQTAEFK 423

Query: 394 KARVTKEDYFEHG 406
               TK+DY E+G
Sbjct: 424 SYCHTKKDYEEYG 436

>Suva_12.154 Chr12 complement(235605..236954) [1350 bp, 449 aa] {ON}
           YJR065C (REAL)
          Length = 449

 Score = 67.4 bits (163), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 90/373 (24%), Positives = 151/373 (40%), Gaps = 78/373 (20%)

Query: 61  PHELGQLTSWELESCIWDYCLYNPDEFGIDWQSLENRHVVLSETCMTLPELSKNTDQVLF 120
           P   GQ+ +W+     W+  +     F       E+   +L+E  +  PE  +   ++ F
Sbjct: 115 PIRHGQVENWDHMERFWENSI-----FKYLRTEPEDHFFLLTEPPLNPPENREQVAEIFF 169

Query: 121 EEYEVDSLY---KAPTAAYIPFYTTNENIKTISGKSDHGELDIEEKIEAGKEYNDFSLVI 177
           E +    LY   +A  A    + ++    ++++G                        VI
Sbjct: 170 ESFNCAGLYIAVQAVLALAASWTSSKVTDRSLTGT-----------------------VI 206

Query: 178 DSGFNCTWVIPIVKGVPYYKAVKKLDVGGR----FLNGLLKETISFRHYNVMDESI-LVN 232
           DSG   T VIP+ +G     A+K + + GR    F+  LL+E          D S+    
Sbjct: 207 DSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDITLFIQSLLRER------GEADTSLRTAE 260

Query: 233 NIKEQCLYVDP--VSYFEAFKAKGKNKIDFVLPDFQTSFQGYVRDPKTALPDNAQILTLT 290
            IK++  YV P  V  F  F         FV+ + + + +              + + + 
Sbjct: 261 KIKQEYCYVCPDIVKEFNKFDRDPSKFAQFVVENQEKTRR--------------KAVDIG 306

Query: 291 DERFSVPEAFFHPEISQS--LKPGIIETVLESIYMLPELLRPLMASNIVCMGGNFNLPGF 348
            ERF  PE FF+PEI+ S  L P +   V ++I   P  +R  + +NIV  GG+     F
Sbjct: 307 YERFLAPEIFFNPEIASSDFLTP-LPTVVDQTIQACPIDVRKGLYNNIVLSGGSTMFKDF 365

Query: 349 TDRLVSELQRQLPTDWVCRAKISSGDKSLTG---------------WTAMAKFAHTDAYK 393
             RL  +L + +  + + ++++ SG KS TG               W   +  A T  +K
Sbjct: 366 GRRLQRDL-KSIVNNRIAQSELLSGTKS-TGVDVSVISHRKQRNAVWFGGSLLAQTAEFK 423

Query: 394 KARVTKEDYFEHG 406
               TK+DY E+G
Sbjct: 424 GYCHTKKDYEEYG 436

>KNAG0B00170 Chr2 (18478..19839) [1362 bp, 453 aa] {ON} Anc_1.514
           YJR065C
          Length = 453

 Score = 67.0 bits (162), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 87/375 (23%), Positives = 148/375 (39%), Gaps = 82/375 (21%)

Query: 61  PHELGQLTSWELESCIWDYCLYNPDEFGIDWQSLENRHVVLSETCMTLPELSKNTDQVLF 120
           P   GQ+ +W+     W+  +     F       E+   +L+E  +  PE  +   ++ F
Sbjct: 119 PIRHGQVENWDHMERFWENSI-----FKYLRTEPEDHFFLLTEPPLNPPENREQIAEIFF 173

Query: 121 EEYEVDSLY--KAPTAAYIPFYTTNENI-KTISGKSDHGELDIEEKIEAGKEYNDFSLVI 177
           E +    LY       A    +T+++ + ++++G                        VI
Sbjct: 174 ESFNCAGLYIAVQAVLALAASWTSSKVVDRSLTGT-----------------------VI 210

Query: 178 DSGFNCTWVIPIVKGVPYYKAVKKLDVGGRFLNGLLKETISFRHYNVMDESI-LVNNIKE 236
           DSG   T VIP+ +G     A+K + + GR +   ++  +  R     D S+     IK+
Sbjct: 211 DSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDITQFIQTLL--RERGEADTSLRTAERIKQ 268

Query: 237 QCLYVDPVSYFEAFKAKGKNKIDFVLPDFQTSFQGYVRDP--------KTALPDNAQILT 288
           +  Y                    V PD    F  + RDP        +       +++ 
Sbjct: 269 EYCY--------------------VCPDIVKEFNKFDRDPEKFAQYVVENQEKTQKKVVD 308

Query: 289 LTDERFSVPEAFFHPEISQS--LKPGIIETVLESIYMLPELLRPLMASNIVCMGGNFNLP 346
           +  ERF  PE FF+PEI+ S  L P +   V ++I   P  +R  + +NIV  GG+    
Sbjct: 309 VGYERFLAPEIFFNPEIASSDFLTP-LPTIVDQTIQACPIDVRKGLYNNIVLSGGSTMFK 367

Query: 347 GFTDRLVSELQRQLPTDWVCRAKISSGDKSLTG---------------WTAMAKFAHTDA 391
            F  RL  +L + +  + + + ++ SG KS TG               W   +  A T  
Sbjct: 368 DFGRRLQRDL-KSIVNNRIAQNELLSGTKS-TGVDVSVISHRKQRNAVWFGGSLLAQTAE 425

Query: 392 YKKARVTKEDYFEHG 406
           +K    TK+DY E+G
Sbjct: 426 FKSYCHTKKDYEEYG 440

>Kpol_1056.16 s1056 (36274..37656) [1383 bp, 460 aa] {ON}
           (36274..37656) [1383 nt, 461 aa]
          Length = 460

 Score = 67.0 bits (162), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 88/372 (23%), Positives = 151/372 (40%), Gaps = 76/372 (20%)

Query: 61  PHELGQLTSWELESCIWDYCLYNPDEFGIDWQSLENRHVVLSETCMTLPELSKNTDQVLF 120
           P   GQ+ +W+     W+  +     F       E+   +L+E  +  PE  +   ++ F
Sbjct: 126 PIRHGQIENWDHMERFWENSI-----FKYLRAEPEDHFFLLTEPPLNPPENREQVAEIFF 180

Query: 121 EEYEVDSLY---KAPTAAYIPFYTTNENIKTISGKSDHGELDIEEKIEAGKEYNDFSLVI 177
           E +    LY   +A  A    + ++    ++++G                        VI
Sbjct: 181 ESFNCAGLYIAVQAVLALAASWTSSQVTDRSLTGT-----------------------VI 217

Query: 178 DSGFNCTWVIPIVKGVPYYKAVKKLDVGGR----FLNGLLKETISFRHYNVMDESI-LVN 232
           DSG   T VIP+ +G     A+K + + GR    F+  LL+E          D S+    
Sbjct: 218 DSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDITLFIQSLLRER------GEADTSLRTAE 271

Query: 233 NIKEQCLYVDP--VSYFEAFKAKGKNKIDFVLPDFQTSFQGYVRDPKTALPDNAQILTLT 290
            IK++  YV P  V  F  F  + +    F++ +   + Q              +++ + 
Sbjct: 272 RIKQEYCYVCPDIVKEFNKFDRQPEKFAQFIIENQDKTKQ--------------KVVDIG 317

Query: 291 DERFSVPEAFFHPEISQS--LKPGIIETVLE-SIYMLPELLRPLMASNIVCMGGNFNLPG 347
            ERF  PE FF+PEI+ S  L P  + TV++ +I   P  +R  + +NIV  GG+     
Sbjct: 318 YERFLAPEIFFNPEIASSDFLTP--LPTVVDHTIQACPIDVRKGLYNNIVLSGGSTMFKD 375

Query: 348 FTDRLVSELQ-----RQLPTDWVCRAKISSGDKSLTG--------WTAMAKFAHTDAYKK 394
           F+ RL  +++     R +  + V   K +  D  +          W   +  A T  +K 
Sbjct: 376 FSRRLQRDIKSIVNSRIIQNEAVTGVKSTGVDVQVISHRKQRNAVWFGGSLLAQTAEFKS 435

Query: 395 ARVTKEDYFEHG 406
              TK+DY E+G
Sbjct: 436 YCHTKKDYEEYG 447

>ADL253C Chr4 complement(255550..257805) [2256 bp, 751 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YNL059C
           (ARP5)
          Length = 751

 Score = 67.4 bits (163), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 46/135 (34%), Positives = 65/135 (48%), Gaps = 13/135 (9%)

Query: 292 ERFSVPEAFFHPEISQSLKPGIIE---TVLESIYMLPELLRPL------MASNIVCMGGN 342
           ER  VPE  F P I    + G++E   TVL  +       R L      MA N+   GGN
Sbjct: 614 ERIRVPEVIFQPSIGGLDQAGVVELCETVL--LKKFDSSRRALSATCEKMAKNVFITGGN 671

Query: 343 FNLPGFTDRLVSELQRQLPTDWVCRAKISSGDKSLTGWTAMAKFAHT-DAYKKARVTKED 401
             LPG  +R+V E    LP     +  ++  D SL+ W  MAKFA    +YK + +TK +
Sbjct: 672 TKLPGIRERIVREFTGFLPVGTELKVTLAK-DPSLSAWKGMAKFASDPTSYKSSILTKRE 730

Query: 402 YFEHGLDWTTKERFG 416
           Y E+G ++  +   G
Sbjct: 731 YEEYGPEYIKEHNLG 745

>ZYRO0A01584g Chr1 complement(130119..132365) [2247 bp, 748 aa] {ON}
           highly similar to uniprot|P53946 Saccharomyces
           cerevisiae YNL059C ARP5 Nuclear actin-related protein
           involved in chromatin remodeling component of chromatin-
           remodeling enzyme complexes
          Length = 748

 Score = 67.4 bits (163), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 45/135 (33%), Positives = 65/135 (48%), Gaps = 13/135 (9%)

Query: 292 ERFSVPEAFFHPEIS---QSLKPGIIETVLESIYMLPELLRPL------MASNIVCMGGN 342
           ER  VPE  F P +    Q+  P + ET+L  +       R L      MA N+   GGN
Sbjct: 611 ERIRVPEVLFQPNMGGEDQAGIPELCETLL--LRKFGSTQRQLSDVSTSMAQNVWITGGN 668

Query: 343 FNLPGFTDRLVSELQRQLPTDWVCRAKISSGDKSLTGWTAMAKFA-HTDAYKKARVTKED 401
             LPG  +R+V E    LP+      +  S D SL  W  MAK A +T+ +K   +TK++
Sbjct: 669 AKLPGLRERIVKEFSEFLPSGSPFSIR-KSQDPSLDAWRGMAKLAQNTEDFKHGYITKQE 727

Query: 402 YFEHGLDWTTKERFG 416
           Y E+G ++  +   G
Sbjct: 728 YLEYGPEYIKEHNLG 742

>ZYRO0G01936g Chr7 complement(144085..145470) [1386 bp, 461 aa] {ON}
           highly similar to uniprot|P47117 Saccharomyces
           cerevisiae YJR065C ARP3 Essential component of the
           Arp2/3 complex which is a highly conserved actin
           nucleation center required for the motility and
           integrity of actin patches involved in endocytosis and
           membrane growth and polarity
          Length = 461

 Score = 67.0 bits (162), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 88/387 (22%), Positives = 157/387 (40%), Gaps = 68/387 (17%)

Query: 42  HLSNQVQNIKDISSVVFRRPHELGQLTSWELESCIWDYCLYNPDEFGIDWQSLENRHVVL 101
           ++ N+       ++     P   GQ+ +W+     W+  +     F       E+   +L
Sbjct: 108 YIGNEALTASQGANYSLNYPIRHGQVENWDHMERFWENSI-----FKYLRTEPEDHFFLL 162

Query: 102 SETCMTLPELSKNTDQVLFEEYEVDSLY--KAPTAAYIPFYTTNENI-KTISGKSDHGEL 158
           +E  +  PE  +   ++ FE +    LY       A    +T+++ + ++++G       
Sbjct: 163 TEPPLNPPENREQVAEIFFESFNCAGLYIAVQAVLALAASWTSSKVVDRSLTGT------ 216

Query: 159 DIEEKIEAGKEYNDFSLVIDSGFNCTWVIPIVKGVPYYKAVKKLDVGGRFLNGLLKETIS 218
                            VIDSG   T VIP+ +G     A+K + + GR +   ++  + 
Sbjct: 217 -----------------VIDSGDGVTHVIPVAEGYVIGSALKNIPIAGRDITQFIQSLL- 258

Query: 219 FRHYNVMDESI-LVNNIKEQCLYVDP--VSYFEAFKAKGKNKIDFVLPDFQTSFQGYVRD 275
            R    +D S+     IK++  YV P  V  F  F    +    +V+ +   + Q     
Sbjct: 259 -RERGEVDTSLRTAERIKQEYCYVCPDIVKEFNKFDRDAEKFAQYVVENQDKTRQ----- 312

Query: 276 PKTALPDNAQILTLTDERFSVPEAFFHPEISQS--LKPGIIETVL-ESIYMLPELLRPLM 332
                    +++ +  ERF  PE FF+PEI+ S  L P  + TVL ++I   P  +R  +
Sbjct: 313 ---------KVVDIGYERFLAPEIFFNPEIASSDFLTP--LPTVLDQTIQACPIDVRKGL 361

Query: 333 ASNIVCMGGNFNLPGFTDRLVSELQ-----RQLPTDWVCRAKISSGDKSLTG-------- 379
            +NIV  GG+     F  RL  +L+     R   T+ +  A+ +  D  +          
Sbjct: 362 YNNIVLSGGSTMFKDFGRRLQRDLKSIVNNRIAETERLSGARSTGVDVQVISHRKQRNAV 421

Query: 380 WTAMAKFAHTDAYKKARVTKEDYFEHG 406
           W   +  A T  +K    TK+DY E+G
Sbjct: 422 WFGGSLLAQTPEFKGYCHTKKDYEEYG 448

>TBLA0D03680 Chr4 (914687..916063) [1377 bp, 458 aa] {ON} Anc_1.514
           YJR065C
          Length = 458

 Score = 66.6 bits (161), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 88/374 (23%), Positives = 151/374 (40%), Gaps = 80/374 (21%)

Query: 61  PHELGQLTSWELESCIWDYCLYNPDEFGIDWQSLENRHVVLSETCMTLPELSKNTDQVLF 120
           P   GQ+ +W+     W+  +     F       E+ + +L+E  +  PE  +   ++ F
Sbjct: 124 PIRHGQVENWDHMERFWENSI-----FKYLRTEPEDHYFLLTEPPLNPPENREQVAEIFF 178

Query: 121 EEYEVDSLY--KAPTAAYIPFYTTNENI-KTISGKSDHGELDIEEKIEAGKEYNDFSLVI 177
           E +    LY       A    +T+++ I ++++G                        VI
Sbjct: 179 ESFNCAGLYIAVQAVLALAASWTSSKVIDRSLTGT-----------------------VI 215

Query: 178 DSGFNCTWVIPIVKGVPYYKAVKKLDVGGRFLNGLLKETISFRHYNVMDESI-LVNNIKE 236
           DSG   T VIP+ +G     A+K + + GR +   ++  +  R     D S+     IK+
Sbjct: 216 DSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDITEFIQSLL--RERGEADTSLRTAERIKQ 273

