Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
CAGL0L11660g5.426ON1459145976790.0
NDAI0C016205.426ON1460145567000.0
TDEL0E019905.426ON1460145966980.0
NCAS0H020405.426ON1460145466690.0
YOR116C (RPO31)5.426ON1460145966660.0
Skud_15.2795.426ON1460145966510.0
Smik_15.2945.426ON1460145966480.0
KAFR0D050305.426ON1462146066250.0
Suva_8.1695.426ON1460145966220.0
Kpol_1016.95.426ON1460146065640.0
SAKL0G02354g5.426ON1458145965630.0
KNAG0B042405.426ON1455145765120.0
ZYRO0F09856g5.426ON1458145864970.0
TBLA0A037205.426ON1458145264570.0
KLTH0F16236g5.426ON1460146164270.0
KLLA0E21253g5.426ON1457145664260.0
AER252C5.426ON1459145663920.0
TPHA0H017605.426ON1459145663710.0
Ecym_55255.426ON1459145963550.0
Kwal_55.214595.426ON1148114650550.0
ZYRO0F05918g7.314ON1744149318970.0
Ecym_80657.314ON1743150218890.0
KNAG0C039707.314ON1721150418770.0
TBLA0F021707.314ON1726151118680.0
YDL140C (RPO21)7.314ON1733150518690.0
Smik_4.957.314ON1719150518660.0
Suva_4.1047.314ON1733150418580.0
KLLA0F05071g7.314ON1720150418570.0
Skud_4.1147.314ON1726150518570.0
KAFR0B010607.314ON168592714771e-176
ADR086C7.314ON174592914621e-174
TPHA0A030707.314ON171993714591e-174
CAGL0I03828g7.314ON171595614571e-173
Kwal_56.244897.314ON172895214541e-173
KLTH0H02046g7.314ON174096914521e-172
Kwal_55.21464singletonOFF32031213361e-172
TDEL0C023207.314ON172796814501e-172
NDAI0A021307.314ON172995514471e-172
SAKL0F10472g7.314ON173095614471e-172
NCAS0A139007.314ON171692714391e-171
Kpol_162.1singletonON131158512531e-148
Kwal_26.69797.51ON165498911641e-133
ZYRO0D04532g7.51ON166798211621e-133
TPHA0H028007.51ON1648112911501e-131
NCAS0F007307.51ON167498611481e-131
CAGL0E05500g7.51ON164398411461e-131
KLLA0F23243g7.51ON165398311421e-130
KLTH0D01628g7.51ON165498811381e-129
TBLA0E019307.51ON165998511231e-127
Skud_15.5067.51ON166598211181e-127
YOR341W (RPA190)7.51ON166498211171e-127
Smik_15.5197.51ON166598111141e-126
NDAI0H012007.51ON166997311101e-126
KAFR0K005407.51ON166297911101e-126
Suva_8.3917.51ON166598211061e-125
KNAG0D049707.51ON167196711041e-125
ADR374C7.51ON164097910961e-124
SAKL0B10736g7.51ON165097710711e-121
Kpol_1040.37.51ON16567399751e-108
TDEL0H040007.51ON16657299701e-107
Kpol_1019.277.314ON3642862109e-17
TDEL0A041305.550ON473116810.92
KAFR0H023208.696ON38296782.0
KAFR0C03730singletonON79165773.1
TPHA0H014405.359ON87580773.4
Ecym_63611.253ON1777104747.1
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0L11660g
         (1459 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0L11660g Chr12 (1245685..1250064) [4380 bp, 1459 aa] {ON} hi...  2962   0.0  
NDAI0C01620 Chr3 (346478..350860) [4383 bp, 1460 aa] {ON} Anc_5....  2585   0.0  
TDEL0E01990 Chr5 (373218..377600) [4383 bp, 1460 aa] {ON} Anc_5....  2584   0.0  
NCAS0H02040 Chr8 complement(393711..398093) [4383 bp, 1460 aa] {...  2573   0.0  
YOR116C Chr15 complement(539763..544145) [4383 bp, 1460 aa] {ON}...  2572   0.0  
Skud_15.279 Chr15 complement(496216..500598) [4383 bp, 1460 aa] ...  2566   0.0  
Smik_15.294 Chr15 complement(500962..505344) [4383 bp, 1460 aa] ...  2565   0.0  
KAFR0D05030 Chr4 complement(988159..992547) [4389 bp, 1462 aa] {...  2556   0.0  
Suva_8.169 Chr8 complement(297556..301938) [4383 bp, 1460 aa] {O...  2555   0.0  
Kpol_1016.9 s1016 (19972..24354) [4383 bp, 1460 aa] {ON} (19972....  2533   0.0  
SAKL0G02354g Chr7 complement(193623..197999) [4377 bp, 1458 aa] ...  2532   0.0  
KNAG0B04240 Chr2 (806212..810579) [4368 bp, 1455 aa] {ON} Anc_5....  2513   0.0  
ZYRO0F09856g Chr6 complement(798821..803197) [4377 bp, 1458 aa] ...  2507   0.0  
TBLA0A03720 Chr1 complement(929751..934127) [4377 bp, 1458 aa] {...  2491   0.0  
KLTH0F16236g Chr6 (1316542..1320924) [4383 bp, 1460 aa] {ON} hig...  2480   0.0  
KLLA0E21253g Chr5 (1896457..1900830) [4374 bp, 1457 aa] {ON} hig...  2479   0.0  
AER252C Chr5 complement(1101343..1105722) [4380 bp, 1459 aa] {ON...  2466   0.0  
TPHA0H01760 Chr8 complement(402254..406633) [4380 bp, 1459 aa] {...  2458   0.0  
Ecym_5525 Chr5 complement(1063773..1068152) [4380 bp, 1459 aa] {...  2452   0.0  
Kwal_55.21459 s55 (846902..850348) [3447 bp, 1148 aa] {ON} YOR11...  1951   0.0  
ZYRO0F05918g Chr6 (487056..492290) [5235 bp, 1744 aa] {ON} highl...   735   0.0  
Ecym_8065 Chr8 (139544..144775) [5232 bp, 1743 aa] {ON} similar ...   732   0.0  
KNAG0C03970 Chr3 complement(778936..784101) [5166 bp, 1721 aa] {...   727   0.0  
TBLA0F02170 Chr6 (535350..540530) [5181 bp, 1726 aa] {ON} Anc_7....   724   0.0  
YDL140C Chr4 complement(205360..210561) [5202 bp, 1733 aa] {ON} ...   724   0.0  
Smik_4.95 Chr4 complement(182198..187357) [5160 bp, 1719 aa] {ON...   723   0.0  
Suva_4.104 Chr4 complement(193257..193711,193754..193782,194161....   720   0.0  
KLLA0F05071g Chr6 complement(496371..501533) [5163 bp, 1720 aa] ...   719   0.0  
Skud_4.114 Chr4 complement(201053..206233) [5181 bp, 1726 aa] {O...   719   0.0  
KAFR0B01060 Chr2 complement(197351..202408) [5058 bp, 1685 aa] {...   573   e-176
ADR086C Chr4 complement(860406..865643) [5238 bp, 1745 aa] {ON} ...   567   e-174
TPHA0A03070 Chr1 complement(671766..676925) [5160 bp, 1719 aa] {...   566   e-174
CAGL0I03828g Chr9 complement(328922..334069) [5148 bp, 1715 aa] ...   565   e-173
Kwal_56.24489 s56 (1018237..1023423) [5187 bp, 1728 aa] {ON} YDL...   564   e-173
KLTH0H02046g Chr8 complement(182788..188010) [5223 bp, 1740 aa] ...   563   e-172
Kwal_55.21464 s55 (850323..851285) [963 bp, 320 aa] {OFF} YOR116...   519   e-172
TDEL0C02320 Chr3 complement(403851..409034) [5184 bp, 1727 aa] {...   563   e-172
NDAI0A02130 Chr1 complement(477808..482997) [5190 bp, 1729 aa] {...   561   e-172
SAKL0F10472g Chr6 (808869..814061) [5193 bp, 1730 aa] {ON} highl...   561   e-172
NCAS0A13900 Chr1 (2728572..2733722) [5151 bp, 1716 aa] {ON} Anc_...   558   e-171
Kpol_162.1 s162 complement(211..4146) [3936 bp, 1311 aa] {ON} co...   487   e-148
Kwal_26.6979 s26 complement(150350..155314) [4965 bp, 1654 aa] {...   452   e-133
ZYRO0D04532g Chr4 (374177..379180) [5004 bp, 1667 aa] {ON} highl...   452   e-133
TPHA0H02800 Chr8 (659254..664200) [4947 bp, 1648 aa] {ON} Anc_7....   447   e-131
NCAS0F00730 Chr6 complement(143500..148524) [5025 bp, 1674 aa] {...   446   e-131
CAGL0E05500g Chr5 (539213..544144) [4932 bp, 1643 aa] {ON} highl...   446   e-131
KLLA0F23243g Chr6 (2165407..2170368) [4962 bp, 1653 aa] {ON} hig...   444   e-130
KLTH0D01628g Chr4 complement(157597..162561) [4965 bp, 1654 aa] ...   442   e-129
TBLA0E01930 Chr5 (468692..473671) [4980 bp, 1659 aa] {ON} Anc_7....   437   e-127
Skud_15.506 Chr15 (901437..906434) [4998 bp, 1665 aa] {ON} YOR34...   435   e-127
YOR341W Chr15 (960987..965981) [4995 bp, 1664 aa] {ON}  RPA190RN...   434   e-127
Smik_15.519 Chr15 (910592..915589) [4998 bp, 1665 aa] {ON} YOR34...   433   e-126
NDAI0H01200 Chr8 complement(280165..285174) [5010 bp, 1669 aa] {...   432   e-126
KAFR0K00540 Chr11 complement(114196..119184) [4989 bp, 1662 aa] ...   432   e-126
Suva_8.391 Chr8 (702691..707688) [4998 bp, 1665 aa] {ON} YOR341W...   430   e-125
KNAG0D04970 Chr4 (905179..910194) [5016 bp, 1671 aa] {ON} Anc_7....   429   e-125
ADR374C Chr4 complement(1372609..1377531) [4923 bp, 1640 aa] {ON...   426   e-124
SAKL0B10736g Chr2 (925889..930841) [4953 bp, 1650 aa] {ON} highl...   417   e-121
Kpol_1040.3 s1040 complement(6642..11612) [4971 bp, 1656 aa] {ON...   380   e-108
TDEL0H04000 Chr8 (680730..685727) [4998 bp, 1665 aa] {ON} Anc_7....   378   e-107
Kpol_1019.27 s1019 complement(51067..52161) [1095 bp, 364 aa] {O...    86   9e-17
TDEL0A04130 Chr1 complement(735166..736587) [1422 bp, 473 aa] {O...    36   0.92 
KAFR0H02320 Chr8 (443614..444762) [1149 bp, 382 aa] {ON} Anc_8.6...    35   2.0  
KAFR0C03730 Chr3 (759382..761757) [2376 bp, 791 aa] {ON}               34   3.1  
TPHA0H01440 Chr8 complement(322547..325174) [2628 bp, 875 aa] {O...    34   3.4  
Ecym_6361 Chr6 (706378..711711) [5334 bp, 1777 aa] {ON} similar ...    33   7.1  

>CAGL0L11660g Chr12 (1245685..1250064) [4380 bp, 1459 aa] {ON} highly
            similar to uniprot|P04051 Saccharomyces cerevisiae
            YOR116c RPO31 DNA-directed RNA polymerase III
          Length = 1459

 Score = 2962 bits (7679), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1430/1459 (98%), Positives = 1430/1459 (98%)

Query: 1    MKEVVIGETPKRISGLEFSALSPADIVAQSELEISSRDLFDLENNRSPKEGGALDPRMGV 60
            MKEVVIGETPKRISGLEFSALSPADIVAQSELEISSRDLFDLENNRSPKEGGALDPRMGV
Sbjct: 1    MKEVVIGETPKRISGLEFSALSPADIVAQSELEISSRDLFDLENNRSPKEGGALDPRMGV 60

Query: 61   SASSMECTTCHGNLASCHGHFGHIKLALPVFHVGYFKATIQILQGICKTCSAILLSEQDK 120
            SASSMECTTCHGNLASCHGHFGHIKLALPVFHVGYFKATIQILQGICKTCSAILLSEQDK
Sbjct: 61   SASSMECTTCHGNLASCHGHFGHIKLALPVFHVGYFKATIQILQGICKTCSAILLSEQDK 120

Query: 121  RHFLSELRRPGVDNLRRMALLKKVLDQCKKQRRCLHCXXXXXXXXXXXXXXXXXSLKIIH 180
            RHFLSELRRPGVDNLRRMALLKKVLDQCKKQRRCLHC                 SLKIIH
Sbjct: 121  RHFLSELRRPGVDNLRRMALLKKVLDQCKKQRRCLHCGALNGVVKKAAAGAGTASLKIIH 180

Query: 181  DTFRWVGKKSTPEKDKWIGDWKEVLSHNPELERYVKRATDDLNPLKTLNLFKQIASEDCE 240
            DTFRWVGKKSTPEKDKWIGDWKEVLSHNPELERYVKRATDDLNPLKTLNLFKQIASEDCE
Sbjct: 181  DTFRWVGKKSTPEKDKWIGDWKEVLSHNPELERYVKRATDDLNPLKTLNLFKQIASEDCE 240

Query: 241  LLGIDATNKAGRPETYIWRYIPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300
            LLGIDATNKAGRPETYIWRYIPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK
Sbjct: 241  LLGIDATNKAGRPETYIWRYIPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300

Query: 301  AGIEKGISINNMMEHWDYLQMTVAMYINSDSINPAMLPGSSTGGGKVKPIRGFCQRLKGK 360
            AGIEKGISINNMMEHWDYLQMTVAMYINSDSINPAMLPGSSTGGGKVKPIRGFCQRLKGK
Sbjct: 301  AGIEKGISINNMMEHWDYLQMTVAMYINSDSINPAMLPGSSTGGGKVKPIRGFCQRLKGK 360

Query: 361  QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPQLVAKVLTFPEKVTRYNIKKLRQLV 420
            QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPQLVAKVLTFPEKVTRYNIKKLRQLV
Sbjct: 361  QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPQLVAKVLTFPEKVTRYNIKKLRQLV 420

Query: 421  QNGPNVHPGANYLLKKNEEARRNLRYGDRQKLANNLQYGDVVERHLEDGDVVLFNRQPSL 480
            QNGPNVHPGANYLLKKNEEARRNLRYGDRQKLANNLQYGDVVERHLEDGDVVLFNRQPSL
Sbjct: 421  QNGPNVHPGANYLLKKNEEARRNLRYGDRQKLANNLQYGDVVERHLEDGDVVLFNRQPSL 480

Query: 481  HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN 540
            HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN
Sbjct: 481  HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN 540

Query: 541  LLTPKSGEPIIAATQDFITGSYLISHKDSFFDKASLTQLLSMMSDGSLQFDIPPPAIMKP 600
            LLTPKSGEPIIAATQDFITGSYLISHKDSFFDKASLTQLLSMMSDGSLQFDIPPPAIMKP
Sbjct: 541  LLTPKSGEPIIAATQDFITGSYLISHKDSFFDKASLTQLLSMMSDGSLQFDIPPPAIMKP 600

Query: 601  CYLWTGKQVFSLLIKPNKNSPVKINLDAKNKVYIPPKQKHYPNEMSQNDGFVIVRGSQIL 660
            CYLWTGKQVFSLLIKPNKNSPVKINLDAKNKVYIPPKQKHYPNEMSQNDGFVIVRGSQIL
Sbjct: 601  CYLWTGKQVFSLLIKPNKNSPVKINLDAKNKVYIPPKQKHYPNEMSQNDGFVIVRGSQIL 660

Query: 661  SGVMDKSVLGDGKKHSVFYTILRDFGPQEAASAMNRMAKLCARYLGNRGFSIGISDVTPA 720
            SGVMDKSVLGDGKKHSVFYTILRDFGPQEAASAMNRMAKLCARYLGNRGFSIGISDVTPA
Sbjct: 661  SGVMDKSVLGDGKKHSVFYTILRDFGPQEAASAMNRMAKLCARYLGNRGFSIGISDVTPA 720

Query: 721  DDLKQKKEDLVEIAYAKCDELIDLYNKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGDV 780
            DDLKQKKEDLVEIAYAKCDELIDLYNKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGDV
Sbjct: 721  DDLKQKKEDLVEIAYAKCDELIDLYNKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGDV 780

Query: 781  CINELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSK 840
            CINELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSK
Sbjct: 781  CINELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSK 840

Query: 841  TPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 900
            TPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY
Sbjct: 841  TPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 900

Query: 901  DNTVRTSSNGIVQFTYGGDGLDPLEMEGNAQPVNFNRSWDHAYNITFNNTDRGLLPYEIK 960
            DNTVRTSSNGIVQFTYGGDGLDPLEMEGNAQPVNFNRSWDHAYNITFNNTDRGLLPYEIK
Sbjct: 901  DNTVRTSSNGIVQFTYGGDGLDPLEMEGNAQPVNFNRSWDHAYNITFNNTDRGLLPYEIK 960

Query: 961  KTVDNILKPLEKRLIRYDTLGRPVSAEDDKLDDYVDQHDSERLFYASLREFMTDXXXXXX 1020
            KTVDNILKPLEKRLIRYDTLGRPVSAEDDKLDDYVDQHDSERLFYASLREFMTD      
Sbjct: 961  KTVDNILKPLEKRLIRYDTLGRPVSAEDDKLDDYVDQHDSERLFYASLREFMTDKAKKLA 1020

Query: 1021 XXXXXXGLPKLIKKSELEGYDPENEHIDAIVQHSITQLYRITEDAVQKFLEIAISKYHRA 1080
                  GLPKLIKKSELEGYDPENEHIDAIVQHSITQLYRITEDAVQKFLEIAISKYHRA
Sbjct: 1021 KLRKSRGLPKLIKKSELEGYDPENEHIDAIVQHSITQLYRITEDAVQKFLEIAISKYHRA 1080

Query: 1081 KVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPII 1140
            KVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPII
Sbjct: 1081 KVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPII 1140

Query: 1141 NAVLVNNNDERAARVVKGRIEKTLLSDVCYYIQDVYKENMAYLQVKVDLNTIDKLQLELT 1200
            NAVLVNNNDERAARVVKGRIEKTLLSDVCYYIQDVYKENMAYLQVKVDLNTIDKLQLELT
Sbjct: 1141 NAVLVNNNDERAARVVKGRIEKTLLSDVCYYIQDVYKENMAYLQVKVDLNTIDKLQLELT 1200

Query: 1201 IEDIAIAITRAPKLKIQTSDVTVLGKDKIAINVLPEGFGSKTSSTSLKEPTENDVFYRMQ 1260
            IEDIAIAITRAPKLKIQTSDVTVLGKDKIAINVLPEGFGSKTSSTSLKEPTENDVFYRMQ
Sbjct: 1201 IEDIAIAITRAPKLKIQTSDVTVLGKDKIAINVLPEGFGSKTSSTSLKEPTENDVFYRMQ 1260

Query: 1261 TLRRALPSIMVKGLNDIARAVINIRDDGKRELLVEGYGLRDVMCTDGVIGAKTATNHVLE 1320
            TLRRALPSIMVKGLNDIARAVINIRDDGKRELLVEGYGLRDVMCTDGVIGAKTATNHVLE
Sbjct: 1261 TLRRALPSIMVKGLNDIARAVINIRDDGKRELLVEGYGLRDVMCTDGVIGAKTATNHVLE 1320

Query: 1321 IFNVLGIEAARASIIGEIDYTMSNHGMSVDPRHIQLLGDVMTFKGEVLGITRFGLSKMRD 1380
            IFNVLGIEAARASIIGEIDYTMSNHGMSVDPRHIQLLGDVMTFKGEVLGITRFGLSKMRD
Sbjct: 1321 IFNVLGIEAARASIIGEIDYTMSNHGMSVDPRHIQLLGDVMTFKGEVLGITRFGLSKMRD 1380

Query: 1381 SVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVVKNTDIAEDEL 1440
            SVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVVKNTDIAEDEL
Sbjct: 1381 SVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVVKNTDIAEDEL 1440

Query: 1441 KPKRTLFESLTSNVANKQV 1459
            KPKRTLFESLTSNVANKQV
Sbjct: 1441 KPKRTLFESLTSNVANKQV 1459

>NDAI0C01620 Chr3 (346478..350860) [4383 bp, 1460 aa] {ON} Anc_5.426
          Length = 1460

 Score = 2585 bits (6700), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1238/1455 (85%), Positives = 1336/1455 (91%), Gaps = 3/1455 (0%)

Query: 1    MKEVVIGETPKRISGLEFSALSPADIVAQSELEISSRDLFDLENNRSPKEGGALDPRMGV 60
            MKEVV+ E PKRISGLEFSALS ADIVAQSE+EISSRDLFDLE  R PK GGALD RMGV
Sbjct: 1    MKEVVVSENPKRISGLEFSALSAADIVAQSEVEISSRDLFDLEKGREPKTGGALDKRMGV 60

Query: 61   SASSMECTTCHGNLASCHGHFGHIKLALPVFHVGYFKATIQILQGICKTCSAILLSEQDK 120
            S+SS+EC TCHGNLASCHGHFGHIKLALPVFHVGYFKATIQILQGICKTCSAILLS++D+
Sbjct: 61   SSSSLECETCHGNLASCHGHFGHIKLALPVFHVGYFKATIQILQGICKTCSAILLSDKDR 120

Query: 121  RHFLSELRRPGVDNLRRMALLKKVLDQCKKQRRCLHCXXXXXXXXXXXXXXXXXSLKIIH 180
            R FL+ELRRPGVDNLRRM +LKKVLDQCKKQRRCL C                 SLKIIH
Sbjct: 121  RQFLNELRRPGVDNLRRMGILKKVLDQCKKQRRCLQCGALNGVVKKAAAGAGSASLKIIH 180

Query: 181  DTFRWVGKKSTPEKDKWIGDWKEVLSHNPELERYVKRATDDLNPLKTLNLFKQIASEDCE 240
            D FRWVGKKS PEKDKW+GDWKEVLSH+PELER+VKR +DDLNPLKTLNLFKQI  EDCE
Sbjct: 181  DNFRWVGKKSAPEKDKWVGDWKEVLSHHPELERFVKRCSDDLNPLKTLNLFKQIKPEDCE 240

Query: 241  LLGIDATNKAGRPETYIWRYIPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300
            LLG+++T K+GRPETYIWRY+PAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK
Sbjct: 241  LLGVNSTVKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300

Query: 301  AGIEKGISINNMMEHWDYLQMTVAMYINSDSINPAMLPGSSTGGGKVKPIRGFCQRLKGK 360
            AG+EKGISINNMMEHWDYLQ+TVAMYINSDS+NPAMLPG+S+GGGKVKPIRGFCQRLKGK
Sbjct: 301  AGLEKGISINNMMEHWDYLQLTVAMYINSDSVNPAMLPGASSGGGKVKPIRGFCQRLKGK 360

Query: 361  QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPQLVAKVLTFPEKVTRYNIKKLRQLV 420
            QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVP  VAKVLTFPEKVTRYN +KL+QL+
Sbjct: 361  QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTFPEKVTRYNRQKLQQLI 420

Query: 421  QNGPNVHPGANYLLKKNEEARRNLRYGDRQKLANNLQYGDVVERHLEDGDVVLFNRQPSL 480
             NGPNVHPGANYLLK NE+ARRNLRYGDR KLA NLQ+GDVVERHLEDGDVVLFNRQPSL
Sbjct: 421  INGPNVHPGANYLLKNNEDARRNLRYGDRVKLAKNLQFGDVVERHLEDGDVVLFNRQPSL 480

Query: 481  HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN 540
            HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN
Sbjct: 481  HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN 540

Query: 541  LLTPKSGEPIIAATQDFITGSYLISHKDSFFDKASLTQLLSMMSDGSLQFDIPPPAIMKP 600
            LLTPKSGEPIIAATQDFITGSYLISHKDSFFD+A+LTQLLSMM D +LQFDIPPPAIMKP
Sbjct: 541  LLTPKSGEPIIAATQDFITGSYLISHKDSFFDRATLTQLLSMMCDANLQFDIPPPAIMKP 600

Query: 601  CYLWTGKQVFSLLIKPNKNSPVKINLDAKNKVYIPPKQKHYPNEMSQNDGFVIVRGSQIL 660
             YLWTGKQ+FSLLIKPNK+SPV INLDAKNKVYIPPK K YPNEMS+NDG+VI+RGSQIL
Sbjct: 601  HYLWTGKQLFSLLIKPNKDSPVVINLDAKNKVYIPPKTKAYPNEMSRNDGYVIIRGSQIL 660

Query: 661  SGVMDKSVLGDGKKHSVFYTILRDFGPQEAASAMNRMAKLCARYLGNRGFSIGISDVTPA 720
            SGVMDKSVLGDGKKHSVFYTILRD+GPQEAA+AMNRMAKLCAR+LGNRGFSIGISDVTPA
Sbjct: 661  SGVMDKSVLGDGKKHSVFYTILRDYGPQEAATAMNRMAKLCARFLGNRGFSIGISDVTPA 720

Query: 721  DDLKQKKEDLVEIAYAKCDELIDLYNKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGDV 780
            DDLKQKKE+LVEIAYAKCDELID +NKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGDV
Sbjct: 721  DDLKQKKEELVEIAYAKCDELIDQFNKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGDV 780

Query: 781  CINELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSK 840
            CINELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHF KNSK
Sbjct: 781  CINELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFQKNSK 840

Query: 841  TPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 900
            TPQSKGFVRNSFFSGL+PPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY
Sbjct: 841  TPQSKGFVRNSFFSGLTPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 900

Query: 901  DNTVRTSSNGIVQFTYGGDGLDPLEMEGNAQPVNFNRSWDHAYNITFNNTDRGLLPYEIK 960
            DNTVRTSSNGIVQFTYGGDGLDP+EMEGNA+PVNFNRSWDHA NITF+    GLLPY+I 
Sbjct: 901  DNTVRTSSNGIVQFTYGGDGLDPMEMEGNAKPVNFNRSWDHATNITFSPDQHGLLPYQIM 960

Query: 961  KTVDNILKPLEKRLIRYDTLGRPVSAEDDKLDDYVDQHDSERLFYASLREFMTDXXXXXX 1020
            +T + ILKPLE RLIRYD LG  V  ED    +YVDQ D+ER FY SLR++M +      
Sbjct: 961  ETTNAILKPLEDRLIRYDNLGEIVPNEDSTKAEYVDQFDAERDFYKSLRDYMDEKAKVLG 1020

Query: 1021 XXXXXXGLPKLIKK--SELEGYDPENEHIDAIVQHSITQLYRITEDAVQKFLEIAISKYH 1078
                  G+  ++ +   EL+  +P+ E +   +++S+ QLY+ITED V+KFLEIA+ KY 
Sbjct: 1021 SVRKSRGMLPMVDEPAEELKKMNPD-EQVPETIRYSVDQLYKITEDLVKKFLEIALYKYR 1079

Query: 1079 RAKVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTP 1138
            +A+VEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTP
Sbjct: 1080 KARVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTP 1139

