Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
CAGL0L12144g8.256ON1156115655460.0
YLR084C (RAX2)8.256ON1220118415860.0
Suva_10.1688.256ON1220118515850.0
Skud_12.1528.256ON1220118415760.0
ZYRO0C01804g8.256ON1209118815500.0
Smik_12.1438.256ON1220118415250.0
NCAS0B049808.256ON1204117915090.0
NDAI0B023808.256ON1219119015100.0
KAFR0B026908.256ON1210118115060.0
SAKL0H17204g8.256ON1211118614920.0
Kpol_392.108.256ON1226118814481e-180
TPHA0B032508.256ON1215120313991e-172
TDEL0F038308.256ON1195117613831e-170
KNAG0G020008.256ON1202119213681e-168
TBLA0E043908.256ON1278125612621e-152
Kwal_56.235898.256ON1213120112351e-149
Ecym_43158.256ON1212108012021e-144
KLTH0G13838g8.256ON1214120411911e-142
KLLA0F18975g8.256ON1200108411351e-135
AGR095W8.256ON1201122510961e-129
CAGL0I10318g3.504ON906112737.6
YIR033W (MGA2)2.662ON111377729.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0L12144g
         (1156 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0L12144g Chr12 complement(1304574..1308044) [3471 bp, 1156 a...  2140   0.0  
YLR084C Chr12 complement(296589..300251) [3663 bp, 1220 aa] {ON}...   615   0.0  
Suva_10.168 Chr10 complement(301631..305293) [3663 bp, 1220 aa] ...   615   0.0  
Skud_12.152 Chr12 complement(279947..283609) [3663 bp, 1220 aa] ...   611   0.0  
ZYRO0C01804g Chr3 (140029..143658) [3630 bp, 1209 aa] {ON} simil...   601   0.0  
Smik_12.143 Chr12 complement(276428..280090) [3663 bp, 1220 aa] ...   592   0.0  
NCAS0B04980 Chr2 complement(912114..915728) [3615 bp, 1204 aa] {...   585   0.0  
NDAI0B02380 Chr2 complement(595444..599103) [3660 bp, 1219 aa] {...   586   0.0  
KAFR0B02690 Chr2 complement(539470..543102) [3633 bp, 1210 aa] {...   584   0.0  
SAKL0H17204g Chr8 (1522944..1526579) [3636 bp, 1211 aa] {ON} sim...   579   0.0  
Kpol_392.10 s392 (27006..30686) [3681 bp, 1226 aa] {ON} (27006.....   562   e-180
TPHA0B03250 Chr2 (745716..749363) [3648 bp, 1215 aa] {ON} Anc_8....   543   e-172
TDEL0F03830 Chr6 complement(701362..704949) [3588 bp, 1195 aa] {...   537   e-170
KNAG0G02000 Chr7 complement(443631..447239) [3609 bp, 1202 aa] {...   531   e-168
TBLA0E04390 Chr5 complement(1115294..1119130) [3837 bp, 1278 aa]...   490   e-152
Kwal_56.23589 s56 complement(610601..614242) [3642 bp, 1213 aa] ...   480   e-149
Ecym_4315 Chr4 (679627..683265) [3639 bp, 1212 aa] {ON} similar ...   467   e-144
KLTH0G13838g Chr7 (1197919..1201563) [3645 bp, 1214 aa] {ON} sim...   463   e-142
KLLA0F18975g Chr6 complement(1739543..1743145) [3603 bp, 1200 aa...   441   e-135
AGR095W Chr7 (914098..917703) [3606 bp, 1201 aa] {ON} Syntenic h...   426   e-129
CAGL0I10318g Chr9 complement(1008846..1011566) [2721 bp, 906 aa]...    33   7.6  
YIR033W Chr9 (416124..419465) [3342 bp, 1113 aa] {ON}  MGA2ER me...    32   9.8  

>CAGL0L12144g Chr12 complement(1304574..1308044) [3471 bp, 1156 aa]
            {ON} similar to uniprot|Q12465 Saccharomyces cerevisiae
            YLR084c
          Length = 1156

 Score = 2140 bits (5546), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1081/1156 (93%), Positives = 1081/1156 (93%)

Query: 1    MLNFSSSRNNEIQLLGSIETFNYYNYQGQQNFTTASSSQNELELIYYSNNTLLRLDAVPT 60
            MLNFSSSRNNEIQLLGSIETFNYYNYQGQQNFTTASSSQNELELIYYSNNTLLRLDAVPT
Sbjct: 1    MLNFSSSRNNEIQLLGSIETFNYYNYQGQQNFTTASSSQNELELIYYSNNTLLRLDAVPT 60

Query: 61   DVEMRHIIPFMDDCFILSGIGTISGIELSRQILLNLTQLSYQPIFEKELGMVKSIFVDNE 120
            DVEMRHIIPFMDDCFILSGIGTISGIELSRQILLNLTQLSYQPIFEKELGMVKSIFVDNE
Sbjct: 61   DVEMRHIIPFMDDCFILSGIGTISGIELSRQILLNLTQLSYQPIFEKELGMVKSIFVDNE 120

Query: 121  VVYFGGDITYNNNGVSGRSVVQWNSTTXXXXXXXXXXXXXXXTVNSIIRLENNNLLFTGQ 180
            VVYFGGDITYNNNGVSGRSVVQWNSTT               TVNSIIRLENNNLLFTGQ
Sbjct: 121  VVYFGGDITYNNNGVSGRSVVQWNSTTNSSSLLPFGGFGSNSTVNSIIRLENNNLLFTGQ 180

Query: 181  FAKLENNSFVSKTNRTRNFSISMEDSEVGQQISLRQATWNANSNLDVDAFICPNSDQQAW 240
            FAKLENNSFVSKTNRTRNFSISMEDSEVGQQISLRQATWNANSNLDVDAFICPNSDQQAW
Sbjct: 181  FAKLENNSFVSKTNRTRNFSISMEDSEVGQQISLRQATWNANSNLDVDAFICPNSDQQAW 240

Query: 241  YSEGSYGVITCNFPNTLTLSKIRIYNTPITDNQISLFRLIAIPGNGILNLTYLDPISHDI 300
            YSEGSYGVITCNFPNTLTLSKIRIYNTPITDNQISLFRLIAIPGNGILNLTYLDPISHDI
Sbjct: 241  YSEGSYGVITCNFPNTLTLSKIRIYNTPITDNQISLFRLIAIPGNGILNLTYLDPISHDI 300

Query: 301  KHCTENCPLFTRETLLNAMGNVTQESDVIRFINNNSTNIKWNEYYQEFAFVNQLPITSLQ 360
            KHCTENCPLFTRETLLNAMGNVTQESDVIRFINNNSTNIKWNEYYQEFAFVNQLPITSLQ
Sbjct: 301  KHCTENCPLFTRETLLNAMGNVTQESDVIRFINNNSTNIKWNEYYQEFAFVNQLPITSLQ 360

Query: 361  FVASNSYYQNVGLSGFQIYQDSFPIFPNNSFNEPNCPSSNDIASYVKLSGNGWFTVANDN 420
            FVASNSYYQNVGLSGFQIYQDSFPIFPNNSFNEPNCPSSNDIASYVKLSGNGWFTVANDN
Sbjct: 361  FVASNSYYQNVGLSGFQIYQDSFPIFPNNSFNEPNCPSSNDIASYVKLSGNGWFTVANDN 420

Query: 421  SYLANSYIPNQGTKPSITYFVGINVPGEYVLNLVTPGCDKDNTCSTRGIVNVTTFDNSNG 480
            SYLANSYIPNQGTKPSITYFVGINVPGEYVLNLVTPGCDKDNTCSTRGIVNVTTFDNSNG
Sbjct: 421  SYLANSYIPNQGTKPSITYFVGINVPGEYVLNLVTPGCDKDNTCSTRGIVNVTTFDNSNG 480

Query: 481  NILGSALIYQNNNNLKYDQIFAGVLNNSISVQVEYYSGINTNTGTATXXXXXXXXXXXSI 540
            NILGSALIYQNNNNLKYDQIFAGVLNNSISVQVEYYSGINTNTGTAT           SI
Sbjct: 481  NILGSALIYQNNNNLKYDQIFAGVLNNSISVQVEYYSGINTNTGTATVVVGVVDVVRVSI 540

Query: 541  SSEFISDQIDGDRSLHLNGIFEYSPSNFTFDNGYLTGKIDYTILDDFGVSNFNKGASIFA 600
            SSEFISDQIDGDRSLHLNGIFEYSPSNFTFDNGYLTGKIDYTILDDFGVSNFNKGASIFA
Sbjct: 541  SSEFISDQIDGDRSLHLNGIFEYSPSNFTFDNGYLTGKIDYTILDDFGVSNFNKGASIFA 600

Query: 601  VDQNQNLYLGSTNGSVYELNSLNGSSVPSTENNLSGLINGMYSVEEGLVIFGSIAHRGRE 660
            VDQNQNLYLGSTNGSVYELNSLNGSSVPSTENNLSGLINGMYSVEEGLVIFGSIAHRGRE
Sbjct: 601  VDQNQNLYLGSTNGSVYELNSLNGSSVPSTENNLSGLINGMYSVEEGLVIFGSIAHRGRE 660

Query: 661  YGAVILNKSITPLDIVANDSIQASFNSTLFGSNLLVFDNSTIFNMTSFMVFENTSYRNLD 720
            YGAVILNKSITPLDIVANDSIQASFNSTLFGSNLLVFDNSTIFNMTSFMVFENTSYRNLD
Sbjct: 661  YGAVILNKSITPLDIVANDSIQASFNSTLFGSNLLVFDNSTIFNMTSFMVFENTSYRNLD 720

Query: 721  LRNAGKNSNDDMLLVGNIVNKGSAIGNESLLISSNGTYSPFSLSDNDTIEGAIYLNDTKA 780
            LRNAGKNSNDDMLLVGNIVNKGSAIGNESLLISSNGTYSPFSLSDNDTIEGAIYLNDTKA
Sbjct: 721  LRNAGKNSNDDMLLVGNIVNKGSAIGNESLLISSNGTYSPFSLSDNDTIEGAIYLNDTKA 780

Query: 781  LYSLSSGNVNYFQLSDKQRLPWTWQSTVVPVFYSNGQQLLGAIQENSNKSQIVLIDLFSS 840
            LYSLSSGNVNYFQLSDKQRLPWTWQSTVVPVFYSNGQQLLGAIQENSNKSQIVLIDLFSS
Sbjct: 781  LYSLSSGNVNYFQLSDKQRLPWTWQSTVVPVFYSNGQQLLGAIQENSNKSQIVLIDLFSS 840

Query: 841  QVINDTGNLTMHKINAIVNFASNATALVGGDFSLSNPACVGLCXXXXXXXXXXXXXXXXI 900
            QVINDTGNLTMHKINAIVNFASNATALVGGDFSLSNPACVGLC                I
Sbjct: 841  QVINDTGNLTMHKINAIVNFASNATALVGGDFSLSNPACVGLCLYNYNNSNWSSFLNNSI 900

Query: 901  TGNISQIKFNDTQMLLSGKLEVNKTADINLLSINLTSNKQDILLYNNSVVLDDFILVRNL 960
            TGNISQIKFNDTQMLLSGKLEVNKTADINLLSINLTSNKQDILLYNNSVVLDDFILVRNL
Sbjct: 901  TGNISQIKFNDTQMLLSGKLEVNKTADINLLSINLTSNKQDILLYNNSVVLDDFILVRNL 960

Query: 961  VVGWNSTDIFIRNVTQWSNLNIFDDGTNATINRIENFGADSNPALIIYGQFDSMKYGTIN 1020
            VVGWNSTDIFIRNVTQWSNLNIFDDGTNATINRIENFGADSNPALIIYGQFDSMKYGTIN
Sbjct: 961  VVGWNSTDIFIRNVTQWSNLNIFDDGTNATINRIENFGADSNPALIIYGQFDSMKYGTIN 1020

Query: 1021 AVIYDFNSWYPYFEVDVVSQTATPLFFADRDQSSYGNTRHVVPDHIIVXXXXXXXXXXXX 1080
            AVIYDFNSWYPYFEVDVVSQTATPLFFADRDQSSYGNTRHVVPDHIIV            
Sbjct: 1021 AVIYDFNSWYPYFEVDVVSQTATPLFFADRDQSSYGNTRHVVPDHIIVSSSHSSSAPSSS 1080

Query: 1081 XXHKTNEKPYKIRRGFXXXXXXXXXXXXXXXXXXXGVVIALLFNPSVNGDYDIIKTNDSD 1140
              HKTNEKPYKIRRGF                   GVVIALLFNPSVNGDYDIIKTNDSD
Sbjct: 1081 SSHKTNEKPYKIRRGFVVLIGLALALATLIVLGITGVVIALLFNPSVNGDYDIIKTNDSD 1140

Query: 1141 NFAGSNITPEKLIRVL 1156
            NFAGSNITPEKLIRVL
Sbjct: 1141 NFAGSNITPEKLIRVL 1156

>YLR084C Chr12 complement(296589..300251) [3663 bp, 1220 aa] {ON}
            RAX2N-glycosylated protein involved in the maintenance of
            bud site selection during bipolar budding; localization
            requires Rax1p; RAX2 mRNA stability is regulated by Mpt5p
          Length = 1220

 Score =  615 bits (1586), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 393/1184 (33%), Positives = 635/1184 (53%), Gaps = 36/1184 (3%)

Query: 2    LNFSSSRNNEIQLLGSIETFNYYNYQGQQNFTTASSSQNELE-LIYYSNNTLLRLDAVPT 60
            LN S + +N +Q+LG ++  ++Y Y GQQNFT     +     L+YYSNNT ++L+    
Sbjct: 40   LNISQNNSNAVQILGGVDALSFYEYTGQQNFTKEIGPETSSHGLVYYSNNTYIQLEDASD 99

Query: 61   DVEMRHIIPFMDDCFILSGIGTISGIELSRQILLNLTQLSYQPIFEKELGMVKSIFVDNE 120
            D  +  I PF  D FILSG GTI+ I +  QIL NL+ LS  PIF + LG V+++  DN 
Sbjct: 100  DTRIDKITPFGVDSFILSGSGTINNISVGNQILYNLSTLSMTPIFNQSLGAVQAVLADNS 159

Query: 121  VVYFGGDITYNNNGVSGRSVVQWNSTTXXXXXXXXXXXXXXXTVNSIIRLENNNLLFTGQ 180
             +YFGG+ +YNN  ++G S + W+S +               +VNSI++L N+N+LF GQ
Sbjct: 160  SIYFGGNFSYNNGSMTGYSALIWDSISNTTQLLPFGGFGENSSVNSIVKLNNDNILFAGQ 219

Query: 181  FAKLENNS-FVSKTNRTRNFSISMEDS--EVGQQISLRQATWNA--NSNLDVDAFICPNS 235
            F  L++ S  +S +N   N + S+  +  E+GQ+I LR A+W++  ++    D+ +CPN+
Sbjct: 220  FYTLDDPSALISSSNNGTNSTSSLNATTLELGQRIPLRYASWDSQGSTTFASDSLVCPNT 279

Query: 236  DQQAWYSEGSYGVITCNFPNTLTLSKIRIYNTPITDNQISLFRLIAIPGNGILNLTYLDP 295
            ++ AW    + G + CN P  ++ +KIR+YN+  +D++IS+F+++  P + I+NLTYLDP
Sbjct: 280  NEDAWLYPDTSGSLVCNLPYEVSPTKIRLYNSQRSDSEISVFQILTDPSSSIMNLTYLDP 339

Query: 296  ISHDIKHCTENCPLFTRETLLNAMGNVTQESDVIRFINNNSTNIKWNEYYQEFAFVNQLP 355
            +S ++K+C E CPL++R TLL+A  NV+   D+I FI+NN T++KW   +Q+FAFVN+LP
Sbjct: 340  LSGELKNCGEFCPLYSRATLLSASQNVSSSMDMITFIDNNKTDVKWTSDFQDFAFVNELP 399

Query: 356  ITSLQFVASNSYYQNVGLSGFQIYQDSFPIFPNNSFNEPNCPSSNDIASYVKLSGNGWFT 415
            ++SL+FVA NSY  +VGLSG ++YQD+F  + N+S NE  C +  + +S   LS N W+ 
Sbjct: 400  VSSLKFVALNSYGGSVGLSGLELYQDTFSTYANDSLNEYGCSALTNDSSSSTLSSNDWYN 459

Query: 416  VANDNSYLANSYIPNQGTK-PSITYFVGINVPGEYVLNLVTPGCDKDNTCSTRGIVNVTT 474
                 SY+A  Y+P+Q    P + ++  I  PG Y +N+ TPGC +DNTCS RGIVNVT 
Sbjct: 460  GLTGESYIAAKYVPDQNEPIPRVKFYPNIIHPGHYTINMYTPGCLQDNTCSARGIVNVTM 519

Query: 475  FDNSNGNILGSALIYQNNNNLKYDQIFAGVLNNSISVQVEYYSGI-NTNTGTATXXXXXX 533
            ++  N  I+ + LIYQNN+NLKYDQI++G L+ S  + +EY SGI  TNT T        
Sbjct: 520  WNQQNNTIMKTYLIYQNNDNLKYDQIYSGYLDFSPEIVLEYVSGIYTTNTATVVVADQVN 579

Query: 534  XXXXXSISSEFISDQIDGDRSLHLNGIFEYSPSNFTFDNGYLTGKIDYTILDDFGVSNFN 593
                   +   +SD  +  +   LNGI +Y  SNFT      T K+  T L+ F V N+ 
Sbjct: 580  VITVSLDAFNTLSDSSNAKKETLLNGILQYQKSNFTSTRLNET-KVGNTTLNLFPVKNYP 638

Query: 594  KGASIFAVDQNQNLYLGSTNGSVYELNSLNGSSVPSTENN-LSGLINGMYSVEEGLVIFG 652
            K +S++A   +  L +G  +  +  ++  +   V S++N  + G ++G+    +GL+IFG
Sbjct: 639  KNSSLYADIYDNKLVIGGVSNRISIVDLNDDFEVTSSKNQTIQGDVHGITKTNQGLLIFG 698

Query: 653  SIAHRGREYGAVILNKSITPLDIVANDS--IQASFNSTLFGSNLLVFDNSTIFNMTSFMV 710
             I     +    + N S    + V N S  + ++ N +L  ++ +V DN  + N +S  +
Sbjct: 699  DILSSNNQSAVFLFNGS---FENVFNQSRTVNSALNISLANNDFIVLDNDYVVNASSNAL 755

Query: 711  FENTSYRNLDLRNAGKNSNDDMLLVGNIVNKGSAIGNESLLISSNGTYSPFSLSDNDTIE 770
              N+S  +L L  AG N + D+L  G + +      N S+   +     P +L       
Sbjct: 756  IRNSSSFSLSLWAAGNNGDGDVLFSGAVSHMQYGNLNGSVRFLNENEIEPLNLEGGIVPY 815

Query: 771  GAIYLNDTKALYSLSSGNVNYFQLSDKQRLPWTWQSTVVPVFYSNGQQLLGAIQENSNKS 830
               YLN++   Y+    ++N    S++    W W S +  + Y++ Q LL     +S  +
Sbjct: 816  LGAYLNESATAYAYEVDSLNKIYFSNEVYPSWNWSSGITQMLYADNQTLLAVSAGSSTTA 875

Query: 831  QIVLIDLFSSQVINDTGNLTMHKINAIVNFASNATALVGGDFSLSNPACVGLCXXXXXXX 890
            ++ + DL +  +I +    +  +INA+VNF  N + LVGGDF ++ P C GLC       
Sbjct: 876  ELSIFDLRNLTMIANETLGSNARINALVNFEKNCSMLVGGDFQMTEPNCTGLCLYNYESK 935

Query: 891  XXXXXXXXXITGNISQIKF-NDTQMLLSGKLEVNKTADINLLSINLTSNKQDILLYNNSV 949
                     I G I+Q+ F N +++++SG  E  +   I L S NLT++    LL  +  
Sbjct: 936  TWSTFLNNTIFGEITQLSFTNSSELIISGLFETKEYQSIRLGSFNLTNSTMIPLLSGSEG 995

Query: 950  VLDDFILVRNLVVGWNSTDIFIRNVTQWSNLNI-------------FDDGTNATINRIEN 996
             L+ F +  + +V WN T +FI    +W+  ++             + D  + T+N+   
Sbjct: 996  KLNSFTVTEDSIVAWNDTSLFIYRNQEWNITSLPGNASSISSVSAIYTDIESNTLNKRGI 1055

Query: 997  FGADSNPALIIYGQFDSMKYGTINAVIYDFNSWYPYFEVDVVSQT-ATPLFFADRDQSSY 1055
               ++   L++ G F+  +YG + ++++DF  W PYF  +  + +   P+ F +RD S+ 
Sbjct: 1056 NNVNNGSILLLNGNFNISQYGYLQSLLFDFQKWTPYFISETTNTSNYNPIIFINRDVSTE 1115

Query: 1056 GNTRHVVPDHIIVXX-----XXXXXXXXXXXXHKTNEKPYKIRRGFXXXXXXXXXXXXXX 1110
             N++  + +  I                     K+  K  KI RGF              
Sbjct: 1116 FNSQSPLANVNITVTSPQSTSSQPPSSSASSESKSKSKKKKIGRGFVVLIGLALALGTVS 1175

Query: 1111 XXXXXGVVIALLFNPSVNGDYDIIKTNDSDNFAGSNITPEKLIR 1154
                 GV++A +F     GDY  IK    +N     + PEKL++
Sbjct: 1176 VLGIAGVILAYVFKDP-EGDYKPIKPRIDENEMLDTVPPEKLMK 1218

>Suva_10.168 Chr10 complement(301631..305293) [3663 bp, 1220 aa] {ON}
            YLR084C (REAL)
          Length = 1220

 Score =  615 bits (1585), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 394/1185 (33%), Positives = 637/1185 (53%), Gaps = 38/1185 (3%)

Query: 2    LNFSSSRNNEIQLLGSIETFNYYNYQGQQNFTTASSSQ-NELELIYYSNNTLLRLDAVPT 60
            LN S   +N IQ+LG ++  ++Y Y GQQNFT    S+ N   L+YYSNNT + L+    
Sbjct: 40   LNISQDNDNAIQILGGVDALSFYEYTGQQNFTKEIGSETNSRGLVYYSNNTYILLEEADE 99