Query: 237 QCLYVDP--VSYFEAFKAKGKNKIDFVLPDFQTSFQGYVRDPKTALPDNAQILTLTDERF 294
           +  YV P  V  F  F  + +    F++   + + Q              +++ +  ERF
Sbjct: 274 EYCYVCPDIVKEFNKFDRQPEKFAQFIVESQEKTKQ--------------KVVDVGYERF 319

Query: 295 SVPEAFFHPEISQS--LKPGIIETVLESIYMLPELLRPLMASNIVCMGGNFNLPGFTDRL 352
             PE FF+PEI+ S  L P +   V ++I   P  +R  + +NIV  GG+     F+ R 
Sbjct: 320 LAPEIFFNPEIASSDYLTP-LPTVVDQTIQACPIDVRKGLYNNIVLSGGSTMFKDFSRR- 377

Query: 353 VSELQRQLPTDWVCRAKISSGDKSLTG--------------------WTAMAKFAHTDAY 392
              LQR + +  +  A+IS  +K +TG                    W   +  A T  +
Sbjct: 378 ---LQRDMKS--IVNARISQNEK-MTGVKSSGVDVQVISHRKQRNAVWFGGSLLAQTAEF 431

Query: 393 KKARVTKEDYFEHG 406
           +    TK DY E G
Sbjct: 432 RGYCHTKRDYEEIG 445

>KAFR0J01160 Chr10 (212425..214680) [2256 bp, 751 aa] {ON} Anc_2.248
           YNL059C
          Length = 751

 Score = 67.0 bits (162), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 51/156 (32%), Positives = 74/156 (47%), Gaps = 12/156 (7%)

Query: 272 YVRDPKTALPDN---AQILTLTDERFSVPEAFFHPEISQSLKPGI---IETVLESIY-ML 324
           ++R P+    +N      L L  ER  VPE  F P I    + GI    ET+L + +   
Sbjct: 591 FLRGPRPHDSENIHEQHQLHLNVERIRVPEILFQPIIGGQDQAGISELCETILSNKFGSK 650

Query: 325 PELLRPL---MASNIVCMGGNFNLPGFTDRLVSELQRQLPTDWVCRAKISSGDKSLTGWT 381
           P  L      MA NI   GG+  LPG  +R+V E    LP       K+S  + SL  W 
Sbjct: 651 PRELSETSLGMAKNIWLTGGHSKLPGLRERIVKEFTGFLPVGTKLGVKMSK-NPSLDAWY 709

Query: 382 AMAKFAHTDA-YKKARVTKEDYFEHGLDWTTKERFG 416
            M K A  +A YK + ++K+DY E+G ++  + + G
Sbjct: 710 GMRKLAQNEADYKDSIISKKDYEEYGAEYIKEHKLG 745

>YNL059C Chr14 complement(512668..514935) [2268 bp, 755 aa] {ON}
           ARP5Nuclear actin-related protein involved in chromatin
           remodeling, component of chromatin-remodeling enzyme
           complexes
          Length = 755

 Score = 66.6 bits (161), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 46/156 (29%), Positives = 73/156 (46%), Gaps = 12/156 (7%)

Query: 272 YVRDPKTALPDN---AQILTLTDERFSVPEAFFHPEISQSLKPGIIE----TVLESIYML 324
           ++R P+    +N      + L  ER  VPE  F P +    + GI E     +L+     
Sbjct: 594 FLRGPRPHDSENIHEQHQMHLNVERIRVPEVIFQPTMGGQDQAGICELSETILLKKFGSQ 653

Query: 325 PELLRPL---MASNIVCMGGNFNLPGFTDRLVSELQRQLPTDWVCRAKISSGDKSLTGWT 381
           P  L      M +N++  GGN  +PG  +R+V E    LPT       +SS D SL  W 
Sbjct: 654 PGKLSQTSIDMVNNVLITGGNAKVPGLKERIVKEFTGFLPTGTNITVNMSS-DPSLDAWK 712

Query: 382 AMAKFAHT-DAYKKARVTKEDYFEHGLDWTTKERFG 416
            MA  A   + Y+K  ++K++Y E+G ++  + + G
Sbjct: 713 GMAALARNEEQYRKTVISKKEYEEYGPEYIKEHKLG 748

 Score = 39.7 bits (91), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 59/227 (25%), Positives = 86/227 (37%), Gaps = 59/227 (25%)

Query: 7   IVIDNGSYQVKFGLASEVRP-RVALNALAKDK-----YGVTHLSNQV---QNIKDISSVV 57
           I ID GS +++ G  +   P  +  NAL K +        T + N     Q ++  S   
Sbjct: 40  IAIDFGSSKLRAGFVNHATPTHIFPNALTKFRDRKLNKNFTFVGNDTLLDQAVRSQSRSP 99

Query: 58  FRRPHELGQLTSWELESCIWDYCLYNPDEFGIDWQSLENRHVVLSETCMTLPELSKNTDQ 117
           F  P     +T+W L   I DY  ++    G+   +     ++L+E   T+     N  Q
Sbjct: 100 FDGPF----VTNWNLTEEILDYTFHH---LGVVPDNGIPNPILLTERLATVQSQRTNWYQ 152

Query: 118 VLFEEYEV-------DSLYKAPTAAYIPFYTTNENIKTISGKSDHGELDIEEKIEAGKEY 170
           +LFE Y V       DSL+         FY  N      SG                   
Sbjct: 153 ILFETYNVPGVTFGIDSLFS--------FYNYNP-----SG------------------- 180

Query: 171 NDFSLVIDSGFNCTWVIPIVKGVPYYKAVKKLDVGGR----FLNGLL 213
           N   LVI  G   T VIP+V G       K+++ GG     +LN L+
Sbjct: 181 NKTGLVISCGHEDTNVIPVVDGAGILTDAKRINWGGHQAVDYLNDLM 227

>CAGL0H09042g Chr8 (884592..885755) [1164 bp, 387 aa] {ON} similar
           to uniprot|P38696 Saccharomyces cerevisiae YHR129c ACT5
          Length = 387

 Score = 65.9 bits (159), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 77/370 (20%), Positives = 152/370 (41%), Gaps = 62/370 (16%)

Query: 4   DQAIVIDNGSYQVKFGLASEVRPRV-----ALNALAKDKYGVTHLSNQVQNIKDI----- 53
           +Q +++DNGS  +K G A   +P V       N LA+    +  +SN+   I +      
Sbjct: 10  NQPVILDNGSSVIKAGFAGSQQPDVLEYAWIGNPLAERS--MVTVSNKETYIGNSAYERR 67

Query: 54  SSVVFRRPHELGQLTSWELESCIWDYCLYNPDEFGIDWQSLENRHVVLSETCMTLPELSK 113
           +++    P+    + SW+    +WDY L N  E     + L+   VVL+ +  T  +  +
Sbjct: 68  ATLHLESPYSTNAIMSWDRLEDLWDYVLLNKLEI----EQLQEHPVVLTNSMSTSKKEEE 123

Query: 114 NTDQVLFEEYEVDSLYKAPTAAYIPFYTTNENIKTISGKSDHGELDIEEKIEAGKEYNDF 173
              +VLFE++ + ++           Y + + I ++ G                      
Sbjct: 124 KMCEVLFEKFSIPAI-----------YCSRDPIMSLYGLG-----------------RTT 155

Query: 174 SLVIDSGFNCTWVIPIVKGVPYYKAVKKLDVGGRFLNGLLKETISFRH---YNVMDESIL 230
              +  G     +  ++ G+    + +  + GG  +   + + +   H    N  +   L
Sbjct: 156 GCSVSCGHRGIGITTVIDGMIVGGSSQISNTGGSAVTNTMLDLLRHNHPKLENGQNGIEL 215

Query: 231 VNNIKEQCLYVDPVSYFEAFKAKGKNKIDFVLPDFQTSFQGYVRDPKTALPDNAQILTLT 290
           + +IKE+C  +    ++   +A       + L   +TS   Y       LPD   I+ + 
Sbjct: 216 IRSIKERCCVLSK-DFYNEIRA-------YELITSKTSNNKY------RLPD-GNIIEIG 260

Query: 291 DERFSVPEAFFHPEISQSLKPGIIETVLESIYMLPELLRPLMASNIVCMGGNFNLPGFTD 350
            ERF  PE  F+P+     +  + + ++ SI     L R  +  +IV  GG+  + GF +
Sbjct: 261 SERFEAPEIIFNPQAYGYSEIPLQKMIINSISRAGILPRSQLLESIVLSGGSSLIKGFGE 320

Query: 351 RLVSELQRQL 360
           RL  E+++++
Sbjct: 321 RLTKEIRKEI 330

>Suva_14.281 Chr14 complement(511583..513850) [2268 bp, 755 aa] {ON}
           YNL059C (REAL)
          Length = 755

 Score = 66.6 bits (161), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 47/156 (30%), Positives = 71/156 (45%), Gaps = 12/156 (7%)

Query: 272 YVRDPKTALPDN---AQILTLTDERFSVPEAFFHPEISQSLKPGIIE----TVLESIYML 324
           ++R P+    +N      + L  ER  VPE  F P +    + GI E     +L+     
Sbjct: 594 FLRGPRPHDSENIHEQHQMHLNVERIRVPEVVFQPTLGGQDQAGICELSETILLKKFGSQ 653

Query: 325 PELLRPL---MASNIVCMGGNFNLPGFTDRLVSELQRQLPTDWVCRAKISSGDKSLTGWT 381
           P  L      M +N+   GGN  +PG  +R+V E    LP        +SS D SL  W 
Sbjct: 654 PGKLSSTSLDMVNNVFITGGNSKVPGLRERIVREFTEFLPVGTNFSVNMSS-DPSLDAWK 712

Query: 382 AMAKFAHT-DAYKKARVTKEDYFEHGLDWTTKERFG 416
            MA  A   + YKK  ++K++Y E+G D+  + + G
Sbjct: 713 GMAALAQNKEEYKKTVISKKEYEEYGPDYIKEHKLG 748

 Score = 44.7 bits (104), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 57/231 (24%), Positives = 88/231 (38%), Gaps = 55/231 (23%)

Query: 7   IVIDNGSYQVKFGLASEVRP-RVALNALAKDK-----YGVTHLSNQV---QNIKDISSVV 57
           I ID GS +++ G  ++  P  +  N L K +        T + N     Q ++  S   
Sbjct: 40  IAIDFGSSKLRAGFVNQAAPTHIFPNVLTKFRDRKLNKNFTFVGNDTLLDQAVRSQSRSP 99

Query: 58  FRRPHELGQLTSWELESCIWDYCLYNPDEFGIDWQSLENRHVVLSETCMTLPELSKNTDQ 117
           F  P     +T+W     I DY  ++    G+   +     ++L+E   T+     N  Q
Sbjct: 100 FDGPF----VTNWNFTEEIMDYTFHH---LGVSPNNGVRNPILLTERMATVQSQRANWYQ 152

Query: 118 VLFEEYEV-------DSLYKAPTAAYIPFYTTNENIKTISGKSDHGELDIEEKIEAGKEY 170
           ++FE Y V       DSLY         FY  N      SG                   
Sbjct: 153 IMFETYNVPGVTFGIDSLYG--------FYNQN-----TSG------------------- 180

Query: 171 NDFSLVIDSGFNCTWVIPIVKGVPYYKAVKKLDVGGRFLNGLLKETISFRH 221
           N   LVID G   T VIP+V G       K+++ GGR     L + ++ ++
Sbjct: 181 NKTGLVIDCGHEDTNVIPVVDGTGVLTDAKRINWGGRQAVDYLSDLMALKY 231

>TDEL0F00470 Chr6 (80760..82145) [1386 bp, 461 aa] {ON} Anc_1.514
           YJR065C
          Length = 461

 Score = 65.1 bits (157), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 88/369 (23%), Positives = 150/369 (40%), Gaps = 70/369 (18%)

Query: 61  PHELGQLTSWELESCIWDYCLYNPDEFGIDWQSLENRHVVLSETCMTLPELSKNTDQVLF 120
           P   GQ+ +W+     W+  +     F       E+   +L+E  +  PE  +   ++ F
Sbjct: 127 PIRHGQVENWDHMERFWENSI-----FKYLRTEPEDHCFLLTEPPLNPPENREQVAEIFF 181

Query: 121 EEYEVDSLY--KAPTAAYIPFYTTNENI-KTISGKSDHGELDIEEKIEAGKEYNDFSLVI 177
           E +    LY       A    +T+++ I ++++G                        VI
Sbjct: 182 ESFNCAGLYIAVQAVLALAASWTSSKVIDRSLTGT-----------------------VI 218

Query: 178 DSGFNCTWVIPIVKGVPYYKAVKKLDVGGRFLNGLLKETISFRHYNVMDESI-LVNNIKE 236
           DSG   T VIP+ +G     A+K + + GR +   +++ +  R     D S+     IK+
Sbjct: 219 DSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDITLFIQQLL--RERGEEDTSLRTAERIKQ 276

Query: 237 QCLYVDP--VSYFEAFKAKGKNKIDFVLPDFQTSFQGYVRDPKTALPDNAQILTLTDERF 294
           +  YV P  V  F  F    +    FV+   + + +              +++ +  ERF
Sbjct: 277 EYCYVCPDIVKEFNKFDRDSEKFAQFVVESQEKTRR--------------KVVDVGCERF 322

Query: 295 SVPEAFFHPEISQS--LKPGIIETVLESIYMLPELLRPLMASNIVCMGGNFNLPGFTDRL 352
             PE FF+PEI+ S  L P +   V  +I   P  +R  + +NIV  GG+     F  RL
Sbjct: 323 MAPEIFFNPEIASSDFLTP-LPTIVDHTIQACPIDVRKGLYNNIVLSGGSTMFKDFGRRL 381

Query: 353 VSELQRQLPTDWVCRAKISSGDKSLTG---------------WTAMAKFAHTDAYKKARV 397
             +L + +  + + +++  SG KS TG               W   +  A T  +K    
Sbjct: 382 QRDL-KSIVNNRIVQSEYLSGTKS-TGVDVQVISHRKQRNAVWFGGSLLAQTAEFKSYCH 439

Query: 398 TKEDYFEHG 406
           TK+DY E G
Sbjct: 440 TKKDYEEIG 448

>Smik_14.267 Chr14 complement(493008..495275) [2268 bp, 755 aa] {ON}
           YNL059C (REAL)
          Length = 755

 Score = 65.1 bits (157), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 46/156 (29%), Positives = 72/156 (46%), Gaps = 12/156 (7%)

Query: 272 YVRDPKTALPDN---AQILTLTDERFSVPEAFFHPEISQSLKPGIIE----TVLESIYML 324
           ++R P+    +N      + L  ER  VPE  F P +    + GI E     +L+     
Sbjct: 594 FLRGPRPHDSENIHEQHQMHLNVERTRVPEIVFQPTMGGQDQAGICELAETILLKKFGSQ 653

Query: 325 PELLRPL---MASNIVCMGGNFNLPGFTDRLVSELQRQLPTDWVCRAKISSGDKSLTGWT 381
           P  L      MA+N+   GGN  +PG  +R+V E    LP        +SS D SL  W 
Sbjct: 654 PGKLSQTSIDMANNVFITGGNAKVPGLKERIVKEFTGFLPVGTNININMSS-DPSLDAWK 712