Query: 1139 IINAVLVNNNDERAARVVKGRIEKTLLSDVCYYIQDVYKENMAYLQVKVDLNTIDKLQLE 1198
            IINAVLVN NDERAARVVKGRIEKTLLSDV YYIQDVYK+N++++QV++DLNTI+KLQLE
Sbjct: 1140 IINAVLVNENDERAARVVKGRIEKTLLSDVAYYIQDVYKDNLSFIQVRIDLNTIEKLQLE 1199

Query: 1199 LTIEDIAIAITRAPKLKIQTSDVTVLGKDKIAINVLPEGFGSKTSSTSLKEPTENDVFYR 1258
            LTIEDIA+A+TRAPKLKI TSDV ++GKDKIAINV PEG+ +K+ ST+ KEPTEN VFYR
Sbjct: 1200 LTIEDIAVALTRAPKLKILTSDVNIIGKDKIAINVFPEGYKAKSISTAAKEPTENAVFYR 1259

Query: 1259 MQTLRRALPSIMVKGLNDIARAVINIRDDGKRELLVEGYGLRDVMCTDGVIGAKTATNHV 1318
            MQ LRRALPSI+VKGL +IARAVINIRDDGKRELLVEGYGLRDVMCTDGVIG KT TNH+
Sbjct: 1260 MQHLRRALPSIVVKGLPEIARAVINIRDDGKRELLVEGYGLRDVMCTDGVIGMKTTTNHI 1319

Query: 1319 LEIFNVLGIEAARASIIGEIDYTMSNHGMSVDPRHIQLLGDVMTFKGEVLGITRFGLSKM 1378
            LE+  VLGIEAAR+SI+GEIDYTMSNHGMSVDPRHIQLLGDVMT+KGEVLGITRFGLSKM
Sbjct: 1320 LEVNTVLGIEAARSSIVGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKM 1379

Query: 1379 RDSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVVKNTDIAED 1438
            RDSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVVK T+IA++
Sbjct: 1380 RDSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVVKGTEIAKE 1439

Query: 1439 ELKPKRTLFESLTSN 1453
             LKPK TLFE+LTS+
Sbjct: 1440 SLKPKPTLFENLTSS 1454

>TDEL0E01990 Chr5 (373218..377600) [4383 bp, 1460 aa] {ON} Anc_5.426
            YOR116C
          Length = 1460

 Score = 2584 bits (6698), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1228/1459 (84%), Positives = 1336/1459 (91%), Gaps = 3/1459 (0%)

Query: 1    MKEVVIGETPKRISGLEFSALSPADIVAQSELEISSRDLFDLENNRSPKEGGALDPRMGV 60
            MKEVV+  TPKRISGLEFSALS ADIVAQSE+EIS+RDLFDLEN R+P+ GGALDP+MGV
Sbjct: 1    MKEVVVSATPKRISGLEFSALSAADIVAQSEVEISTRDLFDLENGRAPRAGGALDPKMGV 60

Query: 61   SASSMECTTCHGNLASCHGHFGHIKLALPVFHVGYFKATIQILQGICKTCSAILLSEQDK 120
            S+SS+ECTTCHGNLASCHGHFGHIKLALPVFHVGYFKATIQILQGICK CSA+LL + D+
Sbjct: 61   SSSSLECTTCHGNLASCHGHFGHIKLALPVFHVGYFKATIQILQGICKNCSAVLLDDHDR 120

Query: 121  RHFLSELRRPGVDNLRRMALLKKVLDQCKKQRRCLHCXXXXXXXXXXXXXXXXXSLKIIH 180
            RHFLSELRRPGVDNLRRM +L KVLDQCKKQRRCL C                 SLKIIH
Sbjct: 121  RHFLSELRRPGVDNLRRMGILSKVLDQCKKQRRCLQCGALNGVVKKAAAGSGSASLKIIH 180

Query: 181  DTFRWVGKKSTPEKDKWIGDWKEVLSHNPELERYVKRATDDLNPLKTLNLFKQIASEDCE 240
            DTFRW GKKS PEKDKW+GDW EVLSHNPELERYVKR  DDLNPLKTLNLFKQ+  EDCE
Sbjct: 181  DTFRWAGKKSVPEKDKWVGDWDEVLSHNPELERYVKRCMDDLNPLKTLNLFKQLKPEDCE 240

Query: 241  LLGIDATNKAGRPETYIWRYIPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300
            LLGID++NK+GRPETYIWRY+PAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK
Sbjct: 241  LLGIDSSNKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300

Query: 301  AGIEKGISINNMMEHWDYLQMTVAMYINSDSINPAMLPGSSTGGGKVKPIRGFCQRLKGK 360
            +G+EKGISINNMMEHWDYLQ++VAMYINSDS+NPAM+PG+S+GGGKVKPIRGFCQRLKGK
Sbjct: 301  SGLEKGISINNMMEHWDYLQLSVAMYINSDSVNPAMMPGASSGGGKVKPIRGFCQRLKGK 360

Query: 361  QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPQLVAKVLTFPEKVTRYNIKKLRQLV 420
            QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVP  VAKVLT+PEKVTRYN +KL+QL+
Sbjct: 361  QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRQKLQQLL 420

Query: 421  QNGPNVHPGANYLLKKNEEARRNLRYGDRQKLANNLQYGDVVERHLEDGDVVLFNRQPSL 480
             NGPNVHPGANYLLKK+E+ARRNLRYGDR KLA NL+ GDVVERHLEDGDVVLFNRQPSL
Sbjct: 421  INGPNVHPGANYLLKKDEDARRNLRYGDRVKLAKNLRVGDVVERHLEDGDVVLFNRQPSL 480

Query: 481  HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN 540
            HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN
Sbjct: 481  HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN 540

Query: 541  LLTPKSGEPIIAATQDFITGSYLISHKDSFFDKASLTQLLSMMSDGSLQFDIPPPAIMKP 600
            LLTPKSGEPIIAATQDFITGSYLISHKDSFFD+ SLTQLLSMMSDG+LQFDIP PAIMKP
Sbjct: 541  LLTPKSGEPIIAATQDFITGSYLISHKDSFFDRGSLTQLLSMMSDGNLQFDIPAPAIMKP 600

Query: 601  CYLWTGKQVFSLLIKPNKNSPVKINLDAKNKVYIPPKQKHYPNEMSQNDGFVIVRGSQIL 660
            CYLWTGKQVFSLLIKPNK SPV INLDAKNKV+IPPK K  P+EMSQNDG+VI+RGS+IL
Sbjct: 601  CYLWTGKQVFSLLIKPNKKSPVVINLDAKNKVFIPPKSKSLPSEMSQNDGYVIIRGSEIL 660

Query: 661  SGVMDKSVLGDGKKHSVFYTILRDFGPQEAASAMNRMAKLCARYLGNRGFSIGISDVTPA 720
            SGVMDKSVLGDGKKHSVFYTILRD+GPQEAA+AMNRMAKLCARYLGNRGFSIGISDVTPA
Sbjct: 661  SGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMAKLCARYLGNRGFSIGISDVTPA 720

Query: 721  DDLKQKKEDLVEIAYAKCDELIDLYNKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGDV 780
            DDLK+KKED+VE AYAKCDELID YNKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGDV
Sbjct: 721  DDLKKKKEDMVEFAYAKCDELIDSYNKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGDV 780

Query: 781  CINELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSK 840
            CINELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSK
Sbjct: 781  CINELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSK 840

Query: 841  TPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 900
            TPQSKGFVRNSFFSGL+PPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY
Sbjct: 841  TPQSKGFVRNSFFSGLTPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 900

Query: 901  DNTVRTSSNGIVQFTYGGDGLDPLEMEGNAQPVNFNRSWDHAYNITFNNTDRGLLPYEIK 960
            DNTVRTSSNGIVQFTYGGDGLDP+EMEGNAQPVNF RSW+HA+N+TFNNT+RGL PY+I+
Sbjct: 901  DNTVRTSSNGIVQFTYGGDGLDPMEMEGNAQPVNFVRSWNHAFNVTFNNTERGLFPYQIE 960

Query: 961  KTVDNILKPLEKRLIRYDTLGRPVSAEDDKLDDYVDQHDSERLFYASLREFMTDXXXXXX 1020
            +  D IL PL  RLIRYD +G+ V  E D L +Y+DQ+D+ER FY SL+ FM        
Sbjct: 961  EETDKILAPLMNRLIRYDNVGKLVPKEKDALIEYIDQNDAERNFYLSLKSFMRGKAELLA 1020

Query: 1021 XXXXXXGLPKLIKK--SELEGYDPENEHIDAIVQHSITQLYRITEDAVQKFLEIAISKYH 1078
                  G+ +L+ +   E +  D  +E +   ++HS+ QL RIT D+V++FL+IAISKY 
Sbjct: 1021 SVRKQRGMKELLDEPGPEFKNID-FDEDVPENIRHSVDQLCRITGDSVREFLKIAISKYR 1079

Query: 1079 RAKVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTP 1138
            RA+VEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTP
Sbjct: 1080 RARVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTP 1139

Query: 1139 IINAVLVNNNDERAARVVKGRIEKTLLSDVCYYIQDVYKENMAYLQVKVDLNTIDKLQLE 1198
            IINAVLVN+NDERAARVVKGRIEKTLLSDV +YIQDVY++N++++QV++DLNTIDKLQLE
Sbjct: 1140 IINAVLVNDNDERAARVVKGRIEKTLLSDVAFYIQDVYQDNLSFMQVRIDLNTIDKLQLE 1199

Query: 1199 LTIEDIAIAITRAPKLKIQTSDVTVLGKDKIAINVLPEGFGSKTSSTSLKEPTENDVFYR 1258
            LTIEDIA+AITRAPKLKIQ SDVT+L KDKIAINV PEG+ +K+ STS KEP ENDVF+R
Sbjct: 1200 LTIEDIAVAITRAPKLKIQASDVTILDKDKIAINVFPEGYKAKSISTSAKEPHENDVFFR 1259

Query: 1259 MQTLRRALPSIMVKGLNDIARAVINIRDDGKRELLVEGYGLRDVMCTDGVIGAKTATNHV 1318
            MQ LRR+LP I+VKGL DI+RAVIN+RDD KRELLVEGYGLRDVM TDGV+G KTATNH+
Sbjct: 1260 MQQLRRSLPGIVVKGLPDISRAVINVRDDTKRELLVEGYGLRDVMSTDGVVGHKTATNHI 1319

Query: 1319 LEIFNVLGIEAARASIIGEIDYTMSNHGMSVDPRHIQLLGDVMTFKGEVLGITRFGLSKM 1378
            LE+F+VLGIEAARASIIGEIDYTMSNHGMSVDPRHIQLLGDVMT+KGE+LGITRFGLSKM
Sbjct: 1320 LEVFSVLGIEAARASIIGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEILGITRFGLSKM 1379

Query: 1379 RDSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVVKNTDIAED 1438
            RDSVLQLASFEKTTDHLFDAAFYMK+DAVEGVSECIILGQTMSIGTG+FKV+K TD+ E 
Sbjct: 1380 RDSVLQLASFEKTTDHLFDAAFYMKRDAVEGVSECIILGQTMSIGTGAFKVIKGTDLHEQ 1439

Query: 1439 ELKPKRTLFESLTSNVANK 1457
            +L+PK TLFESL+   A K
Sbjct: 1440 DLRPKPTLFESLSKETAIK 1458

>NCAS0H02040 Chr8 complement(393711..398093) [4383 bp, 1460 aa] {ON}
            Anc_5.426
          Length = 1460

 Score = 2573 bits (6669), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1227/1454 (84%), Positives = 1336/1454 (91%), Gaps = 3/1454 (0%)

Query: 1    MKEVVIGETPKRISGLEFSALSPADIVAQSELEISSRDLFDLENNRSPKEGGALDPRMGV 60
            MKEVV+ E PKRISGLEFSALS ADIVAQSE+E+SSRDLFDLE  R PK GGALD +MGV
Sbjct: 1    MKEVVVSENPKRISGLEFSALSAADIVAQSEIEVSSRDLFDLEKGREPKIGGALDRKMGV 60

Query: 61   SASSMECTTCHGNLASCHGHFGHIKLALPVFHVGYFKATIQILQGICKTCSAILLSEQDK 120
            S+SS+EC TCHGNLASCHGHFGHIKLALPVFHVGYFKATIQILQG+CKTCSAILL++QDK
Sbjct: 61   SSSSLECETCHGNLASCHGHFGHIKLALPVFHVGYFKATIQILQGVCKTCSAILLNDQDK 120

Query: 121  RHFLSELRRPGVDNLRRMALLKKVLDQCKKQRRCLHCXXXXXXXXXXXXXXXXXSLKIIH 180
            R FL+ELRRPGVDNLRRM +LKKVLDQCKKQRRCL C                 SLKIIH
Sbjct: 121  RQFLTELRRPGVDNLRRMGILKKVLDQCKKQRRCLQCGALNGVVKKAAAGAGPASLKIIH 180

Query: 181  DTFRWVGKKSTPEKDKWIGDWKEVLSHNPELERYVKRATDDLNPLKTLNLFKQIASEDCE 240
            DTFRWVGKKS PEKDKW+GDWKEVLSH+PELER++KR +DDLNPLKTLNLFKQI  EDCE
Sbjct: 181  DTFRWVGKKSAPEKDKWVGDWKEVLSHHPELERFMKRCSDDLNPLKTLNLFKQIKPEDCE 240

Query: 241  LLGIDATNKAGRPETYIWRYIPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300
            LLGID+T K+GRPETYIWRY+PAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK
Sbjct: 241  LLGIDSTVKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300

Query: 301  AGIEKGISINNMMEHWDYLQMTVAMYINSDSINPAMLPGSSTGGGKVKPIRGFCQRLKGK 360
            AG+EKGISINNMMEHWDYLQ+TVAMYINSDS+NPAMLPG+S+GGGKVKPIRGFCQRLKGK
Sbjct: 301  AGLEKGISINNMMEHWDYLQLTVAMYINSDSVNPAMLPGASSGGGKVKPIRGFCQRLKGK 360

Query: 361  QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPQLVAKVLTFPEKVTRYNIKKLRQLV 420
            QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVP  VAKVLTFPEKVTRYN +KL+QL+
Sbjct: 361  QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTFPEKVTRYNKQKLQQLI 420

Query: 421  QNGPNVHPGANYLLKKNEEARRNLRYGDRQKLANNLQYGDVVERHLEDGDVVLFNRQPSL 480
             NGPNVHPGANYLLKKNE+ARRNLRYGDR KLA NLQ+GDVVERHLEDGDVVLFNRQPSL
Sbjct: 421  INGPNVHPGANYLLKKNEDARRNLRYGDRIKLAKNLQHGDVVERHLEDGDVVLFNRQPSL 480

Query: 481  HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN 540
            HRLSILSH+AKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN
Sbjct: 481  HRLSILSHFAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN 540

Query: 541  LLTPKSGEPIIAATQDFITGSYLISHKDSFFDKASLTQLLSMMSDGSLQFDIPPPAIMKP 600
            LLTPKSGEPIIAATQDFITGSYLISHKDSFFD+A+LTQLLSMMS+G+L+FDIPPPAIMKP
Sbjct: 541  LLTPKSGEPIIAATQDFITGSYLISHKDSFFDRATLTQLLSMMSNGTLRFDIPPPAIMKP 600

Query: 601  CYLWTGKQVFSLLIKPNKNSPVKINLDAKNKVYIPPKQKHYPNEMSQNDGFVIVRGSQIL 660
             Y+WTGKQVFSLLI+PNK SPV INLDAKNKV++PPK K YPNEMS+NDG+V++RGS IL
Sbjct: 601  YYMWTGKQVFSLLIRPNKESPVVINLDAKNKVFMPPKYKDYPNEMSRNDGYVVIRGSNIL 660

Query: 661  SGVMDKSVLGDGKKHSVFYTILRDFGPQEAASAMNRMAKLCARYLGNRGFSIGISDVTPA 720
            SGVMDKSVLGDGKKHSVFYTILRD+GPQEAA+AMNRM+KLCARYLGNRGFSIGISDVTPA
Sbjct: 661  SGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMSKLCARYLGNRGFSIGISDVTPA 720

Query: 721  DDLKQKKEDLVEIAYAKCDELIDLYNKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGDV 780
            DDLKQKKE+LVEIAYAKCDELID ++KGKLETQPGCNEEQTLEAKIGGLLSKVREEVGDV
Sbjct: 721  DDLKQKKEELVEIAYAKCDELIDQFHKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGDV 780

Query: 781  CINELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSK 840
            CINELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHF KNSK
Sbjct: 781  CINELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFQKNSK 840

Query: 841  TPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 900
            TPQSKGFVRNSFFSGL+PPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY
Sbjct: 841  TPQSKGFVRNSFFSGLTPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 900

Query: 901  DNTVRTSSNGIVQFTYGGDGLDPLEMEGNAQPVNFNRSWDHAYNITFNNTDRGLLPYEIK 960
            DNTVRTSSNGIVQFTYGGDGLDP+EMEGNA+PVNFNRSWDHA NITF+N ++GLLPYEI 
Sbjct: 901  DNTVRTSSNGIVQFTYGGDGLDPMEMEGNAKPVNFNRSWDHAINITFSNLEKGLLPYEIM 960

Query: 961  KTVDNILKPLEKRLIRYDTLGRPVSAEDDKLDDYVDQHDSERLFYASLREFMTDXXXXXX 1020
            +  + ILKPLE+RLIRYD +G  V  +D++  +YVDQ D+ER FY SLR+++ +      
Sbjct: 961  EKTNEILKPLEERLIRYDNVGELVPKKDNEKAEYVDQFDAERDFYRSLRDYIQEKADILA 1020

Query: 1021 XXXXXXGLPKLIKK--SELEGYDPENEHIDAIVQHSITQLYRITEDAVQKFLEIAISKYH 1078
                  G+ ++  +   EL   DP+ E I   ++HS+ QLY+ITE +VQ FLEIA+ KY 
Sbjct: 1021 RVRKSRGMLEMSSEPGEELRKLDPD-ERITESIKHSVDQLYKITEKSVQTFLEIALYKYR 1079

Query: 1079 RAKVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTP 1138
            +A+VEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTP
Sbjct: 1080 KARVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTP 1139

Query: 1139 IINAVLVNNNDERAARVVKGRIEKTLLSDVCYYIQDVYKENMAYLQVKVDLNTIDKLQLE 1198
            IINAVLVN NDERAARVVKGRIEKTLLSD+ YYIQDVYK+N++++QV+VDL TI+KLQLE
Sbjct: 1140 IINAVLVNENDERAARVVKGRIEKTLLSDIAYYIQDVYKDNLSFIQVRVDLGTIEKLQLE 1199

Query: 1199 LTIEDIAIAITRAPKLKIQTSDVTVLGKDKIAINVLPEGFGSKTSSTSLKEPTENDVFYR 1258
            LTIEDIA+AIT+APKLKIQTSDV +LGKDKIAINV P+G+ +K+ ST  KEP+ N VFYR
Sbjct: 1200 LTIEDIAVAITKAPKLKIQTSDVNILGKDKIAINVYPDGYKAKSISTMAKEPSNNAVFYR 1259

Query: 1259 MQTLRRALPSIMVKGLNDIARAVINIRDDGKRELLVEGYGLRDVMCTDGVIGAKTATNHV 1318
            MQ LRR LPSI+VKG  DI+RAVINIRDDGKRELLVEGYGLRDVMCTDGVIG KT TNH+
Sbjct: 1260 MQHLRRVLPSIVVKGFGDISRAVINIRDDGKRELLVEGYGLRDVMCTDGVIGMKTTTNHI 1319

Query: 1319 LEIFNVLGIEAARASIIGEIDYTMSNHGMSVDPRHIQLLGDVMTFKGEVLGITRFGLSKM 1378
            LE+ NVLGIEAAR+SIIGEIDYTMSNHGMSVDPRHIQLLGDVMT+KGE+LGITRFGLSKM
Sbjct: 1320 LEVNNVLGIEAARSSIIGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEILGITRFGLSKM 1379

Query: 1379 RDSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVVKNTDIAED 1438
            RDSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVVK T+I+E 
Sbjct: 1380 RDSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVVKGTNISEA 1439

Query: 1439 ELKPKRTLFESLTS 1452
            +LKPK TLFE L++
Sbjct: 1440 DLKPKPTLFEKLSN 1453

>YOR116C Chr15 complement(539763..544145) [4383 bp, 1460 aa] {ON}
            RPO31RNA polymerase III largest subunit C160, part of
            core enzyme; similar to bacterial beta-prime subunit and
            to RPA190 and RPO21
          Length = 1460

 Score = 2572 bits (6666), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1228/1459 (84%), Positives = 1331/1459 (91%), Gaps = 3/1459 (0%)

Query: 1    MKEVVIGETPKRISGLEFSALSPADIVAQSELEISSRDLFDLENNRSPKEGGALDPRMGV 60
            MKEVV+ ETPKRI GLEFSALS ADIVAQSE+E+S+RDLFDLE +R+PK  GALDP+MGV
Sbjct: 1    MKEVVVSETPKRIKGLEFSALSAADIVAQSEVEVSTRDLFDLEKDRAPKANGALDPKMGV 60

Query: 61   SASSMECTTCHGNLASCHGHFGHIKLALPVFHVGYFKATIQILQGICKTCSAILLSEQDK 120
            S+SS+EC TCHGNLASCHGHFGH+KLALPVFH+GYFKATIQILQGICK CSAILLSE DK
Sbjct: 61   SSSSLECATCHGNLASCHGHFGHLKLALPVFHIGYFKATIQILQGICKNCSAILLSETDK 120

Query: 121  RHFLSELRRPGVDNLRRMALLKKVLDQCKKQRRCLHCXXXXXXXXXXXXXXXXXSLKIIH 180
            R FL ELRRPGVDNLRRM +LKK+LDQCKKQRRCLHC                 +LKIIH
Sbjct: 121  RQFLHELRRPGVDNLRRMGILKKILDQCKKQRRCLHCGALNGVVKKAAAGAGSAALKIIH 180

Query: 181  DTFRWVGKKSTPEKDKWIGDWKEVLSHNPELERYVKRATDDLNPLKTLNLFKQIASEDCE 240
            DTFRWVGKKS PEKD W+G+WKEVL+HNPELERYVKR  DDLNPLKTLNLFKQI S DCE
Sbjct: 181  DTFRWVGKKSAPEKDIWVGEWKEVLAHNPELERYVKRCMDDLNPLKTLNLFKQIKSADCE 240

Query: 241  LLGIDATNKAGRPETYIWRYIPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300
            LLGIDAT  +GRPETYIWRY+PAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK
Sbjct: 241  LLGIDATVPSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300

Query: 301  AGIEKGISINNMMEHWDYLQMTVAMYINSDSINPAMLPGSSTGGGKVKPIRGFCQRLKGK 360
            AG++KGISINNMMEHWDYLQ+TVAMYINSDS+NPAMLPGSS GGGKVKPIRGFCQRLKGK
Sbjct: 301  AGLDKGISINNMMEHWDYLQLTVAMYINSDSVNPAMLPGSSNGGGKVKPIRGFCQRLKGK 360

Query: 361  QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPQLVAKVLTFPEKVTRYNIKKLRQLV 420
            QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVP  VAKVLT+PEKVTRYN  KL++L+
Sbjct: 361  QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRHKLQELI 420

Query: 421  QNGPNVHPGANYLLKKNEEARRNLRYGDRQKLANNLQYGDVVERHLEDGDVVLFNRQPSL 480
             NGPNVHPGANYLLK+NE+ARRNLRYGDR KLA NLQ GDVVERHLEDGDVVLFNRQPSL
Sbjct: 421  VNGPNVHPGANYLLKRNEDARRNLRYGDRMKLAKNLQIGDVVERHLEDGDVVLFNRQPSL 480

Query: 481  HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN 540
            HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN
Sbjct: 481  HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN 540

Query: 541  LLTPKSGEPIIAATQDFITGSYLISHKDSFFDKASLTQLLSMMSDGSLQFDIPPPAIMKP 600
            LLTPKSGEPIIAATQDFITGSYLISHKDSF+D+A+LTQLLSMMSDG   FDIPPPAIMKP
Sbjct: 541  LLTPKSGEPIIAATQDFITGSYLISHKDSFYDRATLTQLLSMMSDGIEHFDIPPPAIMKP 600

Query: 601  CYLWTGKQVFSLLIKPNKNSPVKINLDAKNKVYIPPKQKHYPNEMSQNDGFVIVRGSQIL 660
             YLWTGKQVFSLLIKPN NSPV INLDAKNKV++PPK K  PNEMSQNDGFVI+RGSQIL
Sbjct: 601  YYLWTGKQVFSLLIKPNHNSPVVINLDAKNKVFVPPKSKSLPNEMSQNDGFVIIRGSQIL 660

Query: 661  SGVMDKSVLGDGKKHSVFYTILRDFGPQEAASAMNRMAKLCARYLGNRGFSIGISDVTPA 720
            SGVMDKSVLGDGKKHSVFYTILRD+GPQEAA+AMNRMAKLCAR+LGNRGFSIGI+DVTPA
Sbjct: 661  SGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMAKLCARFLGNRGFSIGINDVTPA 720

Query: 721  DDLKQKKEDLVEIAYAKCDELIDLYNKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGDV 780
            DDLKQKKE+LVEIAY KCDELI L+NKG+LETQPGCNEEQTLEAKIGGLLSKVREEVGDV
Sbjct: 721  DDLKQKKEELVEIAYHKCDELITLFNKGELETQPGCNEEQTLEAKIGGLLSKVREEVGDV 780

Query: 781  CINELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSK 840
            CINELDN NAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSK
Sbjct: 781  CINELDNWNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSK 840

Query: 841  TPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 900
            TPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY
Sbjct: 841  TPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 900

Query: 901  DNTVRTSSNGIVQFTYGGDGLDPLEMEGNAQPVNFNRSWDHAYNITFNNTDRGLLPYEIK 960
            DNTVRTS+NGIVQFTYGGDGLDPLEMEGNAQPVNFNRSWDHAYNITFNN D+GLLPY I 
Sbjct: 901  DNTVRTSANGIVQFTYGGDGLDPLEMEGNAQPVNFNRSWDHAYNITFNNQDKGLLPYAIM 960

Query: 961  KTVDNILKPLEKRLIRYDTLGRPVSAEDDKLDDYVDQHDSERLFYASLREFMTDXXXXXX 1020
            +T + IL PLE+RL+RYD  G  V  ED    +YVDQ+D+ER FY SLRE++        
Sbjct: 961  ETANEILGPLEERLVRYDNSGCLVKREDLNKAEYVDQYDAERDFYHSLREYINGKATALA 1020

Query: 1021 XXXXXXGLPKLIK--KSELEGYDPENEHIDAIVQHSITQLYRITEDAVQKFLEIAISKYH 1078
                  G+  L++    EL+G DP+ E +   V+ S++QLYRI+E +V+KFLEIA+ KY 
Sbjct: 1021 NLRKSRGMLGLLEPPAKELQGIDPD-ETVPDNVKTSVSQLYRISEKSVRKFLEIALFKYR 1079

Query: 1079 RAKVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTP 1138
            +A++EPGTA+GAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTP
Sbjct: 1080 KARLEPGTAIGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTP 1139

Query: 1139 IINAVLVNNNDERAARVVKGRIEKTLLSDVCYYIQDVYKENMAYLQVKVDLNTIDKLQLE 1198
            IINAVLVN+NDERAARVVKGR+EKTLLSDV +Y+QDVYK+N++++QV++DL TIDKLQLE
Sbjct: 1140 IINAVLVNDNDERAARVVKGRVEKTLLSDVAFYVQDVYKDNLSFIQVRIDLGTIDKLQLE 1199