Query: 61   DVEMRHIIPFMDDCFILSGIGTISGIELSRQILLNLTQLSYQPIFEKELGMVKSIFVDNE 120
            D  +  I PF  D FILSG G+I+G+ L  Q+L NL+ LS   IF + LG V+++ V++ 
Sbjct: 100  DTRIDKITPFGADSFILSGSGSINGVPLGNQVLYNLSTLSMARIFTQSLGSVEAVLVNDT 159

Query: 121  VVYFGGDITYNNNGVSGRSVVQWNSTTXXXXXXXXXXXXXXXTVNSIIRLENNNLLFTGQ 180
             VYFGG+ +YNN  ++G   + W+ST+                VNSI++L ++N+LF G+
Sbjct: 160  SVYFGGNFSYNNGSMTGHGALVWDSTSNTTQLLPFGGFGEDSNVNSIVKLNDDNILFAGK 219

Query: 181  FAKLENNSFVSKTNRTRNFSISMEDS---EVGQQISLRQATWNANSNLDVDA--FICPNS 235
            F  L+++S ++ ++     + S  ++   E+GQ+I LR A+W++  +   ++   +CP++
Sbjct: 220  FYTLDDSSILTTSSTNTTNASSTLNATTLELGQRIPLRYASWDSQGSTTFESSYLVCPDT 279

Query: 236  DQQAWYSEGSYGVITCNFPNTLTLSKIRIYNTPITDNQISLFRLIAIPGNGILNLTYLDP 295
             + AW   G+ G + C  P  +  +KIR+YN+P +DN ISLF+++  P   I+NLTYLDP
Sbjct: 280  SKDAWLYPGTSGSLVCTLPYEVAPTKIRLYNSPNSDNDISLFQILTNPSGSIMNLTYLDP 339

Query: 296  ISHDIKHCTENCPLFTRETLLNAMGNVTQESDVIRFINNNSTNIKWNEYYQEFAFVNQLP 355
            IS +++ C E CPL++R+TLL+A  NV+   D+I FI+NN+T++KW+  +Q+FAF N+L 
Sbjct: 340  ISGELQSCDEFCPLYSRDTLLSASQNVSSSLDMISFIDNNNTDVKWSSDFQDFAFANELS 399

Query: 356  ITSLQFVASNSYYQNVGLSGFQIYQDSFPIFPNNSFNEPNCPS-SNDIASYVKLSGNGWF 414
            +TSL+F A NSY   VGLSG ++YQD+F  + NNS NE  C + +ND +S + LS N W+
Sbjct: 400  VTSLKFTALNSYGNKVGLSGLELYQDTFSTYANNSLNEYGCSALANDSSSSI-LSDNKWY 458

Query: 415  TVANDNSYLANSYIPNQGTK-PSITYFVGINVPGEYVLNLVTPGCDKDNTCSTRGIVNVT 473
                  SY+A  Y+PNQ    P++T++  I  PG Y +N  TPGC +DNTCS+RGIVNVT
Sbjct: 459  DGLTGQSYIAIDYVPNQTKPTPTVTFYPSIIHPGHYTINTYTPGCVQDNTCSSRGIVNVT 518

Query: 474  TFDNSNGNILGSALIYQNNNNLKYDQIFAGVLNNSISVQVEYYSGI-NTNTGTATXXXXX 532
             ++  N  ++ + LIYQNNNNLKYD+I++G L+ S  + ++Y SGI  +NT T       
Sbjct: 519  MWNPQNNTMMETYLIYQNNNNLKYDKIYSGYLDFSPEIVMKYVSGIYASNTATIMVADQV 578

Query: 533  XXXXXXSISSEFISDQIDGDRSLHLNGIFEYSPSNFTFDNGYLTGKIDYTILDDFGVSNF 592
                    S   +S+     R   LNGI +Y  SNFT      T KI  T L+ F V N+
Sbjct: 579  NIITDSLDSFSSLSETTSVKRHTPLNGILQYQRSNFTATTSNGT-KIANTTLNLFSVDNY 637

Query: 593  NKGASIFAVDQNQNLYLGSTNGSVYELNSLNGSSVPSTENN-LSGLINGMYSVEEGLVIF 651
             K +S+FA   ++ L LG  +  +  ++  +   V S+EN  + G + GM    +GL+IF
Sbjct: 638  PKNSSMFADVYDKKLILGGKDNHISVIDFNDNLEVTSSENKTIQGDVYGMTQTNQGLLIF 697

Query: 652  GSIAHRGREYGAVILNKSITPLDIVAN--DSIQASFNSTLFGSNLLVFDNSTIFNMTSFM 709
            G +     +   ++ N S    + V+N   +++ + N TL  ++L+VF+N  IFN +S  
Sbjct: 698  GDVRSSDNKSTVLMFNGS---FESVSNYSKAVENAINITLANNDLIVFNNDYIFNASSNS 754

Query: 710  VFENTSYRNLDLRNAGKNSNDDMLLVGNIVNKGSAIGNESLLISSNGTYSPFSLSDNDTI 769
               N++  +L L +AG N NDD+L  G +     +  + S    +  T    +L+     
Sbjct: 755  QISNSTSFSLSLWSAGNNDNDDVLFSGAVSQMQFSDLSGSARFLNESTVEALNLNKGIVP 814

Query: 770  EGAIYLNDTKALYSLSSGNVNYFQLSDKQRLPWTWQSTVVPVFYSNGQQLLGAIQENSNK 829
                YLN++   Y+  + +++    S+     W W + +  + Y+N Q LL    E+S  
Sbjct: 815  YLGAYLNESTIAYAYKTNSLSKIYFSNNVSPSWNWSNNITKMVYANNQTLLVIGSESSTT 874

Query: 830  SQIVLIDLFSSQVINDTGNLTMHKINAIVNFASNATALVGGDFSLSNPACVGLCXXXXXX 889
            +++ +++L +   I +    +  KINA VNF  N++ LVGGDF +S P C GLC      
Sbjct: 875  AELSILNLRNFTTIANETLGSNAKINAFVNFEKNSSLLVGGDFQMSKPNCTGLCVYNYES 934

Query: 890  XXXXXXXXXXITGNISQIKF-NDTQMLLSGKLEVNKTADINLLSINLTSNKQDILLYNNS 948
                      I G I+Q+ F N++++++SG     K   I L S NLT++    LL  + 
Sbjct: 935  KSWSTFFNNTIVGEITQLAFNNESELIISGLFATEKQQSIRLGSFNLTNSTMVPLLTGSG 994

Query: 949  VVLDDFILVRNLVVGWNSTDIFIRNVTQWSNLNIFDDGTNAT-------------INRIE 995
              L+ F +    +V WN T + I    +W+  ++  +G++ +             + +  
Sbjct: 995  GKLNSFTVTEESIVAWNDTSLLIYKDQKWNTTSLPGNGSSVSSVTTIDTNTDSYALRKRA 1054

Query: 996  NFGADSNPALIIYGQFDSMKYGTINAVIYDFNSWYPYFEVDVVSQTA-TPLFFADRDQSS 1054
               A+    L++ G F   +YG +  +++D  +W PYF  + +  ++  P  F +RD S+
Sbjct: 1055 TTDAEKGSILLLNGNFSIPQYGNLQGLLFDSQNWTPYFTSETLEASSYNPTIFINRDVSA 1114

Query: 1055 YGNTRHVVPDH---IIVXXXXXXXXXXXXXXHKTNEKPYK--IRRGFXXXXXXXXXXXXX 1109
              N++  + +    +                 + N+K  K  + RGF             
Sbjct: 1115 DFNSQIPLSNSNMTVTSPQSTSPLSPSSSASSEPNKKSKKKNMDRGFVVLIGLALALGTV 1174

Query: 1110 XXXXXXGVVIALLFNPSVNGDYDIIKTNDSDNFAGSNITPEKLIR 1154
                  GV++A +F     GDY  IK    +N     + PEKL++
Sbjct: 1175 SVLGIVGVILAYVFKDP-EGDYRPIKPRIDENEMLDTVPPEKLMK 1218

>Skud_12.152 Chr12 complement(279947..283609) [3663 bp, 1220 aa] {ON}
            YLR084C (REAL)
          Length = 1220

 Score =  611 bits (1576), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 395/1184 (33%), Positives = 633/1184 (53%), Gaps = 36/1184 (3%)

Query: 2    LNFSSSRNNEIQLLGSIETFNYYNYQGQQNFTTA-SSSQNELELIYYSNNTLLRLDAVPT 60
            LN S   +N +Q+LG ++  + Y Y GQQNFT   S   N   L+YYSNNT ++++    
Sbjct: 40   LNISQDNSNAVQILGGVDALSLYEYTGQQNFTKEISPGTNSRGLVYYSNNTYIQVEDASD 99

Query: 61   DVEMRHIIPFMDDCFILSGIGTISGIELSRQILLNLTQLSYQPIFEKELGMVKSIFVDNE 120
            D  +  I PF  D FILSG GTI+ + +  QIL NL+ LS  PIF++ LG V+S+ ++  
Sbjct: 100  DTRIDKITPFGADSFILSGSGTINNMPIGNQILYNLSTLSMAPIFDQPLGSVESVLINGT 159

Query: 121  VVYFGGDITYNNNGVSGRSVVQWNSTTXXXXXXXXXXXXXXXTVNSIIRLENNNLLFTGQ 180
             VYFGG+ +YNN  ++G S + W+S +                VNSII+L ++N+LF G+
Sbjct: 160  SVYFGGNFSYNNGSMTGHSALIWDSISNKTQLLPFGGFGENSNVNSIIKLNDDNILFAGK 219

Query: 181  FAKLENNS--FVSKTNRTRNFS--ISMEDSEVGQQISLRQATWN--ANSNLDVDAFICPN 234
            F  L+++S    + +N T N +  ++    E+GQ+I LR ATW+   ++  + ++ +CPN
Sbjct: 220  FYTLDDSSALITAGSNNTTNSTSLLNATKLELGQRIPLRYATWDFQGSTTFESNSLVCPN 279

Query: 235  SDQQAWYSEGSYGVITCNFPNTLTLSKIRIYNTPITDNQISLFRLIAIPGNGILNLTYLD 294
            +++ AW    + G + C  P  ++ +K+R+YN+  +D +IS+F+++  P N I+NLTYLD
Sbjct: 280  ANEDAWVYPATSGTLVCKLPYEVSPTKVRLYNSQDSDGEISVFQILTNPSNSIMNLTYLD 339

Query: 295  PISHDIKHCTENCPLFTRETLLNAMGNVTQESDVIRFINNNSTNIKWNEYYQEFAFVNQL 354
            P+S  +K+C E CPL++R TLL+A  NV+   D+I F++NN+T++KW+  +Q+FAF N+L
Sbjct: 340  PLSGKLKNCDEFCPLYSRATLLSASQNVSSPMDMISFLDNNNTDVKWSSDFQDFAFANEL 399

Query: 355  PITSLQFVASNSYYQNVGLSGFQIYQDSFPIFPNNSFNEPNCPSSNDIASYVKLSGNGWF 414
            P+T L+F A NSY ++VGLSG ++YQD+F  + NNS NE  C +  + +S   LS N W+
Sbjct: 400  PVTLLKFTAINSYGKSVGLSGLELYQDTFSTYANNSLNEYGCSALANDSSSSTLSSNSWY 459

Query: 415  TVANDNSYLANSYIPNQGTK-PSITYFVGINVPGEYVLNLVTPGCDKDNTCSTRGIVNVT 473
                  SY+A  Y+PNQ    P + ++  I  PG Y++N  TPGC +D+TCS+RGIVNVT
Sbjct: 460  NGLGGESYIATEYVPNQDEPTPRVNFYPNIVHPGHYIINTYTPGCVQDHTCSSRGIVNVT 519

Query: 474  TFDNSNGNILGSALIYQNNNNLKYDQIFAGVLNNSISVQVEYYSGINT-NTGTATXXXXX 532
             ++  N  ++ +  IYQNN+NLKYDQI++G L+ S  + +EY SGI+T NT T       
Sbjct: 520  MWNPQNKTMMKTYTIYQNNDNLKYDQIYSGYLDFSPEIILEYVSGIHTSNTATVVVADQV 579

Query: 533  XXXXXXSISSEFISDQIDGDRSLHLNGIFEYSPSNFTFDNGYLTGKIDYTILDDFGVSNF 592
                    +   +S+  +    + LNG+ +Y  SNFT      T KI  T L+ F V N+
Sbjct: 580  NVITVLLDAFSTLSESANTKEYIPLNGVLQYQKSNFTSTTSNET-KIGNTTLNVFAVDNY 638

Query: 593  NKGASIFAVDQNQNLYLGSTNG--SVYELNSLNGSSVPSTENNLSGLINGMYSVEEGLVI 650
               +S+FA      L LG TN   S+  LN  N   V S +  + G ++GM    +GL+I
Sbjct: 639  PNNSSLFADTNGDRLILGGTNNHISIIGLND-NLEVVLSEKQIIQGDVHGMTQTSQGLLI 697

Query: 651  FGSIAHRGREYGAVILNKSITPLDIVANDSIQASFNSTLFGSNLLVFDNSTIFNMTSFMV 710
            FG +     +   ++ N S   +    + ++ ++ N +L  ++L+VFDN  I N +S   
Sbjct: 698  FGDLLSSNNQSSVLLFNGSFENV-FNYSRTVNSAINISLANNDLIVFDNDYIVNTSSSAQ 756

Query: 711  FENTSYRNLDLRNAGKNSNDDMLLVGNIVNKGSAIGNESLLISSNGTYSPFSLSDNDTIE 770
              N++  +L L +AG N NDD+L  G +        N S    S       +L +     
Sbjct: 757  ILNSTSFSLSLWSAGSNGNDDVLFSGAVSRMQFGGLNGSARFLSEDKVQALNLDNAVVPY 816

Query: 771  GAIYLNDTKALYSLSSGNVNYFQLSDKQRLPWTWQSTVVPVFYSNGQQLLGAIQENSNKS 830
             A YLN++   Y+  +  +N    S+     W W +++  + Y+N Q LL    E+S  +
Sbjct: 817  LAAYLNESTTAYAYETNLLNKIYFSNNVDPSWNWSTSITRMLYANNQSLLTVGSESSTTA 876

Query: 831  QIVLIDLFSSQVINDTGNLTMHKINAIVNFASNATALVGGDFSLSNPACVGLCXXXXXXX 890
            ++ + +L +  +I +    +  KINA+VNF  N++ LVGG+F +S P C GLC       
Sbjct: 877  ELSIFNLKNFTMIANETMGSNAKINALVNFEKNSSLLVGGNFQMSKPNCSGLCLYNYESK 936

Query: 891  XXXXXXXXXITGNISQIKFN-DTQMLLSGKLEVNKTADINLLSINLTSNKQDILLYNNSV 949
                       G I+Q+ F+  +Q+++SG  +  +   + L S NLT++    LL     
Sbjct: 937  SWSTFFNNTFFGEITQLSFSAASQLVISGLFDTEEYQSVRLASFNLTNSTMIPLLTGAEG 996

Query: 950  VLDDFILVRNLVVGWNSTDIFIRNVTQWSNLNIFDD----------GTNA---TINRIEN 996
             ++ F++    +V WN T + I    +W+  ++  +           TNA   T+NR   
Sbjct: 997  KINSFVVTEESIVAWNDTSLLIYRDQEWNITSVPGNDSSIGSVSTINTNAGPGTLNRRAT 1056

Query: 997  FGADSNPALIIYGQFDSMKYGTINAVIYDFNSWYPYFEVDVVSQTA--TPLFFADRDQSS 1054
              A++   L++ G F    YG +  +++DF +W PYF V   S T+   P  F +RD S+
Sbjct: 1057 NNAENGTILLLSGNFSIPDYGNLQGLLFDFETWSPYF-VSESSNTSNRNPTIFINRDVST 1115

Query: 1055 YGNTRHVVPDHIIVXXXXXXXXXXXXXXHKTNE-KP---YKIRRGFXXXXXXXXXXXXXX 1110
              N++  + +  +                 ++E KP    +I RGF              
Sbjct: 1116 EFNSQIPLSNLNVTETGPQSASSQFPSSSASSELKPKSKKRIDRGFVVLIGLALALGTVS 1175

Query: 1111 XXXXXGVVIALLFNPSVNGDYDIIKTNDSDNFAGSNITPEKLIR 1154
                 GV++A +F     GDY  IK    +N     + PEKL++
Sbjct: 1176 VLGIAGVILAYVFK-DPEGDYKPIKPRIDENEMLDTVPPEKLMK 1218

>ZYRO0C01804g Chr3 (140029..143658) [3630 bp, 1209 aa] {ON} similar to
            uniprot|Q12465 Saccharomyces cerevisiae YLR084C RAX2
            N-glycosylated protein involved in the maintenance of bud
            site selection during bipolar budding localization
            requires Rax1p
          Length = 1209

 Score =  601 bits (1550), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 392/1188 (32%), Positives = 617/1188 (51%), Gaps = 49/1188 (4%)

Query: 2    LNFSSSRNNEIQLLGSIETFNYYNYQGQQNFTTA-SSSQNELELIYYSNNTLLRLDAVPT 60
            L+ +SSRN  ++LLG  +   +Y Y GQ+NFT+  +SS +   LIYYSN+T L+L     
Sbjct: 38   LDLTSSRNQALELLGDFQDLTFYKYTGQENFTSPLNSSTDSHGLIYYSNDTFLQLANGSN 97

Query: 61   DVEMRHIIPFMDDCFILSGIGTISGIELSRQILLNLTQLSYQPIFEKELGMVKSIFVDNE 120
            D +++ I+P  +D FILSG G I G  L RQ+  NLT LS++PIF++ L  V SI VD  
Sbjct: 98   DTDIKQIVPLGEDSFILSGSGHIDGYNLQRQLHYNLTDLSFKPIFQEGLTEVNSILVDQP 157

Query: 121  VVYFGGDITYNNNGVSGRSVVQWNSTTXXXXXXXXXXXXXXXTVNSIIRLENNNLLFTGQ 180
            +VYFGG+ T++N   +G SVV WNS                 TVNSIIRL+ +N+LF G 
Sbjct: 158  LVYFGGNFTFSNGSQTGHSVVLWNSEKNSTSLLPFIGFGQNSTVNSIIRLDRDNILFAGN 217

Query: 181  FAKLENNSFVSKT---NRTRNFSISMEDSEVGQQISLRQATW-NANSNLDVDAFICPNSD 236
            F +L++   +      +   +   +  D E+G  I L+ A W +++S  D D FICP+ +
Sbjct: 218  FYELDDVKLLENHILGSNNSSSKSNWTDVELGLAIPLQNANWTSSSSQFDADDFICPDPE 277

Query: 237  QQAWYSEGSYGVITCNFPNTLTLSKIRIYNTPITDNQISLFRLIAIPGNGILNLTYLDPI 296
            +++W   G+ G + C+ P   T  KIRIYN+P+ DN++SLFR++A P  GILNL+Y+DP 
Sbjct: 278  RESWLQSGTSGSLACSLPQETTPYKIRIYNSPVEDNEVSLFRILAEPTKGILNLSYVDPE 337

Query: 297  SHDIKHCTENCPLFTRETLLNAMGNVTQESDVIRFINNNSTNIKWNEYYQEFAFVNQLPI 356
              ++++C   CPL+ R+ L  A  N +   ++  F +NN+T+IKW   +QEFAFVN +PI
Sbjct: 338  EGELRYCDAFCPLYNRQRLEEASSNSSSVENMTTFSDNNTTDIKWGRDFQEFAFVNNVPI 397

Query: 357  TSLQFVASNSYYQNVGLSGFQIYQDSFPIFPNNSFNEPNCPSSNDIASY--VKLSGNGWF 414
            +S++FVA +SY  NVGLS +Q +Q    I+ NNS N+P C     + SY    +S N W 
Sbjct: 398  SSVEFVALSSYGSNVGLSSWQFFQSRASIYANNSLNQPAC---GKMQSYSNATISNNDWR 454

Query: 415  TVANDNSYLANSYIPNQGTKPSITYFVGINVPGEYVLNLVTPGCDKDNTCSTRGIVNVTT 474
               N  +YL+ SY+ +QG  P +T+   I  PG Y + L TPGC  D TC+ R IVNVT 
Sbjct: 455  QGLNGQTYLSTSYVEDQGNIPRVTFHPQIQYPGNYSIKLYTPGCLGDGTCNQRAIVNVTL 514

Query: 475  FDNSNGNILGSALIYQNNNNLKYDQIFAGVLNNSISVQVEYYSGINTNTGTATXXXXXXX 534
            +D  +   L S +IY+NNN LKYD+++ G L +S  V +EY+S I  N  T+        
Sbjct: 515  WDGDSNEPLSSEVIYENNNELKYDELWDGHLKSSPKVTLEYHSPIYPNNPTSVVVADYIS 574

Query: 535  XXXXSISSEFISDQIDGDRSLHLNGIFEYSPSNFTFDNGYLTGKIDYTILDDFGVSNFNK 594
                S    F   + D    + LNGIF+Y  SNFT         I  T LD F +S F+ 
Sbjct: 575  LEAKSF-DHFEKHKKD----ITLNGIFQYQISNFT--KNITKESIGNTSLDVFPLSYFSN 627

Query: 595  GASIFA-VDQNQNLYLGSTNGSVYELNSLNGSSVPSTEN-NLSGLINGMYSVEEGLVIFG 652
             +S+FA + +N  L L  +     E+      SV S+++ NL+  + G+ S  +GL++FG
Sbjct: 628  NSSLFASLYENDTLLLADSKSKAAEIKLDKNWSVDSSKSFNLASQVRGIGSYSDGLILFG 687

Query: 653  SIAHRGREYGAVILNKSITPLDIVANDSIQASFNSTLFGSNLLVFDNSTIFNMTSFMVFE 712
                  R+  A+  N S    D + N S++   N  L G+ LLVFDN   +N++S     
Sbjct: 688  DYNSSQRQPLALSFNGSFNSYDKI-NRSVERFTNIDLKGTELLVFDNEFFYNVSSQSYVS 746

Query: 713  NTSYRNLDLRNAGKNSNDDMLLVGNIVNKGSAIGNESLLISSNGTYSPFSLSDNDTIEGA 772
            NT+  +L + +AG+N+N D++  G + +         + +  NG+    ++ DN      
Sbjct: 747  NTTRFSLSVWSAGQNTNGDLIFSGAVSDNDYENLQGPVSLFQNGSAVSSNIKDNINPYMG 806