Query: 382 AMAKFAHT-DAYKKARVTKEDYFEHGLDWTTKERFG 416
            MA  A   + YK+  +++++Y E+G D+  + + G
Sbjct: 713 GMAALAQNEEEYKRTIISRKEYEEYGPDYIKEHKLG 748

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 60/227 (26%), Positives = 88/227 (38%), Gaps = 59/227 (25%)

Query: 7   IVIDNGSYQVKFGLASEVRP-RVALNALAKDK-----YGVTHLSNQV---QNIKDISSVV 57
           I ID GS +++ G  ++  P  V  N L K +        T + N     Q ++  S   
Sbjct: 40  IAIDFGSSKLRAGFVNQSAPTHVFPNVLTKFRDRKLNKNFTFVGNDTLLDQAVRSQSKSP 99

Query: 58  FRRPHELGQLTSWELESCIWDYCLYNPDEFGIDWQSLENRHVVLSETCMTLPELSKNTDQ 117
           F  P     +T+W     I DY  ++    GI  ++  +  ++L+E   T+     N  Q
Sbjct: 100 FDGPF----VTNWNFTEEILDYTFHH---LGIVPENGISNPILLTERMATVQSQRANWYQ 152

Query: 118 VLFEEYEV-------DSLYKAPTAAYIPFYTTNENIKTISGKSDHGELDIEEKIEAGKEY 170
           +LFE Y V       DSLY      +  +Y         SGK                  
Sbjct: 153 ILFETYNVPGVTFGIDSLY-----GFYNYYP--------SGKQ----------------- 182

Query: 171 NDFSLVIDSGFNCTWVIPIVKGVPYYKAVKKLDVGGR----FLNGLL 213
               LVID G   T VIPIV G       K+++ GG     +LN L+
Sbjct: 183 --TGLVIDCGHEDTNVIPIVDGAGILTDAKRINWGGHQAVDYLNDLM 227

>KLTH0G09482g Chr7 complement(789233..791470) [2238 bp, 745 aa] {ON}
           similar to uniprot|P53946 Saccharomyces cerevisiae
           YNL059C ARP5 Nuclear actin-related protein involved in
           chromatin remodeling component of chromatin-remodeling
           enzyme complexes
          Length = 745

 Score = 64.7 bits (156), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 44/158 (27%), Positives = 76/158 (48%), Gaps = 16/158 (10%)

Query: 272 YVRDPKTALPDN---AQILTLTDERFSVPEAFFHPEISQSLKPGIIETVLESIYM----- 323
           ++R P+    +N      + L  ER  VPE  F P ++   + G+ E + E+ ++     
Sbjct: 586 FLRGPRPHDSENINEQHQMHLNVERIRVPEVIFQPSMAGLDQAGVTE-ICETNFLKKFGS 644

Query: 324 ----LPELLRPLMASNIVCMGGNFNLPGFTDRLVSELQRQLPTDWVCRAKISSGDKSLTG 379
               L E  + L A+N+   GGN  LPG  +R+V E    LP       +++S D ++  
Sbjct: 645 TRSQLSEGSKKL-AANVFLTGGNMRLPGVRERIVREFTGMLPMGSNLNVRMAS-DSAVDA 702

Query: 380 WTAMAKFAHTDA-YKKARVTKEDYFEHGLDWTTKERFG 416
           W  MAK +   + YK + +T+++Y E G D+  +   G
Sbjct: 703 WRGMAKLSQAGSQYKGSYITRKEYQELGADYIKEHNLG 740

 Score = 43.9 bits (102), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 51/224 (22%), Positives = 93/224 (41%), Gaps = 54/224 (24%)

Query: 7   IVIDNGSYQVKFGLASEVRP------RVALNALAKDKYGVTHLSNQVQNIKDISSVVFRR 60
           I ID GS +V+ G  ++ +P      R++     +    +T + N       + S   + 
Sbjct: 39  IAIDFGSSEVRAGFGNQDQPSHIFTNRISRWRDRRKNRNLTFIGNDTNLDLSVRSQA-KS 97

Query: 61  PHELGQLTSWELESCIWDYCLYNPDEFGIDWQSLENRHVVLSETCMTLPELSKNTDQVLF 120
           P++   +++W+    I +Y  ++    G++     +  ++++E   TL    +N  Q+LF
Sbjct: 98  PYDGAIVSNWDYTEEIMEYTFHH---LGVNGNDGVSNPILMTEKLATLQSQRENWYQLLF 154

Query: 121 E-------EYEVDSLYKAPTAAYIPFYTTNENIKTISGKSDHGELDIEEKIEAGKEYNDF 173
           E        + +DSL+         FY  N+   T SG                      
Sbjct: 155 ECFGVPQVTFGIDSLFS--------FYANND--ATASG---------------------- 182

Query: 174 SLVIDSGFNCTWVIPIVKGVPYYKAVKKLDVGGR----FLNGLL 213
            LVI+SG   T VIP++ G       K+++ GGR    +L+ LL
Sbjct: 183 -LVINSGNEDTHVIPVMNGKGVLSEAKRINWGGRQSVEYLSNLL 225

>CAGL0J10054g Chr10 complement(985402..987666) [2265 bp, 754 aa]
           {ON} highly similar to uniprot|P53946 Saccharomyces
           cerevisiae YNL059c ARP5 Actin-related protein
          Length = 754

 Score = 63.2 bits (152), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 47/160 (29%), Positives = 73/160 (45%), Gaps = 14/160 (8%)

Query: 269 FQGYVRDPKTALPDN---AQILTLTDERFSVPEAFFHPEISQSLKPGIIETVLESIYM-- 323
           F  ++R P+    +N      + +  ER  VPE  F P +    + GI E + E+I    
Sbjct: 591 FHLFLRGPRPHDSENIHEQHQMHINVERIRVPEVMFQPILGGQDQAGITE-ICETIITKK 649

Query: 324 ---LPELLRPL---MASNIVCMGGNFNLPGFTDRLVSELQRQLPTDWVCRAKISSGDKSL 377
               P  L      MA N+  +GGN  +PG   R+V E    LP+D      IS    +L
Sbjct: 650 FGSTPRNLSQQSLDMAKNVWLVGGNAQVPGLKSRVVKEFTEFLPSDTKINVNISEA-PTL 708

Query: 378 TGWTAMAKFAHTDA-YKKARVTKEDYFEHGLDWTTKERFG 416
             W  M + A+T+  Y++  VT E+Y E G+D+  + +  
Sbjct: 709 DVWNGMYRLANTEEDYQRTIVTSEEYDECGVDYLKEHKLS 748

 Score = 36.6 bits (83), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 51/216 (23%), Positives = 86/216 (39%), Gaps = 38/216 (17%)

Query: 7   IVIDNGSYQVKFGLASEVRP-RVALNALAK--DKYGVTHLSNQVQN--IKDISSVVFRRP 61
           I ID GSY+++ G  +  RP  +  N  +K  D+    +L     +  +   +    R P
Sbjct: 43  IAIDFGSYELRAGYTNISRPSHIFPNRFSKYRDRKTNKYLPCIGYDTWLDQTTRSQARSP 102

Query: 62  HELGQLTSWELESCIWDYCLYNPDEFGIDWQSLENRHVVLSETCMTLPELSKNTDQVLFE 121
            +   + +W++   I  Y  ++    G+   +     ++++E    L     N  Q LFE
Sbjct: 103 FDGPLVVNWDMVEDILQYTFHH---LGVQPDNGVTNPIIINEKLACLQSQRSNWYQTLFE 159

Query: 122 EYEVDSLYKAPTAAYIPFYTTNENIKTISGKSDHGELDIEEKIEAGKEYNDFSLVIDSGF 181
            + V  +  A     + FY  N       G S  G                  +VID G+
Sbjct: 160 SFGVPKVSMA-VEGMLAFYGHN-------GGSSTG------------------IVIDCGY 193

Query: 182 NCTWVIPIVKGVPYYKAVKKLDVGGR----FLNGLL 213
             T VIPIV+G       K+++ GG     +L+ LL
Sbjct: 194 EDTNVIPIVEGQGMMLDAKRINWGGHSSIDYLSNLL 229

>KLTH0C02508g Chr3 (224722..226077) [1356 bp, 451 aa] {ON} highly
           similar to uniprot|P47117 Saccharomyces cerevisiae
           YJR065C ARP3 Essential component of the Arp2/3 complex
           which is a highly conserved actin nucleation center
           required for the motility and integrity of actin patches
           involved in endocytosis and membrane growth and polarity
          Length = 451

 Score = 62.4 bits (150), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 88/373 (23%), Positives = 150/373 (40%), Gaps = 78/373 (20%)

Query: 61  PHELGQLTSWELESCIWDYCLYNPDEFGIDWQSLENRHVVLSETCMTLPELSKNTDQVLF 120
           P   GQ+ +W+     W+  +     F       E+   +L+E  +  PE  +   ++ F
Sbjct: 117 PIRHGQVENWDHMERFWENSI-----FKYLRTEPEDHFFLLTEPPLNPPENREQVAEIFF 171

Query: 121 EEYEVDSLY--KAPTAAYIPFYTTNENI-KTISGKSDHGELDIEEKIEAGKEYNDFSLVI 177
           E +    LY       A    +T+++ + ++++G                        VI
Sbjct: 172 ESFNCAGLYIAVQAVLALAASWTSSKVVDRSLTGT-----------------------VI 208

Query: 178 DSGFNCTWVIPIVKGVPYYKAVKKLDVGGR----FLNGLLKETISFRHYNVMDESI-LVN 232
           DSG   T VIP+ +G     A+K + + GR    F+  LL+E          D ++    
Sbjct: 209 DSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDITLFIQSLLRER------GEEDTTLRTAE 262

Query: 233 NIKEQCLYV--DPVSYFEAFKAKGKNKIDFVLPDFQTSFQGYVRDPKTALPDNAQILTLT 290
            IK++  YV  D V  F  F    +    F++ + + +                +++ + 
Sbjct: 263 RIKQEYCYVCSDIVKEFNKFDRDPQKFAQFIVENSEKT--------------KRKVIDVG 308

Query: 291 DERFSVPEAFFHPEISQS--LKPGIIETVLESIYMLPELLRPLMASNIVCMGGNFNLPGF 348
            ERF  PE FF+PEI+ S  L P +   V ++I   P  +R  + +NIV  GG+     F
Sbjct: 309 YERFLAPEIFFNPEIASSDFLTP-LPTVVDQTIQACPIDVRKGLYNNIVLSGGSTMFKDF 367

Query: 349 TDRLVSELQRQLPTDWVCRAKISSGDKSLTG---------------WTAMAKFAHTDAYK 393
             RL  +L + +  + +  ++  SG KS TG               W   +  A T  +K
Sbjct: 368 GRRLQRDL-KGIVNNRIALSEHLSGTKS-TGVDVQVISHRRQRNAVWFGGSLLAQTAEFK 425

Query: 394 KARVTKEDYFEHG 406
               TK+DY E G
Sbjct: 426 SYCHTKQDYEEIG 438

>KLLA0F03421g Chr6 complement(321000..323243) [2244 bp, 747 aa] {ON}
           similar to uniprot|P53946 Saccharomyces cerevisiae
           YNL059C ARP5 Nuclear actin-related protein involved in
           chromatin remodeling component of chromatin-remodeling
           enzyme complexes
          Length = 747

 Score = 62.4 bits (150), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 45/144 (31%), Positives = 63/144 (43%), Gaps = 12/144 (8%)

Query: 287 LTLTDERFSVPEAFFHPEISQSLKPGIIETV---------LESIYMLPELLRPLMASNIV 337
           L L  ER   PE  F P +    + GI E             S  +  + L   MASNI 
Sbjct: 606 LHLNIERIRAPEVIFQPSMGGLDQAGIAELADGILTKKFGSGSSKLSQQCLD--MASNIF 663

Query: 338 CMGGNFNLPGFTDRLVSELQRQLPTDWVCRAKISSGDKSLTGWTAMAKFAHTDAYKKARV 397
             GGN  +P   +R+V+E    LP +       +  + SL  W  MAKFA +D Y    V
Sbjct: 664 ITGGNTKIPNLRERIVNEFTGFLPVNTPLNVNYAQ-NVSLDAWKGMAKFARSDTYSSTCV 722

Query: 398 TKEDYFEHGLDWTTKERFGYQNWV 421
           TK +Y E G ++  + + G   +V
Sbjct: 723 TKVEYEEFGPNYIKEHKLGNVRFV 746

 Score = 44.7 bits (104), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 48/221 (21%), Positives = 87/221 (39%), Gaps = 36/221 (16%)

Query: 7   IVIDNGSYQVKFGLASEVRP------RVALNALAKDKYGVTHLSNQVQNIKDISSVVFRR 60
           I +D GSY+V+ G  S+  P      ++      K +  +T + N   ++ +      R 
Sbjct: 42  IALDFGSYEVRAGFTSQDTPSHVFPTKIVRYKERKIQKALTFIGNDC-SLDNAVRSHSRS 100

Query: 61  PHELGQLTSWELESCIWDYCLYNPDEFGIDWQSLENRHVVLSETCMTLPELSKNTDQVLF 120
           P++   +T+WE    +  Y  ++    G+      +  ++L+E   T+     N  Q+LF
Sbjct: 101 PYDGSLITNWEYMEDMLSYTFHH---LGVQPNDGISNPMILTEKMATVQAQRSNWYQLLF 157

Query: 121 EEYEVDSLYKAPTAAYIPFYTTNENIKTISGKSDHGELDIEEKIEAGKEYNDFSLVIDSG 180
           E Y +  +       +  FY  N    T                          L+I+SG
Sbjct: 158 ECYGIPQVTFGIDGLF-SFYANNSPDST-------------------------GLIINSG 191

Query: 181 FNCTWVIPIVKGVPYYKAVKKLDVGGRFLNGLLKETISFRH 221
              T +IP++KG       K++D GG      LK  +S ++
Sbjct: 192 HEDTNIIPVIKGKGILSEAKRIDWGGNQSIDYLKSLLSLKY 232

>Kwal_27.9958 s27 (139638..140975) [1338 bp, 445 aa] {ON} YJR065C
           (ARP3) - involved in the function of the actin
           cytoskeleton [contig 43] FULL
          Length = 445

 Score = 61.2 bits (147), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 88/378 (23%), Positives = 153/378 (40%), Gaps = 88/378 (23%)

Query: 61  PHELGQLTSWE-----LESCIWDYCLYNPDEFGIDWQSLENRHVVLSETCMTLPELSKNT 115
           P   GQ+ +W+      E+ I+ Y    P          E+ + +L+E  +  PE  +  
Sbjct: 111 PIRHGQVENWDHMERFWENSIFKYLRTEP----------EDHYFLLTEPPLNPPENREQV 160

Query: 116 DQVLFEEYEVDSLY--KAPTAAYIPFYTTNENI-KTISGKSDHGELDIEEKIEAGKEYND 172
            ++ FE +    LY       A    +T+++ + ++++G                     
Sbjct: 161 AEIFFESFNCAGLYIAVQAVLALAASWTSSKVVDRSLTGT-------------------- 200

Query: 173 FSLVIDSGFNCTWVIPIVKGVPYYKAVKKLDVGGR----FLNGLLKETISFRHYNVMDES 228
              VIDSG   T VIP+ +G     A+K + + GR    F+  LL+E          D +
Sbjct: 201 ---VIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDITLFIQSLLRER------GEEDTT 251