Query: 1199 LTIEDIAIAITRAPKLKIQTSDVTVLGKDKIAINVLPEGFGSKTSSTSLKEPTENDVFYR 1258
            LTIEDIA+AITRA KLKIQ SDV ++GKD+IAINV PEG+ +K+ STS KEP+ENDVFYR
Sbjct: 1200 LTIEDIAVAITRASKLKIQASDVNIIGKDRIAINVFPEGYKAKSISTSAKEPSENDVFYR 1259

Query: 1259 MQTLRRALPSIMVKGLNDIARAVINIRDDGKRELLVEGYGLRDVMCTDGVIGAKTATNHV 1318
            MQ LRRALP ++VKGL DI+RAVINIRDDGKRELLVEGYGLRDVMCTDGVIG++T TNHV
Sbjct: 1260 MQQLRRALPDVVVKGLPDISRAVINIRDDGKRELLVEGYGLRDVMCTDGVIGSRTTTNHV 1319

Query: 1319 LEIFNVLGIEAARASIIGEIDYTMSNHGMSVDPRHIQLLGDVMTFKGEVLGITRFGLSKM 1378
            LE+F+VLGIEAAR SII EI+YTMSNHGMSVDPRHIQLLGDVMT+KGEVLGITRFGLSKM
Sbjct: 1320 LEVFSVLGIEAARYSIIREINYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKM 1379

Query: 1379 RDSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVVKNTDIAED 1438
            RDSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVVK T+I+E 
Sbjct: 1380 RDSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVVKGTNISEK 1439

Query: 1439 ELKPKRTLFESLTSNVANK 1457
            +L PKR LFESL++  A K
Sbjct: 1440 DLVPKRCLFESLSNEAALK 1458

>Skud_15.279 Chr15 complement(496216..500598) [4383 bp, 1460 aa] {ON}
            YOR116C (REAL)
          Length = 1460

 Score = 2566 bits (6651), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1225/1459 (83%), Positives = 1330/1459 (91%), Gaps = 3/1459 (0%)

Query: 1    MKEVVIGETPKRISGLEFSALSPADIVAQSELEISSRDLFDLENNRSPKEGGALDPRMGV 60
            MKEVV+ ETPKRI GLEFSALS ADIVAQSE+E+S+RDLFDLE +R+PK  GALDP+MGV
Sbjct: 1    MKEVVVSETPKRIKGLEFSALSAADIVAQSEVEVSTRDLFDLEKDRAPKANGALDPKMGV 60

Query: 61   SASSMECTTCHGNLASCHGHFGHIKLALPVFHVGYFKATIQILQGICKTCSAILLSEQDK 120
            S+S++EC TCHGNLASCHGHFGH+KLALPVFH+GYFKATIQILQGICK CSA+LLSE DK
Sbjct: 61   SSSTLECATCHGNLASCHGHFGHLKLALPVFHIGYFKATIQILQGICKNCSAVLLSETDK 120

Query: 121  RHFLSELRRPGVDNLRRMALLKKVLDQCKKQRRCLHCXXXXXXXXXXXXXXXXXSLKIIH 180
            RHFL ELRRPGVDNLRRM +LKK+LDQCKKQRRCLHC                 +LKIIH
Sbjct: 121  RHFLHELRRPGVDNLRRMGILKKILDQCKKQRRCLHCGALNGVVKKAAAGAGSAALKIIH 180

Query: 181  DTFRWVGKKSTPEKDKWIGDWKEVLSHNPELERYVKRATDDLNPLKTLNLFKQIASEDCE 240
            DTFRWVGKKS PEKD W+G+WKEVL+HNPELERYVKR  DDLNPLKTLNLFKQI S DCE
Sbjct: 181  DTFRWVGKKSAPEKDIWVGEWKEVLTHNPELERYVKRCMDDLNPLKTLNLFKQIKSADCE 240

Query: 241  LLGIDATNKAGRPETYIWRYIPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300
            LLGIDAT  +GRPETYIWRY+PAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK
Sbjct: 241  LLGIDATIPSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300

Query: 301  AGIEKGISINNMMEHWDYLQMTVAMYINSDSINPAMLPGSSTGGGKVKPIRGFCQRLKGK 360
            AG++KGISINNMMEHWDYLQ+TVAMYINSDS+NPAMLPGSS GGGKVKPIRGFCQRLKGK
Sbjct: 301  AGLDKGISINNMMEHWDYLQLTVAMYINSDSVNPAMLPGSSNGGGKVKPIRGFCQRLKGK 360

Query: 361  QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPQLVAKVLTFPEKVTRYNIKKLRQLV 420
            QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVP  VAKVLT+PEKVTRYN  KL++L+
Sbjct: 361  QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRLKLQELI 420

Query: 421  QNGPNVHPGANYLLKKNEEARRNLRYGDRQKLANNLQYGDVVERHLEDGDVVLFNRQPSL 480
             NGPNVHPGANYLLK+NE+ARRNLRYGDR KLA NLQ GDVVERHLEDGDVVLFNRQPSL
Sbjct: 421  VNGPNVHPGANYLLKRNEDARRNLRYGDRMKLAKNLQIGDVVERHLEDGDVVLFNRQPSL 480

Query: 481  HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN 540
            HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN
Sbjct: 481  HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN 540

Query: 541  LLTPKSGEPIIAATQDFITGSYLISHKDSFFDKASLTQLLSMMSDGSLQFDIPPPAIMKP 600
            LLTPKSGEPIIAATQDFITGSYLISHKDSF+D+A+LTQLLSMMSDG  QFD+PPPAIMKP
Sbjct: 541  LLTPKSGEPIIAATQDFITGSYLISHKDSFYDRATLTQLLSMMSDGIEQFDVPPPAIMKP 600

Query: 601  CYLWTGKQVFSLLIKPNKNSPVKINLDAKNKVYIPPKQKHYPNEMSQNDGFVIVRGSQIL 660
             YLWTGKQVFSLLIKPN NSPV INLDAKNKV++PPK K  P+EMSQNDGFVI+RGSQIL
Sbjct: 601  YYLWTGKQVFSLLIKPNHNSPVVINLDAKNKVFVPPKSKSLPSEMSQNDGFVIIRGSQIL 660

Query: 661  SGVMDKSVLGDGKKHSVFYTILRDFGPQEAASAMNRMAKLCARYLGNRGFSIGISDVTPA 720
            SGVMDKSVLGDGKKHSVFYTILRD+GPQEAA+AMNRMAKLCAR+LGNRGFSIGI+DVTPA
Sbjct: 661  SGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMAKLCARFLGNRGFSIGINDVTPA 720

Query: 721  DDLKQKKEDLVEIAYAKCDELIDLYNKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGDV 780
            DDLKQKKE+LVEIAY KCDELI L+NKG+LETQPGCNEEQTLEAKIGG LSKVREEVGDV
Sbjct: 721  DDLKQKKEELVEIAYRKCDELITLFNKGELETQPGCNEEQTLEAKIGGFLSKVREEVGDV 780

Query: 781  CINELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSK 840
            CINELDN NAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSK
Sbjct: 781  CINELDNWNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSK 840

Query: 841  TPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 900
            TPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY
Sbjct: 841  TPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 900

Query: 901  DNTVRTSSNGIVQFTYGGDGLDPLEMEGNAQPVNFNRSWDHAYNITFNNTDRGLLPYEIK 960
            DNTVRTS+NGIVQFTYGGDGLDPLEMEGNAQPVNFNRSWDHAYNITFNN D GLLPY I 
Sbjct: 901  DNTVRTSANGIVQFTYGGDGLDPLEMEGNAQPVNFNRSWDHAYNITFNNEDEGLLPYAIM 960

Query: 961  KTVDNILKPLEKRLIRYDTLGRPVSAEDDKLDDYVDQHDSERLFYASLREFMTDXXXXXX 1020
            KT + IL+PLE+RL+RYD  G  V  ED    +YVDQ+D+ER FY SLRE++        
Sbjct: 961  KTANEILRPLEERLVRYDNRGSLVKEEDKDRAEYVDQYDAERDFYRSLREYINLKATALA 1020

Query: 1021 XXXXXXGLPKLIK--KSELEGYDPENEHIDAIVQHSITQLYRITEDAVQKFLEIAISKYH 1078
                  G+ + ++  + ELEG D + E +   V+ S++QLYRI+E +V+KFLEIA+ KY 
Sbjct: 1021 NLRKSRGMFEQLEPPEKELEGIDLD-EAVPDNVRTSVSQLYRISEKSVRKFLEIALFKYR 1079

Query: 1079 RAKVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTP 1138
            +A++EPGTA+GAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASK ISTP
Sbjct: 1080 KARLEPGTAIGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKSISTP 1139

Query: 1139 IINAVLVNNNDERAARVVKGRIEKTLLSDVCYYIQDVYKENMAYLQVKVDLNTIDKLQLE 1198
            IINAVLVN+NDERAARVVKGR+EKTLLSDV YY+QDVYK+N++++QV++DL+TIDKLQLE
Sbjct: 1140 IINAVLVNDNDERAARVVKGRVEKTLLSDVAYYVQDVYKDNLSFIQVRIDLSTIDKLQLE 1199

Query: 1199 LTIEDIAIAITRAPKLKIQTSDVTVLGKDKIAINVLPEGFGSKTSSTSLKEPTENDVFYR 1258
            LTIEDIAIAITRA KLKIQ SDV ++GKD+IAINV PEG+ +K+ STS KEP+ENDVFYR
Sbjct: 1200 LTIEDIAIAITRASKLKIQASDVNIIGKDQIAINVFPEGYKAKSISTSAKEPSENDVFYR 1259

Query: 1259 MQTLRRALPSIMVKGLNDIARAVINIRDDGKRELLVEGYGLRDVMCTDGVIGAKTATNHV 1318
            MQ LRRALP ++VKGL DI+RAVINIRDD KRELLVEGYGLRDVMCTDGVIG+KT TNHV
Sbjct: 1260 MQQLRRALPDVVVKGLPDISRAVINIRDDAKRELLVEGYGLRDVMCTDGVIGSKTTTNHV 1319

Query: 1319 LEIFNVLGIEAARASIIGEIDYTMSNHGMSVDPRHIQLLGDVMTFKGEVLGITRFGLSKM 1378
            LE+F+VLGIEAAR SII EI+YTMSNHGMSVDPRHIQLLGDVMT+KGEVLGITRFGLSKM
Sbjct: 1320 LEVFSVLGIEAARYSIIREINYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKM 1379

Query: 1379 RDSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVVKNTDIAED 1438
            RDSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVVK T+I+E 
Sbjct: 1380 RDSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVVKGTNISEK 1439

Query: 1439 ELKPKRTLFESLTSNVANK 1457
            +L PK  LFESL++  A K
Sbjct: 1440 DLVPKPCLFESLSNEAALK 1458

>Smik_15.294 Chr15 complement(500962..505344) [4383 bp, 1460 aa] {ON}
            YOR116C (REAL)
          Length = 1460

 Score = 2565 bits (6648), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1225/1459 (83%), Positives = 1331/1459 (91%), Gaps = 3/1459 (0%)

Query: 1    MKEVVIGETPKRISGLEFSALSPADIVAQSELEISSRDLFDLENNRSPKEGGALDPRMGV 60
            MKEVV+ ETPKRI GLEFSALS ADIVAQSE+E+S+RDLFDLE +R+PK  GALDP+MGV
Sbjct: 1    MKEVVVSETPKRIKGLEFSALSAADIVAQSEVEVSTRDLFDLEKDRAPKANGALDPKMGV 60

Query: 61   SASSMECTTCHGNLASCHGHFGHIKLALPVFHVGYFKATIQILQGICKTCSAILLSEQDK 120
            S+SS+EC TCHGNLASCHGHFGH+KLALPVFH+GYFKATIQILQGICK CSAILLSE DK
Sbjct: 61   SSSSLECATCHGNLASCHGHFGHLKLALPVFHIGYFKATIQILQGICKNCSAILLSETDK 120

Query: 121  RHFLSELRRPGVDNLRRMALLKKVLDQCKKQRRCLHCXXXXXXXXXXXXXXXXXSLKIIH 180
            RHFL ELRRPGVDNLRRM +LKK+LDQCKKQRRCLHC                 +LKIIH
Sbjct: 121  RHFLQELRRPGVDNLRRMGILKKILDQCKKQRRCLHCGALNGVVKKAAAGAGSAALKIIH 180

Query: 181  DTFRWVGKKSTPEKDKWIGDWKEVLSHNPELERYVKRATDDLNPLKTLNLFKQIASEDCE 240
            DTFRWVGKKS PEKD W+G+WKEVL+HNPELERYVKR  DDLNPLKTLNLFKQI S DCE
Sbjct: 181  DTFRWVGKKSAPEKDIWVGEWKEVLTHNPELERYVKRCMDDLNPLKTLNLFKQIKSADCE 240

Query: 241  LLGIDATNKAGRPETYIWRYIPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300
            LLGIDAT  +GRPETYIWRY+PAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK
Sbjct: 241  LLGIDATVPSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300

Query: 301  AGIEKGISINNMMEHWDYLQMTVAMYINSDSINPAMLPGSSTGGGKVKPIRGFCQRLKGK 360
            AG++KGISINNMMEHWDYLQ+TVAMYINSDS+NPAMLPGSS GGGKVKPIRGFCQRLKGK
Sbjct: 301  AGLDKGISINNMMEHWDYLQLTVAMYINSDSVNPAMLPGSSNGGGKVKPIRGFCQRLKGK 360

Query: 361  QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPQLVAKVLTFPEKVTRYNIKKLRQLV 420
            QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVP  VAKVLT+PEKVTRYN  KL++L+
Sbjct: 361  QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRHKLQELI 420

Query: 421  QNGPNVHPGANYLLKKNEEARRNLRYGDRQKLANNLQYGDVVERHLEDGDVVLFNRQPSL 480
             NGPNVHPGANYLLK+NE+ARRNLRYGDR KLA NLQ GDVVERHLEDGDVVLFNRQPSL
Sbjct: 421  VNGPNVHPGANYLLKRNEDARRNLRYGDRLKLAKNLQIGDVVERHLEDGDVVLFNRQPSL 480

Query: 481  HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN 540
            HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN
Sbjct: 481  HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN 540

Query: 541  LLTPKSGEPIIAATQDFITGSYLISHKDSFFDKASLTQLLSMMSDGSLQFDIPPPAIMKP 600
            LLTPKSGEPIIAATQDFITGSYLISHKDSF+D+A+LTQLLSMMSDG  QFDIPPPAIMKP
Sbjct: 541  LLTPKSGEPIIAATQDFITGSYLISHKDSFYDRATLTQLLSMMSDGIEQFDIPPPAIMKP 600

Query: 601  CYLWTGKQVFSLLIKPNKNSPVKINLDAKNKVYIPPKQKHYPNEMSQNDGFVIVRGSQIL 660
             YLWTGKQVFSLLIKPN NSPV INLDAKNKV++PPK K  PNEMSQNDGFVI+RGS+IL
Sbjct: 601  YYLWTGKQVFSLLIKPNHNSPVVINLDAKNKVFVPPKSKSLPNEMSQNDGFVIIRGSKIL 660

Query: 661  SGVMDKSVLGDGKKHSVFYTILRDFGPQEAASAMNRMAKLCARYLGNRGFSIGISDVTPA 720
            SGVMDKSVLGDGKKHSVFYTILRD+GPQEAA+AMNRMAKLCAR+LGNRGFSIGI+DVTPA
Sbjct: 661  SGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMAKLCARFLGNRGFSIGINDVTPA 720

Query: 721  DDLKQKKEDLVEIAYAKCDELIDLYNKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGDV 780
            DDLKQKKE+LVEIAY+KCDELI L+NKG+LETQPGCNEEQTLEAKIGGLLSKVREEVGDV
Sbjct: 721  DDLKQKKEELVEIAYSKCDELITLFNKGELETQPGCNEEQTLEAKIGGLLSKVREEVGDV 780

Query: 781  CINELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSK 840
            CINELDN NAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSK
Sbjct: 781  CINELDNWNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSK 840

Query: 841  TPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 900
            TPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY
Sbjct: 841  TPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 900

Query: 901  DNTVRTSSNGIVQFTYGGDGLDPLEMEGNAQPVNFNRSWDHAYNITFNNTDRGLLPYEIK 960
            DNTVRTS+NGIVQFTYGGDGLDPLEMEGNAQPVNFNRSWDHAYNITFNN D GLLPY I 
Sbjct: 901  DNTVRTSANGIVQFTYGGDGLDPLEMEGNAQPVNFNRSWDHAYNITFNNQDEGLLPYAIM 960

Query: 961  KTVDNILKPLEKRLIRYDTLGRPVSAEDDKLDDYVDQHDSERLFYASLREFMTDXXXXXX 1020
            +T + IL+PLE+RL+RYD  G  V  E+    +YVDQ+D+ER FY SL+E++        
Sbjct: 961  QTTNEILRPLEERLVRYDNSGCLVKEENLNKAEYVDQYDAERDFYRSLKEYINLKATALA 1020

Query: 1021 XXXXXXGLPKLIK--KSELEGYDPENEHIDAIVQHSITQLYRITEDAVQKFLEIAISKYH 1078
                  G+ +L++    E E  DP+    D  V+ S++QLYRI+E +V+KFLEIA+ KY 
Sbjct: 1021 NLRKSRGMLELLEPPTKESEKVDPDKLVPDN-VKTSVSQLYRISEKSVRKFLEIALYKYR 1079

Query: 1079 RAKVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTP 1138
            +A++EPGTA+GAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTP
Sbjct: 1080 KARLEPGTAIGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTP 1139

Query: 1139 IINAVLVNNNDERAARVVKGRIEKTLLSDVCYYIQDVYKENMAYLQVKVDLNTIDKLQLE 1198
            IINAVLVN+NDERAARVVKGR+EKTLLSDV YY+QDVYK+N++++QV++DL TIDKLQLE
Sbjct: 1140 IINAVLVNDNDERAARVVKGRVEKTLLSDVAYYVQDVYKDNLSFIQVRIDLGTIDKLQLE 1199

Query: 1199 LTIEDIAIAITRAPKLKIQTSDVTVLGKDKIAINVLPEGFGSKTSSTSLKEPTENDVFYR 1258
            LTIEDIA+AITRA KLKIQ SDV ++GKD+IAINV PEG+ +++ STS KEP+ENDVFYR
Sbjct: 1200 LTIEDIAVAITRAAKLKIQASDVNIIGKDRIAINVFPEGYKARSISTSAKEPSENDVFYR 1259

Query: 1259 MQTLRRALPSIMVKGLNDIARAVINIRDDGKRELLVEGYGLRDVMCTDGVIGAKTATNHV 1318
            MQ LRRALP ++VKGL DI+RAVINIRDDGKRELLVEGYGLRDVMCTDGVIG++T TNHV
Sbjct: 1260 MQQLRRALPDVVVKGLPDISRAVINIRDDGKRELLVEGYGLRDVMCTDGVIGSRTTTNHV 1319

Query: 1319 LEIFNVLGIEAARASIIGEIDYTMSNHGMSVDPRHIQLLGDVMTFKGEVLGITRFGLSKM 1378
            LE+F+VLGIEAAR SII EI+YTMSNHGMSVDPRHIQLLGDVMT+KGEVLGITRFGLSKM
Sbjct: 1320 LEVFSVLGIEAARYSIIREINYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKM 1379

Query: 1379 RDSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVVKNTDIAED 1438
            RDSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVVK T+I+E 
Sbjct: 1380 RDSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVVKGTNISER 1439

Query: 1439 ELKPKRTLFESLTSNVANK 1457
            +L PK  LFESL++  A K
Sbjct: 1440 DLVPKPCLFESLSNEAALK 1458

>KAFR0D05030 Chr4 complement(988159..992547) [4389 bp, 1462 aa] {ON}
            Anc_5.426 YOR116C
          Length = 1462

 Score = 2556 bits (6625), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1220/1460 (83%), Positives = 1327/1460 (90%), Gaps = 6/1460 (0%)

Query: 1    MKEVVIGETPKRISGLEFSALSPADIVAQSELEISSRDLFDLENNRSPKEGGALDPRMGV 60
            MKEVVI E PK+ISG+EFSALS +DIVAQSE+EISSRDLFDLE NR  KE GALDPRMGV
Sbjct: 1    MKEVVISEAPKKISGIEFSALSASDIVAQSEVEISSRDLFDLEQNRKQKENGALDPRMGV 60

Query: 61   SASSMECTTCHGNLASCHGHFGHIKLALPVFHVGYFKATIQILQGICKTCSAILLSEQDK 120
            S+SS+ C TCHGNLASCHGHFGHIKLALPVFHVGYFKATIQILQ ICK CS++LLS++DK
Sbjct: 61   SSSSLTCETCHGNLASCHGHFGHIKLALPVFHVGYFKATIQILQAICKNCSSVLLSDEDK 120

Query: 121  RHFLSELRRPG-VDNLRRMALLKKVLDQCKKQRRCLHCXXXXXXXXXXXXXXXXXSLKII 179
            + +L ELR  G +DNL++M +LKKV+DQCKKQRRCLHC                 SLKII
Sbjct: 121  KKYLHELRTSGRIDNLKKMGILKKVMDQCKKQRRCLHCGALNGVVKKAAAGSGTASLKII 180

Query: 180  HDTFRWVGKKSTPEKDKWIGDWKEVLSHNPELERYVKRATDDLNPLKTLNLFKQIASEDC 239
            HDTFRWVGKKSTPEKD WIGDW EVLSH+PELER+VKR TDDLNPLKTLNLFKQ+  EDC
Sbjct: 181  HDTFRWVGKKSTPEKDNWIGDWNEVLSHHPELERFVKRCTDDLNPLKTLNLFKQVRPEDC 240

Query: 240  ELLGIDATNKAGRPETYIWRYIPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLI 299
            ELLGID+T K+GRPETYIWRY+PAPPVCIRPSVMMQDSPASNEDDLT+KLTEIVWTSSLI
Sbjct: 241  ELLGIDSTVKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTIKLTEIVWTSSLI 300

Query: 300  KAGIEKGISINNMMEHWDYLQMTVAMYINSDSINPAMLPGSSTGGGKVKPIRGFCQRLKG 359
            KAG+EKGISINNMMEHWDYLQ+TVAMYIN+DS+NPAMLPG+S+GGGKVKPIRGFCQRLKG
Sbjct: 301  KAGLEKGISINNMMEHWDYLQLTVAMYINADSVNPAMLPGASSGGGKVKPIRGFCQRLKG 360

Query: 360  KQGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPQLVAKVLTFPEKVTRYNIKKLRQL 419
            KQGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVP  VAKVLT+PEKVTRYN KKL++L
Sbjct: 361  KQGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRKKLQEL 420

Query: 420  VQNGPNVHPGANYLLKKNEEARRNLRYGDRQKLANNLQYGDVVERHLEDGDVVLFNRQPS 479
            V NGPN+HPGANYLLKKNEEARRNLRYGDR KLA NLQYGD+VERHLEDGDVVLFNRQPS
Sbjct: 421  VMNGPNIHPGANYLLKKNEEARRNLRYGDRLKLAKNLQYGDIVERHLEDGDVVLFNRQPS 480

Query: 480  LHRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKN 539
            LHRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKN
Sbjct: 481  LHRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKN 540

Query: 540  NLLTPKSGEPIIAATQDFITGSYLISHKDSFFDKASLTQLLSMMSDGSLQFDIPPPAIMK 599
            NLLTPKSGEPIIAATQDFITGSYLISHKDSFFD+A+ TQLLSMMSDG+LQFDIPPPAIMK
Sbjct: 541  NLLTPKSGEPIIAATQDFITGSYLISHKDSFFDRATFTQLLSMMSDGNLQFDIPPPAIMK 600

Query: 600  PCYLWTGKQVFSLLIKPNKNSPVKINLDAKNKVYIPPKQKHYPNEMSQNDGFVIVRGSQI 659
            P YLWTGKQ+FSLLIKPN  SPV INLDAKNKVYIPPK K  PNEMS+NDGFVI+RGS I
Sbjct: 601  PYYLWTGKQLFSLLIKPNHKSPVVINLDAKNKVYIPPKSKSLPNEMSRNDGFVIIRGSNI 660

Query: 660  LSGVMDKSVLGDGKKHSVFYTILRDFGPQEAASAMNRMAKLCARYLGNRGFSIGISDVTP 719
            LSGVMDKSVLGDGKKHSVFYTILRD+GPQEAA+AMNRM+KLCAR+LGNRGFSIGISDVTP
Sbjct: 661  LSGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMSKLCARFLGNRGFSIGISDVTP 720

Query: 720  ADDLKQKKEDLVEIAYAKCDELIDLYNKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGD 779
            ADDLK KKE+LVEIAYAKCD+LID YNKGKLETQPGCNEE+TLEAKIGGLLSKVREEVGD
Sbjct: 721  ADDLKIKKEELVEIAYAKCDDLIDSYNKGKLETQPGCNEEETLEAKIGGLLSKVREEVGD 780

Query: 780  VCINELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNS 839
            VCINELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNS
Sbjct: 781  VCINELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNS 840

Query: 840  KTPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQ 899
            KTPQSKGFVRNSFFSGL+PPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQ
Sbjct: 841  KTPQSKGFVRNSFFSGLTPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQ 900

Query: 900  YDNTVRTSSNGIVQFTYGGDGLDPLEMEGNAQPVNFNRSWDHAYNITFNNTDRGLLPYEI 959
            YDNTVRTSSNGIVQFTYGGDGLDP+EMEG+AQPVNFNRSWDHA NITFNN +RGLLPY++
Sbjct: 901  YDNTVRTSSNGIVQFTYGGDGLDPMEMEGSAQPVNFNRSWDHALNITFNNNERGLLPYQV 960

Query: 960  KKTVDNILKPLEKRLIRYDTLGRPVSAED-DKLDDYVDQHDSERLFYASLREFMTDXXXX 1018
             K  + +L PLE+RL+RYD LG  V  ED DKL +Y DQ D+ER FY +LR ++      
Sbjct: 961  MKKTNEVLNPLEERLVRYDNLGNEVMKEDLDKL-EYADQFDAERDFYKTLRSYIQSKSDH 1019

Query: 1019 XXXXXXXXGLPKLIKK--SELEGYDPENEHIDAIVQHSITQLYRITEDAVQKFLEIAISK 1076
                    GL +L+ +   EL+   P+    D + + S+ QL +ITE AV KFLEIA+SK
Sbjct: 1020 LAHVRKSRGLLELLSEPGEELQSLHPDERATD-VSRSSVDQLCKITEKAVLKFLEIALSK 1078

Query: 1077 YHRAKVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVIS 1136
            Y +A+VEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASK IS
Sbjct: 1079 YRKARVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKTIS 1138

Query: 1137 TPIINAVLVNNNDERAARVVKGRIEKTLLSDVCYYIQDVYKENMAYLQVKVDLNTIDKLQ 1196
            TPIINAVLVNNNDERAARVVKGR+EKT+LSDV YYIQDVYK+N+++LQ+++DLNTI+KLQ
Sbjct: 1139 TPIINAVLVNNNDERAARVVKGRVEKTMLSDVAYYIQDVYKDNLSFLQIRIDLNTIEKLQ 1198