Query: 773  IYLNDTKALYSLSSGNVNYFQLSDKQRLPWTWQSTVVPVFYSNGQQLLG-AIQENSNKSQ 831
             YLNDT   Y+   G+ +    S+    PW W +++  + Y N   LL      + +  Q
Sbjct: 807  AYLNDTLTAYAYKDGSDSRIVFSNGDEGPWRWTNSIETMIYRNRDALLALGTSSSPSLPQ 866

Query: 832  IVLIDLFSSQVINDTGNLTMHK---INAIVNFASNATALVGGDFSLSNPACVGLCXXXXX 888
            + +++L +S+V+    N T+ K   +N+++ F  N+T L+GG+FS S+  C GLC     
Sbjct: 867  LSVLNLTTSEVL---ANETLDKGAEVNSMILFGKNSTLLIGGNFSFSDAHCNGLCLYNYK 923

Query: 889  XXXXXXXXXXXITGNISQIKF-NDTQMLLSGKLEVNKTADINLLSINLTSNKQDILLYNN 947
                       ITG ++Q++  N +++L++G L VN T+D+NL+S+N+T      LL   
Sbjct: 924  NKRWSTFANDSITGQVTQVQLRNSSELLIAGSLRVNGTSDVNLVSVNITGQGMKTLLRGW 983

Query: 948  SVVLDDFILVRNLVVGWNSTDIFIRNVTQWSNL------------NIFDDGTNATINRIE 995
               L  F++  + +V WN T +   + T W ++            +I       ++ +  
Sbjct: 984  EGPLRSFVVSEDRLVVWNDTSLMAYDNTSWRHISTSNSTSFTKLQDIHQVSLEHSLEKRA 1043

Query: 996  NFGADSN-PALIIYGQFDSMKYGTINAVIYDFNSWYPYFEVDVVSQTAT--PLFFADRDQ 1052
            N  ++SN   L++YG  D  +  +  A IYD+ SW P F  +  S+ +   P  F ++D 
Sbjct: 1044 NSSSNSNLDGLLVYGN-DKTQGDSYQASIYDYYSWTPLFIANSKSENSNSGPNIFMNQDV 1102

Query: 1053 SSYGNTRHVVPDHI----IVXXXXXXXXXXXXXXHKTNEKPYKIRRGFXXXXXXXXXXXX 1108
            S +  +  ++P+                       K +   +K+ RG+            
Sbjct: 1103 SDFFISEQMLPNPTNHTSSRSSSSSSSAVTSNSGDKKHRASHKVDRGYVVLIGLALAIGT 1162

Query: 1109 XXXXXXXGVVIALLFNPSVNGDYDIIKTNDSDNFAGSNITPEKLIRVL 1156
                   G++IA +F   + G Y+ +        A     P K  + L
Sbjct: 1163 VVVIGVFGILIAYMFGEDIGG-YEFLSPPAEGTKAAETAPPAKSSKFL 1209

>Smik_12.143 Chr12 complement(276428..280090) [3663 bp, 1220 aa] {ON}
            YLR084C (REAL)
          Length = 1220

 Score =  592 bits (1525), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 384/1184 (32%), Positives = 630/1184 (53%), Gaps = 32/1184 (2%)

Query: 2    LNFSSSRNNEIQLLGSIETFNYYNYQGQQNFTTA-SSSQNELELIYYSNNTLLRLDAVPT 60
            LN S + +N +Q+LG ++  ++Y Y GQQNFT   S   N   L+YYSNNT ++L+    
Sbjct: 40   LNISQNNSNAVQILGGVDAISFYKYTGQQNFTKGISPGTNSHGLVYYSNNTYIQLEDASD 99

Query: 61   DVEMRHIIPFMDDCFILSGIGTISGIELSRQILLNLTQLSYQPIFEKELGMVKSIFVDNE 120
            D  +  I PF DD FILSG GTI+ I +  QIL NL+ LS  PIF + LG V+++ V++ 
Sbjct: 100  DTRIDKITPFGDDSFILSGSGTINNISVGNQILYNLSTLSMAPIFNQSLGDVETVLVNDT 159

Query: 121  VVYFGGDITYNNNGVSGRSVVQWNSTTXXXXXXXXXXXXXXXTVNSIIRLENNNLLFTGQ 180
             VYFGG+ +YNN  + G S + W++ +                VNSI++L ++N++F G+
Sbjct: 160  SVYFGGNFSYNNGSMIGHSALVWDAMSDTAQLLPFGGFGENSNVNSILKLNDDNIVFAGK 219

Query: 181  FAKLENNS-FVSKTNRTRN--FSISMEDSEVGQQISLRQATWNA--NSNLDVDAFICPNS 235
            F  L+++S  ++ +N   N  FS++    E+GQ+ISLR A+W++  ++ L  ++ +CPN 
Sbjct: 220  FYTLDDSSVLITSSNNGTNSTFSLNATKLELGQRISLRYASWDSQGSTTLASNSLVCPND 279

Query: 236  DQQAWYSEGSYGVITCNFPNTLTLSKIRIYNTPITDNQISLFRLIAIPGNGILNLTYLDP 295
            +  AW    + G + CN P  ++ +KIR+YN+    ++I+LF+++  P + I+NLTYLDP
Sbjct: 280  NGNAWLYPATSGSLVCNLPYEVSPTKIRLYNSQDAGSEIALFQILTNPSSSIMNLTYLDP 339

Query: 296  ISHDIKHCTENCPLFTRETLLNAMGNVTQESDVIRFINNNSTNIKWNEYYQEFAFVNQLP 355
            +S ++K+C E CPL++R TLL A  N +   D+I FI+ N+T++KW+  +Q+FAF N+LP
Sbjct: 340  LSGELKNCDEFCPLYSRATLLAASQNASSSMDMITFIDGNNTDVKWSSDFQDFAFANELP 399

Query: 356  ITSLQFVASNSYYQNVGLSGFQIYQDSFPIFPNNSFNEPNCPSSNDIASYVKLSGNGWFT 415
            +TSL+ +A NSY  ++GLSG ++YQ++F  + NNS NE  C +  + +S   LS N W+ 
Sbjct: 400  VTSLKLIALNSYGDSIGLSGLELYQNTFSTYANNSLNEYGCSALVNDSSSSILSNNSWYN 459

Query: 416  VANDNSYLANSYIPNQGTK-PSITYFVGINVPGEYVLNLVTPGCDKDNTCSTRGIVNVTT 474
                 SY+A +YIP+Q    P + ++  I   G Y +N  TPGC +DNTCS+RGIVNVT 
Sbjct: 460  GLTGESYIATNYIPDQNEPIPRVKFYPNIIHSGHYTINTYTPGCVQDNTCSSRGIVNVTV 519

Query: 475  FDNSNGNILGSALIYQNNNNLKYDQIFAGVLNNSISVQVEYYSGI-NTNTGTATXXXXXX 533
            ++  N  ++ +  IYQNN+NLKYDQIF+G L+ S  + +EY SGI ++NT T        
Sbjct: 520  WNPQNNTMMKTYTIYQNNDNLKYDQIFSGYLDFSPEIVLEYISGIYSSNTATVVVADRVN 579

Query: 534  XXXXXSISSEFISDQIDGDRSLHLNGIFEYSPSNFTFDNGYLTGKIDYTILDDFGVSNFN 593
                   +   +S+  +  R   LNGIF+Y  SNFT      T K+  T L+ F V+N+ 
Sbjct: 580  VITVSLDTFNALSEINNVKRQTPLNGIFQYQKSNFTGTTSNKT-KVGNTTLNLFPVNNYP 638

Query: 594  KGASIFAVDQNQNLYLGSTNGSVYELNSLNGSSVPSTENN-LSGLINGMYSVEEGLVIFG 652
            K AS+     N  L +G  +  +  ++      + S+EN  + G + G+    +GL+I+G
Sbjct: 639  KNASLLVEIYNDKLIVGGVSNRISTIDLNENFEIKSSENRTIQGDVYGITKTGQGLLIYG 698

Query: 653  SIAHRGREYGAVILNKSITPLDIVANDSIQASFNSTLFGSNLLVFDNSTIFNMTSFMVFE 712
             +     +   ++ N+S   +   +   + ++ N ++  + L VFDN+ I N +S     
Sbjct: 699  DLRSSDNQSTVLLFNESFGKVPNYS-KRVNSATNISIADNELFVFDNNYIINASSNAQIS 757

Query: 713  NTSYRNLDLRNAGKNSNDDMLLVGNIVNKGSAIGNESLLISSNGTYSPFSLSDNDTIEGA 772
            N++  +L L  AG N N D+L  G + +   +  N S    +       ++         
Sbjct: 758  NSTSFSLSLWAAGNNGNGDVLFSGTVSHMEFSNLNGSASFKNEDQVQALNIGRGIVPYFG 817

Query: 773  IYLNDTKALYSLSSGNVNYFQLSDKQRLPWTWQSTVVPVFYSNGQQLLGAIQENSNKSQI 832
             YLN++ + Y+  +  +N    S+K    W W +T+  + Y+N Q +L    E+S+ + +
Sbjct: 818  AYLNESVSAYAYETDALNKIYFSNKVNPSWNWSNTITRMLYANNQTMLVVSSESSSTADL 877

Query: 833  VLIDLFSSQVINDTGNLTMHKINAIVNFASNATALVGGDFSLSNPACVGLCXXXXXXXXX 892
             + +L +   I +    +  K++A+VNF  N++ LVGGDF ++ P C GLC         
Sbjct: 878  TIFNLRNMTTIANETLGSNAKVSALVNFEKNSSILVGGDFQITKPNCSGLCLYNYETKSW 937

Query: 893  XXXXXXXITGNISQIKF-NDTQMLLSGKLEVNKTADINLLSINLTSNKQDILLYNNSVVL 951
                   I G ++Q+   N +++++SG     +   I L S NL +     LL  +   L
Sbjct: 938  STFFNNTIFGEVTQLSLANSSELIISGLFNTREHQSIRLGSFNLNNFTMVPLLSGSEGKL 997

Query: 952  DDFILVRNLVVGWNSTDIFIRNVTQWSNLNIFDD----------GTNA---TINRIENFG 998
            + F++  N +V WN T +FI    +W+  ++  D           TN    T+N+     
Sbjct: 998  NSFVVTDNSLVAWNDTSLFIYGNQKWNITSLPSDDSLIGSVSTISTNTKSDTLNKRATNN 1057

Query: 999  ADSNPALIIYGQFDSMKYGTINAVIYDFNSWYPYFEVDVV-SQTATPLFFADRDQSSYGN 1057
            A     L++ G F   +YG + ++++DF +W PYF  ++  S    P FF +RD S+  N
Sbjct: 1058 AHDGSILLLNGNFTMPQYGNLQSLLFDFQAWTPYFISEISNSSNYNPTFFINRDVSTEFN 1117

Query: 1058 TRHVVPDHIIVXX-----XXXXXXXXXXXXHKTNEKPYKIRRGFXXXXXXXXXXXXXXXX 1112
            ++  +P+  I                     K+  +  KI RGF                
Sbjct: 1118 SQITLPNLNITVTNPQSTSSQSPSTSATSESKSKSEKKKIDRGFVVLIGLALALGTVSVL 1177

Query: 1113 XXXGVVIALLFNPSVNGDYDIIKTNDSDNFAGSNITPEKLIRVL 1156
               GV++A +F     GDY  IK    +N     + PEKL++ +
Sbjct: 1178 GIVGVILAYVFKDP-EGDYKPIKPRIDENEMLDTVPPEKLMKFV 1220

>NCAS0B04980 Chr2 complement(912114..915728) [3615 bp, 1204 aa] {ON}
            Anc_8.256 YLR084C
          Length = 1204

 Score =  585 bits (1509), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 409/1179 (34%), Positives = 629/1179 (53%), Gaps = 43/1179 (3%)

Query: 6    SSRNNEIQLLGSIETFNYYNYQGQQNFTTA-SSSQNELELIYYSNNTLLRLDAVPTDVEM 64
            ++ +N  +LLG I++ ++Y Y GQQNFT+    + N   L YYSNNT ++L     D  +
Sbjct: 41   TTDDNSFELLGGIDSLSFYRYTGQQNFTSGILPNSNSNGLTYYSNNTFIQLYEPSLDSRI 100

Query: 65   RHIIPFMDDCFILSGIGTISGIELSRQILLNLTQLSYQPIFEKELGMVKSIFVDNEVVYF 124
              IIPF  D FILSG G++ G  LS Q+L NL+  S + IF + L  V SI VD  VV F
Sbjct: 101  ERIIPFGSDSFILSGKGSLGGYSLSNQLLFNLSSFSLKQIFNQTLDSVNSILVDGTVVCF 160

Query: 125  GGDITYNNNGVSGRSVVQWNSTTXXXXXXXXXXXXXXXTVNSIIRLENNNLLFTGQFAKL 184
            GG+ T + N ++G SV  WN T                 +NSI +L ++N+LF G+F  L
Sbjct: 161  GGNFTLSTNSLNGHSVALWNYTANSTSLLPFVGFGENSLINSITKLNDDNILFAGKFYTL 220

Query: 185  ENNSFVSKTNRT-RNFSISMEDSEVGQQISLRQATWNAN-SNLDVDAFICPNSDQQAWYS 242
            +N++ ++  N T RN S    D  +GQ I L  ATW++  S  D + F+CP+   +AW+ 
Sbjct: 221  DNSTLLNVVNDTMRNIS----DINLGQLIPLSAATWSSTGSFFDEETFVCPDPTIEAWFQ 276

Query: 243  EGSYGVITCNFPNTLTLSKIRIYNTPITDNQISLFRLIAIPGNGILNLTYLDPISHDIKH 302
             G+ G + CN P  +  +KIRIYN+P  DN+ISLFR+ + P   I+NLTY+DP+   +KH
Sbjct: 277  NGTSGTLNCNLPFDVAPTKIRIYNSPDPDNEISLFRIFSDPSESIMNLTYIDPVLGQLKH 336

Query: 303  CTENCPLFTRETLLNAMGNVTQESDVIRFINNNSTNIKWNEYYQEFAFVNQLPITSLQFV 362
            C   CPL+T++ L +A  NVT  S++I  +N+N+++I+W++ +QEFAFVNQL  +SL+F+
Sbjct: 337  CDAFCPLYTKQVLKSASENVTLSSEMIELLNDNTSDIRWSQDFQEFAFVNQLSASSLRFL 396

Query: 363  ASNSYYQNVGLSGFQIYQDSFPIFPNNSFNEPNCPSSNDIASYVKLSGNGWFTVANDNSY 422
            A NSY  NVGLS FQIYQD++ IF NNS NEP+C S    +S   LS N W    +D +Y
Sbjct: 397  ALNSYGTNVGLSSFQIYQDAYAIFANNSLNEPSCNSLESFSS-SDLSNNTWTRGMDDQNY 455

Query: 423  LANSYIPNQGTKPSITYFVGINVPGEYVLNLVTPGCDKDNTCSTRGIVNVTTFDNSNGNI 482
            +  +YIP+QG  P +T+   +   G+Y + L TPGC +DNTCS+RGIVNVT ++ +N +I
Sbjct: 456  VKTTYIPHQGVLPEVTFHPDLKYSGQYSIELYTPGCQQDNTCSSRGIVNVTVWNTNNNSI 515

Query: 483  LGSALIYQNNNNLKYDQIFAGVLNNSISVQVEYYSGINTNTGTATXXXXXXXXXXXSISS 542
            L + LIYQNN+ LKYD++++G LN S  + V Y+SGI + T   T           S+  
Sbjct: 516  LSTTLIYQNNDQLKYDELYSGYLNYSPKITVTYHSGIYSGTTAGTVVVDRLNIMINSL-- 573

Query: 543  EFISDQIDGDRSLHLNGIFEYSPSNF-TFDNGYLTGKIDYTILDDFGVSNFNKGASIFAV 601
            + +++  +   SL LNG+F+Y  SNF T        ++  T ++   ++ F+   S+ A 
Sbjct: 574  DILNEIHNSTNSLELNGLFQYQLSNFSTSSKDSSIARVANTSINQLTLTGFSSNVSLSAS 633

Query: 602  DQNQNLYLGSTNG--SVYELNSLNGSSVPSTENNLSGLINGMYSVEEGLVIFGSIAHRGR 659
              N  L +G+ +   S+YELN  + +   S++  + G I G+ S   G++++G       
Sbjct: 634  LYNDTLLVGAGDDGLSIYELNK-DLAIQSSSQQGIEGKITGLKSYSNGVLVYGDFNSSKE 692

Query: 660  EYGAVILNKSITPLDIVAN--DSIQASFNSTLFGSNLLVFDNSTIFNMTSFMVFENTSYR 717
                +  N S    D + N    I    N T+  S LLVFDN+ IFN++S     NTS  
Sbjct: 693  SSNVLSFNGS---FDSIGNITSPITNFANITIDDSELLVFDNNLIFNVSSSSQISNTSSF 749

Query: 718  NLDLRNAGKNSNDDMLLVGNIVNKGSAIGNESLLISSNGTYSPFSLSDNDTIEGAIYLND 777
            +L L ++G NSN D L  G +        + S+ I++N   S  SL    +   AI+LND
Sbjct: 750  SLSLWSSGSNSNGDTLFSGALSQVQFTNLSGSVSIANN--LSATSLRSIGSPYAAIFLND 807

Query: 778  TKALYSLSS-GNVNYFQLSDKQRLPWTWQSTVVPVFYSNGQQLLGAIQENSNKSQIVLID 836
            +   Y L +  + +    SD  + PW W   V  + Y   Q +L     +S   ++ +++
Sbjct: 808  SVTGYVLKNDSSTSEMIFSDGSKAPWRWTGYVDSMLYLTNQSMLAVGSSSSVNGELSILN 867

Query: 837  LFSSQVI-NDTGNLTMHKINAIVNFASNATALVGGDFSLSNPACVGLCXXXXXXXXXXXX 895
            L S +V+ N+T N     +  +V+F  N++ LVGG+FS+SN  C GLC            
Sbjct: 868  LDSFKVLANETLNQN-SSVKTMVHFERNSSILVGGNFSISNTECFGLCLYNYTGNQWYTF 926

Query: 896  XXXXITGNISQIK-FNDTQMLLSGKLEVNKTADINLLSINLTSNKQDILLYNNSVVLDDF 954
                I G I++++ FND+Q++++G  +    + +NL  +NLT NK  ++ +     + DF
Sbjct: 927  LNGTINGTITKLQIFNDSQLIIAGVFDTKSQSSVNLALMNLTDNKLVLIRWGFKEPVKDF 986

Query: 955  ILVRNLVVGWNSTDIFIRNVTQWSNLNIFDDGTNATINRI------------ENFGADSN 1002
            I + + +  WN T +F      W ++ I +  ++ TI+ I             +    SN
Sbjct: 987  ITIDDNIFAWNETSLFEYTSNSWVDIPISNSNSSTTIDSIGWTTTTDNNLKKRDNSETSN 1046

Query: 1003 PALIIYGQFDSMKYGTINAVIYDFNSWYPYFEVD-VVSQTATPL-FFADRDQSSYGNTR- 1059
              LI+ GQ     YG I A+IY+F  W PY  ++ +VS    P   F DRD S   +++ 
Sbjct: 1047 NVLIVKGQIYDNVYGHIQAMIYNFEEWIPYLSINSLVSSANQPAELFIDRDVSKLFDSQL 1106

Query: 1060 --HVVPDHIIVXXXXXXXXXXXXXXHKTNEKPYKIRRGFXXXXXXXXXXXXXXXXXXXGV 1117
               V      +               K ++   KI RGF                   GV
Sbjct: 1107 ALQVSNTTASITASSSTPTPTSSPKKKLHQSKKKIDRGFVVLIGLALALGTMTVLGIVGV 1166

Query: 1118 VIALLFNPSVNGDYDIIKTNDSDNFAGSNITPEKLIRVL 1156
            ++A  F    +GDYD+I    +++     + PEKL+  +
Sbjct: 1167 ILAYAFRDD-DGDYDVITPRVNEDEMLKTVPPEKLMEFI 1204

>NDAI0B02380 Chr2 complement(595444..599103) [3660 bp, 1219 aa] {ON}
            Anc_8.256 YLR084C
          Length = 1219

 Score =  586 bits (1510), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 391/1190 (32%), Positives = 632/1190 (53%), Gaps = 43/1190 (3%)

Query: 2    LNFSSSRNNEIQLLGSIETFNYYNYQGQQNFTTAS-SSQNELELIYYSNNTLLRLDAVPT 60
            LN ++S ++  QLLG I+  ++Y Y+GQQNFTT      N   LIYYSNNTL++L+    
Sbjct: 38   LNLTASNDDTFQLLGDIDGLSFYRYKGQQNFTTGIIPGSNSNGLIYYSNNTLIQLEEPSN 97

Query: 61   DVEMRHIIPFMDDCFILSGIGTISGIELSRQILLNLTQLSYQPIFEKELGMVKSIFVDNE 120
            D  +  I PF  D FILSG G++SG  L+ Q+L NLT LS +PIF   +  VK+I +D+ 
Sbjct: 98   DTYIAKITPFGSDSFILSGTGSLSGYSLTNQLLYNLTTLSIEPIFNTSIEEVKTILIDDS 157

Query: 121  VVYFGGDITYNNNGVSGRSVVQWNSTTXXXXXXXXXXXXXXXTVNSIIRLENNNLLFTGQ 180
            +VYFGG+ T  N   +  S++ W+ST+                +NSI++L ++N+LF G+
Sbjct: 158  LVYFGGNFTVLNGTSNIHSLIMWDSTSSSTEFLNFGGFGENSIINSIVKLNDDNILFAGE 217

Query: 181  FAKLENNSF-VSKTNRTRNFSISMEDSEVGQQISLRQATWN-ANSNLDVDAFICPNSDQQ 238
            F  L+   F +  T  ++N   +    ++GQ + L  +TW+   S  D D F+CP++ ++
Sbjct: 218  FYTLDEPDFLIQNTTSSQNNIFNSTTVDIGQLVPLSASTWDTGESTFDSDTFVCPDTTEE 277