Query: 229 I-LVNNIKEQCLYV--DPVSYFEAFKAKGKNKIDFVLPDFQTSFQGYVRDPKTALPDNAQ 285
           +     IK++  YV  D V  F  F    +    F++ + + +                +
Sbjct: 252 LRTAERIKQEYCYVCSDIVKEFNKFDRDSEKFAQFIVENSEKT--------------RRK 297

Query: 286 ILTLTDERFSVPEAFFHPEISQS--LKPGIIETVLESIYMLPELLRPLMASNIVCMGGNF 343
           ++ +  ERF  PE FF+PEI+ S  L P +   V ++I   P  +R  + +NIV  GG+ 
Sbjct: 298 VIDVGYERFLAPEIFFNPEIASSDFLTP-LPTIVDQTIQACPIDVRKGLYNNIVLSGGST 356

Query: 344 NLPGFTDRLVSELQRQLPTDWVCRAKISSGDKSLTG---------------WTAMAKFAH 388
               F  RL  +L + +  + +  ++  SG KS TG               W   +  A 
Sbjct: 357 MFKDFGRRLQRDL-KGIVNNRIALSEHLSGTKS-TGVDVQVISHRRQRNAVWFGGSLLAE 414

Query: 389 TDAYKKARVTKEDYFEHG 406
           T  ++    +K+DY E G
Sbjct: 415 TAEFRGYCHSKQDYEEIG 432

>Kpol_282.4 s282 (8483..9988) [1506 bp, 501 aa] {ON} (8483..9988)
           [1506 nt, 502 aa]
          Length = 501

 Score = 58.5 bits (140), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 34/109 (31%), Positives = 55/109 (50%), Gaps = 1/109 (0%)

Query: 308 SLKPGIIETVLESIYMLPELLRPLMASNIVCMGGNFNLPGFTDRLVSELQRQLPT-DWVC 366
           S+ PGI++ +  SI      LR  +A NIV  GG   +PGF+DRL+ EL ++LP   +  
Sbjct: 392 SVIPGIVDLIESSIMATDVDLRASLAHNIVLTGGTSCIPGFSDRLMLELNKKLPALKFRV 451

Query: 367 RAKISSGDKSLTGWTAMAKFAHTDAYKKARVTKEDYFEHGLDWTTKERF 415
                + ++    W   +  +    + +  V K++Y E G D   K+RF
Sbjct: 452 LTTGQTRERQYQAWLGGSILSSLGTFHQLWVGKQEYEESGADRLLKDRF 500

 Score = 41.2 bits (95), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 52/240 (21%), Positives = 89/240 (37%), Gaps = 60/240 (25%)

Query: 6   AIVIDNGSYQVKFGLASEVRPRVALNALAKDKYGVTHL-----------------SNQVQ 48
           A+VID GS+    G +    P+  L +     YG   L                 +N+ +
Sbjct: 16  AVVIDPGSFTTNIGYSGTDCPQAILPSY----YGEISLKEVASEGNEEIEENSASNNKSK 71

Query: 49  NIKDISSVVFRRP-HEL------GQLTSWELESCIWDYCLYNPDEFGIDWQSLENRHVVL 101
            I    S+ + R  +E+      G++  W+     WD+ L N     +  +S       L
Sbjct: 72  KIFGEQSINYPRADYEIKPIVKNGEVIDWDGAQEQWDWALKN----ALYLESNSGIPAFL 127

Query: 102 SETCMTLPELSKNTDQVLFEEYEVDSLYKAPTAAYIPFYTTNENIKTISGKSDHGELDIE 161
           +E      E  K + +VL E  + ++ Y +PT   I F +   N                
Sbjct: 128 TEPIWNTVENRKKSLEVLLEGLQFEACYLSPTPTCISFASGRPNC--------------- 172

Query: 162 EKIEAGKEYNDFSLVIDSGFNCTWVIPIVKGVPYYKAVKKLDVGGRFLNGLLKETISFRH 221
                        LV+D G +   V P++ G+   K+  +  + GRF+N  +KE +  R 
Sbjct: 173 -------------LVVDIGHDVASVSPVIDGMTLSKSSMRNFISGRFINEKIKEFLKPRE 219

>NCAS0G03050 Chr7 complement(560525..562756) [2232 bp, 743 aa] {ON}
           Anc_2.117 YHR129C
          Length = 743

 Score = 56.2 bits (134), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 42/124 (33%), Positives = 58/124 (46%), Gaps = 13/124 (10%)

Query: 287 LTLTDERFSVPEAFFHPEISQSLKPGIIE---TVL------ESIYMLPELLRPLMASNIV 337
           + L  ER  VPE  F P +    + GIIE   T+L      E   + P  L   MA+N+ 
Sbjct: 609 MHLNVERIRVPEILFQPSMGGQDQAGIIELCETILTKKFGSEQRKLSPTAL--AMANNLW 666

Query: 338 CMGGNFNLPGFTDRLVSELQRQLPTDWVCRAKISSGDKSLTGWTAMAKFA-HTDAYKKAR 396
             GGN  LPG  +R+V E    LP       K  S + SL  W  MAK   +++ YK   
Sbjct: 667 ITGGNSKLPGMKERIVKEFTGFLPVGTAFNVK-QSYNPSLDAWNGMAKLTLNSEDYKNTI 725

Query: 397 VTKE 400
           ++K+
Sbjct: 726 ISKK 729

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 53/217 (24%), Positives = 86/217 (39%), Gaps = 40/217 (18%)

Query: 7   IVIDNGSYQVKFGLASEVRP------RVALNALAKDKYGVTHLSNQVQNIKDISSVVFRR 60
           I ID GS Q++ G  ++  P      R+      K     T + N V   + I +   + 
Sbjct: 39  IAIDFGSSQIRAGYTNQSTPSHIFPNRLTRYRDRKINKTFTFIGNDVSLDQAIRTQS-KS 97

Query: 61  PHELGQLTSWELESCIWDYCLYNPDEFGIDWQSLENRHVVLSETCMTLPELSKNTDQVLF 120
           P +   +T+W+    I  Y     +  G+   +  +  ++L+E   TL     N  Q+LF
Sbjct: 98  PFDGSIITNWDYVEDIMQYIF---NHLGVVGHNGVSNPILLTEKLATLQSQRSNWYQLLF 154

Query: 121 EEYEVDSLYKAPTAAYIPFYTTNENIKTISGKSDHGELDIEEKIEAGKEYNDFSLVIDSG 180
           E +++  +     + +  FY  NE   T                          LVID G
Sbjct: 155 ECFDIPEVTLGIDSMF-AFYGLNERSST-------------------------GLVIDCG 188

Query: 181 FNCTWVIPIVKGVPYYKAVKKLDVGGR----FLNGLL 213
              T VIP+V+G       K+++ GGR    +LN LL
Sbjct: 189 NEETDVIPVVEGAGMLTDAKRINWGGRQAVDYLNDLL 225

>Ecym_6330 Chr6 (632900..634342) [1443 bp, 480 aa] {ON} similar to
           Ashbya gossypii AFR105C
          Length = 480

 Score = 54.7 bits (130), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 33/107 (30%), Positives = 55/107 (51%), Gaps = 5/107 (4%)

Query: 312 GIIETVLESIYMLPELLRPLMASNIVCMGGNFNLPGFTDRLVSELQRQLPTDWVCRAKIS 371
           G+ + +  SI      LR  +A N+V  GG+ ++PG TDR+++EL + LP   +    ++
Sbjct: 375 GLADLIHSSIMSTDVDLRTTLAHNVVITGGSSSIPGLTDRILAELNKSLPA--LKFRMLT 432

Query: 372 SG---DKSLTGWTAMAKFAHTDAYKKARVTKEDYFEHGLDWTTKERF 415
           SG   +K    W   +  A    + +  V K++Y E G D   K+RF
Sbjct: 433 SGQAREKQYQSWLGGSILASLGTFHQLWVGKQEYAEVGADRLLKDRF 479

 Score = 39.3 bits (90), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 65/335 (19%), Positives = 128/335 (38%), Gaps = 61/335 (18%)

Query: 6   AIVIDNGSYQVKFGLASEVRPRVALNALAKDKYGVTHLSNQVQNIKDISSVVF-RRPHEL 64
           AI+ID GS+    G +    P+  L +     YG      +  ++ +  S+   R+ +E+
Sbjct: 16  AIIIDPGSFNTNIGYSGTDCPQAILPSC----YGQYINDEEKPSLFNEQSIGLPRKDYEI 71

Query: 65  ------GQLTSWELESCIWDYCLYNPDEFGIDWQSLENRHVVLSETCMTLPELSKNTDQV 118
                 G++  W+     W++ + +   F    +S +    +L+E      +  K + +V
Sbjct: 72  KEIVRSGEVVDWDKAQEQWEWAIKSVLLF----ESNKGLPALLTEPIWNSEDNRKKSLEV 127

Query: 119 LFEEYEVDSLYKAPTAAYIPFYTTNENIKTISGKSDHGELDIEEKIEAGKEYNDFSLVID 178
           L E  + ++ Y  PTA  + F                                   LV+D
Sbjct: 128 LLEGMDFEACYLTPTATAVSFAMGRPTC----------------------------LVVD 159

Query: 179 SGFNCTWVIPIVKGVPYYKAVKKLDVGGRFLNGLLKETISFRH----YNVMD------ES 228
            G + T V P++ G+   K+  +  + G  LN L++ ++  R     + V        + 
Sbjct: 160 IGHDITSVSPVIDGMTLSKSSMRSFIAGGLLNELIRTSLKPREILPLFQVAKKRPEFVKR 219

Query: 229 ILVNNIKEQCL-YVDPVSYFEAFKAKGKNKIDFVLPDFQTSFQGYVRDPKTALPDNAQIL 287
                I    L +V+   +F+ FK          L  F++  +   +    A P    ++
Sbjct: 220 SFDYEIHPSLLNFVNERQFFQEFKETMLQVAPTSLTKFKSELEQLSKRSIEA-PWGEDLV 278

Query: 288 TLTDERFSVPEAFFHPEISQ------SLKPGIIET 316
             ++ RF++ E  F PE ++        K G++ET
Sbjct: 279 FDSETRFNIAEQLFRPETAKFPEDWPISKDGVVET 313

>AFR105C Chr6 complement(625098..626537) [1440 bp, 479 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YJL081C
           (ARP4)
          Length = 479

 Score = 54.7 bits (130), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 33/107 (30%), Positives = 53/107 (49%), Gaps = 5/107 (4%)

Query: 312 GIIETVLESIYMLPELLRPLMASNIVCMGGNFNLPGFTDRLVSELQRQLPTDWVCRAKIS 371
           G+ + +  SI      LR  ++ N+V  GG  +LPG  DR+ +EL R LP   +    ++
Sbjct: 374 GLADLIYSSIMSTDVDLRTTLSHNVVITGGTSSLPGLMDRISAELNRSLPA--LKFRMLT 431

Query: 372 SG---DKSLTGWTAMAKFAHTDAYKKARVTKEDYFEHGLDWTTKERF 415
           SG   ++   GW   +  A    + +  V K++Y E G D   K+RF
Sbjct: 432 SGQLRERQYQGWLGGSILASLGTFHQLWVGKQEYAEVGADRLLKDRF 478

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 47/221 (21%), Positives = 84/221 (38%), Gaps = 42/221 (19%)

Query: 6   AIVIDNGSYQVKFGLASEVRPRVALNALAKDKYGVTHLSNQVQNIKDISSVVFRRPHEL- 64
           A+VID GS+    G +    P+  L +     YG      + +   + S  + R+ +E+ 
Sbjct: 16  AVVIDPGSFTTNIGYSGTDCPQAILPSC----YGKYTEGEKDELFSEQSIGLPRKDYEIH 71

Query: 65  -----GQLTSWELESCIWDYCLYNPDEFGIDWQSLENRHVVLSETCMTLPELSKNTDQVL 119
                G++  WE     WD+ + +   F    ++      +L+E      E  K + +VL
Sbjct: 72  NIVQNGEVVDWEKAEKQWDWAIRSELRF----ETNSGMPALLTEPIWNSEENRKKSLEVL 127

Query: 120 FEEYEVDSLYKAPTAAYIPFYTTNENIKTISGKSDHGELDIEEKIEAGKEYNDFSLVIDS 179
            E  +  + Y  PTA  + F                                   LV+D 
Sbjct: 128 LESMDFSACYLVPTATAVSFAMGRPTC----------------------------LVVDI 159

Query: 180 GFNCTWVIPIVKGVPYYKAVKKLDVGGRFLNGLLKETISFR 220
           G + T V P+V G+   K+  +  + G  LN L++  ++ R
Sbjct: 160 GHDVTSVCPVVDGMTLSKSSMRSYIAGSLLNELIRSQLAPR 200

>Suva_6.154 Chr6 (266531..268000) [1470 bp, 489 aa] {ON} YJL081C
           (REAL)
          Length = 489

 Score = 53.5 bits (127), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 54/219 (24%), Positives = 89/219 (40%), Gaps = 43/219 (19%)

Query: 6   AIVIDNGSYQVKFGLASEVRPRVALNALAKDKYGVTHLSNQVQNIKDISSV-VFRRPHEL 64
           A+VID GSY    G +    P+  L ++    YG +      + I    S+ + R+ +EL
Sbjct: 16  AVVIDPGSYTTNIGYSGSDFPQSILPSV----YGKSTSDKDSKTIFSEQSIGIPRKDYEL 71

Query: 65  ------GQLTSWELESCIWDYCLYNPDEFGIDWQSLENRHVVLSETCMTLPELSKNTDQV 118
                 G +  W+     W + L N  E  +D  S      +L+E      E  K + +V
Sbjct: 72  KPIIENGLVIDWDTAQEQWQWALKN--ELYLDSNS--GIPALLTEPVWNSTENRKKSLEV 127

Query: 119 LFEEYEVDSLYKAPTAAYIPFYTTNENIKTISGKSDHGELDIEEKIEAGKEYNDFSLVID 178
           L E  + ++ Y APT+  + F     N                             LV+D
Sbjct: 128 LLEGMQFEACYLAPTSTCVSFAAGRPNC----------------------------LVVD 159

Query: 179 SGFNCTWVIPIVKGVPYYKAVKKLDVGGRFLNGLLKETI 217
            G +   V PIV G+   K+ ++  + G+F+N L+K+ I
Sbjct: 160 IGHDTCSVSPIVDGMTLSKSTRRNFIAGKFINHLIKKAI 198

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 29/105 (27%), Positives = 51/105 (48%), Gaps = 1/105 (0%)

Query: 312 GIIETVLESIYMLPELLRPLMASNIVCMGGNFNLPGFTDRLVSELQRQLPT-DWVCRAKI 370
           G+ + V  SI      LR  +A N+V  GG  ++PG +DRL++EL + LP+  +      
Sbjct: 384 GLADLVYSSIMSSDVDLRATLAHNVVLTGGTSSIPGLSDRLMTELNKILPSLKFRILTTG 443

Query: 371 SSGDKSLTGWTAMAKFAHTDAYKKARVTKEDYFEHGLDWTTKERF 415
            + ++    W   +       + +  V K++Y E G+D    +RF
Sbjct: 444 HTRERQYQSWLGGSILTSLGTFHQLWVGKQEYEEVGVDRLLNDRF 488