Query: 1197 LELTIEDIAIAITRAPKLKIQTSDVTVLGKDKIAINVLPEGFGSKTSSTSLKEPTENDVF 1256
            LELTIEDIA+A+T+APKLKIQ SDV++ G DK+ +NV PEG  SK+ STS K+P+ENDVF
Sbjct: 1199 LELTIEDIAVALTKAPKLKIQASDVSIAGDDKVIVNVFPEGSKSKSISTSAKDPSENDVF 1258

Query: 1257 YRMQTLRRALPSIMVKGLNDIARAVINIRDDGKRELLVEGYGLRDVMCTDGVIGAKTATN 1316
            YRMQ LRRALP I+VKGL +IARAVINIRDDGKRELLVEGYGLR+VMCTDGVIG+KT TN
Sbjct: 1259 YRMQQLRRALPHIVVKGLPEIARAVINIRDDGKRELLVEGYGLREVMCTDGVIGSKTVTN 1318

Query: 1317 HVLEIFNVLGIEAARASIIGEIDYTMSNHGMSVDPRHIQLLGDVMTFKGEVLGITRFGLS 1376
            HVLE+ +VLGIEAAR+SIIGEIDYTMSNHGMSVDPRHIQLLGDVMT+KGEVLGITRFGLS
Sbjct: 1319 HVLEVSSVLGIEAARSSIIGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLS 1378

Query: 1377 KMRDSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVVKNTDIA 1436
            KMRDSVLQLASFEKTTDHLFDAAFYMKKD VEGVSECIILGQTMSIGTGSFKVVK TDI 
Sbjct: 1379 KMRDSVLQLASFEKTTDHLFDAAFYMKKDNVEGVSECIILGQTMSIGTGSFKVVKGTDIK 1438

Query: 1437 EDELKPKRTLFESLTSNVAN 1456
             ++LKPK TLFESL+S  +N
Sbjct: 1439 PEDLKPKPTLFESLSSASSN 1458

>Suva_8.169 Chr8 complement(297556..301938) [4383 bp, 1460 aa] {ON}
            YOR116C (REAL)
          Length = 1460

 Score = 2555 bits (6622), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1218/1459 (83%), Positives = 1326/1459 (90%), Gaps = 3/1459 (0%)

Query: 1    MKEVVIGETPKRISGLEFSALSPADIVAQSELEISSRDLFDLENNRSPKEGGALDPRMGV 60
            MKEVV+ ETPKRI GLEFSALS ADIVAQSE+E+S+RDLFDLE +R+P+  GALDP+MGV
Sbjct: 1    MKEVVVSETPKRIKGLEFSALSAADIVAQSEVEVSTRDLFDLEKDRAPRANGALDPKMGV 60

Query: 61   SASSMECTTCHGNLASCHGHFGHIKLALPVFHVGYFKATIQILQGICKTCSAILLSEQDK 120
            S+SS+ECTTCHGNLASCHGHFGH+KLALPVFH+GYFKATIQILQGICK CSAILLSE DK
Sbjct: 61   SSSSLECTTCHGNLASCHGHFGHLKLALPVFHIGYFKATIQILQGICKNCSAILLSETDK 120

Query: 121  RHFLSELRRPGVDNLRRMALLKKVLDQCKKQRRCLHCXXXXXXXXXXXXXXXXXSLKIIH 180
            R FL ELRRPGVDNLRRM +LKK+LDQCKKQRRCLHC                 +LKIIH
Sbjct: 121  RKFLHELRRPGVDNLRRMGILKKILDQCKKQRRCLHCGALNGVVKKAAAGAGSAALKIIH 180

Query: 181  DTFRWVGKKSTPEKDKWIGDWKEVLSHNPELERYVKRATDDLNPLKTLNLFKQIASEDCE 240
            DTFRWVGKKS PEKD W+G+WKEVL+HNPELERYVKR  DDLNPLKTLNLFKQI S DCE
Sbjct: 181  DTFRWVGKKSAPEKDIWVGEWKEVLTHNPELERYVKRCMDDLNPLKTLNLFKQIKSADCE 240

Query: 241  LLGIDATNKAGRPETYIWRYIPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300
            LLGIDAT  +GRPETYIWRY+PAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK
Sbjct: 241  LLGIDATVPSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300

Query: 301  AGIEKGISINNMMEHWDYLQMTVAMYINSDSINPAMLPGSSTGGGKVKPIRGFCQRLKGK 360
            AG++KGISINNMMEHWDYLQ+TVAMYINSDS+NPAMLPGSS GGGKVKPIRGFCQRLKGK
Sbjct: 301  AGLDKGISINNMMEHWDYLQLTVAMYINSDSVNPAMLPGSSNGGGKVKPIRGFCQRLKGK 360

Query: 361  QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPQLVAKVLTFPEKVTRYNIKKLRQLV 420
            QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVP  VAKVLT+PEKVTRYN  KL++LV
Sbjct: 361  QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRHKLQELV 420

Query: 421  QNGPNVHPGANYLLKKNEEARRNLRYGDRQKLANNLQYGDVVERHLEDGDVVLFNRQPSL 480
             NGPNVHPGANYLLKKNE+ARRNLRYGDR KLA +LQ GDV+ERHLEDGDVVLFNRQPSL
Sbjct: 421  VNGPNVHPGANYLLKKNEDARRNLRYGDRMKLAKSLQIGDVIERHLEDGDVVLFNRQPSL 480

Query: 481  HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN 540
            HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN
Sbjct: 481  HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN 540

Query: 541  LLTPKSGEPIIAATQDFITGSYLISHKDSFFDKASLTQLLSMMSDGSLQFDIPPPAIMKP 600
            LLTPKSGEPIIAATQDFITGSYLISHKDSF+D+A+LTQLL MMSDG  QFD+PPPAIMKP
Sbjct: 541  LLTPKSGEPIIAATQDFITGSYLISHKDSFYDRATLTQLLCMMSDGVEQFDVPPPAIMKP 600

Query: 601  CYLWTGKQVFSLLIKPNKNSPVKINLDAKNKVYIPPKQKHYPNEMSQNDGFVIVRGSQIL 660
             YLWTGKQVFSLLIKP+  SPV INLDAKNKV++PPK K  P+EMSQNDGFV++RGSQIL
Sbjct: 601  YYLWTGKQVFSLLIKPSHKSPVVINLDAKNKVFVPPKSKSLPSEMSQNDGFVVIRGSQIL 660

Query: 661  SGVMDKSVLGDGKKHSVFYTILRDFGPQEAASAMNRMAKLCARYLGNRGFSIGISDVTPA 720
            SGVMDKSVLGDGKKHSVFYTILRD+GPQEAA+AMNRMAKLCAR+LGNRGFSIGI+DVTPA
Sbjct: 661  SGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMAKLCARFLGNRGFSIGINDVTPA 720

Query: 721  DDLKQKKEDLVEIAYAKCDELIDLYNKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGDV 780
            DDLKQKKE+LVEIAY KCDELI  +NKG+LETQPGCNEEQTLEAKIGG LSKVREEVGDV
Sbjct: 721  DDLKQKKEELVEIAYRKCDELITSFNKGELETQPGCNEEQTLEAKIGGFLSKVREEVGDV 780

Query: 781  CINELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSK 840
            CINELDN NAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSK
Sbjct: 781  CINELDNWNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSK 840

Query: 841  TPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 900
            TPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY
Sbjct: 841  TPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 900

Query: 901  DNTVRTSSNGIVQFTYGGDGLDPLEMEGNAQPVNFNRSWDHAYNITFNNTDRGLLPYEIK 960
            DNTVRTS+NGIVQFTYGGDGLDPLEMEGNAQPVNFNRSWDHAYNITF+N D GLLPY I 
Sbjct: 901  DNTVRTSANGIVQFTYGGDGLDPLEMEGNAQPVNFNRSWDHAYNITFDNQDEGLLPYAIM 960

Query: 961  KTVDNILKPLEKRLIRYDTLGRPVSAEDDKLDDYVDQHDSERLFYASLREFMTDXXXXXX 1020
            +T + IL PLE RL+RYD  G  V  ED    ++VDQ+D+ER FY SLRE++        
Sbjct: 961  ETANKILVPLEDRLVRYDNRGFLVKDEDKDKAEHVDQYDAERDFYRSLREYINLKATTLA 1020

Query: 1021 XXXXXXGLPKLIKK--SELEGYDPENEHIDAIVQHSITQLYRITEDAVQKFLEIAISKYH 1078
                  G+ +L+     EL+G DP+ E +   V+ S++QLYRI+E +V+KFLEIA+ KY 
Sbjct: 1021 NLRKSRGMLELVNAPPKELQGMDPD-EAVPTNVRTSVSQLYRISEQSVKKFLEIALFKYR 1079

Query: 1079 RAKVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTP 1138
            +A++EPGTA+GAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTP
Sbjct: 1080 KARLEPGTAIGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTP 1139

Query: 1139 IINAVLVNNNDERAARVVKGRIEKTLLSDVCYYIQDVYKENMAYLQVKVDLNTIDKLQLE 1198
            IINAVLVN+NDERAARVVKGR+EKTLLSDV YY+QDVYK+N++++QV++DL TIDKLQLE
Sbjct: 1140 IINAVLVNDNDERAARVVKGRVEKTLLSDVAYYVQDVYKDNLSFIQVRIDLGTIDKLQLE 1199

Query: 1199 LTIEDIAIAITRAPKLKIQTSDVTVLGKDKIAINVLPEGFGSKTSSTSLKEPTENDVFYR 1258
            LTIEDIA+AITRA KLKIQ  DVT++GKDKIAINV PEG+ +K+ STS KEP+ENDVFYR
Sbjct: 1200 LTIEDIAVAITRASKLKIQAPDVTIIGKDKIAINVFPEGYKAKSISTSAKEPSENDVFYR 1259

Query: 1259 MQTLRRALPSIMVKGLNDIARAVINIRDDGKRELLVEGYGLRDVMCTDGVIGAKTATNHV 1318
            MQ LRRALP ++VKGL DI+RAVINIRDDGKRELLVEGYGLRDVMCTDGVIG+KT TNHV
Sbjct: 1260 MQQLRRALPDVVVKGLADISRAVINIRDDGKRELLVEGYGLRDVMCTDGVIGSKTTTNHV 1319

Query: 1319 LEIFNVLGIEAARASIIGEIDYTMSNHGMSVDPRHIQLLGDVMTFKGEVLGITRFGLSKM 1378
            LE+F+VLGIEAAR SI+ EI+YTMSNHGMSVDPRHIQLLGDVMT+KGEVLGITRFGLSKM
Sbjct: 1320 LEVFSVLGIEAARYSIVREINYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKM 1379

Query: 1379 RDSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVVKNTDIAED 1438
            RDSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKV+K T+++E 
Sbjct: 1380 RDSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVIKGTNVSEK 1439

Query: 1439 ELKPKRTLFESLTSNVANK 1457
            +L PK  LFESL++  A K
Sbjct: 1440 DLIPKPCLFESLSNEAALK 1458

>Kpol_1016.9 s1016 (19972..24354) [4383 bp, 1460 aa] {ON}
            (19972..24354) [4383 nt, 1461 aa]
          Length = 1460

 Score = 2533 bits (6564), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1206/1460 (82%), Positives = 1329/1460 (91%), Gaps = 5/1460 (0%)

Query: 1    MKEVVIGETPKRISGLEFSALSPADIVAQSELEISSRDLFDLENNRSPKEGGALDPRMGV 60
            MKEVV+ ETPK+ISGLEFSALS +DIVAQSE+E+S+RDLFDLEN R+PK GGALDP+MGV
Sbjct: 1    MKEVVVSETPKKISGLEFSALSASDIVAQSEVEVSTRDLFDLENGRAPKIGGALDPKMGV 60

Query: 61   SASSMECTTCHGNLASCHGHFGHIKLALPVFHVGYFKATIQILQGICKTCSAILLSEQDK 120
            S+SSMECTTCHGNLASCHGHFGHIKLALPVFHVGYFKATIQILQGICK CS+ILL++ D+
Sbjct: 61   SSSSMECTTCHGNLASCHGHFGHIKLALPVFHVGYFKATIQILQGICKNCSSILLNDTDR 120

Query: 121  RHFLSELRRPGVDNLRRMALLKKVLDQCKKQRRCLHCXXXXXXXXXXXXXXXXXSLKIIH 180
            R FL ELRRPG+DNL+RMA++KK+LDQCKKQRRCL C                 SLKIIH
Sbjct: 121  RDFLHELRRPGIDNLKRMAIIKKILDQCKKQRRCLTCGALNGVVKRAAAGSGSASLKIIH 180

Query: 181  DTFRWVGKKSTPEKDKWIGDWKEVLSHNPELERYVKRATDDLNPLKTLNLFKQIASEDCE 240
            DTFRWVGKKS+PEKD+W+GDW++VL++NPELER+ KR+ DDLNPLKTLNLFKQI  EDCE
Sbjct: 181  DTFRWVGKKSSPEKDEWVGDWEKVLANNPELERFAKRSMDDLNPLKTLNLFKQIRPEDCE 240

Query: 241  LLGIDATNKAGRPETYIWRYIPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300
            LLGID+T KAGRPETYIWRY+PAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK
Sbjct: 241  LLGIDSTVKAGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300

Query: 301  AGIEKGISINNMMEHWDYLQMTVAMYINSDSINPAMLPGSSTGGGKVKPIRGFCQRLKGK 360
            AG+EKGISINNMMEHWDYLQ++VAMYINSDS+NP+M+PG+S+GG K KPIRGFCQRLKGK
Sbjct: 301  AGLEKGISINNMMEHWDYLQLSVAMYINSDSVNPSMMPGASSGGAKAKPIRGFCQRLKGK 360

Query: 361  QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPQLVAKVLTFPEKVTRYNIKKLRQLV 420
            QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVP  VAKVLT+PEKVTRYN +KL+ LV
Sbjct: 361  QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNREKLQALV 420

Query: 421  QNGPNVHPGANYLLKKNEEARRNLRYGDRQKLANNLQYGDVVERHLEDGDVVLFNRQPSL 480
             NGPNVHPGANY+LK NEEARRNLRYGDR K+A  L+ GD+VERHLEDGD+VLFNRQPSL
Sbjct: 421  INGPNVHPGANYILKANEEARRNLRYGDRLKIAKQLRVGDIVERHLEDGDIVLFNRQPSL 480

Query: 481  HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN 540
            HRLSILSH+AKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEA+NLMGVKNN
Sbjct: 481  HRLSILSHFAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAMNLMGVKNN 540

Query: 541  LLTPKSGEPIIAATQDFITGSYLISHKDSFFDKASLTQLLSMMSDGSLQFDIPPPAIMKP 600
            LLTPKSGEPIIAATQDFITGSYLISHKD+F D+A+ TQLLSMMSD +LQFDIPPP I+KP
Sbjct: 541  LLTPKSGEPIIAATQDFITGSYLISHKDTFLDRATFTQLLSMMSDSNLQFDIPPPTIIKP 600

Query: 601  CYLWTGKQVFSLLIKPNKNSPVKINLDAKNKVYIPPKQKHYPNEMSQNDGFVIVRGSQIL 660
              LWTGKQ+FSLLIKPNK+SPV INLDAKNKV+IPPK K  PNEMSQNDGFV++RGSQIL
Sbjct: 601  YCLWTGKQLFSLLIKPNKDSPVVINLDAKNKVFIPPKSKSLPNEMSQNDGFVVIRGSQIL 660

Query: 661  SGVMDKSVLGDGKKHSVFYTILRDFGPQEAASAMNRMAKLCARYLGNRGFSIGISDVTPA 720
            SGVMDKSVLGDGKKHSVFYTILRD+GPQEAA+AMNRMAKLCARYLGNRGFSIGISDVTP 
Sbjct: 661  SGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMAKLCARYLGNRGFSIGISDVTPD 720

Query: 721  DDLKQKKEDLVEIAYAKCDELIDLYNKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGDV 780
            + LKQKKE+LVEIAYAKCDELIDL+ KGKLETQPGCNEEQTLEAKIGGLLSKVREEVGD+
Sbjct: 721  NALKQKKEELVEIAYAKCDELIDLFTKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGDI 780

Query: 781  CINELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSK 840
            CINELDNLNAPLIMATCGSKGS LNVSQMVAVVGQQIISGNRVPDGFQDRSLPHF KNSK
Sbjct: 781  CINELDNLNAPLIMATCGSKGSNLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFRKNSK 840

Query: 841  TPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 900
            TPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY
Sbjct: 841  TPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 900

Query: 901  DNTVRTSSNGIVQFTYGGDGLDPLEMEGNAQPVNFNRSWDHAYNITFNNTDRGLLPYEIK 960
            DNTVRTSSNGIVQFTYGGDGLDPLEMEGNAQPVNF RSWDHA NITF+N+ +GLLPY I 
Sbjct: 901  DNTVRTSSNGIVQFTYGGDGLDPLEMEGNAQPVNFKRSWDHAINITFDNSAQGLLPYAII 960

Query: 961  KTVDNILKPLEKRLIRYDTLGRPVSAEDDKLDDYVDQHDSERLFYASLREFMTDXXXXXX 1020
               ++IL P E+RLIRYD +G  V A D   D++VDQ DSER FY SLR++M +      
Sbjct: 961  NKTNDILAPFEERLIRYDNIGTLVKANDQAKDEFVDQLDSERNFYCSLRKYMQEKASILA 1020

Query: 1021 XXXXXXGLPKLIKK--SELEGYD-PENEHIDAIVQHSITQLYRITEDAVQKFLEIAISKY 1077
                  GL +L  +  +E +  D  E E  +A  + ++ +L +ITE  V+KFLEIA+SKY
Sbjct: 1021 SIRKDKGLKELSSEPGNEFKEMDLDEGESSEA--RFAVEKLCKITEKTVEKFLEIAMSKY 1078

Query: 1078 HRAKVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVIST 1137
             RA+VEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVIST
Sbjct: 1079 RRARVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVIST 1138

Query: 1138 PIINAVLVNNNDERAARVVKGRIEKTLLSDVCYYIQDVYKENMAYLQVKVDLNTIDKLQL 1197
            PIINAVLVN+ND+RAARVVKGRIEKTLLSDV YY+QDVYK+N+++L+VK+DL+TIDKLQL
Sbjct: 1139 PIINAVLVNDNDKRAARVVKGRIEKTLLSDVAYYVQDVYKDNLSFLEVKIDLSTIDKLQL 1198

Query: 1198 ELTIEDIAIAITRAPKLKIQTSDVTVLGKDKIAINVLPEGFGSKTSSTSLKEPTENDVFY 1257
            ELTIEDIA+A+TRAPKLKIQT+DV ++ KDKI I+V PEG  +K+ STS+KEP+ENDVFY
Sbjct: 1199 ELTIEDIAVALTRAPKLKIQTTDVQIVSKDKITISVYPEGSKAKSISTSMKEPSENDVFY 1258

Query: 1258 RMQTLRRALPSIMVKGLNDIARAVINIRDDGKRELLVEGYGLRDVMCTDGVIGAKTATNH 1317
            RMQTLRRALP I+V GL DIARAVINIRDDGKRELLVEGYGLR+VMCTDGVIG+KT TNH
Sbjct: 1259 RMQTLRRALPQIVVNGLPDIARAVINIRDDGKRELLVEGYGLREVMCTDGVIGSKTTTNH 1318

Query: 1318 VLEIFNVLGIEAARASIIGEIDYTMSNHGMSVDPRHIQLLGDVMTFKGEVLGITRFGLSK 1377
            VLE+F+VLGIEAAR+SIIGEIDYTMSNHGMSVDPRHIQLLGDVMT+KGEVLGITRFGLSK
Sbjct: 1319 VLEVFSVLGIEAARSSIIGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSK 1378

Query: 1378 MRDSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVVKNTDIAE 1437
            MRDSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTG+FK++K+T+I  
Sbjct: 1379 MRDSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGAFKILKSTEIKP 1438

Query: 1438 DELKPKRTLFESLTSNVANK 1457
            D+LKPKRTLFE+L +  A K
Sbjct: 1439 DDLKPKRTLFENLVAEPALK 1458

>SAKL0G02354g Chr7 complement(193623..197999) [4377 bp, 1458 aa] {ON}
            highly similar to uniprot|P04051 Saccharomyces cerevisiae
            YOR116C
          Length = 1458

 Score = 2532 bits (6563), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1209/1459 (82%), Positives = 1325/1459 (90%), Gaps = 5/1459 (0%)

Query: 1    MKEVVIGETPKRISGLEFSALSPADIVAQSELEISSRDLFDLENNRSPKEGGALDPRMGV 60
            MKEVV+   PK+I GLEFSALS +DIVAQSE+EIS+RDLFDLEN R+PK GGALD +MGV
Sbjct: 1    MKEVVVDIAPKKIKGLEFSALSASDIVAQSEVEISTRDLFDLENGRTPKVGGALDTKMGV 60

Query: 61   SASSMECTTCHGNLASCHGHFGHIKLALPVFHVGYFKATIQILQGICKTCSAILLSEQDK 120
            S+S  EC+TCHGNLASCHGHFGHIKLALPVFHVGYFKATIQILQG+CK C++ILLS+ DK
Sbjct: 61   SSSHAECSTCHGNLASCHGHFGHIKLALPVFHVGYFKATIQILQGVCKNCASILLSDDDK 120

Query: 121  RHFLSELRRPGVDNLRRMALLKKVLDQCKKQRRCLHCXXXXXXXXXXXXXXXXXSLKIIH 180
            R FL+ELRRPGVDNLRRM  LKK+LDQCKKQRRCLHC                 SLKIIH
Sbjct: 121  RQFLAELRRPGVDNLRRMGTLKKILDQCKKQRRCLHCGMLNGVVKKAAAGSGSASLKIIH 180

Query: 181  DTFRWVGKKSTPEKDKWIGDWKEVLSHNPELERYVKRATDDLNPLKTLNLFKQIASEDCE 240
            DTFRWVGKKS PEK+KW+GDWK+VL HNPELERY+KR  DDLNPLKTLNLFKQ+  EDCE
Sbjct: 181  DTFRWVGKKSAPEKEKWVGDWKQVLEHNPELERYMKRCMDDLNPLKTLNLFKQVKPEDCE 240

Query: 241  LLGIDATNKAGRPETYIWRYIPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300
            LLGID+  K+GRPETYIWRY+PAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK
Sbjct: 241  LLGIDSAVKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300

Query: 301  AGIEKGISINNMMEHWDYLQMTVAMYINSDSINPAMLPGSSTGGGKVKPIRGFCQRLKGK 360
            AG+EKGISINNMME WDYLQ+ VAMYINSDS+NPAM+PG+S  GGK KPIRGFCQRLKGK
Sbjct: 301  AGLEKGISINNMMEQWDYLQLAVAMYINSDSVNPAMMPGAS--GGKTKPIRGFCQRLKGK 358

Query: 361  QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPQLVAKVLTFPEKVTRYNIKKLRQLV 420
            QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVP  VAKVLT+PEKVTRYN  KL+QLV
Sbjct: 359  QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNKHKLQQLV 418

Query: 421  QNGPNVHPGANYLLKKNEEARRNLRYGDRQKLANNLQYGDVVERHLEDGDVVLFNRQPSL 480
             NGPN+HPGANYLLKKN++ARRNLRYGDR KLA NLQYGDVVERH+EDGDVVLFNRQPSL
Sbjct: 419  INGPNIHPGANYLLKKNDDARRNLRYGDRMKLAKNLQYGDVVERHIEDGDVVLFNRQPSL 478

Query: 481  HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN 540
            HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN
Sbjct: 479  HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN 538

Query: 541  LLTPKSGEPIIAATQDFITGSYLISHKDSFFDKASLTQLLSMMSDGSLQFDIPPPAIMKP 600
            LLTPKSGEPIIAATQDFITGSYLISHKDSFFD+A+LTQLLSMMSDG++QFD+PPPA+MKP
Sbjct: 539  LLTPKSGEPIIAATQDFITGSYLISHKDSFFDRATLTQLLSMMSDGNMQFDLPPPAVMKP 598

Query: 601  CYLWTGKQVFSLLIKPNKNSPVKINLDAKNKVYIPPKQKHYPNEMSQNDGFVIVRGSQIL 660
             YLWTGKQVFSLLI+PNK SPV IN+DAKNKV++PPK K  PNEMS NDGFV++RGS+IL
Sbjct: 599  HYLWTGKQVFSLLIRPNKKSPVIINVDAKNKVFMPPKHKGLPNEMSVNDGFVVIRGSEIL 658

Query: 661  SGVMDKSVLGDGKKHSVFYTILRDFGPQEAASAMNRMAKLCARYLGNRGFSIGISDVTPA 720
            SGVMDKSVLGDGKKHSVFYTILRD+GPQEAASAMNRMAKLCARYLGNRGFSIGISDVTP 
Sbjct: 659  SGVMDKSVLGDGKKHSVFYTILRDYGPQEAASAMNRMAKLCARYLGNRGFSIGISDVTPG 718

Query: 721  DDLKQKKEDLVEIAYAKCDELIDLYNKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGDV 780
             DLKQKKED VE AYAKCDELID +NKGKLETQPGCNEEQTLEAKIGGLLSKVREEVG+V
Sbjct: 719  ADLKQKKEDKVEEAYAKCDELIDQFNKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGEV 778

Query: 781  CINELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSK 840
            CI ELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSK
Sbjct: 779  CIRELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSK 838

Query: 841  TPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 900
            TPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY
Sbjct: 839  TPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 898

Query: 901  DNTVRTSSNGIVQFTYGGDGLDPLEMEGNAQPVNFNRSWDHAYNITFNNTDRGLLPYEIK 960
            DNTVRTSSNGIVQFTYGGDGLDPL+MEGNAQPVNFNRSWDHA NITF + D GLLPY+I 
Sbjct: 899  DNTVRTSSNGIVQFTYGGDGLDPLDMEGNAQPVNFNRSWDHANNITFTHKDFGLLPYQII 958

Query: 961  KTVDNILKPLEKRLIRYDTLGRPVSAEDDKLDDYVDQHDSERLFYASLREFMTDXXXXXX 1020
            +  ++ILKPLE++L+R+D LG  ++ ED++  +Y+DQHD+ER FY SLR++MT+      
Sbjct: 959  ENTNSILKPLEQKLVRFDNLGNKLNKEDEEKIEYIDQHDAERNFYQSLRDYMTEKATHLA 1018

Query: 1021 XXXXXXGLPKLIKK--SELEGYDPENEHIDAIVQHSITQLYRITEDAVQKFLEIAISKYH 1078
                  GL  L+ +   EL+  + + ++ + I+  ++ QL +I+++ V+ FL IAISKYH
Sbjct: 1019 KIRKAKGLKTLLDEPAPELKILNLDEQYPEYILT-AVNQLCKISKNLVETFLGIAISKYH 1077

Query: 1079 RAKVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTP 1138
            RAKVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTP
Sbjct: 1078 RAKVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTP 1137

Query: 1139 IINAVLVNNNDERAARVVKGRIEKTLLSDVCYYIQDVYKENMAYLQVKVDLNTIDKLQLE 1198
            IINAVLVN+ DERAARVVKGRIEKT+LSDV YYIQDVYK+N++++Q KVDL TI+KLQLE
Sbjct: 1138 IINAVLVNDGDERAARVVKGRIEKTILSDVVYYIQDVYKDNLSFIQAKVDLGTIEKLQLE 1197