Query: 239  AWYSEGSYGVITCNFPNTLTLSKIRIYNTPITDNQISLFRLIAIPGNGILNLTYLDPISH 298
            +W   G+ G +TC  P  +  +KIRIYN+P  DNQ+SLFR++     GI+NLTY+DPISH
Sbjct: 278  SWIQSGTTGSLTCKLPFEVAPTKIRIYNSPNEDNQVSLFRILTNEAQGIMNLTYIDPISH 337

Query: 299  DIKHCTENCPLFTRETLLNAMGNVTQESDVIRFINNNSTNIKWNEYYQEFAFVNQLPITS 358
            ++KHC   CPL+++  L  A  N T  SD I  + +N+T+IKW + +QEFAF+NQ+ ++S
Sbjct: 338  ELKHCDAFCPLYSKAILSQAYANTTSPSDTIHLLADNTTDIKWTQEFQEFAFINQISVSS 397

Query: 359  LQFVASNSYYQNVGLSGFQIYQDSFPIFPNNSFNEPNCPSSNDIASYVKLSGNGWFTVAN 418
            +QFVA +SY  NV LS FQ+YQ+++ +F N++ NEPNC +S + +S   LS N W     
Sbjct: 398  VQFVALDSYGNNVALSSFQLYQNAYAVFANDTLNEPNC-NSIESSSSSSLSANDWEMGLT 456

Query: 419  DNSYLANSYIPNQGTKPSITYFVGINVPGEYVLNLVTPGCDKDNTCSTRGIVNVTTFDNS 478
              +Y++ +Y PNQ   P +++   I  PG+Y +N+ TPGC +D+TCS+R IVNVT +D+ 
Sbjct: 457  GQTYISTTYTPNQDPVPYVSFSPQIKYPGQYSINIYTPGCTQDDTCSSRAIVNVTVWDSD 516

Query: 479  NGNILGSALIYQNNNNLKYDQIFAGVLNNSISVQVEYYSGINTNTGTATXXXXXXXXXXX 538
              +IL + LIYQNN  LKYD++++G L++S  V +EY SG+  +   AT           
Sbjct: 517  GTSILATELIYQNNKELKYDELYSGYLSSSPRVTIEYVSGLYASNTVATVVADRLNVLID 576

Query: 539  SISSE-FISDQIDGDRSLHLNGIFEYSPSNFTFDNGYLTG-KIDYTILDDFGVSNFNKGA 596
            S+      S+  +    ++LNG+ +Y  SNF+  +   T  KI  T L+   +  F+K  
Sbjct: 577  SLEVPGLTSNGTNNTEIMNLNGLLQYQISNFSTSSSETTDVKITNTSLNQLSLEQFSKNT 636

Query: 597  SIFA-VDQNQNLYLGSTNG--SVYELNSLNGSSVPSTENNLSGLINGMYSVEEGLVIFGS 653
            S++A +  +  L LG++NG   V +LN  N     S E +L+G   G  S   G++ +G 
Sbjct: 637  SMYADLYDDNTLLLGNSNGGIKVVKLNE-NMDIESSNEASLTGNTAGFSSYSGGILAYGE 695

Query: 654  IAHRGREYGAVILNKSITPL-DIVANDSIQASFNSTLFGSNLLVFDNSTIFNMTSFMVFE 712
                 +    V  N +   + +   N SI    N T+  + LLV DN  I+N++S     
Sbjct: 696  YNLSSKITYLVNYNGTFNEIPNFNKNSSITNVVNLTIHDTELLVIDNQAIYNVSSSSTIT 755

Query: 713  NTSYRNLDLRNAGKNSNDDMLLVGNIVNKGSAIGNESLLISSNGTYSPFS--LSDNDTIE 770
            N+S   L L ++G N N D +  G I        N S+ I +N T +  +  +S  +++ 
Sbjct: 756  NSSALQLSLWSSGSNLNRDTVFSGAIALLDYTDLNGSIAIGNNFTVTNITNNVSSTNSLY 815

Query: 771  GAIYLNDTKALYSLSSGNVNYFQLSDKQRLPWTWQSTVVPVFYSNGQQLLGAIQENSNK- 829
              ++LND+ ++Y+  + + +    S+    PW++   +  + YS+ Q +L     + NK 
Sbjct: 816  TGLFLNDSLSIYASKTDSYSELLFSNGYSAPWSFFEGINYMVYSSHQTMLAVASSDFNKN 875

Query: 830  SQIVLIDLFSSQVI-NDTGNLTMHKINAIVNFASNATALVGGDFSLSNPACVGLCXXXXX 888
            S++ +++L + + I N+T N+   KIN ++NF  N+T +VGG+F++    C GLC     
Sbjct: 876  SELSILNLTTFETIANETLNVN-SKINGLINFEHNSTLIVGGNFTILQSNCSGLCLYNYD 934

Query: 889  XXXXXXXXXXXITGNISQIKF-NDTQMLLSGKLEVNKTADINLLSINLTSNKQDILLYNN 947
                       I G I+Q++  N TQ+LLSG       + +NL  ++L++     +   +
Sbjct: 935  SNEWLTFANHSINGTIAQMELINGTQLLLSGLFNAQNISSVNLAIMDLSTYAVSSIKMGD 994

Query: 948  SVVLDDFILVRNLVVGWNSTDIFIRNVTQWSNLNI-FDDGTNATINRIENF--------- 997
            + +L  F  + + ++ WN   +       WS +   F+  T  TI  IE           
Sbjct: 995  ANILQSFATIGDKIITWNGIMLESYENGAWSTIQSNFNSST--TIRSIEPIGFGPTLQKR 1052

Query: 998  -GADSNPALIIYGQFDSMKYGTINAVIYDFNSWYPYFEVDVVSQTATPLFFADRDQSSYG 1056
             G  S    II G     +YGTI A+IY+F  W PY+ +   +       F +RD S+  
Sbjct: 1053 DGTGSADGFIINGNIYDTEYGTIQAMIYNFKEWRPYYIISSTNSQIAGQIFMNRDDSALY 1112

Query: 1057 NTRHVV--PDHIIVXXXXXXXXXXXXXXHKTNEKPY--------KIRRGFXXXXXXXXXX 1106
            N++ V+  P++  V              H +  +P+        KI RGF          
Sbjct: 1113 NSQSVLQNPNNATVTTPSSTSSGTPSATHSS--QPHHQKQVGRKKIDRGFVVLIGLALAL 1170

Query: 1107 XXXXXXXXXGVVIALLFNPSVNGDYDIIKTNDSDNFAGSNITPEKLIRVL 1156
                     G+V+A +F    +G +D +    +++     + PEKL++ L
Sbjct: 1171 GTVSLLGIIGLVLAYIFKDG-DGSHDALNPRTNEDEMLETVPPEKLMKFL 1219

>KAFR0B02690 Chr2 complement(539470..543102) [3633 bp, 1210 aa] {ON}
            Anc_8.256 YLR084C
          Length = 1210

 Score =  584 bits (1506), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 395/1181 (33%), Positives = 625/1181 (52%), Gaps = 36/1181 (3%)

Query: 2    LNFSSSRNNEIQLLGSIETFNYYNYQGQQNFT-TASSSQNELELIYYSNNTLLRLDAVPT 60
            L FSS+ ++ +QLLGS +  + Y Y GQQNF+   +   N   L+YYSNNTL++L+    
Sbjct: 40   LIFSSNNDSSLQLLGSYDALSLYTYTGQQNFSYQITPDTNSNGLVYYSNNTLIQLNQGLD 99

Query: 61   DVEMRHIIPFMDDCFILSGIGTISGIELSRQILLNLTQLSYQPIFEKELGMVKSIFVDNE 120
            D  + +I+P   D FILSG G+++   L  Q+  NL+ LS  PIF   L  V+SI VD +
Sbjct: 100  DTRINNIVPIGSDSFILSGSGSLNEYSLENQLFYNLSSLSVYPIFNTTLEQVESILVDED 159

Query: 121  VVYFGGDITYNNNGVSGRSVVQWNSTTXXXXXXXXXXXXXXXTVNSIIRLENNNLLFTGQ 180
            +VYFGG+ T++N    G SV  WN T+               ++N+I+RL ++N+LF G+
Sbjct: 160  LVYFGGNFTFSNGTDDGHSVAVWNITSNSTGLLPFLGFGENSSINNILRLNDDNILFAGE 219

Query: 181  FAKLENNSFVSKTNRTRNFSISMEDSEVGQQISLRQATWNAN-SNLDVDAFICPNSDQQA 239
            F  L++ S +  T+ T N + ++ D E+   + L +ATW+++ S+ D  +FIC N D  A
Sbjct: 220  FYTLDDASLL--TSNTSNATTNIYDLELSPLLPLNEATWSSDVSDFDASSFICVNPDSDA 277

Query: 240  WYSEGSYGVITCNFPNTLTLSKIRIYNTPITDNQISLFRLIAIPGNGILNLTYLDPISHD 299
            W+  G+ G + C+ P    L+KIRIYN+P + NQIS FRLI+ P   I+N+TY+DP + +
Sbjct: 278  WFVSGTTGTLACSLPYDSALTKIRIYNSPDSQNQISEFRLISDPSGSIMNMTYIDPRTGN 337

Query: 300  IKHCTENCPLFTRETLLNAMGNVTQESDVIRFINNNSTNIKWNEYYQEFAFVNQLPITSL 359
            ++HC   CPL +R+TL +A  +    S++ R +++N+T IKW+  YQEF FVN +  T L
Sbjct: 338  LEHCDSYCPLLSRDTLSSAS-DAASVSEMARLLSDNATVIKWSAEYQEFGFVNVVSTTLL 396

Query: 360  QFVASNSYYQNVGLSGFQIYQDSFPIFPNNSFNEPNCPSSNDIASYVKLSGNGWFTVAND 419
            QF+A NSY  NV L+G+ +YQD + +F NNS N  +C S+N   +   LS N W   A+ 
Sbjct: 397  QFLALNSYGSNVALAGYSLYQDEYAVFANNSLNGASCTSNNSDYTSSTLSDNDWVFGASG 456

Query: 420  NSYLANSYIPNQGTKPSITYFVGINVPGEYVLNLVTPGCDKDNTCSTRGIVNVTTFDNSN 479
             +Y+   Y       P +T+   +   G+YV+NL TPGC  D TCSTRG+VNVT +D S+
Sbjct: 457  QTYVTTFYTEGDDPIPQVTFNANLPYSGDYVINLYTPGCSDDGTCSTRGLVNVTVYDESD 516

Query: 480  GNILGSALIYQNNNNLKYDQIFAGVLNNSISVQVEYYSGINTNTGTATXXXXXXXXXXXS 539
             +IL +  IYQNN  LKYD++F+G L NS+ + +EY SGI++++   T           S
Sbjct: 517  DSILSTVEIYQNNEALKYDELFSGYLKNSVRIVLEYVSGISSDSTGTTVVADRSNIYVTS 576

Query: 540  ISSEFISDQIDGDR---SLHLNGIFEYSPSNFTFDNGYLTGKIDYTILDDFGVSNFNKGA 596
            +    I  QI   +   ++ LNG+F+Y  SNF+      + K+  T L+ + +  FN  +
Sbjct: 577  LD---ILGQISSSKNGSTVALNGLFQYQLSNFSSTFNSSSAKVGKTFLNQYPLDIFNTNS 633

Query: 597  SIFAVDQNQNLYLGSTNGSVYELNSLNGSSVPSTENN-LSGLINGMYSVEEGLVIFGSIA 655
            S+FA   +  L +G    SVY L S N  +  +++N+ + G    M    EG+ ++G+  
Sbjct: 634  SLFASTYDNYLLVGGAEQSVYALESSNDLNFSTSDNSGVEGQFKNMQPFSEGIFLYGNFN 693

Query: 656  HRGREYGAVILNKSITPLDIVANDSIQASFNSTLFGSNLLVFDNSTIFNMTSFMVFENTS 715
              G   GAV  N S  P     N SI    N T   S +LVF+N+ ++N++S  +  N+S
Sbjct: 694  LSGVTEGAVTYNGSFNPFTQYGNSSIDTFKNVTFGNSEILVFNNAYLYNVSSSTLMSNSS 753

Query: 716  YRNLDLRNAGKNSNDDMLLVGNIVNKGSAIGNESLLISSNGTYSPFSLSDNDTIEGAIYL 775
              +L L +AG N+N D+L  G       +  NES+ I +N      + +++      +Y+
Sbjct: 754  SLSLSLWSAGANANGDLLFNGASSQMSYSFNNESINIGANNIVQGLNFNESIDPYLGLYM 813

Query: 776  NDTKALYSLSSGNVNYFQLSDKQRLPWTWQSTVVPVFYSNGQQLL--GAIQENSNKSQIV 833
            N +   Y     +      ++  +  W W + VV   YS+ Q LL  G      + S + 
Sbjct: 814  NTSHGAYFYQDDDNTRVYFTNGSQPSWQWPNDVVAAIYSDNQSLLIAGTSSSLESSSFLT 873

Query: 834  LIDLFSSQVI-NDTGNLTMHKINAIVNFASNATALVGGDFSLSNPACVGLCXXXXXXXXX 892
            +++  +  VI N++ +    +I+ IVNFASNATA++GG+FS+ N  C GLC         
Sbjct: 874  VLNTTTYDVIANESLSSQQSQISGIVNFASNATAIIGGNFSMPNVNCFGLCLFNYGNSTW 933

Query: 893  XXXXXXXITGNISQIK-FNDTQMLLSGKLEVNKTADINLLSINLTSNKQDILLYNNSVVL 951
                   I G +  ++ FN++++++SG       + I + S+NL +NK   L    S   
Sbjct: 934  SSFADASINGTVDHMQLFNESELIVSGLFSTKNISSITMASLNLKNNKITALKSGESNTF 993

Query: 952  DDFILVRNLVVGWNSTDIFIRNVTQW-----SNLN---IFDDGTNATI-NRIENFGADSN 1002
              F +    +V WN+T + I     W     SN+N   + D+    T+ + +      S+
Sbjct: 994  KSFTVADQKIVAWNNTALSIYEDNVWTVERISNINSSSVVDNLNYVTLASALSKRDTSSS 1053

Query: 1003 PALIIYGQFDSMKYGTINAVIYDFNSWYPYFEVDVVSQTATPLFFADRDQSSYGNTRHVV 1062
             A+++ GQ     YG I A++YDF+SW PY  ++  S ++   F  DRD SS+ NT+  +
Sbjct: 1054 DAILVSGQLYDNSYGHIQAMVYDFSSWVPYLLINSESDSSINAFI-DRDMSSFTNTQVAL 1112

Query: 1063 PDHIIVXXXXX-------XXXXXXXXXHKTNEKPYKIRRGFXXXXXXXXXXXXXXXXXXX 1115
              +                        +KT+++  KI RGF                   
Sbjct: 1113 LTNSGTVSNSSSSTTSPGASASATSIPNKTHKR--KIDRGFVVLLGLALALGTVAVLGIA 1170

Query: 1116 GVVIALLFNPSVNGDYDIIKTNDSDNFAGSNITPEKLIRVL 1156
            GV++A +F    NG Y+ I     +N     + PEKL++ +
Sbjct: 1171 GVIMAYVFRDD-NGAYEPINPRIDENEMIETVPPEKLMKYI 1210

>SAKL0H17204g Chr8 (1522944..1526579) [3636 bp, 1211 aa] {ON} similar
            to uniprot|Q12465 Saccharomyces cerevisiae YLR084C RAX2
            N-glycosylated protein involved in the maintenance of bud
            site selection during bipolar budding localization
            requires Rax1p
          Length = 1211

 Score =  579 bits (1492), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 399/1186 (33%), Positives = 618/1186 (52%), Gaps = 45/1186 (3%)

Query: 2    LNFSSSRNNEIQLLGSIETFNYYNYQGQQNFTTASSSQNELELIYYSNNTLLRLDAVPTD 61
            ++ SSS N+E+ LLG  E   +Y Y GQ+NFT  S ++ E +LIYYSN T ++LD++  +
Sbjct: 40   IDLSSSVNDEMALLGDFEDLTFYRYTGQENFT-GSITETEKDLIYYSNGTFIKLDSLSDE 98

Query: 62   ---VEMRHIIPFMDDCFILSGIGTISGIE-LSRQILLNLTQLSYQPIFEKELGMVKSIFV 117
                ++ HIIPF DD FILSG GT+ G   L +Q+L NL+ L Y  IF + +  V  I  
Sbjct: 99   NATADINHIIPFGDDSFILSGTGTLPGGHNLEQQLLYNLSSLEYTAIFNQSISTVNDILA 158

Query: 118  DNEVVYFGGDITYNNNGVSGRSVVQWNSTTXXXXXXXXXXXXXXXTVNSIIRLENNNLLF 177
            D+E+VYFGG+  Y     +G SVV WNSTT                VNSI+RL+N+N++F
Sbjct: 159  DDEIVYFGGEFQYTLGNSTGHSVVLWNSTTNEIQLLPFKGFGLDSVVNSILRLDNDNIVF 218

Query: 178  TGQFAKLENNSFVSKTNRTRNFSISMEDSEVGQQISLRQATWNANSNLDVDAFICPNSDQ 237
             G+F  L++N+ + K  R  N S +  D E  Q I L+ A W++  +L+  + ICP+ D 
Sbjct: 219  AGKFNTLDDNTLL-KQIRGSNSSKNATDIEFDQLIPLKHAGWSSQGSLEHSSLICPSDDS 277

Query: 238  QAWYSEGSY-GVITCNFPNTLTLSKIRIYNTPITDNQISLFRLIAIPGNGILNLTYLDPI 296
              W+ EG+  G  T +    L  SK+RIYN   +D Q+SLFR+I  P NGI+NLTYLDP 
Sbjct: 278  DGWFQEGTATGDFTVSLLTDLRPSKLRIYNAFDSDYQVSLFRIITSPANGIMNLTYLDPQ 337

Query: 297  SHDIKHCTENCPLFTRETLLNAMGNVTQESDVIRFINNNSTNIKWNEYYQEFAFVNQLPI 356
            + ++ +C   CPL + E L  A  NVT  SD + +I NN+TNIKW   YQEFAFVN++ +
Sbjct: 338  TGELSYCDAWCPLLSTELLEQAEANVTISSDSVAYIGNNNTNIKWTSAYQEFAFVNEVSV 397

Query: 357  TSLQFVASNSYYQNVGLSGFQIYQDSFPIFPNNSFNEPNCPSSNDIASYVKLSGNGWFTV 416
             SL F+A +SY  +VGL GF++YQ+ +P F N++ N+PNC + N  +  V  S   W   
Sbjct: 398  ESLTFLALDSYGSSVGLDGFEMYQNGYPTFANDTLNQPNCDNINSYSHAVTSSKQQWTQG 457

Query: 417  ANDNSYLANSYIPNQGTKPSITYFVGINVPGEYVLNLVTPGCDKDNTCSTRGIVNVTTFD 476
            + D+SY+ ++Y    G  PS+ ++  I   G+Y LN+VTPGC  D +CS+RGIVNVT +D
Sbjct: 458  SMDSSYILSTY-DGTGDLPSVNFYPNITYAGDYTLNMVTPGCTGDGSCSSRGIVNVTVWD 516

Query: 477  NSNGNILGSALIYQNNNNLKYDQIFAGVLNNSISVQVEYYSGINTNTGTATXXXXXXXXX 536
              N  +L + LIYQNNN+ KYD +++G L ++  + +++Y  INT++ T+          
Sbjct: 517  QINDTVLSTKLIYQNNNDEKYDLLYSGYLESAPKITLKFYESINTDSSTSIMVADRVDVI 576

Query: 537  XXSISSEFISDQIDGDRSLH--LNGIFEYSPSNF-TFDNGYLTGKIDYTILDDFGVSNFN 593
              SI    I     G ++++  LNG+F+Y  SNF T  N  L  KI  T ++ + + N  
Sbjct: 577  IDSIDQSKI-----GLKTINETLNGLFQYQISNFTTISNDSL--KIGNTTINRYSIENVP 629

Query: 594  KGASIFAVDQNQNLYL-GSTNG-SVYELNSLNGSSVPSTENNLSGLINGMYSVEEGLVIF 651
              + +FA   N  L + G+ NG +V +LN  + + +        G   G+ +   GL+  
Sbjct: 630  SNSELFAGYYNNTLLVDGAFNGIAVLQLND-DLNIISEQRMGTGGPTEGINTYSNGLLFL 688

Query: 652  GSIAHRGREYGAVILNKSITPLDIVANDSIQASFNSTLFGSNLLVFDNSTIFNMTSFMVF 711
            G      ++   +  N + +    +  + I    N T+  S LLVF+N  IFN++S    
Sbjct: 689  GDFNLSSQQISTLSYNGTFSSFGNLRTN-ITRFNNITIDDSELLVFNNRYIFNVSSNEYI 747

Query: 712  ENTSYRNLDLRNAGKNSNDDMLLVGNIVNKGSAIGNESLLISSNGTYSPFSLS--DNDTI 769
             NTS   L L +AG NS +D +LVG +  +     N ++ I+   + S   L   D   +
Sbjct: 748  RNTSSFALSLWSAGSNSKEDGILVGAVSQRQYTELNGAVYINDANSISTIGLPSFDGKRV 807

Query: 770  EGAIYLNDTKALYSLSSGN--VNYFQLSDKQR---LPWTWQSTVVPVFYSNGQQLL--GA 822
              A Y+ND+   Y+ SS N   ++  ++   R   LP +W   V  + Y+    LL  G 
Sbjct: 808  YTATYINDSSTAYAYSSKNDSTHHVLIARGNRSEDLPVSWSHAVNTMIYNKDDSLLAVGT 867

Query: 823  IQENSNKSQIVLIDLFSSQVINDTGNLTMHKINAIVNFASNATALVGGDFSL--SNPACV 880
               ++N + + L ++ +S++I +        +NAIV F  N++ LVGGDF++   + +C 
Sbjct: 868  NAGDTNGTSLSLFNISNSKMIGEENLGAKSSVNAIVAFNKNSSLLVGGDFTIDKDDTSCS 927

Query: 881  GLCXXXXXXXXXXXXXXXXITGNISQIK-FNDTQMLLSGKLEVNKTADINLLSINLTSNK 939
            GLC                I+GNI+ ++ FN TQ+L+SG L       INL  +N+ SN+
Sbjct: 928  GLCLYNYNASKWSNFYNNSISGNITDLQFFNGTQLLISGNLYTENETGINLAKLNMASNE 987