>KLLA0D02288g Chr4 complement(194724..196286) [1563 bp, 520 aa] {ON}
           similar to uniprot|P80428 Saccharomyces cerevisiae
           YJL081C ARP4 Nuclear actin-related protein involved in
           chromatin remodeling component of chromatin-remodeling
           enzyme complexes
          Length = 520

 Score = 53.5 bits (127), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 32/107 (29%), Positives = 55/107 (51%), Gaps = 5/107 (4%)

Query: 312 GIIETVLESIYMLPELLRPLMASNIVCMGGNFNLPGFTDRLVSELQRQLPTDWVCRAKIS 371
           GI++ + +S+      LR  +A N+V  GG   +PG +DR++ EL + LP   +    +S
Sbjct: 415 GIVDLINKSMMEADVDLRATLAHNVVLTGGTSKIPGLSDRIMHELNKSLPA--LKFRMLS 472

Query: 372 SG---DKSLTGWTAMAKFAHTDAYKKARVTKEDYFEHGLDWTTKERF 415
           SG   ++   GW   +  A    + +  V +E+Y E G +   K+RF
Sbjct: 473 SGHLRERQYQGWLGGSILASLGTFHQLWVGREEYEEVGPERLLKDRF 519

 Score = 44.7 bits (104), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 64/319 (20%), Positives = 122/319 (38%), Gaps = 61/319 (19%)

Query: 6   AIVIDNGSYQVKFGLASEVRPRVALNALAKDKYGVTHLSNQVQNIKDISSVVFRRPH--- 62
           AIVID GS+    G +    P+    ++    YG        + I +   ++F R     
Sbjct: 16  AIVIDPGSFVTNIGYSGTDCPQ----SIMPSSYGNVETDGDTKRIFNEQPLLFPRAGMEI 71

Query: 63  ----ELGQLTSWELESCIWDYCLYNPDEFGIDWQSLENRHVVLSETCMTLPELSKNTDQV 118
               E   +  W+     W+Y L N D   + ++S +   V+L+E         K + ++
Sbjct: 72  KPIVENSTIVDWDRAQEQWEYAL-NTD---LKFESNKGTPVLLTEPIWNSEASRKKSLEI 127

Query: 119 LFEEYEVDSLYKAPTAAYIPFYTTNENIKTISGKSDHGELDIEEKIEAGKEYNDFSLVID 178
           L E  E ++ Y A  ++ + F                                   LV+D
Sbjct: 128 LLESMEFEACYLAANSSAVSFAMGRPTC----------------------------LVVD 159

Query: 179 SGFNCTWVIPIVKGVPYYKAVKKLDVGGRFLNGLLKETISFRH----YNVMDES------ 228
            G + + V P++ G+   K+  +  V G++LN L+ + +  R     + V+ +       
Sbjct: 160 IGHDVSTVSPVIDGMTLSKSSTRNYVAGKYLNHLIAKNLKPREIVPIFQVLKKKPDFVKR 219

Query: 229 ILVNNIKEQCL-YVDPVSYFEAFKAKGKNKIDFVLPDFQTSFQG-YVRDPKTAL--PDNA 284
            L  ++ E  + + +   +F+ F    K  +  + P   +SF+       K +L  P   
Sbjct: 220 TLSFDVNESVINFANERQFFQEF----KETLLHIAPKSLSSFKDELATQTKRSLEAPWGE 275

Query: 285 QILTLTDERFSVPEAFFHP 303
           +++   D R+S  E  F P
Sbjct: 276 ELIFDADTRYSFAEQLFRP 294

>TPHA0I01030 Chr9 complement(236150..237661) [1512 bp, 503 aa] {ON}
           Anc_1.287 YJL081C
          Length = 503

 Score = 53.1 bits (126), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 31/113 (27%), Positives = 55/113 (48%), Gaps = 1/113 (0%)

Query: 304 EISQSLKPGIIETVLESIYMLPELLRPLMASNIVCMGGNFNLPGFTDRLVSELQRQLPT- 362
           E  + + PGI++ +  SI      LR  +A N+V  GG   +PG +DR++ EL ++LP  
Sbjct: 390 EEKEKIIPGIVDLIESSINAADVDLRTSLAHNVVLTGGTSCIPGLSDRILLELNKRLPAL 449

Query: 363 DWVCRAKISSGDKSLTGWTAMAKFAHTDAYKKARVTKEDYFEHGLDWTTKERF 415
            +   A   + ++    W   +  +    + +  V K++Y E G D    +RF
Sbjct: 450 KFRVLANGQTRERQYQSWLGGSILSSLGTFHQLWVGKQEYEEIGADRLLTDRF 502

 Score = 38.9 bits (89), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 50/246 (20%), Positives = 94/246 (38%), Gaps = 66/246 (26%)

Query: 6   AIVIDNGSYQVKFGLASEVRPRVALNALAKDKYG-VTHLSNQ-----------VQNIKDI 53
           A+VID GS+    G +    P+  L +     YG +T + +Q             N ++ 
Sbjct: 16  AVVIDPGSFTTNIGFSGSDYPQSILPSC----YGAITEIEDQQADHNKPDESAANNTENA 71

Query: 54  SSVVFRR---------PH---------ELGQLTSWELESCIWDYCLYNPDEFGIDWQSLE 95
           S +  R+         P          + G++  W+     W + L N     +  +S E
Sbjct: 72  SKIKIRKVFNEQSVGYPRANYEIKPIVQNGEVVDWDAAQEQWSWALENE----LFLKSNE 127

Query: 96  NRHVVLSETCMTLPELSKNTDQVLFEEYEVDSLYKAPTAAYIPFYTTNENIKTISGKSDH 155
               +L+E      E  K + +VL E    ++ Y + T   + F          +G+S+ 
Sbjct: 128 GVPALLTEPIWNTVENRKKSLEVLLEGMGFEACYLSATPTCVSF---------AAGRSN- 177

Query: 156 GELDIEEKIEAGKEYNDFSLVIDSGFNCTWVIPIVKGVPYYKAVKKLDVGGRFLNGLLKE 215
                              LV+D G +   V P+V G+ + K+ ++  + G++LN L+ +
Sbjct: 178 ------------------CLVVDIGHDIISVSPVVDGMTFSKSTRRNVISGKYLNVLIND 219

Query: 216 TISFRH 221
            +  R 
Sbjct: 220 FLKPRE 225

>Kwal_14.2377 s14 complement(733179..734624) [1446 bp, 481 aa] {ON}
           YJL081C (ARP4) - 54.8 kDa actin-related protein [contig
           225] FULL
          Length = 481

 Score = 52.4 bits (124), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 49/221 (22%), Positives = 84/221 (38%), Gaps = 38/221 (17%)

Query: 6   AIVIDNGSYQVKFGLASEVRPRVALNA-----LAKDKYGVTHLSNQVQNIKDISSVVFRR 60
           A+VID GSY    G +    P++ + +        +K G    ++Q   +        +R
Sbjct: 16  AVVIDPGSYSTNIGYSGTDSPQINIPSSYGQYTGGEKEGKKSFNDQFMGMAR-PDFEIKR 74

Query: 61  PHELGQLTSWELESCIWDYCLYNPDEFGIDWQSLENRHVVLSETCMTLPELSKNTDQVLF 120
             E G +  WE     W + + +  +FG    S +     L+E      E  K + +VL 
Sbjct: 75  ILEDGCVVDWEAAQEQWTWAIRDELKFG----SFKGTPAFLTEAIWNSEENRKKSLEVLL 130

Query: 121 EEYEVDSLYKAPTAAYIPFYTTNENIKTISGKSDHGELDIEEKIEAGKEYNDFSLVIDSG 180
           E  E ++ Y APTA  + F                                   LV+D G
Sbjct: 131 EGMEFEACYIAPTATCVSFAMGRPTC----------------------------LVVDIG 162

Query: 181 FNCTWVIPIVKGVPYYKAVKKLDVGGRFLNGLLKETISFRH 221
            +   V P+V G+   K+  +  + G+ LN L+++ +  R 
Sbjct: 163 HDVASVCPVVDGMTLSKSSTRNFLAGKLLNKLIEKHLEPRE 203

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 25/91 (27%), Positives = 48/91 (52%), Gaps = 5/91 (5%)

Query: 328 LRPLMASNIVCMGGNFNLPGFTDRLVSELQRQLPTDWVCRAKISSG---DKSLTGWTAMA 384
           LR  +A N+V  GG+ ++ G  DRL++EL ++LP   +    ++SG   ++    W   +
Sbjct: 392 LRATLAHNLVVTGGSSSILGLADRLMTELNKKLPA--LKFRILTSGHLRERQSRAWLGGS 449

Query: 385 KFAHTDAYKKARVTKEDYFEHGLDWTTKERF 415
             +    + +  V +++Y E G +   K+RF
Sbjct: 450 ILSSLGTFHQLWVGRQEYEEVGAERLLKDRF 480

>Skud_10.132 Chr10 complement(251748..253214) [1467 bp, 488 aa] {ON}
           YJL081C (REAL)
          Length = 488

 Score = 51.6 bits (122), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 53/219 (24%), Positives = 90/219 (41%), Gaps = 43/219 (19%)

Query: 6   AIVIDNGSYQVKFGLASEVRPRVALNALAKDKYG-VTHLSNQVQNIKDISSVVFRRPHEL 64
           A+VID GSY    G +    P+  L ++    YG +T   N  +   + S  + R+ +EL
Sbjct: 16  AVVIDPGSYTTNIGYSGSDFPQSILPSV----YGKLTADENSKKMFSEQSIGIPRKDYEL 71

Query: 65  ------GQLTSWELESCIWDYCLYNPDEFGIDWQSLENRHVVLSETCMTLPELSKNTDQV 118
                 G +  W+     W + L N  E  +D  S      +L+E      E  K + +V
Sbjct: 72  KPIIENGLVIDWDTAQEQWQWALRN--ELYLDSNS--GIPALLTEPVWNSMENRKKSLEV 127

Query: 119 LFEEYEVDSLYKAPTAAYIPFYTTNENIKTISGKSDHGELDIEEKIEAGKEYNDFSLVID 178
           L E  + ++ Y APT+  + F     N                             LV+D
Sbjct: 128 LLEGMQFEACYLAPTSTCVSFAAGRPNC----------------------------LVVD 159

Query: 179 SGFNCTWVIPIVKGVPYYKAVKKLDVGGRFLNGLLKETI 217
            G +   V PIV G+   K+ ++  + G+F+N L+++ +
Sbjct: 160 IGHDTCSVSPIVDGMTLSKSTRRNFIAGKFINHLIQKAL 198

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 29/107 (27%), Positives = 53/107 (49%), Gaps = 5/107 (4%)

Query: 312 GIIETVLESIYMLPELLRPLMASNIVCMGGNFNLPGFTDRLVSELQRQLPTDWVCRAKIS 371
           G+   V  SI      LR  +A N+V  GG  ++PG +DRL++EL + LP+  +    ++
Sbjct: 383 GLAGLVYSSIMSSDVDLRATLAHNVVLTGGTSSIPGLSDRLMTELNKILPS--LKFRILT 440

Query: 372 SG---DKSLTGWTAMAKFAHTDAYKKARVTKEDYFEHGLDWTTKERF 415
           +G   ++    W   +       + +  V K++Y E G++    +RF
Sbjct: 441 TGHIRERQYQSWLGGSILTSLGTFHQLWVGKQEYEEVGIERLLNDRF 487

>KAFR0A01560 Chr1 complement(311746..313203) [1458 bp, 485 aa] {ON}
           Anc_1.287 YJL081C
          Length = 485

 Score = 51.6 bits (122), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 45/168 (26%), Positives = 77/168 (45%), Gaps = 16/168 (9%)

Query: 259 DFVLPDFQTSFQGYVRDPKTALPDNAQILTLTDERFS--------VPEAFFHPEISQSLK 310
           D+V P  +T   G V+  K + P N+   ++T E           + E+    EI++   
Sbjct: 322 DYV-PVKRTKPSGSVKSNKDSTPQNSVEPSITAEPLDETNENGKRIIES--SSEITKGSL 378

Query: 311 PGIIETVLESIYMLPELLRPLMASNIVCMGGNFNLPGFTDRLVSELQRQLPTDWVCRAKI 370
            G+ + V  SI      LR  +A N+V  GG   +PG +DRL++EL  +LP   +    I
Sbjct: 379 LGVADLVHSSIMASDVDLRATLAHNVVLTGGTSTIPGLSDRLMAELNSRLPA--LKFRMI 436

Query: 371 SSG---DKSLTGWTAMAKFAHTDAYKKARVTKEDYFEHGLDWTTKERF 415
           ++G   ++    W   +       + +  V KE+Y + G+D    +RF
Sbjct: 437 TTGHTRERQYQSWLGGSVLTSLGTFHQLWVGKEEYQDVGVDRLLADRF 484

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 50/220 (22%), Positives = 84/220 (38%), Gaps = 39/220 (17%)

Query: 6   AIVIDNGSYQVKFGLASEVRPRVALNALAKDKYGVTHLSNQVQNIKDISSVVF-RRPHEL 64
           A+VID GSY    G +    P+  L +   D         + + +    S+   R+ +E+
Sbjct: 16  AVVIDPGSYSTNIGYSGTDCPQAILPSCYGDYTNTDDPEGKKKKVFSEQSICIPRKDYEI 75

Query: 65  ------GQLTSWELESCIWDYCLYNPDEFGIDWQSLENRHVVLSETCMTLPELSKNTDQV 118
                 G +  W+     W + L N     +  +S      +L+E      E  K + ++
Sbjct: 76  KPIVENGVVIDWDAAQEQWSWALENQ----LYLRSNSGIPALLTEPIWNTVENRKKSLEL 131

Query: 119 LFEEYEVDSLYKAPTAAYIPFYTTNENIKTISGKSDHGELDIEEKIEAGKEYNDFSLVID 178
           L E  + ++ Y A T   + F T         G+S                     LV+D
Sbjct: 132 LLEGMDFEACYLASTPTCVSFGT---------GRSS-------------------CLVVD 163

Query: 179 SGFNCTWVIPIVKGVPYYKAVKKLDVGGRFLNGLLKETIS 218
            G +   V P+V G+   K+ K+    G +LN L+K  IS
Sbjct: 164 LGHDTCSVSPVVDGMTLSKSTKRNFFAGGYLNELIKNYIS 203

>Smik_10.161 Chr10 complement(275455..276924) [1470 bp, 489 aa] {ON}
           YJL081C (REAL)
          Length = 489

 Score = 51.6 bits (122), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 53/219 (24%), Positives = 89/219 (40%), Gaps = 43/219 (19%)

Query: 6   AIVIDNGSYQVKFGLASEVRPRVALNALAKDKYGVTHLSNQVQNIKDISSV-VFRRPHEL 64
           A+VID GSY    G +    P+  L ++    YG        +NI    S+ + R+ +EL
Sbjct: 16  AVVIDPGSYTTNIGYSGSDFPQSILPSV----YGKYTADEGKKNIFSEQSIGIPRKDYEL 71

Query: 65  ------GQLTSWELESCIWDYCLYNPDEFGIDWQSLENRHVVLSETCMTLPELSKNTDQV 118
                 G +  W+     W + L N  E  ++  S      +L+E      E  K + +V
Sbjct: 72  KPIVKDGLVIDWDTAQEQWQWALKN--ELYLNSNS--GTPALLTEPVWNSTENRKKSLEV 127