Query: 1199 LTIEDIAIAITRAPKLKIQTSDVTVLGKDKIAINVLPEGFGSKTSSTSLKEPTENDVFYR 1258
            LTIEDIA+AITRA KLKI T+DV+++G++KI INV PEG+ +K+ STS KEP+EN VFYR
Sbjct: 1198 LTIEDIAVAITRASKLKISTADVSIVGRNKININVFPEGYKAKSISTSAKEPSENAVFYR 1257

Query: 1259 MQTLRRALPSIMVKGLNDIARAVINIRDDGKRELLVEGYGLRDVMCTDGVIGAKTATNHV 1318
            MQ LRRALP I+VKGL DI+RAVINIRDDGKRELLVEGYGLRDVM TDGVIG+KT TNH+
Sbjct: 1258 MQHLRRALPGIVVKGLPDISRAVINIRDDGKRELLVEGYGLRDVMTTDGVIGSKTKTNHI 1317

Query: 1319 LEIFNVLGIEAARASIIGEIDYTMSNHGMSVDPRHIQLLGDVMTFKGEVLGITRFGLSKM 1378
            LEIFNVLGIEAAR SI+GEIDYTMSNHGMSVDPRHIQLLGDVMT+KGEVLGITRFGLSKM
Sbjct: 1318 LEIFNVLGIEAARTSIVGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKM 1377

Query: 1379 RDSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVVKNTDIAED 1438
            RDSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVVK T I+E+
Sbjct: 1378 RDSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVVKGTSISEE 1437

Query: 1439 ELKPKRTLFESLTSNVANK 1457
            +LKPK TLFESL ++VA K
Sbjct: 1438 DLKPKHTLFESLCNDVALK 1456

>KNAG0B04240 Chr2 (806212..810579) [4368 bp, 1455 aa] {ON} Anc_5.426
            YOR116C
          Length = 1455

 Score = 2513 bits (6512), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1197/1457 (82%), Positives = 1311/1457 (89%), Gaps = 4/1457 (0%)

Query: 1    MKEVVIGETPKRISGLEFSALSPADIVAQSELEISSRDLFDLENNRSPKEGGALDPRMGV 60
            MKEVV+GET K+ISG+EFSAL+ ADIVAQSE+EI++RDLFDLE  R  K GGALD RMGV
Sbjct: 1    MKEVVVGETQKKISGIEFSALNAADIVAQSEVEITTRDLFDLEKGREQKTGGALDRRMGV 60

Query: 61   SASSMECTTCHGNLASCHGHFGHIKLALPVFHVGYFKATIQILQGICKTCSAILLSEQDK 120
            S+SS EC TCHGNLASCHGHFGHIKLALPVFHVGYFK+TIQILQ ICK CSA+LLS++D+
Sbjct: 61   SSSSQECMTCHGNLASCHGHFGHIKLALPVFHVGYFKSTIQILQCICKDCSAVLLSDKDR 120

Query: 121  RHFLSELRRPGVDNLRRMALLKKVLDQCKKQRRCLHCXXXXXXXXXXXXXXXXXSLKIIH 180
            R FL ELRRPG+DNLR+M++LKKV+DQCKKQRRCL C                 SLKIIH
Sbjct: 121  RDFLKELRRPGIDNLRKMSILKKVIDQCKKQRRCLKCGGLNGVVKKAAAGAGTASLKIIH 180

Query: 181  DTFRWVGKKSTPEKDKWIGDWKEVLSHNPELERYVKRATDDLNPLKTLNLFKQIASEDCE 240
            DTFRWVGKK  PEKD+WIG+W E+L+H+PELER+VKR +DDLNPLKTL LFKQ+ SEDCE
Sbjct: 181  DTFRWVGKKMVPEKDRWIGEWNEILTHHPELERFVKRCSDDLNPLKTLTLFKQLKSEDCE 240

Query: 241  LLGIDATNKAGRPETYIWRYIPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300
            LLGI++T ++GRPETYIWRY+PAPPVCIRPSV MQDSPASNEDDLTVKLTEIVWTSSLIK
Sbjct: 241  LLGINSTVRSGRPETYIWRYLPAPPVCIRPSVTMQDSPASNEDDLTVKLTEIVWTSSLIK 300

Query: 301  AGIEKGISINNMMEHWDYLQMTVAMYINSDSINPAMLPGSSTGGGKVKPIRGFCQRLKGK 360
            AG+ KGISINNMMEHWDYLQ+TVAMYINSDS+NPAMLPG+S+GGGKVKPIRGFCQRLKGK
Sbjct: 301  AGLAKGISINNMMEHWDYLQLTVAMYINSDSVNPAMLPGASSGGGKVKPIRGFCQRLKGK 360

Query: 361  QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPQLVAKVLTFPEKVTRYNIKKLRQLV 420
            QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPQLVAKVLTFPEKVTRYN +KL+QL+
Sbjct: 361  QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPQLVAKVLTFPEKVTRYNKRKLQQLI 420

Query: 421  QNGPNVHPGANYLLKKNEEARRNLRYGDRQKLANNLQYGDVVERHLEDGDVVLFNRQPSL 480
             NGP VHPGANYLLKKNEEARRNLRYGD+ KLA NLQYGDVVERHLEDGDVVLFNRQPSL
Sbjct: 421  INGPTVHPGANYLLKKNEEARRNLRYGDKLKLAKNLQYGDVVERHLEDGDVVLFNRQPSL 480

Query: 481  HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN 540
            HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN
Sbjct: 481  HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN 540

Query: 541  LLTPKSGEPIIAATQDFITGSYLISHKDSFFDKASLTQLLSMMSDGSLQFDIPPPAIMKP 600
            LLTPKSGEPIIAATQDFITGSYLISHKDSFFD  SLTQLLSMMSD  LQFDIPPPAIMKP
Sbjct: 541  LLTPKSGEPIIAATQDFITGSYLISHKDSFFDLGSLTQLLSMMSDAKLQFDIPPPAIMKP 600

Query: 601  CYLWTGKQVFSLLIKPNKNSPVKINLDAKNKVYIPPKQKHYPNEMSQNDGFVIVRGSQIL 660
             YLWTGKQVFSLLI+PNK SPV INLDAKNKVYIPPK K +PNEMS NDGFVI+RGS+IL
Sbjct: 601  YYLWTGKQVFSLLIRPNKKSPVVINLDAKNKVYIPPKDKSFPNEMSINDGFVIIRGSEIL 660

Query: 661  SGVMDKSVLGDGKKHSVFYTILRDFGPQEAASAMNRMAKLCARYLGNRGFSIGISDVTPA 720
            SGVMDKSVLGDGKKHSVFYTILRD+GPQEAA+ MNRMAKLCARYLGNRGFSIGISDVTP+
Sbjct: 661  SGVMDKSVLGDGKKHSVFYTILRDYGPQEAANTMNRMAKLCARYLGNRGFSIGISDVTPS 720

Query: 721  DDLKQKKEDLVEIAYAKCDELIDLYNKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGDV 780
             DL+ KKE++V  AYAKCDELID++  GKLETQPGCNEEQTLEAKIGGLLSKVREEVGDV
Sbjct: 721  SDLRDKKEEMVRFAYAKCDELIDMFKNGKLETQPGCNEEQTLEAKIGGLLSKVREEVGDV 780

Query: 781  CINELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSK 840
            CINELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHF KNSK
Sbjct: 781  CINELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFQKNSK 840

Query: 841  TPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 900
            TPQSKGFVRNSFFSGL+PPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY
Sbjct: 841  TPQSKGFVRNSFFSGLTPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 900

Query: 901  DNTVRTSSNGIVQFTYGGDGLDPLEMEGNAQPVNFNRSWDHAYNITFNNTDRGLLPYEIK 960
            D+TVRTS+NGIVQFTYGGDGLDPL+MEGNA+PVNF RSWDHA NITFN  + GLLPYEI 
Sbjct: 901  DDTVRTSANGIVQFTYGGDGLDPLDMEGNAKPVNFIRSWDHACNITFNKNETGLLPYEIV 960

Query: 961  KTVDNILKPLEKRLIRYDTLGRPVSAEDDKLDDYVDQHDSERLFYASLREFMTDXXXXXX 1020
            +  DN+LKPLE++LIRYD LG  V  E    + Y D+HD+ER FY SLR +M +      
Sbjct: 961  RETDNVLKPLEEKLIRYDNLGAVVPKELIDDERYADRHDAERAFYKSLRMYMQEKAARLA 1020

Query: 1021 XXXXXXGLPKLIKKSELEGYDPENEHIDAIVQHSITQLYRITEDAVQKFLEIAISKYHRA 1080
                  GL ++ +     G D   E + + +Q S+ Q+Y+IT+  V  FL IA+ KYHRA
Sbjct: 1021 QIRNTRGLLEMTQ----NGGDTSMEVVSSELQASVDQVYKITKKNVNAFLTIALHKYHRA 1076

Query: 1081 KVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPII 1140
            KVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPII
Sbjct: 1077 KVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPII 1136

Query: 1141 NAVLVNNNDERAARVVKGRIEKTLLSDVCYYIQDVYKENMAYLQVKVDLNTIDKLQLELT 1200
            NAVLVN  DERAARVVKGRIEKTLLSD+ +YIQDVY+ NM+YL+++VDL TI+KLQLELT
Sbjct: 1137 NAVLVNEGDERAARVVKGRIEKTLLSDLAFYIQDVYRGNMSYLEIRVDLATIEKLQLELT 1196

Query: 1201 IEDIAIAITRAPKLKIQTSDVTVLGKDKIAINVLPEGFGSKTSSTSLKEPTENDVFYRMQ 1260
            +EDIA+A++RAPKLKIQT+D+ +LGKDKI +NV PEG  +K+ STS KEP+EN+VFY+MQ
Sbjct: 1197 MEDIAVALSRAPKLKIQTTDIHILGKDKIHVNVYPEGMKAKSISTSAKEPSENEVFYKMQ 1256

Query: 1261 TLRRALPSIMVKGLNDIARAVINIRDDGKRELLVEGYGLRDVMCTDGVIGAKTATNHVLE 1320
            TLRR+LP ++VKGL DI+RAVINIRDDGKRELLVEGYGLR+VMCTDGVIG+KT TNHVLE
Sbjct: 1257 TLRRSLPDVVVKGLPDISRAVINIRDDGKRELLVEGYGLREVMCTDGVIGSKTITNHVLE 1316

Query: 1321 IFNVLGIEAARASIIGEIDYTMSNHGMSVDPRHIQLLGDVMTFKGEVLGITRFGLSKMRD 1380
            + +VLGIEAARASI+GEIDYTMSNHGMSVDPRHIQLLGDVMT+KGEVLGITRFGLSKMRD
Sbjct: 1317 VNSVLGIEAARASIVGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMRD 1376

Query: 1381 SVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVVKNTDIAEDEL 1440
            SVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMS+GTGSFKVVK  D++E +L
Sbjct: 1377 SVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSVGTGSFKVVKYNDVSERDL 1436

Query: 1441 KPKRTLFESLTSNVANK 1457
            K + TLFESL S  A K
Sbjct: 1437 KVRPTLFESLASETAIK 1453

>ZYRO0F09856g Chr6 complement(798821..803197) [4377 bp, 1458 aa] {ON}
            highly similar to uniprot|P04051 Saccharomyces cerevisiae
            YOR116C
          Length = 1458

 Score = 2507 bits (6497), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1196/1458 (82%), Positives = 1322/1458 (90%), Gaps = 3/1458 (0%)

Query: 1    MKEVVIGETPKRISGLEFSALSPADIVAQSELEISSRDLFDLENNRSPKEGGALDPRMGV 60
            MKEVV  E PK+ISGLEFSALS ADIVAQSE+EIS+RDLFDLEN R+PK GGALDP+MGV
Sbjct: 1    MKEVVSSEAPKKISGLEFSALSAADIVAQSEVEISTRDLFDLENGRAPKTGGALDPKMGV 60

Query: 61   SASSMECTTCHGNLASCHGHFGHIKLALPVFHVGYFKATIQILQGICKTCSAILLSEQDK 120
            S+SSMEC TCHGNLASCHGHFGHIKLALPVFH+GYFKATIQILQGICK CS+ILL + DK
Sbjct: 61   SSSSMECQTCHGNLASCHGHFGHIKLALPVFHIGYFKATIQILQGICKECSSILLEDTDK 120

Query: 121  RHFLSELRRPGVDNLRRMALLKKVLDQCKKQRRCLHCXXXXXXXXXXXXXXXXXSLKIIH 180
            +HFLSELRRPGVDNLRRM +LKKVLDQCKKQRRCL C                 SLKIIH
Sbjct: 121  KHFLSELRRPGVDNLRRMGILKKVLDQCKKQRRCLQCGALNGVVKKAAAGGGSASLKIIH 180

Query: 181  DTFRWVGKKSTPEKDKWIGDWKEVLSHNPELERYVKRATDDLNPLKTLNLFKQIASEDCE 240
            DTFRW GKKS PEK+KWIGDW  VL+H+PELERYVKR  DDLNPLKTLNLFKQ+  EDCE
Sbjct: 181  DTFRWAGKKSVPEKEKWIGDWDSVLAHSPELERYVKRCMDDLNPLKTLNLFKQVKPEDCE 240

Query: 241  LLGIDATNKAGRPETYIWRYIPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300
            LLGID+T K+GRPETYIWRY+PAPPVCIRPSVMMQDSPASNEDDLTVKLTE+VWTSSLIK
Sbjct: 241  LLGIDSTIKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEVVWTSSLIK 300

Query: 301  AGIEKGISINNMMEHWDYLQMTVAMYINSDSINPAMLPGSSTGGGKVKPIRGFCQRLKGK 360
            AG+EKGISINNMMEHWDYLQ+ VAMYINSDS+NPA+L G +  GGKVKPIRGFCQRLKGK
Sbjct: 301  AGLEKGISINNMMEHWDYLQLAVAMYINSDSVNPAILSGGT--GGKVKPIRGFCQRLKGK 358

Query: 361  QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPQLVAKVLTFPEKVTRYNIKKLRQLV 420
            QGRFRGNLSGKRVDFSGRTVISPDPNLS+DEVAVP  VAKVLT+PE+VTRYN  KL+QLV
Sbjct: 359  QGRFRGNLSGKRVDFSGRTVISPDPNLSVDEVAVPDRVAKVLTYPERVTRYNKGKLQQLV 418

Query: 421  QNGPNVHPGANYLLKKNEEARRNLRYGDRQKLANNLQYGDVVERHLEDGDVVLFNRQPSL 480
             NGPN +PGANYLLKK+E+ARRNLR+GDR KLA NL+ GD+VERHLEDGDVVLFNRQPSL
Sbjct: 419  VNGPNEYPGANYLLKKDEDARRNLRFGDRVKLAKNLRIGDLVERHLEDGDVVLFNRQPSL 478

Query: 481  HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN 540
            HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQ+EEARAEAINLMGVK+N
Sbjct: 479  HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQSEEARAEAINLMGVKSN 538

Query: 541  LLTPKSGEPIIAATQDFITGSYLISHKDSFFDKASLTQLLSMMSDGSLQFDIPPPAIMKP 600
            LLTPKSGEPIIAATQDFITGSYLISHKDSFFDK  +TQLLSMMSDG+LQFDIPPP I KP
Sbjct: 539  LLTPKSGEPIIAATQDFITGSYLISHKDSFFDKYDMTQLLSMMSDGALQFDIPPPTIWKP 598

Query: 601  CYLWTGKQVFSLLIKPNKNSPVKINLDAKNKVYIPPKQKHYPNEMSQNDGFVIVRGSQIL 660
            CYLWTGKQ+FSLLI+PNK SPV +NLDAKNKVYIPPK K  PNEMSQNDGFV++RGSQIL
Sbjct: 599  CYLWTGKQIFSLLIRPNKKSPVVLNLDAKNKVYIPPKSKSLPNEMSQNDGFVLIRGSQIL 658

Query: 661  SGVMDKSVLGDGKKHSVFYTILRDFGPQEAASAMNRMAKLCARYLGNRGFSIGISDVTPA 720
            SGVMDKSVLGDGKKHSVFYTILRD+G QEAA AMNRMAKLCARY+GNRGFSIGISDVTPA
Sbjct: 659  SGVMDKSVLGDGKKHSVFYTILRDYGSQEAAEAMNRMAKLCARYVGNRGFSIGISDVTPA 718

Query: 721  DDLKQKKEDLVEIAYAKCDELIDLYNKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGDV 780
            ++LK+KKE++VE AYAKCDELIDL++KGKLETQPGCNEEQTLEAKIGGLLSKVREEVG+V
Sbjct: 719  EELKEKKEEMVESAYAKCDELIDLFSKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGEV 778

Query: 781  CINELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSK 840
            CINELDN+NAPLIMATCGSKGSTLNVSQMVAVVGQQIISG+RVPDGFQDRSLPHFPKNSK
Sbjct: 779  CINELDNMNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGSRVPDGFQDRSLPHFPKNSK 838

Query: 841  TPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 900
            TPQSKGFVRNSFFSGL+PPEFL+HAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSC Y
Sbjct: 839  TPQSKGFVRNSFFSGLTPPEFLYHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCLY 898

Query: 901  DNTVRTSSNGIVQFTYGGDGLDPLEMEGNAQPVNFNRSWDHAYNITFNNTDRGLLPYEIK 960
            DNTVRTSSNGIVQFTYGGDGLDPLEMEGNAQPVNFNR+WDHA N+TFNN DRGLLPY+I 
Sbjct: 899  DNTVRTSSNGIVQFTYGGDGLDPLEMEGNAQPVNFNRTWDHATNVTFNNMDRGLLPYQIM 958

Query: 961  KTVDNILKPLEKRLIRYDTLGRPVSAEDDKLDDYVDQHDSERLFYASLREFMTDXXXXXX 1020
            +  + IL+PLE RL+RYD LG  ++ E+    +Y+DQ+D+ER FY SLR+F+        
Sbjct: 959  QVTEEILQPLENRLVRYDNLGNEITKENRDRIEYIDQNDAERGFYHSLRDFIWAKAQLLA 1018

Query: 1021 XXXXXXGLPKLIKKSELEGYDPE-NEHIDAIVQHSITQLYRITEDAVQKFLEIAISKYHR 1079
                   + +L+ +  LE    + +E++   ++HS+ Q+YRIT+  V++FL +AI KY R
Sbjct: 1019 KFRGSKDMKELMDEPALELQSVDLDENVPEDIRHSVDQVYRITDKMVREFLRVAILKYRR 1078

Query: 1080 AKVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPI 1139
            AKVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPI
Sbjct: 1079 AKVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPI 1138

Query: 1140 INAVLVNNNDERAARVVKGRIEKTLLSDVCYYIQDVYKENMAYLQVKVDLNTIDKLQLEL 1199
            INAVLVN +DERAARVVKGRIEKTLLSDV +YIQDVY++N++YLQV+VDL+TIDKLQLEL
Sbjct: 1139 INAVLVNESDERAARVVKGRIEKTLLSDVAFYIQDVYRDNLSYLQVRVDLSTIDKLQLEL 1198

Query: 1200 TIEDIAIAITRAPKLKIQTSDVTVLGKDKIAINVLPEGFGSKTSSTSLKEPTENDVFYRM 1259
            TIEDIA+A+TRAPKLKIQ SDV ++GKDKIAINV P+G  +K+ ST  KEP+EN+VFYRM
Sbjct: 1199 TIEDIAVAMTRAPKLKIQASDVHIVGKDKIAINVFPDGAKAKSISTLAKEPSENEVFYRM 1258

Query: 1260 QTLRRALPSIMVKGLNDIARAVINIRDDGKRELLVEGYGLRDVMCTDGVIGAKTATNHVL 1319
            Q LRRALP I+VKGL+DI+RAVINIRDDGKRELLVEGYGLRDVM TDGV+G KT TNH+L
Sbjct: 1259 QQLRRALPGIVVKGLSDISRAVINIRDDGKRELLVEGYGLRDVMSTDGVVGHKTVTNHIL 1318

Query: 1320 EIFNVLGIEAARASIIGEIDYTMSNHGMSVDPRHIQLLGDVMTFKGEVLGITRFGLSKMR 1379
            E+++VLGIEAARASI+GEIDYTMSNHGMSVDPRHIQLLGDVMT+KGE+LGITRFGLSKMR
Sbjct: 1319 EVYSVLGIEAARASIVGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEILGITRFGLSKMR 1378

Query: 1380 DSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVVKNTDIAEDE 1439
            DSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTM+IGTG+FKVVK T+++E++
Sbjct: 1379 DSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMAIGTGAFKVVKGTNVSEEQ 1438

Query: 1440 LKPKRTLFESLTSNVANK 1457
            LKPK TLFESL +  + K
Sbjct: 1439 LKPKPTLFESLVNETSVK 1456

>TBLA0A03720 Chr1 complement(929751..934127) [4377 bp, 1458 aa] {ON}
            Anc_5.426 YOR116C
          Length = 1458

 Score = 2491 bits (6457), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1197/1452 (82%), Positives = 1307/1452 (90%), Gaps = 5/1452 (0%)

Query: 1    MKEVVIGETPKRISGLEFSALSPADIVAQSELEISSRDLFDLENNRSPKEGGALDPRMGV 60
            MKEVV  E PK+ISGLEFSALS ADIVAQSE+ I++RDL+DLE+ R+PK+ GALD RMGV
Sbjct: 1    MKEVVTSEIPKKISGLEFSALSAADIVAQSEVAITTRDLYDLEHGRAPKKSGALDQRMGV 60

Query: 61   SASSMECTTCHGNLASCHGHFGHIKLALPVFHVGYFKATIQILQGICKTCSAILLSEQDK 120
            S+S++EC TCHGNLASCHGHFGHIKLALPVFHVGYFKATIQILQ ICK+C+A+LLS++DK
Sbjct: 61   SSSNLECETCHGNLASCHGHFGHIKLALPVFHVGYFKATIQILQAICKSCAAVLLSDEDK 120

Query: 121  RHFLSELRRPGVDNLRRMALLKKVLDQCKKQRRCLHCXXXXXXXXXXXXXXXXXSLKIIH 180
            R+FLSELRRPG+DNL+RM +LKK+LDQCKKQRRCLHC                 SLKIIH
Sbjct: 121  RNFLSELRRPGIDNLKRMGILKKILDQCKKQRRCLHCGGLNGVVKKAAAGGGSASLKIIH 180

Query: 181  DTFRWVGKKSTPEKDKWIGDWKEVLSHNPELERYVKRATDDLNPLKTLNLFKQIASEDCE 240
            DTFRWVGKK TPEKD W+GDW+EVLSHNPELER+VKRA DDLNPLKTLNLFKQI  EDCE
Sbjct: 181  DTFRWVGKKQTPEKDSWVGDWQEVLSHNPELERFVKRAMDDLNPLKTLNLFKQIKPEDCE 240

Query: 241  LLGIDATNKAGRPETYIWRYIPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300
            LLGID+T+K+GRPETYIWRY+PAPPVCIRPSVMMQDSPASNEDDLTVKLTE+VWTSSLIK
Sbjct: 241  LLGIDSTSKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEVVWTSSLIK 300

Query: 301  AGIEKGISINNMMEHWDYLQMTVAMYINSDSINPAMLPGSSTGGGKVKPIRGFCQRLKGK 360
            AG+EKGISINNMMEHWDYLQ++VAMYINSDS+NP ++PG+STG  KVKPIRGFCQRLKGK
Sbjct: 301  AGLEKGISINNMMEHWDYLQLSVAMYINSDSVNPLLMPGASTGN-KVKPIRGFCQRLKGK 359

Query: 361  QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPQLVAKVLTFPEKVTRYNIKKLRQLV 420
            QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVP  VAKVLTFPE+VTRYN +KL+ LV
Sbjct: 360  QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTFPERVTRYNKRKLQALV 419

Query: 421  QNGPNVHPGANYLLKKNEEARRNLRYGDRQKLANNLQYGDVVERHLEDGDVVLFNRQPSL 480
             NGPNVHPGANYLLKK+EEARRNLRYGD+ KLA NLQ GDVVERHLEDGDVVLFNRQPSL
Sbjct: 420  LNGPNVHPGANYLLKKDEEARRNLRYGDKVKLAKNLQIGDVVERHLEDGDVVLFNRQPSL 479

Query: 481  HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN 540
            HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN
Sbjct: 480  HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN 539

Query: 541  LLTPKSGEPIIAATQDFITGSYLISHKDSFFDKASLTQLLSMMSDGSLQFDIPPPAIMKP 600
            LLTPKSGEPIIAATQDFITGSYLISHKDSFFD+A+ TQLLSMM DG+LQFDIPPPAIMKP
Sbjct: 540  LLTPKSGEPIIAATQDFITGSYLISHKDSFFDRATFTQLLSMMCDGNLQFDIPPPAIMKP 599

Query: 601  CYLWTGKQVFSLLIKPNKNSPVKINLDAKNKVYIPPKQKHYPNEMSQNDGFVIVRGSQIL 660
            CYLWTGKQ+FSLLIKPN NSPV IN+DAKNKV+ PPK K  P+EMS NDGFV++RGSQIL
Sbjct: 600  CYLWTGKQLFSLLIKPNSNSPVVINVDAKNKVFKPPKDKSLPSEMSPNDGFVVIRGSQIL 659

Query: 661  SGVMDKSVLGDGKKHSVFYTILRDFGPQEAASAMNRMAKLCARYLGNRGFSIGISDVTPA 720
            SGVMDKSVLGDGKKHSVFYTILRD+GPQEAA+AMNRMAKLCAR+LGNRGFSIGI+DVTP 
Sbjct: 660  SGVMDKSVLGDGKKHSVFYTILRDYGPQEAATAMNRMAKLCARFLGNRGFSIGINDVTPD 719

Query: 721  DDLKQKKEDLVEIAYAKCDELIDLYNKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGDV 780
            D LK  KE+LVEIAYAKCDELI LYN+GKLETQPGCNEEQTLEAKI G+LSKVREEVGD+
Sbjct: 720  DKLKNLKENLVEIAYAKCDELIGLYNQGKLETQPGCNEEQTLEAKISGILSKVREEVGDI 779

Query: 781  CINELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSK 840
            CINELDN NAPLIMATCGSKGS LNVSQMVAVVGQQIISGNRVPDGFQDRSLPHF KNSK
Sbjct: 780  CINELDNWNAPLIMATCGSKGSNLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFQKNSK 839

Query: 841  TPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 900
            TPQSKGFVRNSF+SGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY
Sbjct: 840  TPQSKGFVRNSFYSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 899

Query: 901  DNTVRTSSNGIVQFTYGGDGLDPLEMEGNAQPVNFNRSWDHAYNITFNNTDRGLLPYEIK 960
            DNTVRTSSNGIVQFTYGGDGLDP +MEGNAQPVNFNRSWDHAYNI F+N D+ + PY+I 
Sbjct: 900  DNTVRTSSNGIVQFTYGGDGLDPFDMEGNAQPVNFNRSWDHAYNIKFDNNDKTIYPYQIL 959

Query: 961  KTVDNILKPLEKRLIRYDTLGRPVSAEDDKLDDYVDQHDSERLFYASLREFMTDXXXXXX 1020
            +  ++IL PLE++LIRYD +G+ V+ E+   D++VDQ D+ER FY SLR++MT       
Sbjct: 960  EITNDILHPLEEKLIRYDNIGKVVTPENSGKDEFVDQLDAERNFYNSLRDYMTKKANELA 1019