Query: 940  QDILLYNNSVVLD--DFILVRNLVVGWNSTDIFIRNVTQWSNLNI--FDDG--TNATINR 993
              IL + +++V     F    + ++  +  +I      +W NL    F+D     A +  
Sbjct: 988  VTILRHGSTMVQSFVTFDHTTDELITQSDNEISYYTNGEWKNLTSEDFNDSLYMGAQLIP 1047

Query: 994  IENFGAD---SNPALIIYGQFDSMKYGTINAVIYDFNSWYPYFEVDVVSQTATPLFFADR 1050
            ++   +    SN AL++ G      YG+++A++YDF  W PYF VD  +       F ++
Sbjct: 1048 LKQTSSKRDVSNRALLVNGDLKHSTYGSVSAMLYDFEDWMPYFIVDGENAGRASNIFMNK 1107

Query: 1051 DQSSYGNTRHVVPDHIIVXXXXXXXXXXXXXXHKTNEKPYKIRRGFXXXXXXXXXXXXXX 1110
            D SS   T+ ++                     K      KI RGF              
Sbjct: 1108 DLSSLYTTQTILQGS-NTSTSTTSSNMPSETSDKNESSSDKIDRGFVVLIGLALAIGTVA 1166

Query: 1111 XXXXXGVVIALLFNPSVNGDYDIIKTNDSDNFAGSNITPEKLIRVL 1156
                 G +IA  F  +  G Y+ +K    +      + PEKL++ +
Sbjct: 1167 VLGGAGAIIAYFFAGN-KGQYEPLKPRVDEGDMIDTVPPEKLMKFV 1211

>Kpol_392.10 s392 (27006..30686) [3681 bp, 1226 aa] {ON}
            (27006..30686) [3681 nt, 1227 aa]
          Length = 1226

 Score =  562 bits (1448), Expect = e-180,   Method: Compositional matrix adjust.
 Identities = 396/1188 (33%), Positives = 606/1188 (51%), Gaps = 46/1188 (3%)

Query: 9    NNEIQLLGSIETFNYYNYQGQQNFT-TASSSQNELELIYYSNNTLLRLDAVPTDVEMRHI 67
            NNEIQ+L +IE   +Y YQGQQNFT +  ++ N   LIYYSN+TL++L     + ++  I
Sbjct: 45   NNEIQILSNIEGLTFYQYQGQQNFTGSIDTNSNTHGLIYYSNDTLIKLLEGSDNTKIDQI 104

Query: 68   IPFMDDCFILSGIGTISGIELSRQILLNLTQLSYQPIFEKELGMVKSIFVDNEVVYFGGD 127
            +P  +D FILSG GT+ G +L  Q+L NL+ LS  P+F  +L  +KSI VD ++VYFGG+
Sbjct: 105  VPLDEDAFILSGSGTLGGFQLENQLLYNLSDLSIIPLFNNQLQNIKSILVDKDIVYFGGN 164

Query: 128  ITYNNNGVSGRSVVQWNSTTXXXXXXXXXXXXXXXTVNSIIRLENNNLLFTGQFAKLENN 187
             +Y +N  +  S++ WN  T               TVNSI++L+ +NLLF G F+ L++ 
Sbjct: 165  FSYTSNNKTANSIISWNKVTKNVDMLPFIGFGKNSTVNSILKLDEDNLLFFGDFSTLDDK 224

Query: 188  SFVSKTNRTRNFSISMEDS------EVGQQISLRQATWNANSNLDVDA-FICPNSDQQAW 240
            S +     T     S   S      E+ QQISL+ A+W +  +L     FICPN   +AW
Sbjct: 225  SLLVSNITTYTQQNSTSSSSTETNLELEQQISLKYASWASLGDLKSSTQFICPNGQNEAW 284

Query: 241  YSEGSYGVITCNFPNTLTLSKIRIYNTPITDNQISLFRLIAIPGNGILNLTYLDPISHDI 300
             S G+ G ITCN     +LSKIRI+N+P   +QI+ FR++  P NGI+NLTYLDP++ ++
Sbjct: 285  SSAGTTGEITCNLAFEASLSKIRIFNSPYEQDQIASFRIVTAPSNGIMNLTYLDPLTSEV 344

Query: 301  KHCTENCPLFTRETLLNAMGNVTQESDVIRFINNNSTNIKWNEYYQEFAFVNQLPITSLQ 360
            K+C   CPL++   L  +  N T  +    FIN N TNI W+  YQEFAFVNQ+P+T+LQ
Sbjct: 345  KYCDAFCPLYSSNALQASSENATTSASTSAFINGNKTNIGWSTDYQEFAFVNQVPVTALQ 404

Query: 361  FVASNSYYQNVGLSGFQIYQDSFPIFPNNSFNEPNCPSSNDIASYVKLSGNGWFTVANDN 420
             +A  SY  NVGLSGFQ+YQ+S+ IF NNS NEP C S N +     LS N W+   N  
Sbjct: 405  VIALTSYGDNVGLSGFQLYQNSYSIFANNSLNEPACDSPNTVIPSSYLSNNIWYQGLNSQ 464

Query: 421  SYLANSYIPNQGTKPSITYFVGINVPGEYVLNLVTPGCDKDNTCSTRGIVNVTTFDNSNG 480
            SY+A  Y P     P + ++  IN  G Y +N+ TPGC  D TCS RGIVNVT +D +  
Sbjct: 465  SYIATKYTPGDDPSPLVNFYPSINRIGNYTVNIYTPGCTGDGTCSFRGIVNVTLWDTATN 524

Query: 481  NILGSALIYQNNNNLKYDQIFAGVLNNSISVQVEYYSGINTNTGTATXXXXXXXXXXXSI 540
            +++ + LIYQNNN +KYDQ+F G L+ +  V +EYYSGIN                  +I
Sbjct: 525  DLISTTLIYQNNNEMKYDQLFEGFLDYAPKVTLEYYSGINDENSPVVVVADNVDLVPINI 584

Query: 541  S-SEFISDQIDGDRSLH--LNGIFEYSPSNFTFDNGYLTGKIDYTILDDFGVSNFNKGAS 597
               E I +       L   LNG+F+Y  SNFT  N   T K+D T L+ F VS F+   S
Sbjct: 585  ELDETIGNVTSSTEELKVPLNGMFQYQLSNFTSSNNNSTLKVDNTSLNLFPVSRFSSSVS 644

Query: 598  IFAVDQNQNLYLGSTNGSVYELNSLNGSSVPSTE-NNLSGLINGMYSVEEGLVIFGSIAH 656
            ++ V+ N+ L LG +   VY L+  N +++ ST      G + G  +   G+V+FG+   
Sbjct: 645  LYGVEYNETLLLGGSIAGVYALSLSNYTNIRSTRIVETGGEVTGTGAYAGGVVLFGNFNI 704

Query: 657  RGREYGAVILNKSITPLDIVANDSIQASFNSTLFG-SNLLVFDNSTIFNMTSFMVFENTS 715
              R   ++  N +      V  +S  A+F++  FG S +L F+N   FN ++     NTS
Sbjct: 705  SNRIVSSLSYNGTFDSFGNV--NSNIATFSNLTFGESEILAFNNEYFFNTSTSSYIFNTS 762

Query: 716  YRNLDLRNAGKNSNDDMLLVGNIVNKGSAIGNESLLISSNGTYSPFSLSDNDTIEGAIYL 775
              +L + +AG N   D L  G I        N S +++ NGT     L +       +YL
Sbjct: 763  ALSLSIWSAGSNDFGDTLFSGLITRNEFPNLNNSAVLTGNGTAQSLQLRNGIQPYLGVYL 822

Query: 776  NDTKALYSLSSGNVNYFQLSDKQRLPWTWQSTVVPVFYSNGQQL-LGAIQENSNKSQIVL 834
            ND+   Y   S + +    S+  +  W    +V   +YS+ + + +G+   N +    + 
Sbjct: 823  NDSLTAYLYDSSSNSNILFSNGLQGNWNLPRSVSSAYYSDNETMFVGSSLSNGDSGAELF 882

Query: 835  IDLFSSQ--VINDTGNLTMHKINAIVNFASNATALVGGDFSLSNPACVGLCXXXXXXXXX 892
            +  F++   + N+T ++    IN+IV+F  N++ LVGGDF+  N  C             
Sbjct: 883  VLNFTTMDLLYNETFDVN-SSINSIVSFGRNSSLLVGGDFTAPNTNC-SNLCLLNLGNNQ 940

Query: 893  XXXXXXXITGNISQIKF-NDTQMLLSGKLEVNKTADINLLSINLTSNKQDILLYNNSVVL 951
                     G I+ ++F ND+++L+SG       + I+L  I+L +N++   L ++S  +
Sbjct: 941  WSSFSNKFDGTITGLEFANDSRLLISGSYRFENQSGISLGYIDL-NNQEFKSLLSDSQKV 999

Query: 952  DDFILVRNLVVGWNSTDIFIRNVTQWSNLNIFDDGTNATINRIE-------------NFG 998
            + F      +V W+S+ I+      WSN  I +  ++ +I  ++                
Sbjct: 1000 NSFNYNNGTIVAWDSSTIYSYRGDSWSNHQIPNTNSSTSIKNVQIVSKLNNSLSTNNTSN 1059

Query: 999  ADSNPALIIYGQFDSMKYGTINAVIYDFNSWYPYFEVDVVSQ--TATPLFFADRDQSSYG 1056
              ++  ++++G+  S  YG + A+ YDF +W PY+     S   T+    F ++D S   
Sbjct: 1060 NLNDELILVFGELYSEDYGFVQAMFYDFQNWIPYYITQPYSSLNTSKNSLFMNKDISLLY 1119

Query: 1057 NTRHVVPD--------HIIVXXXXXXXXXXXXXXHKTNEKPYKIRRGFXXXXXXXXXXXX 1108
             ++ V+ +                           K      KI RG+            
Sbjct: 1120 ESQVVLQNPNSTISISSTSSSSATTRSSSTSSTSLKNGNIESKIHRGYVVLIGLALAIGT 1179

Query: 1109 XXXXXXXGVVIALLFNPSVNGDYDIIKTNDSDNFAGSNITPEKLIRVL 1156
                   GV +A +F+    G+Y  IK    ++     + PEKL++ +
Sbjct: 1180 VAILGIFGVTMAYIFSDD-KGEYVRIKPRIDEHEMLDTVPPEKLMKFI 1226

>TPHA0B03250 Chr2 (745716..749363) [3648 bp, 1215 aa] {ON} Anc_8.256
            YLR084C
          Length = 1215

 Score =  543 bits (1399), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 382/1203 (31%), Positives = 605/1203 (50%), Gaps = 77/1203 (6%)

Query: 2    LNFSSSRNNEIQLLGSIETFNYYNYQGQQNFT----TASSSQNELELIYYSNNTLLRLDA 57
            LNF+++ +N IQLLG +E   +Y+Y+GQQNFT    +  SS N L  IYYS++ L++L+ 
Sbjct: 42   LNFNNT-SNSIQLLGDVENLQFYHYEGQQNFTDDGNSGISSTNNL--IYYSDDVLIQLEV 98

Query: 58   VPTDVEMRHIIPFMDDCFILSGIGTISGIELSRQILLNLTQLSYQPIFEKELGMVKSIFV 117
               D +++ IIP  DD F+LSG G ++G  L RQ+L NLT LS +PIF+++LG + SI V
Sbjct: 99   GSNDTDIQKIIPVGDDSFVLSGSGHLNGYALGRQLLYNLTTLSIKPIFDQDLGNITSILV 158

Query: 118  DNEVVYFGGDITYNNNGVSGRSVVQWNSTTXXXXXXXXXXXXXXXTVNSIIRLENNNLLF 177
            D E+VYFGG+ TY     +  SV+ WN T+                VNSI++L ++N+LF
Sbjct: 159  DEEIVYFGGEFTYQTRSQNSSSVISWNMTSDEVIELPFQGFGSDSKVNSILKLNDDNILF 218

Query: 178  TGQFAKLENNSFVS--KTNRTRNFSISMEDS---EVGQQISLRQATWNANSN-LDVDAFI 231
             G F  L N+S ++   T+   NF+ S E+S   ++ QQISL+ ATW+A +   D + F+
Sbjct: 219  VGMFDTLGNSSLLTYNTTSNFSNFTNSTENSSTIQLEQQISLKYATWDAGTAYFDQNNFV 278

Query: 232  CPNSDQQAWYSEGSYGVITCNFPNTLTLSKIRIYNTPITDNQISLFRLIAIPGNGILNLT 291
            C     +AW  EG  G +  NFPNT++ SKIRIYN    ++ +SLFR++  P NGI+NLT
Sbjct: 279  CEAGSSEAWIVEGRSGNLQLNFPNTVSPSKIRIYNANTAEDGVSLFRIVTSPSNGIMNLT 338

Query: 292  YLDPISHDIKHCTENCPLFTRETLLNAMGNVTQESDVIRFINNNSTNIKWNEYYQEFAFV 351
            Y+DP++  +K+C   CPL     L  A  N T E+    FINNN+T++ W+E YQEFAF+
Sbjct: 339  YVDPLTGQLKYCDAFCPLLNSSGLETASSNSTSETRQRVFINNNTTSVTWSESYQEFAFI 398

Query: 352  NQLPITSLQFVASNSYYQNVGLSGFQIYQDSFPIFPNNSFNEPNCPS-SNDIASYVKLSG 410
            N + +++L  +A +SY     LSG +++QDS   + NN+ N+P C + S  + S   LS 
Sbjct: 399  NNIDVSALTLIAQDSYGSKTALSGIELFQDSHTAYANNTLNQPGCDTESTSLFSSSVLSD 458

Query: 411  NGWFTVANDNSYLANSYIPNQGTKPSITYFVGINVPGEYVLNLVTPGCDKDNTCSTRGIV 470
            NGW+   + +SY+A +Y  +    P++ ++  I   G++ + + TPGC  D TC +R IV
Sbjct: 459  NGWYKGLDSDSYIAANYQSDSSPLPTVQFYPNIQAVGDFSIKMYTPGCLADGTCESRSIV 518

Query: 471  NVTTFDNSNGNILGSALIYQNNNNLKYDQIFAGVLNNSISVQVEYYSGINTNTGTATXXX 530
            NVT  D ++G +L + LIYQNNN +KYD+IF G L  S  + + +YS I  +  +A    
Sbjct: 519  NVTVLDPTDGTVLSTQLIYQNNNEMKYDEIFNGKLTVSPEITLTFYSTILPDLDSAIIVA 578

Query: 531  XXXXXXXXSIS-SEFISDQIDGDRSLHLNGIFEYSPSNFTFDNGYLTGKIDYTILDDFGV 589
                     I+  + + D      SL LNG+F+Y  SNFT D      K+    +    +
Sbjct: 579  DRVDLTPTYINVDDILLDSNLKSTSLKLNGLFQYQLSNFTSDT---KTKVGNNSIHQLAL 635

Query: 590  SNFNKGASIFAVDQNQNLYLGSTNGSVYEL---------NSL---NGSSVPSTENNLSGL 637
            S F    S+     N +++L  +  ++ +L         N++   NG      EN   GL
Sbjct: 636  SQFPSSVSLIGNTFNNSIFLAGSTSNIVQLQLNSDLELRNTVVVDNGGETTRIENYSQGL 695

Query: 638  I-NGMYSVEEGLVI--------FGSIAHRGREYGAVILNKSITPLDIVANDSIQASFNST 688
            +  G Y++    V+        F S +  G                    D++    N T
Sbjct: 696  LFFGQYNISSTNVVDNLSFNGTFSSFSQLG--------------------DNVTTFANFT 735

Query: 689  LFGSNLLVFDNSTIFNMTSFMVFENTSYRNLDLRNAGKNSNDDMLLVGNIVNKGSAIGNE 748
              GS LL F+N  ++N++S     N +     +   G NSN+D LL+GNIV    +  NE
Sbjct: 736  YEGSELLFFNNDYLYNVSSESYIYNNTMFTASVLATGANSNNDTLLLGNIVRSEYSNFNE 795

Query: 749  SLLISSNGTYSPFSLSDNDTIEGAIYLNDTKALYSLSSGNVNYFQLSDKQRLPWTWQSTV 808
             L +  N +    + S +     A++LNDT  LY+   G  +     +       +  T+
Sbjct: 796  PLKLYGNSSLESLTFSSSIVPYAAVFLNDTANLYAYKDGENSKIIYGNNMTTSLDFSGTL 855

Query: 809  VPVFYSNGQQLLGAIQENSNKSQIVLIDLFSSQVINDTGNLTMHK-INAIVNFASNATAL 867
              + +SN   LL A    +N S  ++I   S  +   + NL  +  I ++++F SN T L
Sbjct: 856  NKLSFSNNSSLLFANAITNNGSSSLVISNISDGMSLASENLNNYGYITSMIDFNSNNTIL 915

Query: 868  VGGDFSLSNPACVGLCXXXXXXXXXXXXXXXXITGNISQIK-FNDTQMLLSGKLEVNKTA 926
            V G+F+L +  C G+C                I G+I +++ +N  Q+L+SG       +
Sbjct: 916  VSGNFTLDDVDCHGICLYNYFTKKWSAFANSTIKGSIVEMQLWNSDQILISGLFSAQNYS 975

Query: 927  DINLLSINLTSNKQDILLYNNSVVLDDFILVRNLVVGWNSTDIFIRNVTQWSNLNIFDDG 986
             I L S+++      +L  ++ + +  FI     +  W++  I      +W+ ++ F + 
Sbjct: 976  SITLASLDIKGYNISVLSDDSKIEISSFIHDGQSITVWSNDTIMEYKSEKWNEIS-FPNT 1034

Query: 987  TNATINRIENFGAD-----SNPALII--YGQFDSMKYGTINAVIYDFNSWYPYFEVD--V 1037
            T+  I  +E    D     SN + I+  YG+F+S  YG +NA+++    W PYF ++   
Sbjct: 1035 TSKYIESVEAVSIDLQNSTSNVSKILFAYGEFNSTLYGRLNAMLFRAGDWKPYFSINNFQ 1094

Query: 1038 VSQTATPLFFADRDQSSYGNTRHVVPDHIIVXXXXXXXXXXXXXX----HKTNEKPYKIR 1093
            V++      F +RD SS  N+++ +P +I                    +K   K  KI 
Sbjct: 1095 VNEDPAITLFENRDLSSLFNSKNSLPANITSAETSSRSTVSSATATTVVNKIEGKHSKID 1154

Query: 1094 RGFXXXXXXXXXXXXXXXXXXXGVVIALLFNPSVNGDYDIIKTNDSDNFAGSNITPEKLI 1153
            RGF                   GV IA +F       Y+ IK           + PEKL+
Sbjct: 1155 RGFVVLIALALAVGTVALLGLFGVTIAYIFRDE--QKYESIKPRIDGQEMLDTVPPEKLM 1212

Query: 1154 RVL 1156
            + +
Sbjct: 1213 KFI 1215

>TDEL0F03830 Chr6 complement(701362..704949) [3588 bp, 1195 aa] {ON}
            Anc_8.256 YLR084C
          Length = 1195

 Score =  537 bits (1383), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 379/1176 (32%), Positives = 604/1176 (51%), Gaps = 55/1176 (4%)

Query: 12   IQLLGSIETFNYYNYQGQQNFT-TASSSQNELELIYYSNNTLLRLDAVPTDVEMRHIIPF 70
            +QL G      +  Y+GQ+NFT T +++ +   ++YYSN+T ++L    +D  +  I+PF
Sbjct: 44   LQLFGGFNALTFPQYEGQENFTGTINNNTDSRGIVYYSNDTFIKLINGSSDSYVEKIVPF 103

Query: 71   MDDCFILSGIGTISGIELSRQILLNLTQLSYQPIFEKELGMVKSIFVDNEVVYFGGDITY 130
              + FIL G G++ G EL RQ+L NL+ LS +PIFE  L  V+ I  D  V YFGG+ ++
Sbjct: 104  GSESFILGGSGSLLGYELGRQLLYNLSDLSLRPIFENSLTDVRVILEDYPVAYFGGNFSF 163

Query: 131  NNNGVSGRSVVQWNSTTXXXXXXXXXXXXXXXTVNSIIRLENNNLLFTGQFAKLENNSFV 190
            +N    G SV  WNS++                VNSII+L+++N+LFTG+F  L++ + +
Sbjct: 164  DNGSTVGHSVATWNSSSNTTSLLPFGGFGEESIVNSIIKLDSDNILFTGEFYTLDDQTLL 223

Query: 191  ------SKTNRTRNFSISMEDSEVGQQISLRQATWNANSNLDVD--AFICPNSDQQAWYS 242
                  SKTN +++        E+ + + LR ATWN +S+   D  AFICPNS ++AW  
Sbjct: 224  ITNENTSKTNHSQSI-------EINELLPLRAATWNTDSDSSFDSSAFICPNSQKEAWSV 276

Query: 243  EGSYGVITCNFPNTLTLSKIRIYNTPITDNQISLFRLIAIPGNGILNLTYLDPISHDIKH 302
              + G +  + P      K+RIYN+P   N +SLFR+I  P NGI+NLTY+DP+S ++ +
Sbjct: 277  PSTSGSLEASLPYESYPKKVRIYNSPEEHNAVSLFRIITKPSNGIMNLTYVDPLSGELLN 336

Query: 303  CTENCPLFTRETLLNAMGNVTQESDVIRFINNNSTNIKWNEYYQEFAFVNQLPITSLQFV 362
            C   CPL  +++L  A+ N    S V+R ++NN T+I+W+  YQ+FAFVN++ +T LQF+
Sbjct: 337  CDAFCPLMLQDSLKAAVAN-GNTSQVVR-LDNNLTDIQWSYDYQDFAFVNKIAVTDLQFL 394

Query: 363  ASNSYYQNVGLSGFQIYQDSFPIFPNNSFNEPNCPSSNDIASYVKLSGNGWFTVANDNSY 422
            A +SY   VGLS FQ+YQD+   + NNS NE  C  SNDIAS   LS + W       SY
Sbjct: 395  ALSSYGDAVGLSSFQLYQDTLTTYANNSLNEVGC-ESNDIASTSALSDSEWQQGLFGQSY 453

Query: 423  LANSYIPNQGTKPSITYFVGINVPGEYVLNLVTPGCDKDNTCSTRGIVNVTTFDNSNGNI 482
            L   +   Q T P +T++  IN  G+Y +NL TPGC  D TC++R IVNVT +    G+I
Sbjct: 454  LVADFRTGQETLPKVTFYPAINYAGQYTMNLYTPGCSSDQTCTSRSIVNVTMWSEVGGSI 513