Query: 119 LFEEYEVDSLYKAPTAAYIPFYTTNENIKTISGKSDHGELDIEEKIEAGKEYNDFSLVID 178
           L E  + ++ Y APT+  + F     N                             LV+D
Sbjct: 128 LLEGMQFEACYLAPTSTCVSFAAGRPNC----------------------------LVVD 159

Query: 179 SGFNCTWVIPIVKGVPYYKAVKKLDVGGRFLNGLLKETI 217
            G +   V PIV G+   K+ ++  + G+F+N L+K+ +
Sbjct: 160 IGHDTCSVSPIVDGMTLSKSTRRNFLAGKFINHLIKKAL 198

 Score = 44.3 bits (103), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 28/105 (26%), Positives = 49/105 (46%), Gaps = 1/105 (0%)

Query: 312 GIIETVLESIYMLPELLRPLMASNIVCMGGNFNLPGFTDRLVSELQRQLPT-DWVCRAKI 370
           G+   V  SI      LR  +A N+V  GG   +PG +DRL++EL + LP+  +      
Sbjct: 384 GLAHLVYSSIMSSDVDLRATLAHNVVLTGGTSLIPGLSDRLMTELNKILPSLKFRILTTG 443

Query: 371 SSGDKSLTGWTAMAKFAHTDAYKKARVTKEDYFEHGLDWTTKERF 415
            + ++    W   +       + +  V K++Y E G++    +RF
Sbjct: 444 HTMERQYQSWLGGSILTSLGTFHQLWVGKKEYEEVGVERLLNDRF 488

>TDEL0D01550 Chr4 complement(305973..307415) [1443 bp, 480 aa] {ON}
           Anc_1.287 YJL081C
          Length = 480

 Score = 50.4 bits (119), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 33/107 (30%), Positives = 54/107 (50%), Gaps = 5/107 (4%)

Query: 312 GIIETVLESIYMLPELLRPLMASNIVCMGGNFNLPGFTDRLVSELQRQLPTDWVCRAKIS 371
           G  + V  SI      LR  +A NIV  GG  ++PGF+DRL+SEL ++LP   +    ++
Sbjct: 375 GAADLVNASILASDVDLRATLAHNIVLTGGTSSIPGFSDRLMSELNKKLPA--LKFRILT 432

Query: 372 SG---DKSLTGWTAMAKFAHTDAYKKARVTKEDYFEHGLDWTTKERF 415
           +G   ++    W   +      ++ +  V K++Y E G D    +RF
Sbjct: 433 TGHLRERQYQAWLGGSILTSLGSFHQLWVGKQEYEEVGPDRLLSDRF 479

>SAKL0D05874g Chr4 complement(479873..481366) [1494 bp, 497 aa] {ON}
           similar to uniprot|P80428 Saccharomyces cerevisiae
           YJL081C ARP4 Nuclear actin-related protein involved in
           chromatin remodeling component of chromatin-remodeling
           enzyme complexes
          Length = 497

 Score = 50.4 bits (119), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 30/107 (28%), Positives = 53/107 (49%), Gaps = 5/107 (4%)

Query: 312 GIIETVLESIYMLPELLRPLMASNIVCMGGNFNLPGFTDRLVSELQRQLPTDWVCRAKIS 371
           G+ + +  SI      LR  +A N+V  GG  ++PG TDR+++EL + LP   +    ++
Sbjct: 392 GLTDLIYSSIMATDVDLRATLAHNVVVTGGTSSIPGLTDRIMAELNKSLPA--LKFRMLT 449

Query: 372 SG---DKSLTGWTAMAKFAHTDAYKKARVTKEDYFEHGLDWTTKERF 415
           SG   ++    W   +  +    + +  V K++Y E G     K+RF
Sbjct: 450 SGHLKERQYQSWLGGSILSSLGTFHQLWVGKQEYEEVGASRLLKDRF 496

 Score = 34.3 bits (77), Expect = 0.63,   Method: Compositional matrix adjust.
 Identities = 46/233 (19%), Positives = 83/233 (35%), Gaps = 57/233 (24%)

Query: 6   AIVIDNGSYQVKFGLASEVRPRVALNALAKDKYG-------VTHLSNQVQNIKDISSVVF 58
           A+VID GSY    G +    P+V L +    +YG             Q ++ + +   VF
Sbjct: 16  AVVIDPGSYTTNIGYSGTDCPQVTLPS----RYGQYISEEEEKDEQEQQEDDRKLKQKVF 71

Query: 59  --------RRPHEL------GQLTSWELESCIWDYCLYNPDEFGIDWQSLENRHVVLSET 104
                   R  +++      G +  W+     W + +    +  + ++S +     L+E 
Sbjct: 72  SEQSIGLPRNNYQIKPIVRNGSVIDWDSAQEQWSWAI----QHELHFESTKGMPAFLTEP 127

Query: 105 CMTLPELSKNTDQVLFEEYEVDSLYKAPTAAYIPFYTTNENIKTISGKSDHGELDIEEKI 164
                E  K + +VL E  E ++ + +PT   + F                         
Sbjct: 128 IWNTEENRKKSLEVLLENMEFEACFLSPTPTCVSFAMGRPTC------------------ 169

Query: 165 EAGKEYNDFSLVIDSGFNCTWVIPIVKGVPYYKAVKKLDVGGRFLNGLLKETI 217
                     LV+D G +   V P+V G+   K+     + G  LN LL + +
Sbjct: 170 ----------LVVDIGHDVCSVSPVVDGMTLSKSSTSNFIAGSLLNALLSKQL 212

>YJL081C Chr10 complement(283802..285271) [1470 bp, 489 aa] {ON}
           ARP4Nuclear actin-related protein involved in chromatin
           remodeling, component of chromatin-remodeling enzyme
           complexes
          Length = 489

 Score = 49.7 bits (117), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 51/218 (23%), Positives = 90/218 (41%), Gaps = 41/218 (18%)

Query: 6   AIVIDNGSYQVKFGLASEVRPRVALNALAKDKYGVTHLSNQVQNIKDISSVVFRRPHEL- 64
           A+VID GSY    G +    P+  L ++   KY     + ++ + + I   + R+ +EL 
Sbjct: 16  AVVIDPGSYTTNIGYSGSDFPQSILPSVY-GKYTADEGNKKIFSEQSIG--IPRKDYELK 72

Query: 65  -----GQLTSWELESCIWDYCLYNPDEFGIDWQSLENRHVVLSETCMTLPELSKNTDQVL 119
                G +  W+     W + L N  E  ++  S      +L+E      E  K + +VL
Sbjct: 73  PIIENGLVIDWDTAQEQWQWALQN--ELYLNSNS--GIPALLTEPVWNSTENRKKSLEVL 128

Query: 120 FEEYEVDSLYKAPTAAYIPFYTTNENIKTISGKSDHGELDIEEKIEAGKEYNDFSLVIDS 179
            E  + ++ Y APT+  + F     N                             LV+D 
Sbjct: 129 LEGMQFEACYLAPTSTCVSFAAGRPNC----------------------------LVVDI 160

Query: 180 GFNCTWVIPIVKGVPYYKAVKKLDVGGRFLNGLLKETI 217
           G +   V PIV G+   K+ ++  + G+F+N L+K+ +
Sbjct: 161 GHDTCSVSPIVDGMTLSKSTRRNFIAGKFINHLIKKAL 198

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 28/105 (26%), Positives = 51/105 (48%), Gaps = 1/105 (0%)

Query: 312 GIIETVLESIYMLPELLRPLMASNIVCMGGNFNLPGFTDRLVSELQRQLPT-DWVCRAKI 370
           G+ + V  SI      LR  +A N+V  GG  ++PG +DRL++EL + LP+  +      
Sbjct: 384 GLADLVYSSIMSSDVDLRATLAHNVVLTGGTSSIPGLSDRLMTELNKILPSLKFRILTTG 443

Query: 371 SSGDKSLTGWTAMAKFAHTDAYKKARVTKEDYFEHGLDWTTKERF 415
            + ++    W   +       + +  V K++Y E G++    +RF
Sbjct: 444 HTIERQYQSWLGGSILTSLGTFHQLWVGKKEYEEVGVERLLNDRF 488

>TBLA0D05360 Chr4 (1321243..1323033) [1791 bp, 596 aa] {ON}
           Anc_1.287 YJL081C
          Length = 596

 Score = 49.7 bits (117), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 39/144 (27%), Positives = 65/144 (45%), Gaps = 8/144 (5%)

Query: 276 PKTALPDNAQILTLTDERFSVPEAFFHPEISQSLKPGIIETVLESIYMLPELLRPLMASN 335
           P   + +N +      E   VP+     +I  ++ PGI + V  ++      LR  +A N
Sbjct: 456 PSENINENGKRSIEDGENVDVPKKSDKKDI-DNIIPGIADLVEATVNSSDVDLRATLAHN 514

Query: 336 IVCMGGNFNLPGFTDRLVSELQRQLPTDWVCRAKI-SSG---DKSLTGWTAMAKFAHTDA 391
           ++  GG   +PG  DRL+ EL ++LP     + +I SSG   ++    W   +       
Sbjct: 515 VILTGGTSLIPGLADRLMYELNKKLP---ALKFRILSSGHRRERKYQAWLGGSILTSLGT 571

Query: 392 YKKARVTKEDYFEHGLDWTTKERF 415
           + +  V K +Y E G D   K+RF
Sbjct: 572 FHQLWVGKREYEEVGPDRLLKDRF 595

 Score = 37.7 bits (86), Expect = 0.059,   Method: Compositional matrix adjust.
 Identities = 37/163 (22%), Positives = 67/163 (41%), Gaps = 32/163 (19%)

Query: 59  RRPHELGQLTSWELESCIWDYCLYNPDEFGIDWQSLENRHVVLSETCMTLPELSKNTDQV 118
           +R  E G +  W++    W + L   ++  +D  S +    +L+E      +  K + +V
Sbjct: 162 KRIIENGMVADWDIAEEQWSWALR--EKLYMD--SFKGIPALLTEPVWNTVQNRKKSLEV 217

Query: 119 LFEEYEVDSLYKAPTAAYIPFYTTNENIKTISGKSDHGELDIEEKIEAGKEYNDFSLVID 178
           L E+ E ++ Y           T   N+   +GK +                    LV+D
Sbjct: 218 LLEKMEFEACY---------LTTIPTNVSFAAGKPN-------------------CLVVD 249

Query: 179 SGFNCTWVIPIVKGVPYYKAVKKLDVGGRFLNGLLKETISFRH 221
            G +   V P++ G+   K+V++    GR+LN LL+  I  R 
Sbjct: 250 VGHDTCSVSPVIDGMTLTKSVRRNFFAGRYLNRLLENYIKPRE 292

>ZYRO0G21428g Chr7 (1766725..1768176) [1452 bp, 483 aa] {ON} highly
           similar to uniprot|P80428 Saccharomyces cerevisiae
           YJL081C ARP4 Nuclear actin-related protein involved in
           chromatin remodeling component of chromatin- remodeling
           enzyme complexes
          Length = 483

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 32/107 (29%), Positives = 55/107 (51%), Gaps = 5/107 (4%)

Query: 312 GIIETVLESIYMLPELLRPLMASNIVCMGGNFNLPGFTDRLVSELQRQLPTDWVCRAKIS 371
           GI + V  SI      LR  +A NIV  GG+ ++PGF+DRL++EL ++LP   +    ++
Sbjct: 378 GISDLVHSSITSADVDLRATLAHNIVLTGGSSSVPGFSDRLMNELTKKLPA--LKFRVLT 435

Query: 372 SG---DKSLTGWTAMAKFAHTDAYKKARVTKEDYFEHGLDWTTKERF 415
           +G   ++    W   +      ++ +  V K +Y E G +    +RF
Sbjct: 436 TGHLRERQYQSWLGGSILTSLGSFHQLWVGKREYEEVGAERLLNDRF 482

 Score = 40.0 bits (92), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 47/231 (20%), Positives = 88/231 (38%), Gaps = 53/231 (22%)

Query: 6   AIVIDNGSYQVKFGLASEVRPRVALNALAKDKYGVTHLSNQVQNIKD---------ISSV 56
           A+VID GS+    G +    P+  L +     YG  H +N+  +  D           S+
Sbjct: 16  AVVIDPGSFTTNIGYSGTDCPQAILPSC----YG-HHKTNENADGDDEKSKPKVFAEQSL 70

Query: 57  VFRRPH-------ELGQLTSWELESCIWDYCLYNPDEFGIDWQSLENRHVVLSETCMTLP 109
            F RP        E G +  W+     WD+ L N     +  +S +    +++E+     
Sbjct: 71  TFPRPDYEIKPIVENGLVVDWDAAQEQWDWALRN----VLHLESNKGVPALMTESIWNTM 126

Query: 110 ELSKNTDQVLFEEYEVDSLYKAPTAAYIPFYTTNENIKTISGKSDHGELDIEEKIEAGKE 169
           E    + +VL E  + ++ Y + T   + F T   N                        
Sbjct: 127 ENKTKSLEVLLETLDFEACYISSTPTCVSFATGRPNC----------------------- 163

Query: 170 YNDFSLVIDSGFNCTWVIPIVKGVPYYKAVKKLDVGGRFLNGLLKETISFR 220
                LV+D G +     P+V G+   ++ ++  + G+F++ L+ + +  R
Sbjct: 164 -----LVVDVGHDTASSSPVVDGMTLSRSTRRNFISGKFVDQLIGKYLQPR 209

>KLTH0H09702g Chr8 complement(835255..836700) [1446 bp, 481 aa] {ON}
           similar to uniprot|P80428 Saccharomyces cerevisiae
           YJL081C ARP4 Nuclear actin-related protein involved in
           chromatin remodeling component of chromatin-remodeling
           enzyme complexes
          Length = 481

 Score = 48.1 bits (113), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 31/108 (28%), Positives = 57/108 (52%), Gaps = 7/108 (6%)

Query: 312 GIIETVLESIYMLPELLRPLMASNIVCMGGNFNLPGFTDRLVSELQRQLPTDWVCRAKI- 370
           G+ + V  +I      LR  +A N+V  GG+ ++PG TDRL++EL ++LP     + +I 
Sbjct: 376 GLADLVNTAITATDVDLRATLAHNLVVTGGSSSIPGLTDRLMTELNKKLP---ALKFRIL 432

Query: 371 SSG---DKSLTGWTAMAKFAHTDAYKKARVTKEDYFEHGLDWTTKERF 415
           +SG   ++    W   +  +    + +  V +++Y E G +   K+RF
Sbjct: 433 TSGHLRERQSRAWLGGSILSSLGTFHQLWVGRQEYEEVGAERLLKDRF 480

 Score = 47.8 bits (112), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 50/221 (22%), Positives = 82/221 (37%), Gaps = 38/221 (17%)

Query: 6   AIVIDNGSYQVKFGLASEVRPRVALNAL-----AKDKYGVTHLSNQVQNIKDISSVVFRR 60
           A+VID GSY    G +    P++ + +      A  K G    ++Q   I        +R
Sbjct: 16  AVVIDPGSYSTNIGYSGTDSPQLNIPSCYGQYTAGGKEGQKSFNDQFM-IMPRPDFEIKR 74

Query: 61  PHELGQLTSWELESCIWDYCLYNPDEFGIDWQSLENRHVVLSETCMTLPELSKNTDQVLF 120
             E G +  WE     W + + +  +F    +S +     L+E      E  K + +VL 
Sbjct: 75  ILENGCVVDWEAAQEQWAWAIRDELKF----ESFKGTPAFLTEAIWNPEENRKKSLEVLL 130