Query: 1021 XXXXXXGLPKLIKK--SELEGYDPENEHIDAIVQHSITQLYRITEDAVQKFLEIAISKYH 1078
                  G+ +L+     E +  D + +  D+I +HS+ Q+ RITE+ V++FL+IAI+KY 
Sbjct: 1020 DVRKSRGMKELLSAPGDEFKLMDLDEQTPDSI-RHSVEQICRITENTVREFLKIAITKYR 1078

Query: 1079 RAKVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTP 1138
            RA+VEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTP
Sbjct: 1079 RARVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTP 1138

Query: 1139 IINAVLVNNNDERAARVVKGRIEKTLLSDVCYYIQDVYKENMAYLQVKVDLNTIDKLQLE 1198
            IINAVLVN NDERAARVVKGRIEKTLLSDV YYIQD YK+N +YL+VK+DL TI+KLQLE
Sbjct: 1139 IINAVLVNENDERAARVVKGRIEKTLLSDVAYYIQDCYKDNNSYLEVKIDLGTIEKLQLE 1198

Query: 1199 LTIEDIAIAITRAPKLKIQTSDVTVLGKDKIAINVLPEGFGSKTSSTSLKEPTENDVFYR 1258
            LT+ DIA AI RAPKLKIQ  DV      KI I+V PE   SK S+ S KEP EN+VFYR
Sbjct: 1199 LTMSDIADAIARAPKLKIQFGDVVPESNSKIRISVRPEASVSKISA-SAKEPLENNVFYR 1257

Query: 1259 MQTLRRALPSIMVKGLNDIARAVINIRDDGKRELLVEGYGLRDVMCTDGVIGAKTATNHV 1318
            MQ LRRALPSI+VKGL DIARAVINIRD+GKRELLVEGYGLRDVMCTDGVIG+KT TNHV
Sbjct: 1258 MQHLRRALPSIVVKGLPDIARAVINIRDNGKRELLVEGYGLRDVMCTDGVIGSKTTTNHV 1317

Query: 1319 LEIFNVLGIEAARASIIGEIDYTMSNHGMSVDPRHIQLLGDVMTFKGEVLGITRFGLSKM 1378
            LE+ +VLGIEAARASIIGEIDYTMSNHGMSVDPRHIQLLGDVMT+KGEVLGITRFGLSKM
Sbjct: 1318 LEVNSVLGIEAARASIIGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKM 1377

Query: 1379 RDSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVVKNTDIAED 1438
            RDSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVVK+T I   
Sbjct: 1378 RDSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVVKDTHIRNG 1437

Query: 1439 ELKPKRTLFESL 1450
             LKPKRTLFESL
Sbjct: 1438 TLKPKRTLFESL 1449

>KLTH0F16236g Chr6 (1316542..1320924) [4383 bp, 1460 aa] {ON} highly
            similar to uniprot|P04051 Saccharomyces cerevisiae
            YOR116C
          Length = 1460

 Score = 2480 bits (6427), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1188/1461 (81%), Positives = 1298/1461 (88%), Gaps = 4/1461 (0%)

Query: 1    MKEVVIGETPKRISGLEFSALSPADIVAQSELEISSRDLFDLENNRSPKEGGALDPRMGV 60
            MKEVV+   PKRI GLEFSALS +DIVAQS++EIS+RDLFDLEN R PK GGALD RMGV
Sbjct: 1    MKEVVVDIAPKRIKGLEFSALSASDIVAQSKVEISTRDLFDLENGRKPKSGGALDTRMGV 60

Query: 61   SASSMECTTCHGNLASCHGHFGHIKLALPVFHVGYFKATIQILQGICKTCSAILLSEQDK 120
            S+S  EC+TCHGNLASCHGHFGHIKL+LPVFHVGYFKATIQ+LQ ICKTC+A+LLSE+DK
Sbjct: 61   SSSQAECSTCHGNLASCHGHFGHIKLSLPVFHVGYFKATIQVLQSICKTCAALLLSEEDK 120

Query: 121  RHFLSELRRPGVDNLRRMALLKKVLDQCKKQRRCLHCXXXXXXXXXXXXXXXXXSLKIIH 180
              FLSELRRPG+DNLRRM +LKKV+DQCKKQRRCL C                 SLKI+H
Sbjct: 121  HQFLSELRRPGIDNLRRMGILKKVVDQCKKQRRCLRCGSLNGVVKKAAAGSGSASLKILH 180

Query: 181  DTFRWVGKKSTPEKDKWIGDWKEVLSHNPELERYVKRATDDLNPLKTLNLFKQIASEDCE 240
            DTFRWVGKKS PEKDKW+GDWK VL+HNPELERYVK+  DDLNPLKTLNLFKQ+A EDCE
Sbjct: 181  DTFRWVGKKSAPEKDKWVGDWKTVLAHNPELERYVKKCMDDLNPLKTLNLFKQVAPEDCE 240

Query: 241  LLGIDATNKAGRPETYIWRYIPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300
            LLGID+T K+GRPETYIWRY+PAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK
Sbjct: 241  LLGIDSTVKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300

Query: 301  AGIEKGISINNMMEHWDYLQMTVAMYINSDSINPAMLPGSSTGGGKVKPIRGFCQRLKGK 360
            AG+EKGISINNMME WDYLQ+ VAMYINSDS+NPAM+PG STGG K KPIRGFCQRLKGK
Sbjct: 301  AGLEKGISINNMMEQWDYLQLAVAMYINSDSVNPAMMPGGSTGG-KTKPIRGFCQRLKGK 359

Query: 361  QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPQLVAKVLTFPEKVTRYNIKKLRQLV 420
            QGRFRGNLSGKRVDFSGRTV+SPDPNLSIDEVAVP  VAKVLT+PE VTRYN +KL+QLV
Sbjct: 360  QGRFRGNLSGKRVDFSGRTVVSPDPNLSIDEVAVPDRVAKVLTYPEMVTRYNKQKLQQLV 419

Query: 421  QNGPNVHPGANYLLKKNEEARRNLRYGDRQKLANNLQYGDVVERHLEDGDVVLFNRQPSL 480
             NGPN HPGANYLLKK+EEARRNLRYGDR KLA NLQYGDVVERHLEDGDVVLFNRQPSL
Sbjct: 420  INGPNEHPGANYLLKKDEEARRNLRYGDRMKLARNLQYGDVVERHLEDGDVVLFNRQPSL 479

Query: 481  HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN 540
            HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN
Sbjct: 480  HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN 539

Query: 541  LLTPKSGEPIIAATQDFITGSYLISHKDSFFDKASLTQLLSMMSDGSLQFDIPPPAIMKP 600
            LLTPKSGEPIIAATQDFITGSYLISHKDSFF +A   QLLSMMSDG+LQFDIPPP+IMKP
Sbjct: 540  LLTPKSGEPIIAATQDFITGSYLISHKDSFFSRAEFVQLLSMMSDGNLQFDIPPPSIMKP 599

Query: 601  CYLWTGKQVFSLLIKPNKNSPVKINLDAKNKVYIPPKQKHYPNEMSQNDGFVIVRGSQIL 660
             Y+WTGKQVFSLLI+PNK SPV INLDAKNKVYIPPK K  PNEMS NDG+V++RGS+IL
Sbjct: 600  YYMWTGKQVFSLLIRPNKESPVVINLDAKNKVYIPPKDKSLPNEMSINDGYVVIRGSKIL 659

Query: 661  SGVMDKSVLGDGKKHSVFYTILRDFGPQEAASAMNRMAKLCARYLGNRGFSIGISDVTPA 720
            SGVMDKSVLGDGKKHSVFYTILRDFGPQEAA AMNRMAKLCAR+LGNRGFSIGI+DVTP 
Sbjct: 660  SGVMDKSVLGDGKKHSVFYTILRDFGPQEAAFAMNRMAKLCARFLGNRGFSIGINDVTPG 719

Query: 721  DDLKQKKEDLVEIAYAKCDELIDLYNKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGDV 780
             +LK KKE +VE AYAKCD LIDL+NKGKLETQPGCNEEQTLEAKIGGLLSKVREEVG+V
Sbjct: 720  FELKNKKEIMVEDAYAKCDALIDLFNKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGEV 779

Query: 781  CINELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSK 840
            CI ELDNLN+ LIMA CGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHF KNSK
Sbjct: 780  CIKELDNLNSCLIMANCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFLKNSK 839

Query: 841  TPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 900
            TPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY
Sbjct: 840  TPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 899

Query: 901  DNTVRTSSNGIVQFTYGGDGLDPLEMEGNAQPVNFNRSWDHAYNITFNNTDRGLLPYEIK 960
            DNT+RTSSNGIVQFTYGGDGLDP++MEGNAQPVNF+RSW+HA N+TFN+ D+ LLPY+I 
Sbjct: 900  DNTIRTSSNGIVQFTYGGDGLDPIDMEGNAQPVNFSRSWEHANNVTFNHVDKPLLPYQIM 959

Query: 961  KTVDNILKPLEKRLIRYDTLGRPVSAEDDKLDDYVDQHDSERLFYASLREFMTDXXXXXX 1020
            +  + +LKPLE++L+RYD LG  +        +Y+DQ D+ER FY SLR++M +      
Sbjct: 960  QQTNGVLKPLEEKLVRYDNLGNELDPSLQDRVEYIDQDDAERNFYKSLRDYMYEKASHLA 1019

Query: 1021 XXXXXXGLPKLIKK--SELEGYDPENEHIDAIVQHSITQLYRITEDAVQKFLEIAISKYH 1078
                  GL + + +  +EL+  D + E   A    S+ QL +I+   V KFLEIAI KYH
Sbjct: 1020 NIRAHKGLKEFLDEPAAELQAMDLD-EGAPASALASVDQLCKISSKLVLKFLEIAIFKYH 1078

Query: 1079 RAKVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTP 1138
            +AKVEPGTAVGA+GA SIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTP
Sbjct: 1079 KAKVEPGTAVGAVGAHSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTP 1138

Query: 1139 IINAVLVNNNDERAARVVKGRIEKTLLSDVCYYIQDVYKENMAYLQVKVDLNTIDKLQLE 1198
            IINAVLVNNNDERAARVVKGRIEKTLLSDV +YIQDVYK+NM++LQVKVDL TI+KLQLE
Sbjct: 1139 IINAVLVNNNDERAARVVKGRIEKTLLSDVAFYIQDVYKDNMSFLQVKVDLGTIEKLQLE 1198

Query: 1199 LTIEDIAIAITRAPKLKIQTSDVTVLGKDKIAINVLPEGFGSKTSSTSLKEPTENDVFYR 1258
            LT+EDIA+AITRA KLKI  SDV+++GKDK+ INV PE    K+ STS KEP EN++FYR
Sbjct: 1199 LTVEDIAVAITRAAKLKIAASDVSIMGKDKVNINVYPEMAKLKSISTSAKEPVENELFYR 1258

Query: 1259 MQTLRRALPSIMVKGLNDIARAVINIRDDGKRELLVEGYGLRDVMCTDGVIGAKTATNHV 1318
            MQ LRRALP I+VKGL DIARAVINI+DDG RELLVEGYGLR+VM TDGVIG KT TNH+
Sbjct: 1259 MQHLRRALPGIVVKGLPDIARAVINIKDDGSRELLVEGYGLREVMTTDGVIGMKTKTNHI 1318

Query: 1319 LEIFNVLGIEAARASIIGEIDYTMSNHGMSVDPRHIQLLGDVMTFKGEVLGITRFGLSKM 1378
            LE+F+VLGIEAAR SI+GEIDYTMSNHGMSVDPRH+QLLGDVMT+KGE+LGITRFGLSKM
Sbjct: 1319 LEVFSVLGIEAARTSIVGEIDYTMSNHGMSVDPRHVQLLGDVMTYKGEILGITRFGLSKM 1378

Query: 1379 RDSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVVKNTDIAED 1438
            RDSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTG+FKVVK TDI+E 
Sbjct: 1379 RDSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGAFKVVKGTDISES 1438

Query: 1439 ELKPKRTLFESLTSNVANKQV 1459
            +L PK TLFESL  +V   +V
Sbjct: 1439 DLAPKPTLFESLCDSVTALKV 1459

>KLLA0E21253g Chr5 (1896457..1900830) [4374 bp, 1457 aa] {ON} highly
            similar to uniprot|P04051 Saccharomyces cerevisiae
            YOR116C
          Length = 1457

 Score = 2479 bits (6426), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1185/1456 (81%), Positives = 1300/1456 (89%), Gaps = 5/1456 (0%)

Query: 1    MKEVVIGETPKRISGLEFSALSPADIVAQSELEISSRDLFDLENNRSPKEGGALDPRMGV 60
            MKE VI   PK+I G+ FSALS ADIV+QSE+EIS+RDLFDL+N RS KEGGALDPRMGV
Sbjct: 1    MKETVIDIAPKKIKGISFSALSAADIVSQSEVEISTRDLFDLDNGRSAKEGGALDPRMGV 60

Query: 61   SASSMECTTCHGNLASCHGHFGHIKLALPVFHVGYFKATIQILQGICKTCSAILLSEQDK 120
            S+S  ECTTCHGNLASCHGHFGHIKLALPVFHVGYFKATIQILQ +CK C A+LLSE+DK
Sbjct: 61   SSSQAECTTCHGNLASCHGHFGHIKLALPVFHVGYFKATIQILQSVCKGCGALLLSEEDK 120

Query: 121  RHFLSELRRPGVDNLRRMALLKKVLDQCKKQRRCLHCXXXXXXXXXXXXXXXXXSLKIIH 180
            R FL+ELRRPG+DNLRRM +LKK+LDQCKKQRRC  C                 +LKIIH
Sbjct: 121  RKFLTELRRPGMDNLRRMNILKKILDQCKKQRRCFECGELNGVVKKAAAGSGSAALKIIH 180

Query: 181  DTFRWVGKKSTPEKDKWIGDWKEVLSHNPELERYVKRATDDLNPLKTLNLFKQIASEDCE 240
            DTFRWVGKKS PEK++WIGDWK+VL +NPELERYVKR  DDLNPLK LNLFKQI   DCE
Sbjct: 181  DTFRWVGKKSAPEKEQWIGDWKQVLENNPELERYVKRCMDDLNPLKVLNLFKQIKPNDCE 240

Query: 241  LLGIDATNKAGRPETYIWRYIPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300
            LLGID+T+K+GRPETYIWRY+PAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK
Sbjct: 241  LLGIDSTSKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300

Query: 301  AGIEKGISINNMMEHWDYLQMTVAMYINSDSINPAMLPGSSTGGGKVKPIRGFCQRLKGK 360
            AG+EKGISINNMME WDYLQ+ VAMYINSDS+NP+MLPGSS  G K KPIRGFCQRLKGK
Sbjct: 301  AGLEKGISINNMMEQWDYLQLAVAMYINSDSVNPSMLPGSS--GTKSKPIRGFCQRLKGK 358

Query: 361  QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPQLVAKVLTFPEKVTRYNIKKLRQLV 420
            QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVP  VAK+LT+PEKVTRYN  KL+QLV
Sbjct: 359  QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKILTYPEKVTRYNKHKLQQLV 418

Query: 421  QNGPNVHPGANYLLKKNEEARRNLRYGDRQKLANNLQYGDVVERHLEDGDVVLFNRQPSL 480
             NGP VHPGANYLLKKNE+ARRNLRYGDR KLA  LQYGDVVERH+EDGDVVLFNRQPSL
Sbjct: 419  INGPKVHPGANYLLKKNEDARRNLRYGDRVKLAKQLQYGDVVERHIEDGDVVLFNRQPSL 478

Query: 481  HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN 540
            HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN
Sbjct: 479  HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN 538

Query: 541  LLTPKSGEPIIAATQDFITGSYLISHKDSFFDKASLTQLLSMMSDGSLQFDIPPPAIMKP 600
            LLTPKSGEPIIAATQDFITGSYLISHKDSFFD+A LTQLLSMMSD +LQFDIPPP+IMKP
Sbjct: 539  LLTPKSGEPIIAATQDFITGSYLISHKDSFFDRAQLTQLLSMMSDSNLQFDIPPPSIMKP 598

Query: 601  CYLWTGKQVFSLLIKPNKNSPVKINLDAKNKVYIPPKQKHYPNEMSQNDGFVIVRGSQIL 660
             YLWTGKQVFSLLIKP++ SPV INLDAKNKVY+PP +K YPNEMSQNDGFV++RGS IL
Sbjct: 599  HYLWTGKQVFSLLIKPSRKSPVVINLDAKNKVYLPPPKKEYPNEMSQNDGFVLIRGSNIL 658

Query: 661  SGVMDKSVLGDGKKHSVFYTILRDFGPQEAASAMNRMAKLCARYLGNRGFSIGISDVTPA 720
            SGVMDKSVLGDGKKHSVFYTILRD+GP EAA AMNRMAKLCARYLGNRGFSIGI+DVTP 
Sbjct: 659  SGVMDKSVLGDGKKHSVFYTILRDYGPNEAAQAMNRMAKLCARYLGNRGFSIGINDVTPG 718

Query: 721  DDLKQKKEDLVEIAYAKCDELIDLYNKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGDV 780
             DLKQKKE +VE AYAKCDELIDL+NKGKLETQPGCNEEQTLEAKIGGLLSKVREEVG+V
Sbjct: 719  SDLKQKKEQMVESAYAKCDELIDLFNKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGEV 778

Query: 781  CINELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSK 840
            CI ELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSK
Sbjct: 779  CIRELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSK 838

Query: 841  TPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 900
            TPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY
Sbjct: 839  TPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 898

Query: 901  DNTVRTSSNGIVQFTYGGDGLDPLEMEGNAQPVNFNRSWDHAYNITFNNTDRGLLPYEIK 960
            DNTVRTSSNGIVQFTYGGDGLDPL+MEGNAQPVNFNRSW HA N+T N+   GLLPY+I 
Sbjct: 899  DNTVRTSSNGIVQFTYGGDGLDPLDMEGNAQPVNFNRSWTHANNLTLNDNSPGLLPYQII 958

Query: 961  KTVDNILKPLEKRLIRYDTLGRPVSAEDDKLDDYVDQHDSERLFYASLREFMTDXXXXXX 1020
               + IL+PLE +L RYD +G+ +  ED+  D+Y+DQ D+ER FY SLREFMT+      
Sbjct: 959  AETNVILQPLENKLKRYDNIGQELRKEDEHKDEYIDQFDAERSFYQSLREFMTEKALTLA 1018

Query: 1021 XXXXXXGLPKLIKK--SELEGYDPENEHIDAIVQHSITQLYRITEDAVQKFLEIAISKYH 1078
                  GL +L+ +   EL  ++  +E++ A +  ++ QL +I++  VQKFL IAISKYH
Sbjct: 1019 SLRGERGLKELVDEPAEELREFN-WDENVPASITIALNQLCKISKILVQKFLSIAISKYH 1077

Query: 1079 RAKVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTP 1138
            RA+VEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTP
Sbjct: 1078 RARVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTP 1137

Query: 1139 IINAVLVNNNDERAARVVKGRIEKTLLSDVCYYIQDVYKENMAYLQVKVDLNTIDKLQLE 1198
            IINAVLVN+NDERAARVVKGR+EKTLLSDV +Y+QD+Y++NMA+LQ+K+D  TI+KLQLE
Sbjct: 1138 IINAVLVNDNDERAARVVKGRVEKTLLSDVSFYVQDIYRDNMAFLQIKIDSETIEKLQLE 1197

Query: 1199 LTIEDIAIAITRAPKLKIQTSDVTVLGKDKIAINVLPEGFGSKTSSTSLKEPTENDVFYR 1258
            LT+EDI +AI +APKLKI T+D++++GKDKI I V  +G   K+ ST++KEP  N+VFYR
Sbjct: 1198 LTLEDIVVAIAKAPKLKIGTNDISIIGKDKINIAVSSDGKSMKSISTAMKEPEPNEVFYR 1257

Query: 1259 MQTLRRALPSIMVKGLNDIARAVINIRDDGKRELLVEGYGLRDVMCTDGVIGAKTATNHV 1318
            MQ LRRALP I+VKG +DI+RAVINIRDDGKRELLVEGYGLRDVM TDGVIG+KT TNH+
Sbjct: 1258 MQQLRRALPHIVVKGFSDISRAVINIRDDGKRELLVEGYGLRDVMTTDGVIGSKTKTNHI 1317

Query: 1319 LEIFNVLGIEAARASIIGEIDYTMSNHGMSVDPRHIQLLGDVMTFKGEVLGITRFGLSKM 1378
            LE+++VLGIEAAR+ II EIDYTMSNHGMSVDPRHIQLLGDVMT+KGEVLGITRFGL+KM
Sbjct: 1318 LEVYDVLGIEAARSCIINEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLAKM 1377

Query: 1379 RDSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVVKNTDIAED 1438
            RDSVLQLASFEKTTDHLFDAAFYMK DAVEGVSECIILGQTMSIGTGSFKVVKNT + E+
Sbjct: 1378 RDSVLQLASFEKTTDHLFDAAFYMKNDAVEGVSECIILGQTMSIGTGSFKVVKNTVVGEN 1437

Query: 1439 ELKPKRTLFESLTSNV 1454
            +L PK TLFE+L   V
Sbjct: 1438 DLTPKPTLFETLCDTV 1453

>AER252C Chr5 complement(1101343..1105722) [4380 bp, 1459 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YOR116C
            (RPO31)
          Length = 1459

 Score = 2466 bits (6392), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1188/1456 (81%), Positives = 1292/1456 (88%), Gaps = 8/1456 (0%)

Query: 1    MKEVVIGETPKRISGLEFSALSPADIVAQSELEISSRDLFDLENNRSPKEGGALDPRMGV 60
            MKEVV+   PKRISGLEFSALS +DIVAQSE+EI +RDLFDLE+ R+PK+GGALD RMGV
Sbjct: 1    MKEVVVDILPKRISGLEFSALSASDIVAQSEVEIFTRDLFDLEDGRAPKKGGALDSRMGV 60

Query: 61   SASSMECTTCHGNLASCHGHFGHIKLALPVFHVGYFKATIQILQGICKTCSAILLSEQDK 120
            S+S  EC+TCHG LASCHGHFGHIKLALPVFHVGYFKATIQILQ ICK C+ +LL+E+DK
Sbjct: 61   SSSQAECSTCHGTLASCHGHFGHIKLALPVFHVGYFKATIQILQSICKNCAKLLLNEEDK 120

Query: 121  RHFLSELRRPGVDNLRRMALLKKVLDQCKKQRRCLHCXXXXXXXXXXXXXXXXXSLKIIH 180
            R FLSELRRPG+DNLRRMA LKKVLDQCKKQRRCLHC                 +LKIIH
Sbjct: 121  RQFLSELRRPGIDNLRRMATLKKVLDQCKKQRRCLHCGMLNGVVKKAAAGSGSAALKIIH 180

Query: 181  DTFRWVGKKSTPEKDKWIGDWKEVLSHNPELERYVKRATDDLNPLKTLNLFKQIASEDCE 240
            DTFRWVGKKS PEKDKWIGDW +VL H+PELERY+KR  ++LNPLKTLNLFKQI+ +DCE
Sbjct: 181  DTFRWVGKKSAPEKDKWIGDWNQVLQHSPELERYMKRTMENLNPLKTLNLFKQISPQDCE 240

Query: 241  LLGIDATNKAGRPETYIWRYIPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300
            LLGID+T KAGRPETYIWRY+PAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK
Sbjct: 241  LLGIDSTVKAGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300

Query: 301  AGIEKGISINNMMEHWDYLQMTVAMYINSDSINPAMLPGSSTGGGKVKPIRGFCQRLKGK 360
            AG+EKGISINNMME WDYLQM VAMYINSDS+NPA++PG + GGGK KPIRGFCQRLKGK
Sbjct: 301  AGLEKGISINNMMEQWDYLQMAVAMYINSDSVNPALMPGGN-GGGKTKPIRGFCQRLKGK 359

Query: 361  QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPQLVAKVLTFPEKVTRYNIKKLRQLV 420
            QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVP  VAKVLTFPEKVTRYN  KL+QL+
Sbjct: 360  QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTFPEKVTRYNKHKLQQLI 419

Query: 421  QNGPNVHPGANYLLKKNEEARRNLRYGDRQKLANNLQYGDVVERHLEDGDVVLFNRQPSL 480
             NG NVHPGANYLLKKNEEARRNLRYGDR KLA NLQ GDVVERHLEDGDVVLFNRQPSL
Sbjct: 420  VNGANVHPGANYLLKKNEEARRNLRYGDRIKLAKNLQIGDVVERHLEDGDVVLFNRQPSL 479

Query: 481  HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN 540
            HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN
Sbjct: 480  HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN 539

Query: 541  LLTPKSGEPIIAATQDFITGSYLISHKDSFFDKASLTQLLSMMSDGSLQFDIPPPAIMKP 600
            LLTPKSGEPIIAATQDFITGSYLISHKDSFFD+A+  Q+LSMMSDG+LQFDIPPPAIM+P
Sbjct: 540  LLTPKSGEPIIAATQDFITGSYLISHKDSFFDRATFVQMLSMMSDGNLQFDIPPPAIMRP 599

Query: 601  CYLWTGKQVFSLLIKPNKNSPVKINLDAKNKVYIPPKQKHYPNEMSQNDGFVIVRGSQIL 660
             YLWTGKQ+FSLLIKPNK SPV INLDAKNKVYI PK K YPNEMS NDG+V++RGS IL
Sbjct: 600  HYLWTGKQLFSLLIKPNKKSPVIINLDAKNKVYIAPKNKAYPNEMSANDGYVVIRGSNIL 659

Query: 661  SGVMDKSVLGDGKKHSVFYTILRDFGPQEAASAMNRMAKLCARYLGNRGFSIGISDVTPA 720
            SGVMDKSVLGDGKKHSVFYTILRDFGPQEA  AMNRMAKLCARYLGNRGFSIGISDVTP 
Sbjct: 660  SGVMDKSVLGDGKKHSVFYTILRDFGPQEATQAMNRMAKLCARYLGNRGFSIGISDVTPG 719

Query: 721  DDLKQKKEDLVEIAYAKCDELIDLYNKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGDV 780
             +LK  KE++VEIAYAKCDELIDLY +GKLETQPGCNEEQTLEAKIGGLLSKVREEVGDV
Sbjct: 720  VELKATKEEMVEIAYAKCDELIDLYKRGKLETQPGCNEEQTLEAKIGGLLSKVREEVGDV 779

Query: 781  CINELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSK 840
            CI ELDNLNAPLIMATCGSKGS LNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSK
Sbjct: 780  CIRELDNLNAPLIMATCGSKGSNLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSK 839

Query: 841  TPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 900
            TPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY
Sbjct: 840  TPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 899

Query: 901  DNTVRTSSNGIVQFTYGGDGLDPLEMEGNAQPVNFNRSWDHAYNITFNNTDRGLLPYEIK 960
            DNTVRTSSNGIVQFTYGGDGLDPL MEGNA+PVNFNRSWDHA NIT+N+ D+G+LPY+I 
Sbjct: 900  DNTVRTSSNGIVQFTYGGDGLDPLNMEGNAKPVNFNRSWDHANNITYNHDDKGMLPYQIL 959