Query: 483  LGSALIYQNNNNLKYDQIFAGVLNNSISVQVEYYSGINTNTGTATXXXXXXXXXXXSISS 542
            L S L++QNN  +KYDQ+++G L  +  + +EYYS I+ N  +             S+  
Sbjct: 514  LSSILLHQNNEAMKYDQVYSGHLETAPVLTLEYYSPISPNNPSNVVVADRLEVIVESV-- 571

Query: 543  EFISDQIDGDRSLHLNGIFEYSPSNFTFDNGYLTGKIDYTILDDFGVSNFNKGASIFAVD 602
            + + +Q   D ++ LNG+F+Y  SNFT ++      I  T L+ + V NF K AS+F+  
Sbjct: 572  DILKNQT--DETIPLNGMFQYQLSNFT-NSTDSKPSIANTTLNSYTVQNFPKNASLFSSM 628

Query: 603  QNQNLYLGSTNGSVYELNSLNGSSVPSTENNLS-GLINGMYSVEEGLVIFGSIAHRGREY 661
             N  L++G +   V  +       V ST    + G + G+ S  +G+++FG+     +  
Sbjct: 629  YNNTLWVGGSVSGVAAVELDEDLHVSSTAKYATGGTVEGISSYSDGIILFGTFNLSSQPV 688

Query: 662  GAVILN---KSITPLDIVANDSIQASFNSTLFGSNLLVFDNSTIFNMTSFMVFENTSYRN 718
              +  N    S   L+         SF        LLVF+N  +FN++S     N+S   
Sbjct: 689  STLTFNGVFGSFGNLETTLRTYTNVSFQQ----DELLVFNNEYVFNLSSNSYISNSSTFG 744

Query: 719  LDLRNAGKNSNDDMLLVGNIVNKGSAIGNESLLISSNGTYSPFSLSDNDTIEGAIYLNDT 778
            L L +AG+N  DD L  G +          S  I SN + + FSL +      A +LND+
Sbjct: 745  LSLWSAGRNQFDDTLFSGAVTKNQFPGLYGSASIYSNSSVAHFSLQNGAQPYAACHLNDS 804

Query: 779  KALYSLSSGNVNYFQLSDKQRLPWTWQSTVVPVFYSNGQQLLGAIQENSNKSQIV-LIDL 837
               Y+   G+V+     + +  PWTW  T+  + YS    +L    + S    I+ L +L
Sbjct: 805  VTAYAYRYGSVSQLYFDNGKEGPWTWFGTINSMRYSKNSTILAIGTDGSTDEPILSLFNL 864

Query: 838  FSSQVINDTGNLTMHKINAIVNFASNATALVGGDFSLSNPACVGLCXXXXXXXXXXXXXX 897
             S  V+ +T       I+++V F  N++ LVGGD+ +S+  C GLC              
Sbjct: 865  TSFDVLANTTISENGTISSMVFFDRNSSLLVGGDYHISDADCSGLCLYNYDQKQWTKFAN 924

Query: 898  XXITGNISQIKFNDT-QMLLSGKLEVNKTADINLLSINLTSNKQDILLYNNSVVLDDFIL 956
              ITGNI++++ +++  +L+SG + V     +NLLS N+++ + + L+++++  +  FI 
Sbjct: 925  NSITGNITEMQLSESYDLLISGAMNVANKTSVNLLSFNMSNYEVNPLVWDSNGPIKSFIA 984

Query: 957  VRNLVVGWNSTDIFIRNVTQWSNLNIFDDGTNATINRIENFGADSNPAL----IIYGQFD 1012
              N ++ WN T +   +   W NL  FD+  ++ I+ ++     + PAL         FD
Sbjct: 985  EDNDIITWNETSLSGYSDGDWQNLE-FDN--SSLISIVDVIAVKTEPALDKRQTFSSTFD 1041

Query: 1013 SMKYGTIN------AVIYDFNSWYPYFEVDVV--SQTATPLFFADRDQSSYGNTRHVVPD 1064
            ++     N      A IY+F  W PY+  +       +   FF ++D S   ++++++ D
Sbjct: 1042 AILVAGQNYAEYPQASIYNFQRWLPYYVANKADDEDPSRTTFFTNQDDSQLYDSQNLLSD 1101

Query: 1065 HIIVXXXXXXXXXXXXXXHKTN----EKPYKIRRGFXXXXXXXXXXXXXXXXXXXGVVIA 1120
                                +      K  KI RGF                   GV++A
Sbjct: 1102 PTRTTTSSSSSTTSSSQTSPSKGSLVRKSGKINRGFVVLIGLALALGTVVIIGITGVLLA 1161

Query: 1121 LLFNPSVNGDYDIIKTNDSDNFAGSNITPEKLIRVL 1156
            L+FN   +  Y+ +     ++     + PEKL++ L
Sbjct: 1162 LVFNG--HSGYEQVDPRADESEMIDTVPPEKLLKFL 1195

>KNAG0G02000 Chr7 complement(443631..447239) [3609 bp, 1202 aa] {ON}
            Anc_8.256 YLR084C
          Length = 1202

 Score =  531 bits (1368), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 383/1192 (32%), Positives = 593/1192 (49%), Gaps = 83/1192 (6%)

Query: 8    RNNEIQLLGSIETFNYYNYQGQQNFTTASSSQNELELIYYSNNTLLRL-DAVPTDVEMRH 66
            +NN+ Q+L  I   ++Y Y GQQNFTT ++  +   LIYYSN T + L D++  + +++ 
Sbjct: 43   KNNQFQILDDINGISFYEYLGQQNFTTDANVTDVQRLIYYSNETFMSLSDSIAAEAQIQG 102

Query: 67   IIPFMDDCFILSGIGTISGIELSRQILLNLTQLSYQPIFEKELGMVKSIFVDNEVVYFGG 126
            IIP  DD FILSG G I+ + L+ Q++ N+T LS   IF+  L  ++ + VD  +VYF G
Sbjct: 103  IIPLGDDSFILSGQGMINNVSLASQLVFNMTDLSITKIFDTPLRSIEGVTVDGPLVYFMG 162

Query: 127  DITYNNNGVSGRSVVQWNSTTXXXXXXXXXXXXXXXTVNSIIRLENNNLLFTGQFAKLEN 186
            + T+NNN       + W+S                  +NSI++L ++N+LF G F+ + N
Sbjct: 163  NFTFNNN----TGAIMWDSRDRSINLLPFHGFGPYANINSILKLNDDNILFAGHFSTVWN 218

Query: 187  NSFVSKTNRTRNFSISMEDSEVGQQISLRQATWNANSNLDVDAFICPNSDQQAWYSEGSY 246
            +S + ++N +     +     +   + L+ + W  N  LD    ICP+  + +W    + 
Sbjct: 219  SSLLLQSNVSEESVRNTTSLLLNPSVPLQYSQWKTNGELDSSQLICPDPSKDSWSVSATT 278

Query: 247  GVITCNFPNTLTLSKIRIYNTPITDNQISLFRLIAIPGNGILNLTYLDPISHDIKHCTEN 306
            G  TC  P  +T SKIRIYN+P  D+Q+SLFR +  P   I+NLTYLDP+S ++  C   
Sbjct: 279  GDFTCELPFQITPSKIRIYNSPDKDSQVSLFRFLTYPAGSIMNLTYLDPLSGNMTSCDAF 338

Query: 307  CPLFTRETLLNAMGNVTQESDVIRFINNNSTNIKWNEYYQEFAFVNQLPITSLQFVASNS 366
            CPL+++ T+L +  + T E++ +  INNNSTNI+W   YQEFA V+ +  TSL+F A  S
Sbjct: 339  CPLYSK-TVLQSQWDNTAEANTVAIINNNSTNIQWTPNYQEFALVSPVAATSLEFNALAS 397

Query: 367  YYQNVGLSGFQIYQDSFPIFPNNSFNEPNC----PSSNDIASYVKLSGNGWFTVANDNSY 422
            Y  N+GL+GFQIYQ SF  F NNSFN PNC      SN+  +   LS N W +V     Y
Sbjct: 398  YGNNLGLAGFQIYQASFSAFGNNSFNTPNCNNNDKDSNNTFTSSSLSPNNWTSVG---EY 454

Query: 423  LANSYIPNQGTKPSITYFVGINVPGEYVLNLVTPGCDKDNTCSTRGIVNVTTFDNSNGNI 482
            L   Y PN+   P +TY + I   GEY +N+ TPGC  DNTCSTRGIVN T FD     +
Sbjct: 455  LTVGYTPNENPVPKVTYKIDIQHSGEYSINVFTPGCSADNTCSTRGIVNYTLFDTVTNKM 514

Query: 483  LGSALIYQNNNNLKYDQIFAGVLNNSISVQVEYYSGINTNTGTATXXXXXXXXXXXSISS 542
            L ++LIYQNN+ +KYD +++G LN+S  + + YYSG+     + T           +I S
Sbjct: 515  LATSLIYQNNDEIKYDTLYSGQLNSSCEITMTYYSGL---YASNTVTTIVADRVDLNIIS 571

Query: 543  EFISDQIDGDRSLHLNGIFEYSPSNFTFDNGYLTGKIDYTILDDFGVSNFNKGASIFAVD 602
              +S + +  + L LNG+F+Y  SNFT D+  +  KI  T L+ F ++NF    S+ A  
Sbjct: 572  MDLSHRTEVSK-LALNGLFQYQISNFTNDS--IPMKIANTSLNQFALNNFEPSVSLRAFP 628

Query: 603  -QNQNLYLGSTNGSVYELN------SLNGSSVPSTENNLSGLINGMYSVEEGLVIFGSIA 655
              N ++ L  T G+++ +N        N + + STEN              GLV+     
Sbjct: 629  LSNSSILLSGTEGNMFSINLNTDLSVQNSTRLISTEN-----FTTFQPYSNGLVMLDG-- 681

Query: 656  HRGREYGAVILNKSITPLDIVANDSIQASF-NSTLFGSNLLVFDNSTIFNMTS-FMVFEN 713
                +    +   +   L+   + S+     N TL G  LLVF+N  I+N+TS      N
Sbjct: 682  ----QGNVSLFKDNFKNLNTTMDGSLATDVANITLNGDELLVFNNGYIYNVTSQQQTRSN 737

Query: 714  TSYRNLDLRNAGKNSNDDMLLVGNIVNKGSAIGNESLLISS--NGTYSPFSLSDNDTIEG 771
            +S  NL + +AG NS +D + +G +V    AI N+S  +++  N      SL  N     
Sbjct: 738  SSIFNLTVSSAGANSINDTIFLGKVVQWQYAIANQSAQVNADFNDGIEQMSLPSNTVPSR 797

Query: 772  AIYLNDTKALYSLSSGNVNYFQLSDKQRLPWT---------WQSTVVPVFYSNGQQLL-- 820
             I+LND    Y        +++ S+K +L  T         W      V Y     LL  
Sbjct: 798  GIFLNDDSTGY--------FYKESNKSKLYITNSNSTSGLEWYGEPETVVYDKNDTLLMV 849

Query: 821  GAIQENSNKSQIVLIDLFSSQVINDTGNLTMHKINAIVNFASNATALVGGDFSLSNPACV 880
            G   +N+  S + L +L S  VI +        I++++ FA N T LV GDF  SN  C 
Sbjct: 850  GYYNDNTFSSTLSLTNLTSFDVIKEENLNVGSSISSLLYFAKNDTLLVAGDFEPSNGNCS 909

Query: 881  GLCXXXXXXXXXXXXXXXXITGNISQIKF--NDTQMLLSGKLEVNKTADINLLSINLTSN 938
             LC                ++G+++ ++   NDT ++L G L + +  D+N+  +NL++N
Sbjct: 910  DLCLYNYKSGQWDSLANNSVSGSVAALQLYQNDTILVL-GNLTLPQANDVNMAFVNLSNN 968

Query: 939  KQD--ILLYNNSVVLDDFILVRNLVVGWNSTDIFIRNVTQWSNLNIFDDGTNAT----IN 992
                 I+  +  V L   I+  + +V WN T +F  +   W+ +++    ++AT    + 
Sbjct: 969  HVGSLIMKKDAPVNLHSMIVSNSRIVAWNDTVLFSFDGNSWTRVSVPGTDSSATSISSVQ 1028

Query: 993  RIENFGADSNPALIIYGQFDSMKYGTINAVIYDFNSWYPYFEVDVVSQTATPLFFADRDQ 1052
             I   G D   AL++ G+F   ++G I +++Y+F  W PY       +  T   F +RD 
Sbjct: 1029 FISMEGTDD--ALLLLGEFRHSEFGDIKSIVYNFRDWIPYLLYVDGPRQGTGHLFMNRDI 1086

Query: 1053 SSYG-------NTRHVVPDHIIVXXXXXXXXXXXXXXHK---TNEKPYK--IRRGFXXXX 1100
            S +        N+  V+ +                   K   T+ KP +  + RGF    
Sbjct: 1087 SLHNIAQIPLLNSTRVLTNQSFASSTSSSVSSTSTTLPKVSTTHSKPGRRIVDRGFVVLI 1146

Query: 1101 XXXXXXXXXXXXXXXGVVIALLFNPSVNGDYDIIKTNDSDNFAGSNITPEKL 1152
                           GV++A +F  +V   Y  +     +N   + + PEKL
Sbjct: 1147 GLALALATVSVMGVAGVLLAYIFRDNVGDSYQTLNPRMDENAMVNTLPPEKL 1198

>TBLA0E04390 Chr5 complement(1115294..1119130) [3837 bp, 1278 aa] {ON}
            Anc_8.256 YLR084C
          Length = 1278

 Score =  490 bits (1262), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 373/1256 (29%), Positives = 638/1256 (50%), Gaps = 128/1256 (10%)

Query: 2    LNFSSSRNNEIQLLGS--IETFNYYNYQGQQNFTTASSSQNELELIYYSNNTLLRLDAVP 59
             N   S N  +QLL S   +T N+ +Y GQQNFT    S ++  LIYYSN+T +RL  +P
Sbjct: 43   FNLQDSTNQSLQLLTSNGFDTLNFVHYNGQQNFTQPIISSSQNHLIYYSNDTYIRLLDIP 102

Query: 60   TDVEMRHIIPFMDDCFILSGIGTISGIELSRQILLNLTQLSYQPIFEKEL-GMVKSIFVD 118
                ++HIIP+  D FILSG G+++G ELS Q++ NLT LS  PIFE +L   V++IF D
Sbjct: 103  YSTRIQHIIPYGQDAFILSGTGSLNGFELSNQLVYNLTDLSLTPIFENKLVPEVRTIFKD 162

Query: 119  NE--VVYFGGDITY---NNNGVSGRSVVQWNSTTXXXXXXXXXXXXXXXTVNSIIRLENN 173
             +  +VYFGG+ +Y   ++N  +G  ++ W+S++                +N+I++L +N
Sbjct: 163  PDTNLVYFGGNFSYLLPDSNISNG--LIIWDSSSNDTISYEFGGFGSNSVINNILKLNSN 220

Query: 174  NLLFTGQFAKLENNSF------VSKTNRTRNFSISMEDS--EVGQQISL---RQATWNAN 222
            +LLF+GQF  L++ S       ++  N T +       S  E+ Q+I L   + +T + N
Sbjct: 221  DLLFSGQFYTLDDPSILHIPYNITFPNNTSSLLSQQNVSTFELNQRIPLTFGKFSTADTN 280

Query: 223  SNLDVDAFICPNSDQQAWYSEGSYGVITCNFPNTLTLSKIRIYNTPITDNQISLFRLIAI 282
              ++ +  ICP S+ +AW S+   G +    P ++  SKIRI+N+P  D++++ FR+   
Sbjct: 281  DYINKNQLICPTSEIEAWASDSKAGSLQITLPFSIRPSKIRIFNSPDPDDEVATFRINPG 340

Query: 283  PGNGILNLTYLDPISHDIKHCTENCPLFTRETLLNAMGNVTQESDVIRFINNNSTNIKWN 342
              N I++L YLDP+   +K+C+E CPL+ R  L     N   +S VI  ++NN+T+IKW+
Sbjct: 341  NQNSIMSLAYLDPLDGQLKYCSEFCPLYNRNQLKLFNSNDNLKSHVITLLDNNTTDIKWS 400

Query: 343  EYYQEFAFVNQLPITSLQFVASNSYYQNVGLSGFQIYQDSFPIFPNNSFNEPNCPSS--- 399
              YQEFAFVNQ  +T+L+F A +SY   VGLSG  ++Q    +F N S+N+P+C      
Sbjct: 401  TTYQEFAFVNQFDLTTLEFQALSSYGSRVGLSGLSLFQSDIAVFANESYNKPSCNDQTAY 460

Query: 400  --NDI----------ASYVKLSGNGWFTVANDNSYLANSYIPNQGTKPSITYFVGINVPG 447
               D+          +SY  LS N W+T   ++ YLA +Y+ +    P++T++  +   G
Sbjct: 461  DNEDLIKAALPRVMGSSYSILSDNDWYTPLPNSDYLACTYLSSSKLIPTVTFYPNLLYAG 520

Query: 448  EYVLNLVTPGCDKDNTCSTRGIVNVTTFDNSNGNILGSALIYQNNNNLKYDQIFAGVLNN 507
             Y ++++TPGC  DN+C +RGIVNVT ++ ++ +IL ++LIYQ N N K+DQIF G L+ 
Sbjct: 521  NYTVDMITPGCTADNSCDSRGIVNVTMWNQTDSSILQTSLIYQTNENYKFDQIFNGYLDP 580

Query: 508  SISVQVEYYSGINTNTGTATXXXXXXXXXXXSISSEFI----SDQIDGDRSLHLNGIFEY 563
             + + + +YSG+ +NTG  T           S+  +F+    S++ID   ++ LNG+F+Y
Sbjct: 581  LVKITMSFYSGVYSNTGNFTIVADRINLIINSL--DFVTTTSSNEID-IYNVTLNGLFQY 637

Query: 564  SPSNFTFDNGYLTGKIDYTILDDFGVSNFNKGASIFAVDQNQNLYLGSTNGSVYELNSL- 622
             P   + +N  L      + ++ +  SN+    S+ A   +++  L    GS+ +L    
Sbjct: 638  -PEYNSVNN--LNENYTNSTINQYAYSNYPANVSLIAAAYDKDTLL--VGGSINKLQEFQ 692

Query: 623  ---NGSSVPSTENNLSGL--INGMYSVEEGLVIFGSIAHRGREYGAVILNKSITPLDIVA 677
               NG ++ S +N    L  + G+    +GL+ +G I      Y A+    +      + 
Sbjct: 693  IEKNGQNI-SLQNTFKDLNSVTGIVPYSDGLIAYGDIMDSSGSYKAITFTNN--KFGTLG 749

Query: 678  N--DSIQASFNSTLFGS-NLLVFDNSTIFNMTSFMVFENTSYRNLDLRNAGKNSNDDMLL 734
            N  D IQ+  N +L  S  +L F+N   +N ++   F+NTS   L L +AGKN+ +D++ 
Sbjct: 750  NFTDEIQSFSNISLTTSWEILSFNNKYFYNQSNMEDFKNTSTFELSLWSAGKNAQNDLIF 809

Query: 735  VGNIVNKGSAIGNESLLISSNGTYSPFSLSDNDTIEGAIYLNDTKALYSLSSGNVNYFQL 794
             G +    +      + I++N      +L +N     A++LND+  +Y+    N    +L
Sbjct: 810  SGLVSENENVNLTGVVSINANEQIKELNLGNNIYPYSAVFLNDSSTIYAYMEPNTRLNRL 869

Query: 795  --SDKQRLPWTWQSTVVPVFYSNGQQLL--GAIQENSNKSQIVLIDLFSSQVINDTGNLT 850
              S+ +++ W+W++ +  + +   + LL  G I +        +++L S++VI    N T
Sbjct: 870  IHSNGEQISWSWKNKISSMAFFPNESLLSVGTISDKDVFPSFSILNLTSNKVI---ANET 926

Query: 851  MHK---INAIVNFASNATALVGGDFSLSNPACVGLCXXXXXXXXXXXXXXXXITGNISQI 907
            ++K   I++++ F  N++ LVGG+F+ S+  C GLC                + G +S++
Sbjct: 927  LNKNSQISSLLYFTKNSSVLVGGNFTFSDYQCSGLCLFNYETKNWSTFMNNTLEGTVSKL 986

Query: 908  KF-NDTQMLLSGKLEVNKTADINLLSINLTSNKQDILLYNNSVVLDDFILVRNLVVGWNS 966
            +  N++ +L+SG L  NK+A+I+L  +NL +    ILL N +  L  F    N +  WNS
Sbjct: 987  ELKNNSNILISGTLSTNKSANIDLALLNLNTYNVSILLQNTN--LTSFEFTGNQIAAWNS 1044

Query: 967  TDIFIRNVTQWS--------------NLNIFDDGTNATINRIENFGADSNPALIIYGQFD 1012
            + +F  N   WS              +++IFD     + + +E         ++  GQF 
Sbjct: 1045 STLFQYNNEAWSQILLPNGTESLKLDSISIFDITNKNSSSILEKRALRDTNIMVATGQFY 1104

Query: 1013 SMKYGTINAVIYDFNSWYPYFEVDVVSQTATP---LFFADRDQSSYGNTRHVVPDHII-- 1067
            S   GT+ A+ Y  ++W PYF  ++ +   T      F ++D SS      ++ D ++  
Sbjct: 1105 SKGLGTVQALYYTSDTWIPYFYGNLTNNMDTSNSINIFPNKDISS-----KIISDFVLKN 1159

Query: 1068 ---------------VXXXXXXXXXXXXXXHKTNEKP---------------YKIRRGFX 1097
                                          + T+ +P               +KI+RGF 
Sbjct: 1160 WNFNLSDVGNSTNTTNSTNTTSTTNLTSPSNTTSPQPSSSIIPIIGKQQNKKHKIQRGFV 1219

Query: 1098 XXXXXXXXXXXXXXXXXXGVVIALLFNPSVNGDYDIIKTNDSDNFAGSNITPEKLI 1153
                              G++++ +F  S  GDY+ +K   +++     + PEKL+
Sbjct: 1220 VLIGLALSLATVALLGIFGILLSFIFRDS-RGDYESLKPRTTEHEMFDAVPPEKLM 1274