Query: 121 EEYEVDSLYKAPTAAYIPFYTTNENIKTISGKSDHGELDIEEKIEAGKEYNDFSLVIDSG 180
           E  E ++ Y APTA    F                                   LV+D G
Sbjct: 131 EGMEFEACYIAPTATCTSFAMGRPTC----------------------------LVLDIG 162

Query: 181 FNCTWVIPIVKGVPYYKAVKKLDVGGRFLNGLLKETISFRH 221
            +   V P+V G+   K+  +  + G+ LN L++  +  R 
Sbjct: 163 HDVASVCPVVDGMTLSKSSTRNFLAGKLLNKLIENHLKPRE 203

>CAGL0M03201g Chr13 complement(364771..366252) [1482 bp, 493 aa]
           {ON} similar to uniprot|P80428 Saccharomyces cerevisiae
           YJL081c ACT3 protein Actin-like protein ARP4
          Length = 493

 Score = 47.8 bits (112), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 53/233 (22%), Positives = 85/233 (36%), Gaps = 51/233 (21%)

Query: 6   AIVIDNGSYQVKFGLASEVRPRVAL--------NALAKDKYGVTHLSNQVQNIKDISSVV 57
           A++ID GSY    G A    P+  L         A        T  + + + +    S+ 
Sbjct: 16  AVIIDPGSYTTNIGYAGTDCPQSILPSSFGEIHEAEESTSEDNTEKTRKTRKVFSEQSIP 75

Query: 58  FRRPH-------ELGQLTSWELESCIWDYCLYNPDEFGIDWQSLENRHV--VLSETCMTL 108
             RP        E GQ+  W+     W + L N  E  I+     NR +  +L+E     
Sbjct: 76  IPRPDYEVKRVVENGQVCDWDSAVEQWSWALRN--ELHIE----SNRGIPAMLTEPLWNS 129

Query: 109 PELSKNTDQVLFEEYEVDSLYKAPTAAYIPFYTTNENIKTISGKSDHGELDIEEKIEAGK 168
            E    + ++L E  E ++ Y   T+  + F T   N                       
Sbjct: 130 KENRSKSLEILLEGMEFEACYLTATSTAVSFATGRPN----------------------- 166

Query: 169 EYNDFSLVIDSGFNCTWVIPIVKGVPYYKAVKKLDVGGRFLNGLLKETISFRH 221
                SL++D G +   V P++ G+   K+ +     GRFLN LL + +  R 
Sbjct: 167 -----SLIVDIGHDIASVTPVIDGMSLSKSTRCNHFAGRFLNKLLTDYLKPRE 214

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 26/106 (24%), Positives = 51/106 (48%), Gaps = 1/106 (0%)

Query: 311 PGIIETVLESIYMLPELLRPLMASNIVCMGGNFNLPGFTDRLVSELQRQLPT-DWVCRAK 369
           PGI++ +  SI      +R  +A N+V  GG+  +PG +DR+++EL  + P   +   A 
Sbjct: 387 PGIVDLISSSISSCDVDIRASLAHNLVITGGSSTIPGLSDRILNELNMKFPALKFRVLAT 446

Query: 370 ISSGDKSLTGWTAMAKFAHTDAYKKARVTKEDYFEHGLDWTTKERF 415
             S ++    W   +  +    + +  + K++Y E G +    +R 
Sbjct: 447 GQSIERQYQSWLGGSILSSLGTFHQLWIGKKEYEEVGSERLLHDRL 492

>NCAS0B06060 Chr2 complement(1146248..1147741) [1494 bp, 497 aa]
           {ON} 
          Length = 497

 Score = 47.4 bits (111), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 28/105 (26%), Positives = 51/105 (48%), Gaps = 1/105 (0%)

Query: 312 GIIETVLESIYMLPELLRPLMASNIVCMGGNFNLPGFTDRLVSELQRQLPT-DWVCRAKI 370
           G+ + V  +I      LR  +A N+V  GG+ ++PG +DRL+ EL R+LP   +   +  
Sbjct: 392 GLADLVYSAIIKSDVDLRASLAHNVVLTGGSSSIPGLSDRLILELNRRLPALKFRILSTG 451

Query: 371 SSGDKSLTGWTAMAKFAHTDAYKKARVTKEDYFEHGLDWTTKERF 415
            + ++    W   +       + +  V K +Y E G++    +RF
Sbjct: 452 HTKERQYQAWLGGSILTSLGTFHQLWVGKNEYNEVGVERLLMDRF 496

 Score = 37.7 bits (86), Expect = 0.045,   Method: Compositional matrix adjust.
 Identities = 45/226 (19%), Positives = 80/226 (35%), Gaps = 42/226 (18%)

Query: 6   AIVIDNGSYQVKFGLASEVRPRVALNALAKDKYGVTHLSNQVQNIKDI---SSVVFRRPH 62
           A++ID GS+    G +    P+  L +        T         K I   SS+   RP 
Sbjct: 16  AVIIDPGSFSTNIGYSGTDYPQSILPSSYGTYKETTEGQESTTKRKRIFSESSIQIPRPD 75

Query: 63  -------ELGQLTSWELESCIWDYCLYNPDEFGIDWQSLENRHVVLSETCMTLPELSKNT 115
                  E G +  W+     W + L +     +  QS      +L+E      E  K +
Sbjct: 76  YEIKRIVENGSIMDWDAAQEQWSWALKSQ----LHLQSTSGIPALLTEPIWNSVENRKKS 131

Query: 116 DQVLFEEYEVDSLYKAPTAAYIPFYTTNENIKTISGKSDHGELDIEEKIEAGKEYNDFSL 175
            ++L E    ++ Y +     + F     N                             L
Sbjct: 132 LEILLEGMNFEACYLSSVPTCVSFAAGRPNC----------------------------L 163

Query: 176 VIDSGFNCTWVIPIVKGVPYYKAVKKLDVGGRFLNGLLKETISFRH 221
           V+D G + T V P+V G+   K+  +  + G+++N L+++ +  R 
Sbjct: 164 VVDIGHDTTSVSPVVDGMTLSKSSMRNFIAGKYINTLIEKYLQPRE 209

>NDAI0G05580 Chr7 complement(1374852..1376399) [1548 bp, 515 aa]
           {ON} Anc_1.287
          Length = 515

 Score = 47.0 bits (110), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 50/228 (21%), Positives = 87/228 (38%), Gaps = 48/228 (21%)

Query: 6   AIVIDNGSYQVKFGLASEVRPRVALNALAKDKYGVTHLSNQVQNIKDI-----SSVVFRR 60
           +IVID GSY    G +    P     ++    YG    + + +N K        S+   R
Sbjct: 14  SIVIDPGSYTTNIGYSGSDCPE----SIIPSSYGQYKDTAKEENQKKTKVFSEQSIGLAR 69

Query: 61  PH-------ELGQLTSWELESCIWDYCLYNPDEFGIDWQSLENRHVVLSETCMTLPELSK 113
           P        E G++  W+     WD+ L N     +  +S     V+L+E      E  K
Sbjct: 70  PDYEIKRIVENGEIADWDTAQEQWDWVLKNE----LFLKSNSGIPVLLTEPIWNSVENRK 125

Query: 114 NTDQVLFEEYEVDSLYKAPTAAYIPFYTTNENIKTISGKSDHGELDIEEKIEAGKEYNDF 173
            + +VL E  + ++ Y +P +  + F     N                            
Sbjct: 126 KSLEVLLEGMDFEACYLSPVSTCVSFAAGRPNC--------------------------- 158

Query: 174 SLVIDSGFNCTWVIPIVKGVPYYKAVKKLDVGGRFLNGLLKETISFRH 221
            LV+D G + T V P++ G+   K+  +  + GR++N L++  +  R 
Sbjct: 159 -LVVDIGHDTTSVSPVIDGMTLSKSSTRNFIAGRYINHLIETYLKPRE 205

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 33/108 (30%), Positives = 50/108 (46%), Gaps = 7/108 (6%)

Query: 312 GIIETVLESIYMLPELLRPLMASNIVCMGGNFNLPGFTDRLVSELQRQLPTDWVCRAKI- 370
           GI + V  SI      LR  +A N+V  GG   +P   DRL+ EL ++LP     + +I 
Sbjct: 410 GIADLVQRSILDSDVDLRASLAHNVVITGGTSCIPRLNDRLMYELSKRLP---ALKFRIL 466

Query: 371 SSG---DKSLTGWTAMAKFAHTDAYKKARVTKEDYFEHGLDWTTKERF 415
           ++G   +K    W   +       + +  V KE+Y E G D    +RF
Sbjct: 467 TTGHLREKQYQAWLGGSILTSLGTFHQLWVGKEEYKEVGADRLLVDRF 514

>ACR184C Chr3 complement(669411..670616) [1206 bp, 401 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPR034W
           (ARP7)
          Length = 401

 Score = 47.0 bits (110), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 61/267 (22%), Positives = 96/267 (35%), Gaps = 46/267 (17%)

Query: 174 SLVIDSGFNCTWVIPIVKGVPYYKAVKKLDVGGRFLNGLLKETISFRH-----YNVMDES 228
           +LV+D G +   V PIV G      + +    G FL+  L + +  R      Y+     
Sbjct: 141 ALVVDVGASKVTVTPIVDGSVVKTGILRSRYAGDFLDFQLMKALDDRPDGTSLYHWQQSR 200

Query: 229 ILVNNIKEQCLYVDPVSYFEAFKAKGKNKIDFVLPDFQTSFQGYVRDPKTALPDNAQILT 288
             + + K   L V  +   E  K   K  I F+    +       +  KT   D  Q   
Sbjct: 201 TWMRDFKNTMLQVSLMRLSEVEKQLQKQSISFIPIPLEGRKHFLFKRQKTVTWDLKQC-- 258

Query: 289 LTDERFSVPEAFFHPEISQSLKP------GIIETVLESI--------------------- 321
                + +PE+ F P    S+ P      G+ + V ++I                     
Sbjct: 259 -----YRIPESLFDPS---SVSPEFDSADGLSDLVGKAIKKCAASITSSNGSAAQPAAAG 310

Query: 322 --YMLPELLRPLMASNIVCMGGNFNLPGFTDRLVSELQRQLPT-DWVCRAKISSGDKSLT 378
                PE +   + +N+V +GG   L G   RLV++L  Q P       A  +  D+ L 
Sbjct: 311 LPSATPEQIHAALLTNVVIIGGTSLLQGLEQRLVNDLSLQFPQYKLSTYATPAHVDRQLQ 370

Query: 379 GWTAMAKFAHTDAYKKAR-VTKEDYFE 404
            W       H   +K    VTK++Y E
Sbjct: 371 SWQGGVNMCHLPDWKLGSWVTKQEYLE 397

>KNAG0B01920 Chr2 complement(362300..363817) [1518 bp, 505 aa] {ON}
           Anc_1.287 YJL081C
          Length = 505

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 49/238 (20%), Positives = 88/238 (36%), Gaps = 58/238 (24%)

Query: 6   AIVIDNGSYQVKFGLASEVRPRVALNALAKDKYGVTHLSNQVQNIKDISS--VVFRRPH- 62
           A+VID GSY    G +    P    +++   +YG    +N+    +D  S     +R H 
Sbjct: 16  AVVIDPGSYSTNIGYSGTDCP----HSILPSRYGSFKKTNKDSGDEDTKSDESATKRAHI 71

Query: 63  -------------------ELGQLTSWELESCIWDYCLYNPDEFGIDWQSLENRHVVLSE 103
                              E G +T W+     W++ L N     +  +S +    +L+E
Sbjct: 72  FSEQSLGLPRKDYEIKTIVENGAVTDWDAAQEQWEWALKNE----LFLESTKGIPALLTE 127

Query: 104 TCMTLPELSKNTDQVLFEEYEVDSLYKAPTAAYIPFYTTNENIKTISGKSDHGELDIEEK 163
                 +  K + + L E    ++ Y APT+  + F T   N                  
Sbjct: 128 PVWNTKKNRKKSLETLLESMNFEACYLAPTSTCVSFATGRANC----------------- 170

Query: 164 IEAGKEYNDFSLVIDSGFNCTWVIPIVKGVPYYKAVKKLDVGGRFLNGLLKETISFRH 221
                      LV+D G +   V P+V G+   K+ ++    G+++N L++  +  R 
Sbjct: 171 -----------LVVDIGHDTCSVSPVVDGMTLSKSTRRSFFAGKYINHLIENFLKPRE 217

 Score = 40.4 bits (93), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 27/105 (25%), Positives = 45/105 (42%), Gaps = 1/105 (0%)

Query: 312 GIIETVLESIYMLPELLRPLMASNIVCMGGNFNLPGFTDRLVSELQRQLPT-DWVCRAKI 370
           G+ + V  SI      LR  +A N+   GG   +PG +DRL+ EL  +LP   +      
Sbjct: 400 GLADLVHSSIMASDVDLRASLAHNVQLTGGTSLIPGLSDRLMLELNARLPALKFRILTTG 459

Query: 371 SSGDKSLTGWTAMAKFAHTDAYKKARVTKEDYFEHGLDWTTKERF 415
              ++    W   +       + +  V +++Y E G D    +RF
Sbjct: 460 HKKEREYQSWLGGSVLTSLGTFHQLWVGRQEYEEVGADRLLNDRF 504

>TDEL0C03120 Chr3 (558606..559922) [1317 bp, 438 aa] {ON} Anc_7.448
           YPR034W
          Length = 438

 Score = 37.7 bits (86), Expect = 0.054,   Method: Compositional matrix adjust.
 Identities = 62/274 (22%), Positives = 99/274 (36%), Gaps = 60/274 (21%)

Query: 174 SLVIDSGFNCTWVIPIVKGVPYYKAVKKLDVGGRFLN----GLLKETI-SFRHYNVMDES 228
           +LVID G   T V PIV G      V K   GG FL+     LL+E + S  H    + +
Sbjct: 147 ALVIDVGARGTTVTPIVDGTVVRSGVMKSRFGGDFLDYQVAKLLEEPLGSSSHEAWYNSA 206

Query: 229 ILVNNIKEQCLYV--DPVSYFEAFKAKGKNKIDFVLPDFQTSFQGYVRDPKTA-----LP 281
             +   K   L V    +S  E +                 ++  Y+ +P T      L 
Sbjct: 207 TWIREFKSTMLQVCDKNLSELERYHRDQLLLQQQQQQQLGGAYHNYMTNPLTQKRNFLLK 266

Query: 282 DNAQILTL-TDERFSVPEAFFHPEISQ---SLKPGIIETVLESIYML------------- 324
            N + +TL   + + V E  F P+++    + + G+ E +  SI                
Sbjct: 267 KNNKTVTLELRDCYRVCEYLFQPQLASPDYASRDGLGELLSRSIKKAAASVSAQGTPGGG 326

Query: 325 -----------PEL-------------------LRPLMASNIVCMGGNFNLPGFTDRLVS 354
                      P+L                   +   + +N+V  G    + GF  R+VS
Sbjct: 327 QGASLVYNRHQPQLQPEQPSTTTTTASSATTEQVYAQLLTNVVITGSTSLVAGFEPRIVS 386