Query: 961  KTVDNILKPLEKRLIRYDTLGRPVSAEDDKLDDYVDQHDSERLFYASLREFMTDXXXXXX 1020
            +  + IL PLE++L RYD +G P++   +  + Y+DQHD+ER FY SLR +M++      
Sbjct: 960  EETNAILHPLEQQLSRYDNVGNPLAPGLENEELYIDQHDAEREFYQSLRTYMSEKARKLA 1019

Query: 1021 XXXXXXGLPKLIKKSELE----GYDPENEHIDAIVQHSITQLYRITEDAVQKFLEIAISK 1076
                  GL +L     LE      D     +D     S+ QL +I+   V+ FL+IAISK
Sbjct: 1020 DITKSRGLKELYHAPALELQLMDLDASCPEVDV---KSVNQLCKISSKLVRTFLDIAISK 1076

Query: 1077 YHRAKVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVIS 1136
            Y +AKVEPGTAVGAIGA SIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVIS
Sbjct: 1077 YRKAKVEPGTAVGAIGAHSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVIS 1136

Query: 1137 TPIINAVLVNNNDERAARVVKGRIEKTLLSDVCYYIQDVYKENMAYLQVKVDLNTIDKLQ 1196
            TPIINA LVN++DERAARVVKGR+EKTLLSDV +YIQDVY++NM++LQVKVDL TI+KLQ
Sbjct: 1137 TPIINATLVNDDDERAARVVKGRVEKTLLSDVIFYIQDVYRDNMSFLQVKVDLATIEKLQ 1196

Query: 1197 LELTIEDIAIAITRAPKLKIQTSDVTVLGKDKIAINVLPEGFGSKTSSTSLKEPTENDVF 1256
            LELT+EDIAIAIT APKLKI T DV+++G++KI INV  +   +K+ ST   EP ENDVF
Sbjct: 1197 LELTVEDIAIAITSAPKLKISTGDVSIVGRNKININVCNDLDKAKSISTLASEPHENDVF 1256

Query: 1257 YRMQTLRRALPSIMVKGLNDIARAVINIRDDGKRELLVEGYGLRDVMCTDGVIGAKTATN 1316
            ++MQ LRRALP I+VKGL DI+RAVINIRDDGKRELLVEGYGLRDVM TDGV+G KT TN
Sbjct: 1257 FKMQHLRRALPGIVVKGLPDISRAVINIRDDGKRELLVEGYGLRDVMTTDGVVGYKTKTN 1316

Query: 1317 HVLEIFNVLGIEAARASIIGEIDYTMSNHGMSVDPRHIQLLGDVMTFKGEVLGITRFGLS 1376
            H LE+++VLGIEAAR SII EIDYTMSNHGMSVDPRHIQLLGDVMT+KGEVLGITRFGLS
Sbjct: 1317 HFLEVYDVLGIEAARTSIIDEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLS 1376

Query: 1377 KMRDSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVVKNTDIA 1436
            KMRDSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTM+IGTGSFKVVK T+I+
Sbjct: 1377 KMRDSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMTIGTGSFKVVKGTNIS 1436

Query: 1437 EDELKPKRTLFESLTS 1452
             D+LKPK TLFE+L S
Sbjct: 1437 PDDLKPKPTLFENLCS 1452

>TPHA0H01760 Chr8 complement(402254..406633) [4380 bp, 1459 aa] {ON}
            Anc_5.426 YOR116C
          Length = 1459

 Score = 2458 bits (6371), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1176/1456 (80%), Positives = 1315/1456 (90%), Gaps = 7/1456 (0%)

Query: 1    MKEVVIGETPKRISGLEFSALSPADIVAQSELEISSRDLFDLENNRSPKEGGALDPRMGV 60
            MKEVVI ETPKRISGLEFSALS +DI+AQSE+EIS+RDLFDLEN R+P EGGALDP+MGV
Sbjct: 1    MKEVVISETPKRISGLEFSALSTSDIIAQSEVEISTRDLFDLENGRAPIEGGALDPKMGV 60

Query: 61   SASSMECTTCHGNLASCHGHFGHIKLALPVFHVGYFKATIQILQGICKTCSAILLSEQDK 120
            S+S++EC+TCHGNLASCHGHFGHIKL+LPVFHVGYFKATIQILQG+CK+CSAILL++ DK
Sbjct: 61   SSSTLECSTCHGNLASCHGHFGHIKLSLPVFHVGYFKATIQILQGVCKSCSAILLNDTDK 120

Query: 121  RHFLSELRRPGVDNLRRMALLKKVLDQCKKQRRCLHCXXXXXXXXXXXXXXXXXSLKIIH 180
            RHFL ELR+P +DNL+RM++LKK+LDQCKKQRRCL C                 SLKIIH
Sbjct: 121  RHFLHELRKPDIDNLKRMSILKKILDQCKKQRRCLECGDLNGVVKRAATGSGSASLKIIH 180

Query: 181  DTFRWVGKKSTPEKDKWIGDWKEVLSHNPELERYVKRATDDLNPLKTLNLFKQIASEDCE 240
            DTFRWVGKK+ PEKDKWIGDW +VL++NPELE+++KR TDDLNPLKTLNLFKQI +EDCE
Sbjct: 181  DTFRWVGKKNVPEKDKWIGDWNQVLTNNPELEKFIKRCTDDLNPLKTLNLFKQIKNEDCE 240

Query: 241  LLGIDATNKAGRPETYIWRYIPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300
            LLGID+T  +GRPETYIWRY+PAPPVCIRPSVMMQDS ASNEDDLTVKLTEIVWTSSLIK
Sbjct: 241  LLGIDSTVASGRPETYIWRYLPAPPVCIRPSVMMQDSSASNEDDLTVKLTEIVWTSSLIK 300

Query: 301  AGIEKGISINNMMEHWDYLQMTVAMYINSDSINPAMLPGSSTGGGKVKPIRGFCQRLKGK 360
            AG+EKGISINNMMEHWDYLQ++VAMYINSDS+N  ++PGS+ GG K KPIRGFCQRLKGK
Sbjct: 301  AGLEKGISINNMMEHWDYLQLSVAMYINSDSVNLLVMPGSN-GGTKAKPIRGFCQRLKGK 359

Query: 361  QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPQLVAKVLTFPEKVTRYNIKKLRQLV 420
            QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVP+LVAKVLT+PEKVTRYN  KL++LV
Sbjct: 360  QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPELVAKVLTYPEKVTRYNKTKLQKLV 419

Query: 421  QNGPNVHPGANYLLKKNEEARRNLRYGDRQKLANNLQYGDVVERHLEDGDVVLFNRQPSL 480
             NGPNVHPGANYLLK NEEARRNLRYG+R KLA  L+ GD+VERHLEDGD+VLFNRQPSL
Sbjct: 420  MNGPNVHPGANYLLKSNEEARRNLRYGNRDKLAKQLRIGDIVERHLEDGDIVLFNRQPSL 479

Query: 481  HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHV-PQTEEARAEAINLMGVKN 539
            HRLSILSH+AKIRPWRTFRLNECVCTPYNADFDGDEMNL    QTEEARAEAINLMGVKN
Sbjct: 480  HRLSILSHFAKIRPWRTFRLNECVCTPYNADFDGDEMNLLCYQQTEEARAEAINLMGVKN 539

Query: 540  NLLTPKSGEPIIAATQDFITGSYLISHKDSFFDKASLTQLLSMMSDGSLQFDIPPPAIMK 599
            NLLTPKSGEPIIAATQDFITGSYLISHKDSFFD+A+LTQLLSMMSD +L+FDIPPPAI K
Sbjct: 540  NLLTPKSGEPIIAATQDFITGSYLISHKDSFFDRATLTQLLSMMSDANLKFDIPPPAIFK 599

Query: 600  PCYLWTGKQVFSLLIKPNKNSPVKINLDAKNKVYIPPKQKHYPNEMSQNDGFVIVRGSQI 659
            P  LWTGKQ+FSLLIKPNK SPV INLDAKNKVYIPP+ K +P+EMS NDG+VI+RGS+I
Sbjct: 600  PQCLWTGKQIFSLLIKPNKESPVVINLDAKNKVYIPPQNKSWPSEMSPNDGYVIIRGSEI 659

Query: 660  LSGVMDKSVLGDGKKHSVFYTILRDFGPQEAASAMNRMAKLCARYLGNRGFSIGISDVTP 719
            LSGVMDKSVLGDGKKHSVFYTILRD+GPQE+A+AMNRMAKLCARYLGNRGFSIGISDVTP
Sbjct: 660  LSGVMDKSVLGDGKKHSVFYTILRDYGPQESANAMNRMAKLCARYLGNRGFSIGISDVTP 719

Query: 720  ADDLKQKKEDLVEIAYAKCDELIDLYNKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGD 779
             ++LK KKEDLVEIAY KCDELI  YNKG+LETQPGCNEEQTLEAKIGGLLSKVREEVGD
Sbjct: 720  GEELKLKKEDLVEIAYKKCDELIIQYNKGELETQPGCNEEQTLEAKIGGLLSKVREEVGD 779

Query: 780  VCINELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNS 839
            VCINELDNLNAPLIMATCGSKGS LNVSQMVAVVGQQIISGNRVPDGFQDRSLPHF KNS
Sbjct: 780  VCINELDNLNAPLIMATCGSKGSNLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFEKNS 839

Query: 840  KTPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQ 899
            KTPQSKGFVRNSFF+GL+PPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQ
Sbjct: 840  KTPQSKGFVRNSFFTGLTPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQ 899

Query: 900  YDNTVRTSSNGIVQFTYGGDGLDPLEMEGNAQPVNFNRSWDHAYNITFNNTDRGLLPYEI 959
            YDNT+RTSSNGIVQFTYGGDGLDPL+MEGNA+PVNF R+WDHA NITF+   +GLLPY+I
Sbjct: 900  YDNTIRTSSNGIVQFTYGGDGLDPLDMEGNAKPVNFKRTWDHASNITFDFNAKGLLPYQI 959

Query: 960  KKTVDNILKPLEKRLIRYDTLGRPVSAEDDKLDDYVDQHDSERLFYASLREFMTDXXXXX 1019
             K  + IL+PLE  L+RY+ +G+P+S +D   D+YVDQ D++R FYAS+RE+M +     
Sbjct: 960  IKQTNLILQPLENALVRYNNVGKPLSKKDYHKDEYVDQLDAKRDFYASIREYMVEKAEQL 1019

Query: 1020 XXXXXXXGLPKLIKK--SELEGYDPENEHIDAIVQHSITQLYRITEDAVQKFLEIAISKY 1077
                    L +LI +   EL+  D + E+I + V+  + +L +I+E  V+KFLEIAISKY
Sbjct: 1020 AKIRKARSLKELISEPAEELQHIDFD-ENIPSNVREVVDKLCKISEANVKKFLEIAISKY 1078

Query: 1078 HRAKVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVIST 1137
            HRAKVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASK IST
Sbjct: 1079 HRAKVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKTIST 1138

Query: 1138 PIINAVLVNNNDERAARVVKGRIEKTLLSDVCYYIQDVYKENMAYLQVKVDLNTIDKLQL 1197
            PII AVLVN++D RAARVVKGRIEKTLLSDV YYI+DVY++N  ++++K+DL+TI+KLQL
Sbjct: 1139 PIIKAVLVNDSDRRAARVVKGRIEKTLLSDVAYYIEDVYRDNRTFIRIKIDLSTIEKLQL 1198

Query: 1198 ELTIEDIAIAITRAPKLKIQTSDVTVLGKDKIAINVLPEGFGSKTSSTSLKEPTENDVFY 1257
            ELTIEDIAIAI++APKLKI +S++ ++G DKIAI+V  E   SK+ STSLKE +EN VFY
Sbjct: 1199 ELTIEDIAIAISKAPKLKIDSSNIHIVGNDKIAIDVFEE--ASKSISTSLKESSENTVFY 1256

Query: 1258 RMQTLRRALPSIMVKGLNDIARAVINIRDDGKRELLVEGYGLRDVMCTDGVIGAKTATNH 1317
            +MQTLRRALP ++VKGL DI+RAVINI+DD K ELLVEGYGLRDVMCTDGVIG KT+TNH
Sbjct: 1257 KMQTLRRALPDVVVKGLADISRAVINIKDDSKTELLVEGYGLRDVMCTDGVIGTKTSTNH 1316

Query: 1318 VLEIFNVLGIEAARASIIGEIDYTMSNHGMSVDPRHIQLLGDVMTFKGEVLGITRFGLSK 1377
            +LEIFNVLGIEAAR+SI+GEIDYTMSNHGMSVDPRHIQLLGDVMTFKGEVLGITRFGLSK
Sbjct: 1317 ILEIFNVLGIEAARSSIVGEIDYTMSNHGMSVDPRHIQLLGDVMTFKGEVLGITRFGLSK 1376

Query: 1378 MRDSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVVKNTDIAE 1437
            MRDSVLQLASFEKTTDHLFDAAFYMKKD V+GVSECIILGQTMSIGTGSF VVK+T ++ 
Sbjct: 1377 MRDSVLQLASFEKTTDHLFDAAFYMKKDEVKGVSECIILGQTMSIGTGSFNVVKHTVVSP 1436

Query: 1438 DELKPKRTLFESLTSN 1453
            +++KPKRTLFESL S+
Sbjct: 1437 EQVKPKRTLFESLVSS 1452

>Ecym_5525 Chr5 complement(1063773..1068152) [4380 bp, 1459 aa] {ON}
            similar to Ashbya gossypii AER252C
          Length = 1459

 Score = 2452 bits (6355), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1179/1459 (80%), Positives = 1302/1459 (89%), Gaps = 4/1459 (0%)

Query: 1    MKEVVIGETPKRISGLEFSALSPADIVAQSELEISSRDLFDLENNRSPKEGGALDPRMGV 60
            MKEVV+   PK+I GL FSALS +DIVAQSE+EI +RDLFDLEN R+PK+GGALD +MGV
Sbjct: 1    MKEVVVDVAPKKIKGLHFSALSASDIVAQSEVEIFTRDLFDLENGRAPKQGGALDSKMGV 60

Query: 61   SASSMECTTCHGNLASCHGHFGHIKLALPVFHVGYFKATIQILQGICKTCSAILLSEQDK 120
            S+S  EC+TCHGNLASCHGHFGHIKLALPVFH+GYFKATIQILQ ICK C+AILLSE++K
Sbjct: 61   SSSQAECSTCHGNLASCHGHFGHIKLALPVFHIGYFKATIQILQSICKNCAAILLSEEEK 120

Query: 121  RHFLSELRRPGVDNLRRMALLKKVLDQCKKQRRCLHCXXXXXXXXXXXXXXXXXSLKIIH 180
            R FL+ELRRPG+DNLRRMA L+KVLDQCKKQRRCLHC                 +LKIIH
Sbjct: 121  RQFLAELRRPGIDNLRRMATLRKVLDQCKKQRRCLHCGALNGVVKKAATGSGSAALKIIH 180

Query: 181  DTFRWVGKKSTPEKDKWIGDWKEVLSHNPELERYVKRATDDLNPLKTLNLFKQIASEDCE 240
            DTFRWVGKKS PEK+KWIGDW +VL HNPELERY+KR+ D+LNPLKTLNLFKQ+ ++DCE
Sbjct: 181  DTFRWVGKKSAPEKEKWIGDWNQVLQHNPELERYMKRSMDNLNPLKTLNLFKQVRAQDCE 240

Query: 241  LLGIDATNKAGRPETYIWRYIPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300
            LLGID+T KAGRPETYIWRY+PAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK
Sbjct: 241  LLGIDSTVKAGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300

Query: 301  AGIEKGISINNMMEHWDYLQMTVAMYINSDSINPAMLPGSSTGGGKVKPIRGFCQRLKGK 360
            AG+EKGISINNMME WDYLQM VAMYINSDS+NPA++PG + GG     IRGFCQRLKGK
Sbjct: 301  AGLEKGISINNMMEQWDYLQMAVAMYINSDSVNPALMPGGTGGGKTKP-IRGFCQRLKGK 359

Query: 361  QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPQLVAKVLTFPEKVTRYNIKKLRQLV 420
            QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVP  VAKVLT+PE+VTRYN  KL+QL+
Sbjct: 360  QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPERVTRYNKHKLQQLI 419

Query: 421  QNGPNVHPGANYLLKKNEEARRNLRYGDRQKLANNLQYGDVVERHLEDGDVVLFNRQPSL 480
             NGPNVHPGANY+LKKNE+ARRNLRYGDR KLA N+Q GDVVERH+EDGDVVLFNRQPSL
Sbjct: 420  INGPNVHPGANYMLKKNEDARRNLRYGDRIKLAKNIQIGDVVERHIEDGDVVLFNRQPSL 479

Query: 481  HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN 540
            HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN
Sbjct: 480  HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN 539

Query: 541  LLTPKSGEPIIAATQDFITGSYLISHKDSFFDKASLTQLLSMMSDGSLQFDIPPPAIMKP 600
            LLTPKSGEPII+ATQDFITGSYLISHKDSFFD+A+ TQLLSMM+D ++QFD+PPPAI+KP
Sbjct: 540  LLTPKSGEPIISATQDFITGSYLISHKDSFFDRATFTQLLSMMADANMQFDLPPPAIIKP 599

Query: 601  CYLWTGKQVFSLLIKPNKNSPVKINLDAKNKVYIPPKQKHYPNEMSQNDGFVIVRGSQIL 660
            CYLWTGKQVFSLLI+PNK SPV INLDAKNKVY+PPK K +PNEMS NDG+VI+RGS+IL
Sbjct: 600  CYLWTGKQVFSLLIRPNKKSPVIINLDAKNKVYLPPKNKSFPNEMSSNDGYVIIRGSEIL 659

Query: 661  SGVMDKSVLGDGKKHSVFYTILRDFGPQEAASAMNRMAKLCARYLGNRGFSIGISDVTPA 720
             GVMDKSVLGDGKKHSVFYTILRDFGP EAA AMNRMAKLCARYLGNRGFSIGI+DVTP 
Sbjct: 660  CGVMDKSVLGDGKKHSVFYTILRDFGPYEAAKAMNRMAKLCARYLGNRGFSIGINDVTPG 719

Query: 721  DDLKQKKEDLVEIAYAKCDELIDLYNKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGDV 780
             +LK KKE++VEIAYAKCDELIDL+ +G+LETQPGCNEEQTLEAKIGGLLSKVREEVG+V
Sbjct: 720  KELKAKKEEMVEIAYAKCDELIDLFKRGELETQPGCNEEQTLEAKIGGLLSKVREEVGEV 779

Query: 781  CINELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSK 840
            CI ELDNLNAPLIMATCGSKGS LNVSQMVAVVGQQIISGNRVPDGFQDRSLPHF KNSK
Sbjct: 780  CIRELDNLNAPLIMATCGSKGSNLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFAKNSK 839

Query: 841  TPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 900
            TPQSKGFVR+SFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY
Sbjct: 840  TPQSKGFVRSSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 899

Query: 901  DNTVRTSSNGIVQFTYGGDGLDPLEMEGNAQPVNFNRSWDHAYNITFNNTDRGLLPYEIK 960
            DNTVRTSSNG+VQFTYGGDGLDPL MEGNAQPVNFNRSWDHA NITFNN + GLLPY+I 
Sbjct: 900  DNTVRTSSNGVVQFTYGGDGLDPLNMEGNAQPVNFNRSWDHANNITFNNEEPGLLPYQIM 959

Query: 961  KTVDNILKPLEKRLIRYDTLGRPVSAEDDKLDDYVDQHDSERLFYASLREFMTDXXXXXX 1020
            +T ++IL PLE++L+R D +G  +SA+    D+Y+DQ+D+ER FY SLR +MT       
Sbjct: 960  ETSNSILVPLERQLLRLDNVGNAISADLGSNDEYIDQNDAERDFYQSLRTYMTAKAHRLA 1019

Query: 1021 XXXXXXGLPKLIKK--SELEGYDPENEHIDAIVQHSITQLYRITEDAVQKFLEIAISKYH 1078
                  GL  L+++   EL+  D +     A + +SI QL +I+ + V  FL IAISKYH
Sbjct: 1020 QIRKSKGLKSLLEEPAQELKYMDLDASASTADL-NSINQLCKISYNLVTTFLNIAISKYH 1078

Query: 1079 RAKVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTP 1138
            +AKVEPGTAVGAIGA SIGEPGTQMTLKTFHFAGVASMN+TLGVPRIKEIINASKVISTP
Sbjct: 1079 KAKVEPGTAVGAIGAHSIGEPGTQMTLKTFHFAGVASMNITLGVPRIKEIINASKVISTP 1138

Query: 1139 IINAVLVNNNDERAARVVKGRIEKTLLSDVCYYIQDVYKENMAYLQVKVDLNTIDKLQLE 1198
            IINA+LVN+NDERAARVVKGRIEKTLLSDV +YIQDVY++NM+++QVKVDL+TI+KLQLE
Sbjct: 1139 IINALLVNDNDERAARVVKGRIEKTLLSDVVFYIQDVYRDNMSFIQVKVDLSTIEKLQLE 1198

Query: 1199 LTIEDIAIAITRAPKLKIQTSDVTVLGKDKIAINVLPEGFGSKTSSTSLKEPTENDVFYR 1258
            LTIEDIAIAI+RAPKLKI T DV+++GK+KI I+V  +    K+ ST + EP ENDVFYR
Sbjct: 1199 LTIEDIAIAISRAPKLKISTGDVSIIGKNKINISVGNDLEKGKSISTLVSEPNENDVFYR 1258

Query: 1259 MQTLRRALPSIMVKGLNDIARAVINIRDDGKRELLVEGYGLRDVMCTDGVIGAKTATNHV 1318
            MQ LRRALP+I+VKGL DI+RAVINI +DGKRELLVEGYGLRDVM TDGVIG KT TNH 
Sbjct: 1259 MQHLRRALPNIVVKGLPDISRAVINILEDGKRELLVEGYGLRDVMTTDGVIGYKTKTNHF 1318

Query: 1319 LEIFNVLGIEAARASIIGEIDYTMSNHGMSVDPRHIQLLGDVMTFKGEVLGITRFGLSKM 1378
            LE+F VLGIEAAR SII EIDYTMSNHGMSVDPRHIQLLGDVMT+KGEVLGITRFGLSKM
Sbjct: 1319 LEVFEVLGIEAARTSIIDEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKM 1378

Query: 1379 RDSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVVKNTDIAED 1438
            RDSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVV+ T+I+ D
Sbjct: 1379 RDSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVVRGTNISMD 1438

Query: 1439 ELKPKRTLFESLTSNVANK 1457
            ELKP  TLFE+L +N A K
Sbjct: 1439 ELKPNPTLFENLCNNTALK 1457

>Kwal_55.21459 s55 (846902..850348) [3447 bp, 1148 aa] {ON} YOR116C
            (RPO31) - RNA polymerase III large subunit [contig 130]
            FULL
          Length = 1148

 Score = 1951 bits (5055), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 929/1146 (81%), Positives = 1013/1146 (88%), Gaps = 4/1146 (0%)

Query: 1    MKEVVIGETPKRISGLEFSALSPADIVAQSELEISSRDLFDLENNRSPKEGGALDPRMGV 60
            MKEVV+   PKRI GLEFSALS +DIV QS++EIS+RDLFDLEN R PK GGALD RMGV
Sbjct: 1    MKEVVVDIAPKRIKGLEFSALSASDIVGQSKVEISTRDLFDLENGRKPKSGGALDTRMGV 60

Query: 61   SASSMECTTCHGNLASCHGHFGHIKLALPVFHVGYFKATIQILQGICKTCSAILLSEQDK 120
            S+S  EC+TCHGNLASCHGHFGHIKL+LPVFHVGYFKATIQ+LQ ICK+C+A+LLSE+DK
Sbjct: 61   SSSQAECSTCHGNLASCHGHFGHIKLSLPVFHVGYFKATIQVLQSICKSCAALLLSEEDK 120

Query: 121  RHFLSELRRPGVDNLRRMALLKKVLDQCKKQRRCLHCXXXXXXXXXXXXXXXXXSLKIIH 180
            R FLSELRRPG+DNLRRM +LKKV+DQCKKQRRCL C                 SLKI+H
Sbjct: 121  RQFLSELRRPGIDNLRRMGILKKVVDQCKKQRRCLRCGSLNGVVKKAAAGSGSASLKILH 180

Query: 181  DTFRWVGKKSTPEKDKWIGDWKEVLSHNPELERYVKRATDDLNPLKTLNLFKQIASEDCE 240
            DTFRWVGKKS PEKDKW+GDWK VLSHNPELERYVK+  DDLNPLKTLNLFKQ++ EDCE
Sbjct: 181  DTFRWVGKKSAPEKDKWVGDWKTVLSHNPELERYVKKCMDDLNPLKTLNLFKQVSPEDCE 240

Query: 241  LLGIDATNKAGRPETYIWRYIPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300
            L+GID+T K+GRPETYIWRY+PAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK
Sbjct: 241  LMGIDSTVKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300

Query: 301  AGIEKGISINNMMEHWDYLQMTVAMYINSDSINPAMLPGSSTGGGKVKPIRGFCQRLKGK 360
            AG+EKGISINNMME WDYLQ+ VAMYINSDS+NPAM+PG STGG K KPIRGFCQRLKGK
Sbjct: 301  AGLEKGISINNMMEQWDYLQLAVAMYINSDSVNPAMMPGGSTGG-KTKPIRGFCQRLKGK 359

Query: 361  QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPQLVAKVLTFPEKVTRYNIKKLRQLV 420
            QGRFRGNLSGKRVDFSGRTV+SPDPNLSIDEVAVP  VAKVLT+PE VTRYN  KL+QLV
Sbjct: 360  QGRFRGNLSGKRVDFSGRTVVSPDPNLSIDEVAVPDRVAKVLTYPEMVTRYNKAKLQQLV 419

Query: 421  QNGPNVHPGANYLLKKNEEARRNLRYGDRQKLANNLQYGDVVERHLEDGDVVLFNRQPSL 480
             NGPN HPGANYLLKK+EEARRNLRYGDR KLA NLQYGD+VERHLEDGDVVLFNRQPSL
Sbjct: 420  INGPNEHPGANYLLKKDEEARRNLRYGDRIKLAKNLQYGDLVERHLEDGDVVLFNRQPSL 479

Query: 481  HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN 540
            HRLSILSH+AKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN
Sbjct: 480  HRLSILSHFAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN 539

Query: 541  LLTPKSGEPIIAATQDFITGSYLISHKDSFFDKASLTQLLSMMSDGSLQFDIPPPAIMKP 600
            LLTPKSGEPIIAATQDFITGSYLISHKDSF+ +A   QLLSMMSDG++QFDIPPPAIMKP
Sbjct: 540  LLTPKSGEPIIAATQDFITGSYLISHKDSFYSRAEFVQLLSMMSDGNMQFDIPPPAIMKP 599

Query: 601  CYLWTGKQVFSLLIKPNKNSPVKINLDAKNKVYIPPKQKHYPNEMSQNDGFVIVRGSQIL 660
             Y+WTGKQVFSLLI+PNK S V INLDAKNKVYIPPK KH PNEMS NDGFV++RGSQIL
Sbjct: 600  YYMWTGKQVFSLLIRPNKKSSVVINLDAKNKVYIPPKHKHLPNEMSINDGFVVIRGSQIL 659