>Kwal_56.23589 s56 complement(610601..614242) [3642 bp, 1213 aa] {ON}
            YLR084C (RAX2) - YLR084C [contig 176] FULL
          Length = 1213

 Score =  480 bits (1235), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 365/1201 (30%), Positives = 581/1201 (48%), Gaps = 73/1201 (6%)

Query: 2    LNFSSSRNNEIQLLGSIETFNYYNYQGQQNFTTASSSQNELELIYYSNNTLLRLDAVPTD 61
            L+ S S N EIQLLG+ +  NYY Y GQ NFT  S  +    LIY+SN TLL L +    
Sbjct: 40   LDLSGSNNEEIQLLGNFQNLNYYRYTGQDNFTGISDEKARESLIYHSNGTLLELSSPQYS 99

Query: 62   VE---MRHIIPFMDDCFILSGIGTISGIELSRQILLNLTQLSYQPIFEKELGMVKSIFVD 118
             E   + H+IP  DD FILSG G ISG  L  Q++ NL+ LSY  IF + L  V +I V+
Sbjct: 100  NESFSVDHVIPLRDDSFILSGTGAISGAVLDHQVVFNLSDLSYTAIFNQSLSPVNAITVN 159

Query: 119  NEVVYFGGDITYNNNGVSGRSVVQWNSTTXXXXXXXXXXXXXXXTVNSIIRLENNNLLFT 178
                YFGG   +         ++ W+                   VNSI+ L++NN+LF 
Sbjct: 160  GNKAYFGGSFKFKGPDQDTHGLIVWDFVKNEVETLPFGGLGKDSNVNSILVLDDNNILFA 219

Query: 179  GQFAKLENNSFVSKTNRTRNFSISMEDSEVGQQISLRQATWNANSNLDVDAFICP-NSDQ 237
            G F+ ++  S ++ T    + S S    E+  +I L+ A W ++ +L  D  +CP NS  
Sbjct: 220  GNFSTIDEKSALNSTLGINSTSDSAP--ELSHKIPLKTAKWTSDGSLQKDDLVCPSNSAT 277

Query: 238  QAWYSEGSYGVITCNFPNTLTLSKIRIYNTPITDNQISLFRLIAIPGNGILNLTYLDPIS 297
             AW   G+ G    +  +T+  SK+R++N    D ++SLFR+I  P NGI+NLTYLDP S
Sbjct: 278  SAWLGTGTTGQFELSIAHTIRPSKLRLHNARTLDEEVSLFRVITTPSNGIMNLTYLDPSS 337

Query: 298  HDIKHCTENCPLFTRETLLNAMGNVTQESDVIRFINNNSTNIKWNEYYQEFAFVNQLPIT 357
             +++ C   CPL + + L  A       +D + F+NN +T ++W+E YQ+FAFVN +P+T
Sbjct: 338  GELRTCDAWCPLLSTQNLTAAKSKAAS-TDQVEFLNNQTT-VQWSESYQDFAFVNSVPVT 395

Query: 358  SLQFVASNSYYQNVGLSGFQIYQDSFPIFPNNSFNEPNCPSSNDIASYVKLSGNGWFTVA 417
            S+ F+A +SY  +VG++GF++Y+D F ++ N+SFN P+C S+++  S   LS + W   +
Sbjct: 396  SITFMALDSYGSSVGVNGFELYEDDFSVYANDSFNVPDCSSTSNY-SKASLSASQWDQGS 454

Query: 418  NDNSYLANSYIPNQGTKPSITYFVGINVPGEYVLNLVTPGCDKDNTCSTRGIVNVTTFDN 477
            +D  Y+  + + N    PS+T++  I   G Y +N++TPGC  D +C +R +VN + +D+
Sbjct: 455  SDEDYVY-TLVENSQEAPSVTFYPQIVYSGLYTINVLTPGCLADGSCQSRSVVNASLWDS 513

Query: 478  SNGNILGSALIYQNNNNLKYDQIFAGVLNNSISVQVEYYSGINTNTGTATXXXXXXXXXX 537
            +NG +L S  IYQNN+  KYD +++G L N + V +EY   I    G+            
Sbjct: 514  NNGTLLSSITIYQNNDYEKYDNLYSGYLENEVKVVLEYEGAIGNTEGSPMMVAGQISVNT 573

Query: 538  XSISSEFISDQIDGDRSLHLNG-------IFEYSPSNFTFDNGYLTGKIDYTILDDFGVS 590
                S   +D+    ++  LNG              NF  +N         T L  + VS
Sbjct: 574  DEFDSSVFTDKY---KTGKLNGLLHYSLSNSSSYLQNFKSNNS--------TDLAQYSVS 622

Query: 591  NFNKGASIFAVDQNQN-LYLGSTNGSVYELNSLNGSSVPS-TENNLSGLINGMYSVEEGL 648
            NF K ++ F VD+ +N + L +++G V +L       V + T   +   ++G+++  EGL
Sbjct: 623  NFAKNSNFF-VDKFKNYIMLFASSGKVSKLEIDQQFDVRTVTTEEVGDEVSGVFAFSEGL 681

Query: 649  VIFGSIAHRGREYGAVILNKSITPLDIVANDSIQASF-NSTLFGSNLLVFDNSTIFNMTS 707
             + G+    G   GA   N S    DI  + S   +F N TL G+ L+   N    N T+
Sbjct: 682  GVIGTF--DGSTKGAKFYNGSF--FDIPLSHSNVTTFTNFTLDGAELVSLGNYYAINTTT 737

Query: 708  FMVFENTSYRNLDLRNAGKNSNDDMLLVGNIV-NKGSAIGNESLLISSNGTYSPFSLSDN 766
              +F N+S   L  R+AG N+  + +  G++  N+ + +     + S++ + S    S  
Sbjct: 738  DTLFRNSSKMTLTARSAGLNNLGETVFYGSLTRNEYTDLNGSFFISSNSQSSSRLRGSQG 797

Query: 767  DTIEGAIYLNDTK---ALYSLSSGNVN-----YFQLSDKQRLPWTWQSTVVPVFYSNGQQ 818
                 A Y++++    A Y  SS N +     Y  ++ ++ L + W + V  + YS    
Sbjct: 798  RIWYDATYIDNSTTGYAFYDPSSTNGSYGVSIYKDMAKERDLSYRWTNMVGSMLYSKNSS 857

Query: 819  LLGAIQENSNKS-QIVLIDLFSSQVINDTGNLTMH---KINAIVNFASNATALVGGDFSL 874
            LL    +N  +S Q++L +L + +   DT          IN+++ F  N + LVGGDF+ 
Sbjct: 858  LLALGMKNETRSPQLLLTNLTTGE---DTATFEWKTNVSINSLIFFDQNTSVLVGGDFNE 914

Query: 875  SNPACVGLCXXXXXXXXXXXXXXXXITGNISQIK-FNDTQMLLSGKLEVNKTADINLLSI 933
            S   C GLC                I G+I  +K FN + ++L G  ++N T  +NL S+
Sbjct: 915  SESNCSGLCLFDYERKHWSPFFDNMINGSIHSMKIFNKSSLVLGGFFDINDTKQVNLASM 974

Query: 934  NLTSNKQDILLYNNSVVLDDFILVRNLV---VGWNSTDIFIRNVTQWSNLNI-FDDGT-- 987
            +LT    +IL      +L DFI V   V   V  ++ D+F      W +++  FDD +  
Sbjct: 975  SLTDGSYNILHQGTETIL-DFIFVDGKVDNLVAVSANDLFRLTNNNWESISAQFDDSSVF 1033

Query: 988  -NATINRIENFG-----ADSNPALIIYGQFDSMKYGTINAVIYDFNSWYPYFEVDVVSQT 1041
               +   I+  G      +   +L+I G      YG I+A +YDFN W PYF     + T
Sbjct: 1034 GGLSEFPIQQGGQNKKREEEKNSLLITGDLLHKTYGKISAALYDFNDWIPYFSTTPATST 1093

Query: 1042 ---ATPLFFADRDQSSYGNTRHVVPDHI---IVXXXXXXXXXXXXXXHKTNEKPYKIRRG 1095
                    ++++D SS  N + V+                        +   K  KI RG
Sbjct: 1094 DGLGQSRIYSNKDISSAFNYQGVLQSSRGGNSSSVPSGTSSPTSSSPSQLGAKKNKIARG 1153

Query: 1096 FXXXXXXXXXXXXXXXXXXXGVVIALLFNPSVNGDYDIIKTNDSDNFAGSNITPEKLIRV 1155
            F                   G+ +   F  S +  Y  ++    ++     + PEKL+R 
Sbjct: 1154 FVVLIGLALAMGTLAVMGVIGIALTFFFGKSSD-KYQSLEPRADESEMIDTVPPEKLMRF 1212

Query: 1156 L 1156
            +
Sbjct: 1213 I 1213

>Ecym_4315 Chr4 (679627..683265) [3639 bp, 1212 aa] {ON} similar to
            Ashbya gossypii AGR095W
          Length = 1212

 Score =  467 bits (1202), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 347/1080 (32%), Positives = 536/1080 (49%), Gaps = 76/1080 (7%)

Query: 2    LNFSSSRNNEIQLLGSIETFNYYNYQGQQNFTTASSSQNELELIYYSNNTLLRLDAVPTD 61
            L+ S+ RN+++ +    +TF+YY Y+GQQ FT  +  +    LIYYSNNT ++L  +P  
Sbjct: 40   LDLSTVRNSQLLIFDDFQTFDYYTYKGQQIFTGLADERKN-SLIYYSNNTYVQLAELPDG 98

Query: 62   VEMRHIIPFMDDCFILSGIGTISGIELSRQILLNLTQLSYQPIFEKELGMVKSIFVDNEV 121
             E++ I+P+ DD FILSG G   G  L  Q++ NL+      I ++ L  V  I  D EV
Sbjct: 99   AEIKKIVPWGDDSFILSGRGVFEGHRLEHQLIYNLSSFEITEILKEPLEHVNDILTDGEV 158

Query: 122  VYFGGDITYNNNGVSGRSVVQWNSTTXXXXXXXXXXXXXXXTVNSIIRLENNNLLFTGQF 181
            VYFGG  TYN+  +SG SVV+W++T                 VN+II+L+++N+LF G+F
Sbjct: 159  VYFGGGFTYNDGNLSGHSVVKWDATDKSSSLLPFYGFGQGSVVNNIIKLDDSNILFVGKF 218

Query: 182  AKLENNSFVSKTNRTRNFSISMEDSEVGQQISLRQATWNANSNLDVDAFICPNSDQQAW- 240
            + ++N + +   N + +F  +  + E     SLR ++   +  L+  AF+CP     +W 
Sbjct: 219  STIDNTALLPHRNVSSSFLSNSTNIETNALASLRFSSLVHDGTLNSSAFVCPEGSADSWT 278

Query: 241  YSEGSYGVITCNFPNTLTLSKIRIYNTPITDNQISLFRLIAIPGNGILNLTYLDPISHDI 300
                + G +T    N +T SKIRIYN+  ++NQ++LFR++  P   I+N+TY+DPI+  +
Sbjct: 279  IPHSTMGELTIRVINQMTPSKIRIYNSKDSNNQVNLFRIVTSPSRSIMNMTYVDPITGAL 338

Query: 301  KHCTENCPLFTRETLLNAMGNVTQESDVIRFINNNSTNIKWNEYYQEFAFVNQLPITSLQ 360
              C   CPL     L N   N T  S +  F NNN+  +KW   YQEFAFVN++PI  L 
Sbjct: 339  AVCDAWCPLQPLSVLSNLAENST-SSVMAAFPNNNNVLVKWTAAYQEFAFVNRVPIQELT 397

Query: 361  FVASNSYYQNVGLSGFQIYQDSFPIFPNNSFNEPNCPSSNDIASYVKLSGNGWFTVANDN 420
            F+A +S+  NVGL G +++Q  +  + NN+ N+PNC S  +  + V      W+    D 
Sbjct: 398  FIAIDSFGHNVGLLGIELFQAEYDTYVNNTLNQPNCDSQQNFPASVVSKDTVWYQGLPDQ 457

Query: 421  SYLANSYIPNQGTKPSITYFVGINVPGEYVLNLVTPGCDKDNTCSTRGIVNVTTFDNSNG 480
            SY+A S+      KPS+T    I  PG Y LNLVTPGC  DNTC+ RGIVNV T    NG
Sbjct: 458  SYMATSF---TAGKPSVTLTPSIPYPGIYTLNLVTPGCLTDNTCAFRGIVNV-TIRAQNG 513

Query: 481  NILGSALIYQNNNNLKYDQIFAGVLNNSISVQVEYYSGINTNTGTATXXXXXXXXXXXSI 540
              L +  IYQNN NLKYD +F G L++S +V +E+   I+                  SI
Sbjct: 514  THLMNRWIYQNNENLKYDPLFRGYLDDSPNVVLEWIGPIDPAAANNVMVADRVTSIIDSI 573

Query: 541  SSEFISDQIDGDRSLHLNGIFEYSPSNFTFDNGYLTGKIDYTILDDFGVSNFNKGASIFA 600
              E +  +     S  LNG+F+Y+ SNFT  N  L+  +  T +D + V N    +S+F 
Sbjct: 574  --EDLEMKNGTSNSNLLNGLFQYAASNFT--NTNLSTLVGSTNIDQYPVRNIPHSSSLFG 629

Query: 601  VDQNQNLYLGSTNGSVYELNSLNGSSVPSTEN-------------NLSGLINGMYSVEEG 647
               N  L++GS         S++G +  S                +  G + G++    G
Sbjct: 630  QIYNDTLFIGSP--------SIDGLAKISRRKDDWNDIIVDPQLIDTEGPVTGIFPYSNG 681

Query: 648  LVIFGSIAHRGREYGAVIL--NKSITPLDIVANDSIQASFNSTLFGSNLLVFDNSTIFNM 705
            L +     H  +   A  L  N SI+ +   +N    +  N T+ GS +LVFDN  ++N+
Sbjct: 682  LAL---TVHSNQTNMASSLSFNGSISTI-FRSNAPSLSILNLTIDGSEILVFDNGYVYNV 737

Query: 706  TSFMVFENTSYRNLDLRNAGKNSNDDMLLVGNIVNKGSAIGNESLLISSNG---TYSPFS 762
            +S     N+    L L +AG N  DD++L GN+ +    + N ++ I ++      S   
Sbjct: 738  SSQSDISNSETLKLSLLSAGANLEDDLILAGNVQSTKHFVPNGAIAIDADSNEVVTSGLP 797

Query: 763  LSDNDTIEGAIYLNDTKALYSL-------SSGNVNYFQLSDKQRLPWTWQSTVVPVFYSN 815
              D+  I   +++ND+ + Y+        S G +  +   + + L  T  STV  + Y  
Sbjct: 798  SVDDGIIYRGLFINDSSSAYAYYSKSLGSSKGGIVVYGEHEPEYLS-TDDSTVNDMLYIK 856

Query: 816  GQQLLGAIQENSNK--SQIVLIDLFSS-QVINDTGNLTMHKINAIVNFASNATALVGGDF 872
               LL  +   +++  + + + DL +    I +T  +    IN +V F  N T LVGG F
Sbjct: 857  DSNLLAVVTSGTSQGLASLYIHDLSADFAPIKETFEIG-EVINTMVLFGRNYTLLVGGTF 915

Query: 873  SLSNPACVGLCXXXXXXXXXXXXXXXXITGNISQIKFND-TQMLLSGKLEVNKTADINLL 931
            + +   C  LC                ITG+I Q++F D   ++++G L  + + D+ L+
Sbjct: 916  TRN--GCRDLCLYNYATNNWTRFMDGNITGDIRQLQFLDGNTLMVAGLLASSDSKDLQLV 973

Query: 932  SINLTSNKQDI--LLYNNSVVLDDFILVRN---LVVGWNSTDIFIRNVTQWSNLNIFDDG 986
             I+L SN + I  L   N+      + V N    ++  +   +F     QW N++  D  
Sbjct: 974  EIDL-SNMEIISKLQGTNTGTFQHVLTVGNSSSELIAHDGNQVFHFVDGQWKNISP-DTS 1031

Query: 987  TNATINRIENFGAD-------------SNPALIIYGQFDSMKYGTINAVIYDFNSWYPYF 1033
                IN +     D              N  ++I G F S  YG INA+ YDFN W PY+
Sbjct: 1032 GQTQINGLTLLSTDFSQRNSIMKRDRVGNELVVINGNFSSPDYGDINAMYYDFNGWNPYY 1091

>KLTH0G13838g Chr7 (1197919..1201563) [3645 bp, 1214 aa] {ON} similar
            to uniprot|Q12465 Saccharomyces cerevisiae YLR084C RAX2
            N-glycosylated protein involved in the maintenance of bud
            site selection during bipolar budding localization
            requires Rax1p
          Length = 1214

 Score =  463 bits (1191), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 348/1204 (28%), Positives = 590/1204 (49%), Gaps = 78/1204 (6%)

Query: 2    LNFSSSRNNEIQLLGSIETFNYYNYQGQQNFTTASSSQNELELIYYSNNTLLRLDAVPTD 61
            L+ S S+NNE+QLLG+ +  N   Y GQ+NFT   S   E  LIYYSN T L + +    
Sbjct: 40   LDLSKSKNNEVQLLGNFKDINILKYSGQKNFTGEVSGNPENALIYYSNETFLEIYSSSDS 99

Query: 62   VEM---RHIIPFMDDCFILSGIGTISGIELSRQILLNLTQLSYQPIFEKELGMVKSIFVD 118
             E+    HI+PF DD FILSG G+ISG +LSRQ+L NL+ L ++ IF ++L  V +I  +
Sbjct: 100  SEVFSVDHIVPFKDDAFILSGAGSISGHQLSRQLLFNLSSLEFREIFGQDLAQVNTITAN 159

Query: 119  NEVVYFGGDITYNNNGVSGRSVVQWNSTTXXXXXXXXXXXXXXXTVNSIIRLENNNLLFT 178
             + V+FGG   Y  +  +  S++ W+S                 TVNSI+ L+N+N+LF 
Sbjct: 160  GDKVFFGGSFEYEMSNQTIHSLLVWDSIKDGVEVLPFGGFGKNSTVNSILNLDNSNILFA 219

Query: 179  GQFAKLENNSFVSKTNRTRNFSISMEDSEVGQQISLRQATWNANSNLDVDAFICPNSDQQ 238
            G F+ ++N   ++  N +   + S+   E+G QISL+ A W ++  LD  A  CP+++  
Sbjct: 220  GNFSAVDNTQQLNNINVSNTSNTSVP--ELGHQISLQSAAWVSDGTLDKSAIKCPSTEST 277

Query: 239  AWYSEGS-YGVITCNFPNTLTLSKIRIYNTPITDNQISLFRLIAIPGNGILNLTYLDPIS 297
             W   GS  G      P     SK+R++N   +D Q+SLFR++  P NGI+NLTYLDP +
Sbjct: 278  GWLKTGSTQGQFELYMPEETRPSKLRVFNARDSDEQVSLFRIVTTPSNGIMNLTYLDPTT 337

Query: 298  HDIKHCTENCPLFTRETLLNAMGNVTQESDVIRFINNNSTNIKWNEYYQEFAFVNQLPIT 357
             ++  C   CPL + + L + + + +   D +++  N +T ++W+E +Q+FAFVN +P++
Sbjct: 338  GELASCDAWCPLLSSQNLTD-ISSKSYPGDQVQYFENRTT-LQWSESFQDFAFVNNVPVS 395

Query: 358  SLQFVASNSYYQNVGLSGFQIYQDSFPIFPNNSFNEPNCPSSNDIASYVKLSGNGWFTVA 417
             L F+A +SY  +VGL+G ++Y+ ++ ++ NN+ N PNC   +  ++ +  + + W + +
Sbjct: 396  DLTFIALDSYGSSVGLAGIELYESAYSVYANNTLNAPNCAQGSATSNALLSNSSAWDSGS 455

Query: 418  NDNSYLANSYIPNQGTKPSITYFVGINVPGEYVLNLVTPGCDKDNTCSTRGIVNVTTFDN 477
            ++ +YL+ S + +  T P + ++  I  PG Y ++++TPGC +D++C TRGI+N T  D 
Sbjct: 456  SEGNYLSTS-VQDSETNPFVIFYPSIIYPGVYTIDVLTPGCLEDSSCQTRGIINATIRDV 514

Query: 478  SNGNILGSALIYQNNNNLKYDQIFAGVLNNSISVQVEYYSGINTNTGTATXXXXXXXXXX 537
             N  +L S  IYQNN+  K+D +++G L++ + V +E+   IN+ T              
Sbjct: 515  QNNTLLDSIEIYQNNDYEKFDTLYSGFLDSEVKVTLEFDGAINSGTEVPVM--------- 565

Query: 538  XSISSEFISDQIDGDRSL-------HLNGIFEYSPSNFTFDNGYLT--GKIDYTILDDFG 588
              ++S+ + +  D D+S+        +NG+  YS SN    + +L+  G    T L  + 
Sbjct: 566  --VASKIVVNIEDFDQSVFENNTSGFINGLLHYSTSN---TSSFLSELGSYSATDLAHYS 620

Query: 589  VSNFNKGASIFAVDQNQNLYLGSTNGSVYELNSLNGSSVPS-TENNLSGLINGMYSVEEG 647
            VS   K ++IFA     +L L +T+G +  L   N  S+   T   +   I+ +     G
Sbjct: 621  VSKLPKHSNIFANMFEDDLVLFTTDGEMARLKLANNLSIEEYTFETIGKDISTISEYSGG 680

Query: 648  LVIFGSIAHRGREYGAVILNKSITPLDIVANDSIQASFNSTLFGSNLLVFDNSTIFNMTS 707
            L+I G+  +   E  A   N +   L    N +++   N TL  + +L+FD + I N T+
Sbjct: 681  LIIVGTF-NGSSEPAARGFNGTFFNLTEF-NSTVRTFSNLTLGQTEMLIFDKNIILNGTT 738

Query: 708  FMVFENTSYRNLDLRNAGKNSNDDMLLVGNIVNKGSAIGNESLLISSN-----------G 756
                 +TS   L++ +AG+N  +D L  G ++       N S  IS+N           G
Sbjct: 739  GEKIYDTSKLTLEVASAGRNPYNDTLFQGYVLQNDYTNLNGSFFISTNSEEVSQNFWALG 798