Query: 355 ELQRQLPTDWVCR-AKISSGDKSLTGWTAMAKFA 387
           EL  + P + +   A     D+++ GW AM   A
Sbjct: 387 ELAVRFPQNKLATYANQIHLDRAVQGWIAMGAMA 420

>SAKL0F13772g Chr6 (1099703..1100971) [1269 bp, 422 aa] {ON} similar
           to uniprot|Q12406 Saccharomyces cerevisiae YPR034W ARP7
           Actin-related protein involved in transcriptional
           regulation subunit of the chromatin remodeling Snf/Swi
           complex
          Length = 422

 Score = 35.8 bits (81), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 62/300 (20%), Positives = 112/300 (37%), Gaps = 86/300 (28%)

Query: 174 SLVIDSGFNCTWVIPIVKGVPYYKAVKKLDVGGRFLNGLLKETI---------------- 217
           SLV+D G +   V PI+ G     AV +    G FL+  + E +                
Sbjct: 140 SLVVDIGASKITVTPIIDGSVVKPAVLRSKFAGDFLDYQVAENLKNSLPIEPAGEDSKVP 199

Query: 218 -SFRHYNVMDESILVNNIKEQCLYVDP--VSYFEAFK---AKGKNKIDFVLPDFQTSFQG 271
            SF+++        +++ K   L V P  +   E  +   A   N +D         +  
Sbjct: 200 ESFKYWE--SSRTWIHDFKATMLQVSPSKIQELEGMQDTMAFSHNPLD------NKKYFL 251

Query: 272 YVRDPKTALPDNAQILTLTD-ERFSVPEAFFHPEISQ---SLKPGIIETVLESI------ 321
           Y +  KT        LTL   E + + E  F P+++    + K G+ E V++++      
Sbjct: 252 YKKGNKT--------LTLEQRECYKLAEMLFQPQLASDQFAAKEGLAELVVKAVKKAGAA 303

Query: 322 --------------------------YMLPELLRPLMASNIVCMGGNFNLPGFTDRLVSE 355
                                        PE +   + +NIV  G    +PG   R+V+E
Sbjct: 304 VTTSNSGPAGGGGPSGSSSMGIGASSTTTPEQIHAALLTNIVITGSTSLVPGVEQRIVNE 363

Query: 356 LQRQLPTDWVCRAKISSG------DKSLTGWTAMAKFAHTDAYKKAR-VTKEDYFEHGLD 408
           L  Q P     + K+SS       D+ L  W      ++  +++    +T+++Y  +G++
Sbjct: 364 LSYQFP-----QYKLSSFANPMVLDRKLQSWQGGVTMSNLPSWELGNWITRQEYDANGIN 418

>KLTH0C05324g Chr3 complement(458911..460110) [1200 bp, 399 aa] {ON}
           similar to uniprot|Q12406 Saccharomyces cerevisiae
           YPR034W ARP7 Actin-related protein involved in
           transcriptional regulation subunit of the chromatin
           remodeling Snf/Swi complex
          Length = 399

 Score = 34.3 bits (77), Expect = 0.61,   Method: Compositional matrix adjust.
 Identities = 59/262 (22%), Positives = 104/262 (39%), Gaps = 41/262 (15%)

Query: 174 SLVIDSGFNCTWVIPIVKGVPYYKAVKKLDVGGRFLNGLLKETISFRHYNVMDESILVNN 233
           +LV+D G   + V PI+ G     AV +    G FL+  + E ++       +E    NN
Sbjct: 137 ALVVDVGAAKSTVTPIIDGTVVQTAVARSKFAGDFLDMQVNELLTKIAPIKDEEEGDPNN 196

Query: 234 IKEQ--CLYVDPVSYFEAFKAKGKNKIDFVLPDFQTS---FQG--YVRDPKTALPDNAQI 286
            K+    L+ +  ++ + FK          L D  ++     G  Y+   K  L    + 
Sbjct: 197 RKDPSLTLWRNSRTWIQEFKTYMLQVAPSRLQDLDSAALDMMGLTYI---KNFLLQKQKT 253

Query: 287 LTLTDER-FSVPEAFFHPE-ISQSL--KPGIIETVLESI---------------YMLPEL 327
           ++LT ++   + E  F P  +SQ      G+ E V +S+                  PE 
Sbjct: 254 ISLTQKQCCELAEGLFQPRSVSQQFVAAEGLSEIVAKSVKKAGASTATSSSATNVTTPEQ 313

Query: 328 LRPLMASNIVCMGGNFNLPGFTDRLVSELQRQLPTDWVCRAKISS------GDKSLTGWT 381
               + +NI+  G +  + G   R+V++L  Q P     + K+SS       D+ L  W 
Sbjct: 314 THAALLTNILITGSSSLISGLEQRIVNDLSYQFP-----QYKLSSFANPLVLDRKLQSWQ 368

Query: 382 AMAKFAHTDAYKKAR-VTKEDY 402
                A+  ++     V++ DY
Sbjct: 369 GGVTMANLPSWDLGDWVSQSDY 390

>Kpol_520.11 s520 complement(26673..28139) [1467 bp, 488 aa] {ON}
           complement(26673..28139) [1467 nt, 489 aa]
          Length = 488

 Score = 34.3 bits (77), Expect = 0.67,   Method: Compositional matrix adjust.
 Identities = 39/162 (24%), Positives = 69/162 (42%), Gaps = 13/162 (8%)

Query: 174 SLVIDSGFNCTWVIPIVKGVPYYKAVKKLDVGGRFLNGLLKETISFRHYNVMDESILVNN 233
           SLVID   + + V PIV GV     + K   GG FL+  +      + ++ +DE +    
Sbjct: 155 SLVIDISGSGSSVTPIVDGVIIKNGIVKSKYGGDFLDYQI-----IKKFSTIDEDLEEEM 209

Query: 234 IKEQCLYVDPVSYFEAFKAKGKNKIDFVLPDFQTSFQGYVRDPKTALPDNAQILTLTDER 293
                ++V   S+ + FK       D  L D +  ++  +R  +  L +   I ++    
Sbjct: 210 TNSSNIWVSSNSWIKNFKKTMLQVTDKKLQDVEKYYEEQLR-LQAELQNQGSITSVGTNP 268

Query: 294 FSVPEAFFHPEISQSLKPGIIETVLESIYMLPE-LLRPLMAS 334
            SV + + +    +S K    E+    +Y   E L +P +AS
Sbjct: 269 LSVKKEYLY----RSRKTVTFES--RELYQFGEYLFQPQLAS 304

>TDEL0A04400 Chr1 (778465..779763) [1299 bp, 432 aa] {ON} Anc_5.575
           YML032C
          Length = 432

 Score = 32.3 bits (72), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 24/88 (27%), Positives = 38/88 (43%), Gaps = 13/88 (14%)

Query: 218 SFRHY--NVMDESILVNNIKEQCLYVDPVSYFEAFKAKGKNKIDFVLPDFQTSFQGYVRD 275
           S RH       + +  + +KE+ +     S +E F AKGK          Q   +G V  
Sbjct: 324 SIRHTVDQTTSKPVPASLLKEKGIDDSRESSYEKFAAKGK----------QIGAEGSVSQ 373

Query: 276 PKTALPDNAQILTLTDERFSVPEAFFHP 303
           P +A+  N+Q  + T  R++ P    HP
Sbjct: 374 P-SAIEPNSQPTSTTSSRYAPPNTVIHP 400

>Ecym_3505 Chr3 complement(941314..942231) [918 bp, 305 aa] {ON}
           similar to Ashbya gossypii AGR099C
          Length = 305

 Score = 32.3 bits (72), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 16/45 (35%), Positives = 26/45 (57%)

Query: 313 IIETVLESIYMLPELLRPLMASNIVCMGGNFNLPGFTDRLVSELQ 357
           II  VLESI  LP  ++  +  N++ +GG   + G  +RL+  L+
Sbjct: 205 IISLVLESIKQLPIDVKSKVLQNVIIIGGLSKIQGLKERLIENLR 249

>KAFR0K02150 Chr11 (441832..443304) [1473 bp, 490 aa] {ON} Anc_7.448
           YPR034W
          Length = 490

 Score = 32.3 bits (72), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 19/80 (23%), Positives = 36/80 (45%), Gaps = 2/80 (2%)

Query: 325 PELLRPLMASNIVCMGGNFNLPGFTDRLVSELQRQLPT-DWVCRAKISSGDKSLTGWTAM 383
           PE +   + +N++  G    + G   R++ EL  + P       A     D+ + GW A 
Sbjct: 400 PEQIYSTLLTNVIITGSTSLISGMEQRIIKELSIRFPQYKLTTFANQIMMDRRIEGWIAA 459

Query: 384 AKFAHTDAYKKAR-VTKEDY 402
              A+  +++  +  +KEDY
Sbjct: 460 TSMANLPSWELGKWYSKEDY 479

>AGR099C Chr7 complement(924366..925283) [918 bp, 305 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR106W
           (ARP10)
          Length = 305

 Score = 32.0 bits (71), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 27/110 (24%), Positives = 54/110 (49%), Gaps = 15/110 (13%)

Query: 312 GIIETVLESIYMLPELLRPLMASNIVCMGGNFNLPGFTDRLVSELQRQLPTDWVCRAKIS 371
            ++  VL ++  L   ++  +  NIV +G    +PG   RL+ E+Q    T++VC    +
Sbjct: 204 ALVPLVLRAVRNLSADVKRNVLPNIVIIGSMARMPGLRQRLIVEIQ----TEFVC----A 255

Query: 372 SGDKSLTGWTAMAKFA-HTDAYKK---ARVTKEDYFEHGL--DWTTKERF 415
            G ++L+ W   + +  H+  + +     V +E +  +G+  DW   +RF
Sbjct: 256 RGIEALSVWQGGSIYTFHSLMHNELDLMEVNRERFKNNGVVPDWQL-QRF 304

>Smik_4.687 Chr4 (1219205..1221751) [2547 bp, 848 aa] {ON} YDR416W
           (REAL)
          Length = 848

 Score = 32.3 bits (72), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 16/66 (24%), Positives = 34/66 (51%)

Query: 158 LDIEEKIEAGKEYNDFSLVIDSGFNCTWVIPIVKGVPYYKAVKKLDVGGRFLNGLLKETI 217
           L + EK++   +Y +F   ++  +   WV   +    YY +  +LD  G  L+  L++T+
Sbjct: 272 LIVLEKLDLDNQYEEFMNQMNVMYAENWVFLTLSLAKYYISRGRLDSCGDLLDKSLRQTL 331

Query: 218 SFRHYN 223
           +F  ++
Sbjct: 332 NFSDFD 337

>Kwal_27.10552 s27 complement(390650..391705) [1056 bp, 351 aa] {ON}
           YPR034W (ARP7) - actin related protein, subunit of the
           chromatin remodeling Snf/Swi complex [contig 35] PARTIAL
          Length = 351

 Score = 31.6 bits (70), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 22/85 (25%), Positives = 39/85 (45%), Gaps = 12/85 (14%)

Query: 325 PELLRPLMASNIVCMGGNFNLPGFTDRLVSELQRQLPTDWVCRAKISS------GDKSLT 378
           PE +   + +NIV  G +  +PG   R+V++L  Q P     + K+SS       D+ L 
Sbjct: 263 PEQIHAALLTNIVITGSSSLIPGLEQRIVNDLSYQFP-----QYKLSSFANPLVLDRKLQ 317

Query: 379 GWTAMAKFAHTDAYKKAR-VTKEDY 402
            W      A+  ++     +++ DY
Sbjct: 318 SWQGGVTMANLPSWDLGEWISQSDY 342

>CAGL0K05335g Chr11 (521914..523503) [1590 bp, 529 aa] {ON} similar
           to uniprot|Q12406 Saccharomyces cerevisiae YPR034w ARP7
           Actin-like protein
          Length = 529

 Score = 31.6 bits (70), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 22/92 (23%), Positives = 41/92 (44%), Gaps = 12/92 (13%)

Query: 323 MLPELLRPLMASNIVCMGGNFNLPGFTDRLVSELQRQLPTDWVCRAKISSG------DKS 376
           + PE +  L+ +N++  GG   + G   R++ EL  + P     + K+S+        +S
Sbjct: 434 ITPEHVYSLLLTNVIITGGTSLIDGMEQRIIRELSIRFP-----QYKLSTFTNPDQLQRS 488

Query: 377 LTGWTAMAKFAHTDAYKKAR-VTKEDYFEHGL 407
           L  W      ++   +   +  TKED+  H L
Sbjct: 489 LQAWNGAVSLSNLPKWGLTQWFTKEDFNNHKL 520

>KNAG0B02110 Chr2 complement(399743..401200) [1458 bp, 485 aa] {ON}
           Anc_7.448 YPR034W
          Length = 485

 Score = 31.6 bits (70), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 21/80 (26%), Positives = 37/80 (46%), Gaps = 2/80 (2%)

Query: 325 PELLRPLMASNIVCMGGNFNLPGFTDRLVSELQRQLPT-DWVCRAKISSGDKSLTGWTAM 383
           PE +   + +N++  G    + G   R++ EL  + P    V  A  +  D+ L  W   
Sbjct: 393 PEQVYTSLLTNVIITGAASLIDGIESRIIRELSIRFPQYKLVTFANQNLMDRQLQSWMGA 452

Query: 384 AKFAHTDAYKKAR-VTKEDY 402
           A  A+  +++  +  TKEDY
Sbjct: 453 ATMANLPSWELGKWYTKEDY 472

>TBLA0H02800 Chr8 (655357..656811) [1455 bp, 484 aa] {ON} Anc_2.593
           YMR033W
          Length = 484

 Score = 30.8 bits (68), Expect = 6.6,   Method: Compositional matrix adjust.
 Identities = 18/58 (31%), Positives = 29/58 (50%), Gaps = 4/58 (6%)

Query: 164 IEAGKEYNDFSL----VIDSGFNCTWVIPIVKGVPYYKAVKKLDVGGRFLNGLLKETI 217
           I  G  Y+  SL    +ID G N T ++PIV           L+ GG ++N +L++ +
Sbjct: 144 ISLGASYSMVSLQNCCIIDIGLNHTDIVPIVDYTTINHLSNTLNYGGSYINTILQKLL 201

>NCAS0H03060 Chr8 (588900..590318) [1419 bp, 472 aa] {ON} Anc_2.593
           YMR033W
          Length = 472

 Score = 30.8 bits (68), Expect = 6.6,   Method: Compositional matrix adjust.
 Identities = 22/61 (36%), Positives = 31/61 (50%), Gaps = 7/61 (11%)

Query: 289 LTDERFSVPEAFFHPEISQSLKPGIIETVLESIYMLP----ELLRPLMASNIVCMGGNFN 344
           L DE F+VP+  F  +I +SL P    T   S Y  P    EL+ P++  +IV +    N
Sbjct: 24  LNDETFTVPQLEFPTQIYRSLDPA---TNQYSFYTHPTDSTELIHPVVNGSIVDLDAFLN 80

Query: 345 L 345
           L
Sbjct: 81  L 81

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.319    0.136    0.411 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 47,536,395
Number of extensions: 2151616
Number of successful extensions: 5931
Number of sequences better than 10.0: 161
Number of HSP's gapped: 5787
Number of HSP's successfully gapped: 222
Length of query: 421
Length of database: 53,481,399
Length adjustment: 112
Effective length of query: 309
Effective length of database: 40,638,807
Effective search space: 12557391363
Effective search space used: 12557391363
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 67 (30.4 bits)