Query: 757  TYSPF--SLSDNDTIEGAIYLNDTKALYSLSSGNVNYFQLSDKQRLPWTWQSTVVPVFYS 814
               P+  +  DN T   A Y  D  +    +S  V+    S        W   V  +  S
Sbjct: 799  GKLPYDAAFVDNSTTAYAYYNPDNTS----NSFGVSVMNDSGSTVQLSAWSGKVGAMASS 854

Query: 815  NGQQLLG-AIQENSNKSQIVLIDLFSSQVINDTGNLTMHKINAIVNFASNATALVGGDFS 873
                LL    ++    SQ+++ +  S + +      +   +N+I+ FA N + LVGG F 
Sbjct: 855  KNDSLLAIGGKDQHTDSQLLVTNSSSGESLASYKWDSEISLNSIIFFARNNSVLVGGSFR 914

Query: 874  LSNPACVGLCXXXXXXXXXXXXXXXXITGNISQIK-FNDTQMLLSGKLEVNKTADINLLS 932
            ++N  C GLC                I G I++++ FN++ +L++G   +N+T  ++L S
Sbjct: 915  VNNTQCSGLCLFNYQDKKWSPFLNNSIRGVINRMEIFNNSNLLIAGSFRLNETDGVSLAS 974

Query: 933  INLTSNKQDILLYNNSVVLDDFILV---RNLVVGWNSTDIFIRNVTQWSNLNI-FDDGTN 988
            I L  +  +I L+  ++ L+ F+ +    N VV ++ T +      +W  ++  F +  N
Sbjct: 975  ICLKDSSSEI-LHEGNITLNGFVSMDGSSNNVVAFSDTSLLQLESGKWQQISTNFTE--N 1031

Query: 989  ATINRIENFGAD----------SNPALIIYGQFDSMKYGTINAVIYDFNSWYPYFEVDVV 1038
            +    ++ F             S+  L+I G     K+G+INA  YD   W P+   +  
Sbjct: 1032 SKFKGLDVFPLKDTTRKQKRDSSSKVLLITGSLQHAKFGSINAAFYDSGEWTPFLSSNQA 1091

Query: 1039 SQTA---TPLFFADRDQSSYGNTRHVVPDHIIVXXXXXXXXXXXXXXHKT---NEKPYKI 1092
            + ++   T   F +RD S + + +  +                            K  KI
Sbjct: 1092 TSSSDLETSHVFLNRDLSDFLDYKGYLQGTFSSNTSSGTSGTPSPSGSSPSNLQRKKKKI 1151

Query: 1093 RRGFXXXXXXXXXXXXXXXXXXXGVVIALLFNPSVNGDYDIIKTNDSDNFAGSNITPEKL 1152
             RGF                   GV+ +  F  S +G Y + K    +N     + PEKL
Sbjct: 1152 DRGFIVLISLALALGTLAVLGLLGVIFSYFFGDSGDG-YQLSKPRTDENEMIDTVPPEKL 1210

Query: 1153 IRVL 1156
            +R +
Sbjct: 1211 MRFI 1214

>KLLA0F18975g Chr6 complement(1739543..1743145) [3603 bp, 1200 aa]
            {ON} similar to uniprot|Q12465 Saccharomyces cerevisiae
            YLR084C RAX2 N-glycosylated protein involved in the
            maintenance of bud site selection during bipolar budding
            localization requires Rax1p
          Length = 1200

 Score =  441 bits (1135), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 337/1084 (31%), Positives = 539/1084 (49%), Gaps = 88/1084 (8%)

Query: 11   EIQLLGSIETFNYYNYQGQQNFTTASSSQNELELIYYSNNTLLRLDAVPTDVEMRHIIPF 70
            ++  + + E     +Y GQQNFT  +   NE  L+YYSN+T ++L     +  +  I+P 
Sbjct: 44   DLTYMNNFEELTVISYTGQQNFTVQA---NESSLLYYSNDTFVKLFETSPETTVTMIVPL 100

Query: 71   MDDCFILSGIGTISGIELSRQILLNLTQLSYQPIFEKELGMVKSIFVDNEVVYFGGDITY 130
             +D FILSG G I+G+ L +QILLNLT L+  PIF   +  V  I   NE V F G+ + 
Sbjct: 101  FEDSFILSGTGQINGVALEQQILLNLTSLTTSPIFPSAVENVMDILTVNETVIFVGNFSM 160

Query: 131  NNNGVSGRSVVQWNSTTXXXXXXXXXXXXXXXTVNSIIRLENNNLLFTGQFAKLENNSFV 190
            + +  +G   V W+                   VNS+++L ++N+LF G F +++N S +
Sbjct: 161  SVSNETGHGAVLWDVVANTTELFPFKGFGENSIVNSVVKLNSDNILFAGSFQEIQNASLL 220

Query: 191  SK-TNRTRNFSISMEDSEVGQQISLRQATWNANSNLDVDAFICPNSDQQAW-YSEGSYGV 248
             +  N T +    +   +  Q + L+ ++     N+  D  +CP+  Q  W  SE     
Sbjct: 221  QEFGNATNSSHEDLTSLQFDQSVPLKLSSITG-ENVQSDILLCPSGGQNGWSASEAVQST 279

Query: 249  ITCNFPNTLTLSKIRIYNTPITDNQISLFRLIAIPGNGILNLTYLDPISHDIKHCTENCP 308
            +  +  N +  SK+RIYN+   +++ISLFR+I  P NGI+NLTYLDP S ++K C   CP
Sbjct: 280  LQFDLKNEIHPSKVRIYNSVEENSEISLFRIITGPSNGIMNLTYLDPASGELKQCDAWCP 339

Query: 309  LFTRETLLNAMGNVTQESDVIRFINNNSTNIKWNEYYQEFAFVNQLPITSLQFVASNSYY 368
            L + E L     N T     +  INNNSTN+KW+E YQEFAFVN +P+T LQFVA  SY 
Sbjct: 340  LLSIEDLTQISQNSTAAPKSVG-INNNSTNLKWSESYQEFAFVNDIPVTMLQFVALASYG 398

Query: 369  QNVGLSGFQIYQDSFPIFPNNSFNEPNCPSSNDIASYVKLSGNGWFTVANDNSYLANSYI 428
             N  L   +I++  F ++ NNS+NEPNC S  +  S  +LS + W+T    ++Y++ +  
Sbjct: 399  SNAALHSIEIFETEFMVYANNSYNEPNCESVTEY-SKAELSSDNWYTTDESDTYISTNID 457

Query: 429  PNQGTKPSITYFVGINVPGEYVLNLVTPGCDKDNTCSTRGIVNVTTFDNSNGNILGSALI 488
             N    P +T+   I  PG Y  N+ TPGC +DN+CS RGIVNVT  D S   +L S LI
Sbjct: 458  DN---IPYVTFHPNITYPGRYTFNIYTPGCLQDNSCSKRGIVNVTMIDRSINEVLASVLI 514

Query: 489  YQNNNNLKYDQIFAGVLNNSISVQVEYYSGINTNTGTATXXXXXXXXXXXSISSEFISDQ 548
            YQ NN  K+D ++ G L ++  + V +   I  +                 + +E+I D 
Sbjct: 515  YQTNNEDKFDPLYTGSLGSAPEIIVTWDKAIGESDSVMV-------VDRLGVITEYI-DT 566

Query: 549  I---DGDRSLHLNGIFEYSPSNFTFDNGYLTGKIDYT--ILDDFGVSNFNKGASIFAVDQ 603
            I     D + HLNG+F+Y+ +N       +T  I  T    +D+ + NF   A+++A   
Sbjct: 567  ISISSNDTTFHLNGLFQYNTAN-------VTASIFSTNDTFNDYALYNFPLDANLYAASL 619

Query: 604  NQNLYLGSTNGSVYELNSLNGSSVPSTENNL--SGLINGMYSVEEGLVIFGSIA------ 655
            N ++ +G     + ++  LN  ++ S+   L  SG   G++    GL++ G+        
Sbjct: 620  NNDILIGGNFNGIAKV-ELNDEALISSSQKLGTSGYTTGIFEYSNGLLLSGTYQVENDSR 678

Query: 656  HRGREYGAVILNKSITPLDIVANDSIQASFNSTLFGSNLLVFDNSTIFNMTSFMVFENTS 715
            H    Y     N S   LD    + I    N T+ G  LL+FDN+ IFN+++ M   N+S
Sbjct: 679  HEILSYDGNAFN-SFGQLD----EPIDRIVNFTIDGHELLLFDNAYIFNVSANMYVSNSS 733

Query: 716  YRNLDLRNAGKNSNDDMLLVGNIVNKGSAIGNESLLISSNGTYSPFSLSDNDT---IEGA 772
               +  ++AG NS +D LL G+ + +     N    +SS+G  S  +L +  T      A
Sbjct: 734  TFEITGQSAGINSGNDSLLFGSFLKRSVGELNGLASLSSDGQVSSPTLPELPTDVQPYKA 793

Query: 773  IYLNDTKALYSLSSGNVNYFQL--------SDKQRLPWTWQSTVVPVFYSNGQQLLGAIQ 824
             Y+NDT A Y+L  G+ +  Q         S    L   W + +    Y N   +L    
Sbjct: 794  AYINDTSAAYALQEGSTDNVQHRVLITNTNSSSHMLQIQWSAPINAFLYDNVPNILAIGT 853

Query: 825  ENSNKS-----QIVLIDLFSSQVINDTGNLTMHKINAIVNFASNATALVGGDFSLSNPAC 879
              SN S     Q  +++L   + +      T  ++N++V+F+SN + LVGG + + N  C
Sbjct: 854  NGSNSSSQYDVQFSILNLTGYENVARVNFSTNERVNSMVSFSSNNSILVGGSYEIDN--C 911

Query: 880  VGLCXXXXXXXXXXXXXXXXITGNISQIKFND--TQMLLSGKLEVNKTADINLLSINLTS 937
              LC                ITG+I Q++F D    +L+ G ++ N  ++I LLS+ + S
Sbjct: 912  NDLCLYNYQTKEWTSFLNDSITGDIRQMQFADEGKTLLVGGLIKTNNESNIQLLSVEVGS 971

Query: 938  N--------KQDILLYNNSVVLDDFILVRNLVVGWNSTDIFIRNVTQWSNL--NIFDDGT 987
            N         + +L +   V +DD     N++   NS  + + + T WS+    + +D  
Sbjct: 972  NIFSTVKSGTEPLLSF---VPIDDS--TDNIIAQMNSEILRLESGT-WSSFGPQLNNDSI 1025

Query: 988  NA---TINRIENFGADSNPALIIY-GQFDSMKYGTINAVIYDFNS--WYPYFEV-DVVSQ 1040
             +    ++  E+   D    +++  G  +S ++G + +V+YD ++  W PYF + D   Q
Sbjct: 1026 VSGFKVLSGTESKKRDEGSHIVLLEGTLNSSEWGNLTSVVYDGSTQKWQPYFVISDPKEQ 1085

Query: 1041 TATP 1044
             + P
Sbjct: 1086 ESLP 1089

>AGR095W Chr7 (914098..917703) [3606 bp, 1201 aa] {ON} Syntenic
            homolog of Saccharomyces cerevisiae YLR084C (RAX2)
          Length = 1201

 Score =  426 bits (1096), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 356/1225 (29%), Positives = 554/1225 (45%), Gaps = 133/1225 (10%)

Query: 2    LNFSSSRNNEIQLLGSIETFNYYNYQGQQNFTTASSSQNELELIYYSNNTLLRLDAVPTD 61
            L+ S++RN  + +    + F YYNY+GQQ FT     Q    LIYYS  T ++L  +  D
Sbjct: 40   LDLSAARNERLLVFDDFQAFEYYNYKGQQLFTGQEQHQGS-SLIYYSEGTYVQLAKLDDD 98

Query: 62   VEMRHIIPFMDDCFILSGIGTISGIELSRQILLNLTQLSYQPIFEKELGMVKSIFVDNEV 121
              +R I+PF  D FILSG G +    L  Q++ NL+ L    I  + L  V  I VD ++
Sbjct: 99   TVVRRIVPFGSDSFILSGTGKLQDQRLEHQLMYNLSTLEVTEILPQSLESVNDILVDGDM 158

Query: 122  VYFGGDITYNNNGVSGRSVVQWNSTTXXXXXXXXXXXXXXXTVNSIIRLENNNLLFTGQF 181
            VYFGG  TY++   SG S VQWN+T+               +VN+I++L  + +LF G+F
Sbjct: 159  VYFGGQFTYSDGNKSGHSAVQWNATSRTTSLLPFGGFGRGSSVNNILKLSGSGVLFVGRF 218

Query: 182  AKLENNSFVSKTN---RTRNFSISMEDSEVGQQISLRQATWNANSNLDVDAFICPNSDQQ 238
            + LE  S+    +    T    +++   E     SLR +T  ++ +LD   FICP S+  
Sbjct: 219  SNLEAASYAETASVLASTEKPQLNVTTIETNALTSLRYSTITSDGHLDKGKFICPTSNDD 278

Query: 239  AWYSEGS-----YGVITCNFPNTLTLSKIRIYNTPITDNQISLFRLIAIPGNGILNLTYL 293
            +W+   S      G +     + +  SKIRIYN+    N+I LFR++  P   I+N+TY+
Sbjct: 279  SWFVPHSGDGPARGELNIKVLHRIIPSKIRIYNSKKNGNEIKLFRIVTSPSQSIMNMTYI 338

Query: 294  DPISHDIKHCTENCPLFTRETLLNAMGNVTQESDVIRFINNNSTNIKWNEYYQEFAFVNQ 353
            DP + ++  C   CPL  R  L +     +  +DV R +N+    IKW   YQEFAF+NQ
Sbjct: 339  DPNTGELATCDAWCPLMPRSNLTSKAAE-SGPADVARLVNDEKVLIKWTPDYQEFAFINQ 397

Query: 354  LPITSLQFVASNSYYQNVGLSGFQIYQDSFPIFPNNSFNEPNCPSSNDIASYVKLSGNGW 413
            + +  ++F+A +SY  NVGL G +++Q  +  + N++ N+PNC       S    + N W
Sbjct: 398  IHMEEIKFIALDSYGNNVGLVGVELFQTEYDAYVNSTLNQPNCGEQQ--LSPFSTTANIW 455

Query: 414  FTVANDNSYLANSYI---PNQGTKPSITYFVGINVPGEYVLNLVTPGCDKDNTCSTRGIV 470
               A D SYL+ + +   P    KP I +       G Y LNL TPGC+ D TC  RGIV
Sbjct: 456  HQGATDASYLSANVVESNPMVNVKPVIPH------SGTYTLNLYTPGCEDDGTCDYRGIV 509

Query: 471  NVTTFDNSNGNILGSALIYQNNNNLKYDQIFAGVLNNSISVQVEYYSGINTNTGTATXXX 530
            NVT    SNG  L +  IYQNN  LKYD ++ G L+ + +V++E+ S IN+         
Sbjct: 510  NVTLL-ASNGTTLMTRWIYQNNYRLKYDPLYTGHLDPNPTVRMEWVSPINSAVNRKIMVA 568

Query: 531  XXXXXXXXSISSEFISDQIDGDRSLHLNGIFEYSPSNFTFDNGYLTGKIDYTILDDFGVS 590
                    S+      D I   R   LNG+F+Y+P+  + DNG     I   I  D   +
Sbjct: 569  DRVSAIIDSLDG---LDDIRHPREKSLNGLFQYTPAGSSLDNG-----IQKYINKD-PQT 619

Query: 591  NFNKGASIFAVDQNQNLYLGSTNGSVYELNSLNGS---SVPSTENNLSGLINGMYSVEEG 647
            +  +G S+     +  L LG  +     + +  G+    V  T  ++ G +NG+    +G
Sbjct: 620  DMPEGVSLVGQVYDGKLILGVKSTGHIAVVTPKGTDWNDVDVTRQDVPGSLNGISPYSKG 679

Query: 648  LVIFG---------SIAHRGREYGAVILNKSITPLDIVANDSIQASFNSTLFGSNLLVFD 698
            LV  G         S  H    +G+          D+  N    +  N T+ GS LL+F+
Sbjct: 680  LVFTGKFNLSSGPSSALHYDGNFGSF--------FDL--NSETSSIINMTIDGSELLLFN 729

Query: 699  NSTIFNMTSFMVFENTSYRNLDLRNAGKNSNDDMLLVGNI--VNKGSAIGNESLLISSNG 756
            N  I+N ++  +  ++ ++ L   +A  NSN+D+L  G+I  +  GSA G  +L    N 
Sbjct: 730  NKFIYNTSTSQMLTSSMFQ-LSALSAAANSNNDLLFTGSIADIKHGSAHGAVALDAEGNI 788

Query: 757  TYSPFSLSDNDTIEGAIYLNDTKALY---------SLSSGNV------NYFQLSDKQRLP 801
              S         +   +YLNDT   Y         S+++G V      N F LS+     
Sbjct: 789  FTSGTPSISGARVHRGVYLNDTATAYAYYSVSPNSSVATGGVVIETPGNNFNLSNN---- 844

Query: 802  WTWQSTVVPVFYSNGQQLLGAIQENS---NKSQIVLIDLFSSQVINDTGNLTMHKINAIV 858
                +TV  + Y      L  I  N        ++L DL + Q +         +IN+IV
Sbjct: 845  ---IATVREMIYVKKTNFL-VISTNEVEGTPGALILYDLRTLQEVAREKLNPGERINSIV 900

Query: 859  NFASNATALVGGDFSLSNPACVGLCXXXXXXXXXXXXXXXXITGNISQIKF-NDTQMLLS 917
             F  + T LVGG F      C  LC                I+G I Q++F N+  ++  
Sbjct: 901  LFGEDNTLLVGGSF--EKDGCHDLCLYNFVKRSWSAFASGLISGEIKQLQFVNNRNLIAV 958

Query: 918  GKLEVNKTADINLLSINLTSNK------QDILLYNNSVVL-----DDFILVRNLVVGWNS 966
            G + V    +I  L+ +L  ++      Q      NSV+      D+++      V W+ 
Sbjct: 959  GSMTVQSRPNILFLNFDLVRSRVVEQHEQPNGRAFNSVLTIGDSGDEYVAEDGKQV-WHY 1017

Query: 967  TDIFIRNVTQWSNLNIFDDGTNATI-------NRIENFGADSNPALIIYGQFDSMKYGTI 1019
            +    + VT  S   I  DG +  +       N+    G   N  ++I+GQ +S +YG I
Sbjct: 1018 SGSEWKTVTPLSGGQIRIDGISLLMLNNPRSQNKRNRVG---NELVVIHGQMNSSEYGEI 1074

Query: 1020 NAVIYDFNSWYPYFEVDVVSQTATPLFFADR-----DQSSYGNTRHVVPDHIIVXXXXXX 1074
            NA+ Y+F +W PY+    +  +A   F   R     +Q     T   +P  ++V      
Sbjct: 1075 NAMHYNFENWEPYYF--TIGSSAREEFNVPRGQIFLNQDISRQTTTSLPLEVVVSDSP-- 1130

Query: 1075 XXXXXXXXHKTNEKPYKIRRGFXXXXXXXXXXXXXXXXXXXGVVIALLFNPSVNGD---Y 1131
                      T E   K+ +G+                   GV++A  F     GD   Y
Sbjct: 1131 ---------PTAEPKRKLAKGYVVLIALGLALATIALLGIIGVILAYAF-----GDHNAY 1176

Query: 1132 DIIKTNDSDNFAGSNITPEKLIRVL 1156
              +K   +++     + PEKL++ +
Sbjct: 1177 QPLKPRINEDEMLKTVPPEKLMKFI 1201

>CAGL0I10318g Chr9 complement(1008846..1011566) [2721 bp, 906 aa]
           {ON} similar to uniprot|P32504 Saccharomyces cerevisiae
           YGR140w kinetochore protein complex CBF3
          Length = 906

 Score = 32.7 bits (73), Expect = 7.6,   Method: Compositional matrix adjust.
 Identities = 26/112 (23%), Positives = 55/112 (49%), Gaps = 11/112 (9%)

Query: 204 EDSEVGQQISLRQATWNANSNLDVDAFICPNSDQQAWYSEGSYGVITCNFP----NTLTL 259
           + S++ +  +L    WN+N+    D +   + ++  + ++  +  +  N+P    + L L
Sbjct: 130 QSSQLNKMATLSINMWNSNTQELSDKYFKTSMEKLRFLTDYHFYTL-LNWPYKERSKLKL 188

Query: 260 SKIRIYNTPITDNQISLFRLIAIPGNGILNLTYLDPISHDIKHCTENCPLFT 311
           S ++++N    +N ++ +RLI I  +G +  T    I HD   C   CP+ T
Sbjct: 189 SHLKVHNVENDENSLNAYRLIIINDDGAVQGTV---IPHD---CPLICPITT 234

>YIR033W Chr9 (416124..419465) [3342 bp, 1113 aa] {ON}  MGA2ER
           membrane protein involved in regulation of OLE1
           transcription, acts with homolog Spt23p; inactive ER
           form dimerizes and one subunit is then activated by
           ubiquitin/proteasome-dependent processing followed by
           nuclear targeting
          Length = 1113

 Score = 32.3 bits (72), Expect = 9.8,   Method: Compositional matrix adjust.
 Identities = 21/77 (27%), Positives = 39/77 (50%), Gaps = 10/77 (12%)

Query: 682 QASFNSTLFGSNLL---VFDNSTIFNMTS-------FMVFENTSYRNLDLRNAGKNSNDD 731
           Q+SFNS+L  +  L   +F++ ++ N TS         +FEN+SY   D  +  ++ ++D
Sbjct: 856 QSSFNSSLLDNESLNENLFESQSMINPTSMEIQHPTLQLFENSSYSEYDQSDFEEDGDED 915

Query: 732 MLLVGNIVNKGSAIGNE 748
           + +   +   G A   E
Sbjct: 916 LFVTDEVEKPGVACREE 932

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.316    0.134    0.387 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 129,533,960
Number of extensions: 6280855
Number of successful extensions: 19877
Number of sequences better than 10.0: 104
Number of HSP's gapped: 20177
Number of HSP's successfully gapped: 115
Length of query: 1156
Length of database: 53,481,399
Length adjustment: 121
Effective length of query: 1035
Effective length of database: 39,606,813
Effective search space: 40993051455
Effective search space used: 40993051455
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 71 (32.0 bits)