Query: 661  SGVMDKSVLGDGKKHSVFYTILRDFGPQEAASAMNRMAKLCARYLGNRGFSIGISDVTPA 720
            SGVMDKSVLGDGKKHSVFYTILRDFGP+EAA AMNRMAKLCARYLGNRGFSIGI+DVTP 
Sbjct: 660  SGVMDKSVLGDGKKHSVFYTILRDFGPKEAAYAMNRMAKLCARYLGNRGFSIGINDVTPG 719

Query: 721  DDLKQKKEDLVEIAYAKCDELIDLYNKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGDV 780
             +LK KKE +VE AYAKCD+LID +NKGKLETQPGCNEEQTLEAKIGGLLSKVREEVG+V
Sbjct: 720  FELKNKKEVMVEDAYAKCDDLIDQFNKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGEV 779

Query: 781  CINELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSK 840
            CI ELDNLN+ LIMA CGSKGS LNVSQMVAVVGQQIISGNRVPDGFQDRSLPHF KNSK
Sbjct: 780  CIKELDNLNSCLIMANCGSKGSNLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFLKNSK 839

Query: 841  TPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 900
            TPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY
Sbjct: 840  TPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 899

Query: 901  DNTVRTSSNGIVQFTYGGDGLDPLEMEGNAQPVNFNRSWDHAYNITFNNTDRGLLPYEIK 960
            DNT+RTSSNGIVQFTYGGDGLDP++MEGNAQPVNF RSWDHA NITFN++D+ LLPY+I 
Sbjct: 900  DNTIRTSSNGIVQFTYGGDGLDPIDMEGNAQPVNFTRSWDHANNITFNHSDKPLLPYQIM 959

Query: 961  KTVDNILKPLEKRLIRYDTLGRPVSAEDDKLDDYVDQHDSERLFYASLREFMTDXXXXXX 1020
            +  ++IL+PLE++L+RYD LGR +        +++DQ D+ER FY SLRE++        
Sbjct: 960  QQTNSILQPLEEKLVRYDNLGRTLDPSLQDRAEFIDQDDAERNFYKSLREYLHTKASHLA 1019

Query: 1021 XXXXXXGLPKLIKK--SELEGYDPENEHIDAIVQHSITQLYRITEDAVQKFLEIAISKYH 1078
                  GL + + +   EL+  D +     A++  S+ QL +I+   V KFLEIAI KYH
Sbjct: 1020 KIRSHKGLKQFLDEPAPELQSMDLDEGSPSALLA-SVDQLCKISSKLVAKFLEIAIFKYH 1078

Query: 1079 RAKVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTP 1138
            +AKVEPGTAVGA+GA SIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTP
Sbjct: 1079 KAKVEPGTAVGAVGAHSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTP 1138

Query: 1139 IINAVL 1144
            IINAVL
Sbjct: 1139 IINAVL 1144

>ZYRO0F05918g Chr6 (487056..492290) [5235 bp, 1744 aa] {ON} highly
            similar to uniprot|P04050 Saccharomyces cerevisiae
            YDL140C
          Length = 1744

 Score =  735 bits (1897), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 515/1493 (34%), Positives = 771/1493 (51%), Gaps = 133/1493 (8%)

Query: 11   KRISGLEFSALSPADIVAQSELEISSRDLFDLENNRSPKEGGALDPRMGVSASSMECTTC 70
            + +  ++F   SP +I A S  +I   +  D    R+ K GG  DPR+G    S++C TC
Sbjct: 12   RTVKEVQFGLFSPEEICAISVAKIKFPETMDETQTRA-KIGGLNDPRLGSIDRSLKCQTC 70

Query: 71   HGNLASCHGHFGHIKLALPVFHVGYFKATIQILQGICKTCSAILLSEQDKRHFLSELRRP 130
               +  C GHFGHI+LA PVFH+G+     ++ + +C  C  +LL E +      E  R 
Sbjct: 71   QEGMNECPGHFGHIELAKPVFHIGFISKIKKVCECVCMHCGKLLLDEHN------EQMRQ 124

Query: 131  GVDNLRRMALLKKVLDQCKKQRRCLHCXXXXXXXXXXXXXXXXXSLKIIHDTFRWVGKK- 189
             +           V   CK +   + C                        T R  G K 
Sbjct: 125  AIKIKDSKKRFNAVWSLCKAK---MICDTDVPSDEDPTQLISRGGCGNAQPTIRRDGLKL 181

Query: 190  -STPEKDKWIGDWKEVLSHNPELERYVKRATDDLNPLKTLNLFKQIASEDCELLGIDATN 248
              + +KDK  GD       N E E+ V      LN  + LN+FK I+ ED   LG +   
Sbjct: 182  VGSWKKDKNSGD-------NEEPEQRV------LNMEEILNIFKHISPEDSWKLGFN--E 226

Query: 249  KAGRPETYIWRYIPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIKAGIEKGIS 308
            +  RPE  I   +P PP  +RPS+   +S    EDDLT KL +I+  +  ++     G  
Sbjct: 227  EFARPEWMILTVLPVPPPPVRPSISFNES-QRGEDDLTFKLADILKANISLETLEHNGAP 285

Query: 309  INNMMEHWDYLQMTVAMYINSD-SINPAMLPGSSTGGGKVKPIRGFCQRLKGKQGRFRGN 367
             + + E    LQ  VA Y+++D +  P  L  S       +P++    RLKGK+GR RGN
Sbjct: 286  HHTIEEAESLLQFHVATYMDNDIAGQPQALQKSG------RPVKSIRARLKGKEGRIRGN 339

Query: 368  LSGKRVDFSGRTVISPDPNLSIDEVAVPQLVAKVLTFPEKVTRYNIKKLRQLVQNGPNVH 427
            L GKRVDFS RTVIS DPNL +D+V VP+ +AK LT+PE VT YNI +L  LV+NGPN H
Sbjct: 340  LMGKRVDFSARTVISGDPNLDLDQVGVPKSIAKTLTYPEVVTPYNIDRLTMLVRNGPNEH 399

Query: 428  PGANYLLKKNEEARRNLRYGDRQKLANNLQYGDVVERHLEDGDVVLFNRQPSLHRLSILS 487
            PGA Y+++ N + R +LRY  R      LQYG  VERH+ D D VLFNRQPSLH++S+++
Sbjct: 400  PGAKYVIRDNGD-RIDLRYSKRAGDIQ-LQYGWKVERHVIDNDPVLFNRQPSLHKMSMMA 457

Query: 488  HYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNNLLTPKSG 547
            H  K+ P+ TFRLN  V +PYNADFDGDEMNLHVPQ+EE RAE   L  V   +++P+S 
Sbjct: 458  HKVKVMPYSTFRLNLSVTSPYNADFDGDEMNLHVPQSEETRAELSQLCAVPQQIVSPQSN 517

Query: 548  EPIIAATQDFITGSYLISHKDSFFDKASLTQLLSMMSDGSLQFD--IPPPAIMKPCYLWT 605
            +P +   QD + G   ++ +D+F +   +  +L  + D    +D  IP PAI+KP  LWT
Sbjct: 518  KPCMGVVQDTLCGIRKLTLRDNFIELGQVLNMLYWVPD----WDGVIPTPAILKPKPLWT 573

Query: 606  GKQVFSLLIKPNKNSPVKINLDA--KNKVYIPPKQKHYPNEMSQNDGFVIVRGSQILSGV 663
            GKQ+ S+ I      P  I+L    +    + PK          ++G +++ G QI+ GV
Sbjct: 574  GKQLLSVAI------PKGIHLQRFDEGTTLLSPK----------DNGMLVIDG-QIIFGV 616

Query: 664  MDKSVLGDGKKHSVFYTILRDFGPQEAASAMNRMAKLCARYLGNRGFSIGISD-VTPADD 722
            +DK  +G      + + + R+ GPQ  A+  + + K+   +  + GFS GI D +     
Sbjct: 617  VDKKTVGSSSG-GLIHVVTREKGPQVCATLFSNIQKVVNYWFLHCGFSTGIGDTIADGQT 675

Query: 723  LKQKKEDLVEIAYAKCDELIDLYNKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGDVCI 782
            ++Q  E + E A  K +++        L  + G    ++ E  +   L++ R++ G +  
Sbjct: 676  MRQITEAIAE-AKVKVEDVTKEAQANLLTAKHGMTLRESFEDNVVRYLNEARDKAGRLAE 734

Query: 783  NELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSKTP 842
              L++ N    M + GSKGS +N++QM A VGQQ + G R+  GF DR+LPHF K+  +P
Sbjct: 735  VNLNDTNFVKQMVSAGSKGSFINIAQMSACVGQQSVEGKRIAFGFVDRTLPHFSKDDYSP 794

Query: 843  QSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYDN 902
            +SKGFV NS+  GL+P EF FHA+ GREGL+DTAVKTAETGY+ RRL+K+LED+   YD 
Sbjct: 795  ESKGFVENSYLRGLTPQEFFFHAMGGREGLIDTAVKTAETGYIQRRLVKALEDIMVHYDG 854

Query: 903  TVRTSSNGIVQFTYGGDGLDPLEMEGNAQPV--NFNRSWDHAYNITFNNTD--------- 951
            T R S   I+QF YG DG+D   +E  A       +R+++  Y I   N D         
Sbjct: 855  TTRNSLGNIIQFIYGEDGMDAAHIEKQAVETIGGSDRNFERRYRIDLLNPDYSLDPSLLE 914

Query: 952  -----------RGLLPYEIKKTVDNILKPLEKRLIRYDTLGRPVSAEDDKLDDYVDQH-- 998
                       + LL  E K+ V++  +   +R+     +  P+     ++     Q   
Sbjct: 915  SGSEIIGDLKLQSLLDEEYKQLVED--RKFLRRIFVDGEVNWPLPVNIRRIIQNAQQTFR 972

Query: 999  -DSERLFYASLREFMTDXXXXXXXXXXXXGLPKLIKKSELEGYDPENEHIDA-IVQHSIT 1056
             D  +    ++R+ +              G  ++IK+++ +        + + +    + 
Sbjct: 973  IDRSKPSDVTIRDVVWGVKELQERLLVVRGNSRIIKEAQEDAITLFCCLMRSRLASRRVI 1032

Query: 1057 QLYRITEDAVQKFLEIAISKYHRAKVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASM 1116
            Q YR+T+ A +  L     ++ R+ V PG  VG + AQSIGEP TQMTL TFHFAGVAS 
Sbjct: 1033 QEYRLTKQAFEWVLNNIEVQFLRSVVHPGEMVGVLAAQSIGEPATQMTLNTFHFAGVASK 1092

Query: 1117 NVTLGVPRIKEIINASKVISTPIINAVLVNN--NDERAARVVKGRIEKTLLSDVC----- 1169
             VT GVPR+KEI+N +K + TP + A L  +   D+  A++++  IE T L  V      
Sbjct: 1093 KVTSGVPRLKEILNVAKNMKTPSLTAYLEPDYAADQEKAKLIRSVIEHTTLKSVTVASEI 1152

Query: 1170 YYIQD----VYKENMAYLQVKVDL--NTIDK---------LQLEL---TIEDIAIAITRA 1211
            YY  D       E+   +Q+   L  +  +K         L+LEL    + D  + + + 
Sbjct: 1153 YYDPDPRSTAIPEDEEIIQLHFSLLDDETEKSLAQQSPWLLRLELDRAAMNDKDLTMGQV 1212

Query: 1212 PKLKIQT--SDVTVLGKDKIAINVLPEGFGSKTSSTSLKEPTENDVFYRMQTLRRALPSI 1269
             +   +T  +D+ V+  +  A  ++      +  S  L+   E D   + +     L +I
Sbjct: 1213 GEKIKETFKNDLFVIWSEDNAEQLIIRCRVVRPKSMDLETEAEEDHMLK-KIENTMLENI 1271

Query: 1270 MVKGLNDIARAVINIRD------DGKRE------LLVEGYGLRDVMCTDGVIGAKTATNH 1317
             ++G+ +I R V+   D       G+ +      L  +G  L +VM   GV  ++  TN 
Sbjct: 1272 TLRGVENIERVVMMKYDRKVPSETGEYQKIPEWVLETDGVNLSEVMTVPGVDASRIYTNS 1331

Query: 1318 VLEIFNVLGIEAARASIIGEIDYTMSNHGMSVDPRHIQLLGDVMTFKGEVLGITRFGLSK 1377
             ++I  VLGIEA RA++  E+   +++ G  V+ RH+ LL DVMT +G +  +TR G ++
Sbjct: 1332 FIDIMEVLGIEAGRAALYKEVFNVIASDGSYVNYRHMALLVDVMTTQGGLTSVTRHGFNR 1391

Query: 1378 MRDSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVV 1430
                 L   SFE+T + LF+A    + D   GVSE +ILGQ   IGTG+F V+
Sbjct: 1392 SNTGALMRCSFEETVEILFEAGASAELDDCRGVSENVILGQMAPIGTGAFDVM 1444

>Ecym_8065 Chr8 (139544..144775) [5232 bp, 1743 aa] {ON} similar to
            Ashbya gossypii ADR086C
          Length = 1743

 Score =  732 bits (1889), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 522/1502 (34%), Positives = 765/1502 (50%), Gaps = 150/1502 (9%)

Query: 11   KRISGLEFSALSPADIVAQSELEISSRDLFDLENNRSPKEGGALDPRMGVSASSMECTTC 70
            + I  ++F   SP ++ A S  +I   +  D E     K GG  DPR+G    + +C TC
Sbjct: 12   RTIKEVQFGLFSPEEVRAISVAKIEFPETMD-ETQMRAKVGGLNDPRLGSIDRNYKCQTC 70

Query: 71   HGNLASCHGHFGHIKLALPVFHVGYFKATIQILQGICKTCSAILLSEQDKRHFLSELRRP 130
               +  C GHFGHI+LA PVFH+G+     ++ + +C  C  +LL E       +EL R 
Sbjct: 71   GEGMNDCPGHFGHIELAKPVFHIGFISKIKKVCECVCMHCGKLLLDE------YNELMRQ 124

Query: 131  GV---DNLRRMALLKKVLDQCKKQRRCLHCXXXXXXXXXXXXXXXXXSLK--IIHDTFRW 185
             +   D  RR      V   CK +  C                    + +  I  D    
Sbjct: 125  AIKIKDPKRR---FNAVWSLCKSKMVCDTEVPSEDDPSKYISRGGCGNAQPSIRKDGLSL 181

Query: 186  VGKKSTPEKDKWIGDWKEVLSHNPELERYVKRATDDLNPLKTLNLFKQIASEDCELLGID 245
            VG   T +KDK   D     S  PE     KR    L+  + LN+FK I  ED   LG +
Sbjct: 182  VG---TWKKDKNSED-----SDQPE-----KRI---LSAEEILNVFKHITPEDSLRLGFN 225

Query: 246  ATNKAGRPETYIWRYIPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIKAGIEK 305
                  RPE  I   +P PP  +RPS+   +S    EDDLT KL +I+  +  ++     
Sbjct: 226  --EDFARPEWMILTVLPVPPPPVRPSISFNES-QRGEDDLTYKLGDILKANINVQRLEIN 282

Query: 306  GISINNMMEHWDYLQMTVAMYINSDSINPAMLPGSSTGGGKVKPIRGFCQRLKGKQGRFR 365
            G   + + E    LQ  VA Y+++D    A  P +    G+  PI+    RLKGK+GR R
Sbjct: 283  GSPQHVIQESESLLQFHVATYMDNDI---AGQPQAVQKSGR--PIKSIRARLKGKEGRIR 337

Query: 366  GNLSGKRVDFSGRTVISPDPNLSIDEVAVPQLVAKVLTFPEKVTRYNIKKLRQLVQNGPN 425
            GNL GKRVDFS RTVIS DPNL +D+V VP+ +AK LT+PE VT YNI +L QLV+NGPN
Sbjct: 338  GNLMGKRVDFSARTVISGDPNLDLDQVGVPKSIAKTLTYPEVVTPYNIDRLTQLVRNGPN 397

Query: 426  VHPGANYLLKKNEEARRNLRYGDRQKLANNLQYGDVVERHLEDGDVVLFNRQPSLHRLSI 485
             HPGA Y+++ N + R +LRY  R      LQYG  VERH+ D D VLFNRQPSLH++S+
Sbjct: 398  EHPGAKYVIRDNGD-RIDLRYSKRAGDIQ-LQYGWKVERHIIDNDPVLFNRQPSLHKMSM 455

Query: 486  LSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNNLLTPK 545
            ++H  K+ P+ TFRLN  V +PYNADFDGDEMNLHVPQ+EE RAE   L  V   +++P+
Sbjct: 456  MAHRVKVMPYSTFRLNLSVTSPYNADFDGDEMNLHVPQSEETRAELSQLCAVPQQIVSPQ 515

Query: 546  SGEPIIAATQDFITGSYLISHKDSFFDKASLTQLLSMMS-----DGSLQFDIPPPAIMKP 600
            S +P +   QD + G   ++ +D+F +   L Q+L+M+      DG     IP P I+KP
Sbjct: 516  SNKPCMGIVQDTLCGIRKMTLRDTFIE---LDQVLNMLYWIPDWDGV----IPKPTILKP 568

Query: 601  CYLWTGKQVFSLLIKPNKNSPVKINLDAKNKVYIPPKQKHYPNEMSQNDGFVIVRGSQIL 660
              LW+GKQ+ S+ I PN    + +    +   Y+ PK          ++G +I+ G QI+
Sbjct: 569  KPLWSGKQLLSMAI-PNG---IHLQRFDEGTTYLSPK----------DNGMLIIDG-QII 613

Query: 661  SGVMDKSVLGDGKKHSVFYTILRDFGPQEAASAMNRMAKLCARYLGNRGFSIGISDVTPA 720
             GV+DK  +G      + + + R+ GPQ  A     + K+   +L + GFSIGI D    
Sbjct: 614  FGVVDKKTVG-SSSGGLIHVVTREKGPQVCAKLFGNIQKVVNYWLLHNGFSIGIGDTIAD 672

Query: 721  DDLKQKKEDLVEIAYAKCDELIDLYNKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGDV 780
            +   ++  + + +A  +  E+        L  + G    ++ E  +   L++ R++ G  
Sbjct: 673  EKTMREITEAIALAKKRVQEVTKEAQANLLTAKHGMTLRESFEDNVVRFLNEARDKAGRS 732

Query: 781  CINELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSK 840
                L +LN    M + GSKGS +N++QM A VGQQ + G R+  GF DR+LPHF K+  
Sbjct: 733  AELNLRDLNNVKQMVSAGSKGSFINIAQMSACVGQQSVEGKRIAFGFADRTLPHFSKDDY 792

Query: 841  TPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 900
            +P+SKGFV NS+  GL+P EF FHA+ GREGL+DTAVKTAETGY+ RRL+K+LED+   Y
Sbjct: 793  SPESKGFVENSYLRGLTPQEFFFHAMGGREGLIDTAVKTAETGYIQRRLVKALEDIMVHY 852

Query: 901  DNTVRTSSNGIVQFTYGGDGLDPLEMEGNAQPV--NFNRSWDHAYNITFNNTDRGLLPYE 958
            D T R S   I+QF YG DG+D   +E  +       + +++  Y I   N + GL P  
Sbjct: 853  DGTTRNSLGNIIQFVYGEDGMDASHIEKQSIDTIPGSDLAFEKRYRIDLLNPEYGLDPSL 912

Query: 959  IKKTVD--------NILKPLEKRLIRYDTLGR----------PVSAEDDKLDDYVDQH-- 998
            ++   +        N+L    K+L++   L R          P+     ++     Q   
Sbjct: 913  LESATEIMGDLKLQNMLDEEYKQLVQDRQLLRSVFLDGEHNWPLPVNIRRIIQNAQQTFR 972

Query: 999  -DSERLFYASLREFMTDXXXXXXXXXXXXGLPKLIKKSELEGYDPENEHIDA-IVQHSIT 1056
             D+ +    ++++ +              G   ++K+++          + + +    + 
Sbjct: 973  IDTTKPTDLTIKDVVLGVRKLQDNLLVLRGSSNILKEAQENAVTLFCSLVRSRLATRRVL 1032

Query: 1057 QLYRITEDAVQKFLEIAISKYHRAKVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASM 1116
              YR+T+   Q  L    +++ R+ V PG  VG + AQSIGEP TQMTL TFHFAGVAS 
Sbjct: 1033 TEYRLTKQTFQWVLNNIEAQFLRSIVHPGEMVGVLAAQSIGEPATQMTLNTFHFAGVASK 1092

Query: 1117 NVTLGVPRIKEIINASKVISTPIINAVLVNN--NDERAARVVKGRIEKTLLSDVCYYIQD 1174
             VT GVPR+KEI+N +K + TP +   L  +   D+  A++++  IE T L  V    + 
Sbjct: 1093 KVTSGVPRLKEILNVAKNMKTPSLTVYLNEDYAADQEKAKLIRSAIEHTTLKSVTVSSEI 1152

Query: 1175 VYKENMAYLQVKVDLNTIDKLQLELTIEDIAIAITRAPKLKIQTSDVTVLGKDKIAINVL 1234
             Y  + +   ++ D   I +L   L  E+   +      LK Q+  +  L  D+ A+N  
Sbjct: 1153 YYDPDPSSTVIEEDEEII-QLHFSLMDEETENS------LKHQSPWLLRLELDRAAMNDK 1205

Query: 1235 PEGFGSKTSSTSLKEPTENDVFY------------RMQTLR------------------- 1263
                G       +KE  +ND+F             R + +R                   
Sbjct: 1206 DLTMGQ--VGEKIKETFKNDLFVIWSEDNAENLIIRCRVVRDPKTLDAEAEAEEDHMLKK 1263

Query: 1264 ---RALPSIMVKGLNDIARAVINIRD------DGKRE------LLVEGYGLRDVMCTDGV 1308
                 L SI ++G+ DI R V+   D       G+        L  +G  L +VM   GV
Sbjct: 1264 IENTMLESITLRGVQDITRVVMMKYDRKVPNETGEYHKVPEWVLETDGVNLSEVMTVPGV 1323

Query: 1309 IGAKTATNHVLEIFNVLGIEAARASIIGEIDYTMSNHGMSVDPRHIQLLGDVMTFKGEVL 1368
               +  TN  ++I NVLGIEA RA++  E+   +++ G  V+ RH+ LL DVMT +G ++
Sbjct: 1324 DPTRIYTNSFIDIMNVLGIEAGRAALYREVYNVIASDGSYVNYRHMALLVDVMTSQGFLM 1383

Query: 1369 GITRFGLSKMRDSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFK 1428
             +TR G ++     L   SFE+T + LF+A    + D   GVSE +ILGQ   IGTG+F 
Sbjct: 1384 SVTRHGFNRADTGALMRCSFEETVEILFEAGASAELDDCNGVSENVILGQMAPIGTGAFD 1443

Query: 1429 VV 1430
            V+
Sbjct: 1444 VM 1445

>KNAG0C03970 Chr3 complement(778936..784101) [5166 bp, 1721 aa] {ON}
            Anc_7.314 YDL140C
          Length = 1721

 Score =  727 bits (1877), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 511/1504 (33%), Positives = 789/1504 (52%), Gaps = 156/1504 (10%)

Query: 11   KRISGLEFSALSPADIVAQSELEISSRDLFDLENNRSPKEGGALDPRMGVSASSMECTTC 70
            + +  ++F   SP ++ A S  +I   +  D    R+ K GG  DPR+G    +++C TC
Sbjct: 12   RTVKEVQFGLFSPEEVRAISVAKIKFPETMDETQTRA-KIGGLNDPRLGSIDRNLKCQTC 70

Query: 71   HGNLASCHGHFGHIKLALPVFHVGYFKATIQILQGICKTCSAILLSEQDK--RHFLSELR 128
               ++ C GHFGHI LA PVFHVG+     ++ + +C  C  +LL E ++  R  ++ ++
Sbjct: 71   QEGMSECPGHFGHIDLAKPVFHVGFITKIKKVCECVCMHCGKLLLDENNEQMRQVMA-IK 129

Query: 129  RPGVDNLRRMALLKKVLDQCKKQRRCLHCXXXXXXXXXXXXXXXXXSLKIIHDTFRWVGK 188
             P        AL       CK +  C                     +   +D  + V +
Sbjct: 130  DPKKRFNATWAL-------CKTKMVC------------------ETDVPSENDPTKLVSR 164

Query: 189  ------KSTPEKD--KWIGDWKEVLSHNPELERYVKRATDDLNPLKTLNLFKQIASEDCE 240
                  + T  KD  K +G WK       E E   +R    L+  + LN+FK I++ED  
Sbjct: 165  GGCGNTQPTVRKDGLKLVGSWKR--KKTIEGEEPEQRV---LSTEEILNIFKHISTEDFI 219

Query: 241  LLGIDATNKAGRPETYIWRYIPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300
             LG +   +  RPE  I   +P PP  +RPS+   +S    EDDLT KL +I+  +  ++
Sbjct: 220  RLGFN--EEFSRPEWMILTVLPVPPPPVRPSISFNES-QRGEDDLTFKLADILKANISLE 276

Query: 301  AGIEKGISINNMMEHWDYLQMTVAMYINSD-SINPAMLPGSSTGGGKVKPIRGFCQRLKG 359
                 G   + + E    LQ  VA Y+++D +  P  L  S       +P++    RLKG
Sbjct: 277  TLEHNGAPHHAIEEAESLLQFHVATYMDNDIAGQPQALQKSG------RPVKSIRARLKG 330

Query: 360  KQGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPQLVAKVLTFPEKVTRYNIKKLRQL 419
            K+GR RGNL GKRVDFS RTVIS DPNL +D+V VP+ +A+ LT+PE VT YNI +L QL
Sbjct: 331  KEGRIRGNLMGKRVDFSARTVISGDPNLELDQVGVPKSIARTLTYPEVVTPYNIDRLTQL 390

Query: 420  VQNGPNVHPGANYLLKKNEEARRNLRYGDRQKLANNLQYGDVVERHLEDGDVVLFNRQPS 479
            V+NGPN HPGA Y++++N + R +LRY  R      LQYG  VERH+ D D VLFNRQPS
Sbjct: 391  VRNGPNEHPGAKYVIRENGD-RIDLRYSKRAGDVQ-LQYGWKVERHIMDDDPVLFNRQPS 448

Query: 480  LHRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKN 539
            LH++S+++H  K+ P+ TFRLN  V +PYNADFDGDEMNLHVPQ+EE RAE   L  V  
Sbjct: 449  LHKMSMMAHKVKVIPYSTFRLNLSVTSPYNADFDGDEMNLHVPQSEETRAELSQLCAVPL 508

Query: 540  NLLTPKSGEPIIAATQDFITGSYLISHKDSFFDKASLTQLLSMMSDGSLQFD--IPPPAI 597
             +++P+S +P +   QD + G  +++ +D+F +   +  +L  + D    +D  IP PAI
Sbjct: 509  QIVSPQSNKPCMGIVQDTLCGIRILTLRDTFLELDHVLNMLYWVPD----WDGVIPTPAI 564

Query: 598  MKPCYLWTGKQVFSLLIKPNKNSPVKINLDAKNKVYIPPKQKHYPNEMSQNDGFVIVRGS 657
            +KP  LWTGKQ+ S+ I PN    + +    +    + PK          ++G +I+ G 
Sbjct: 565  LKPKPLWTGKQILSVAI-PNG---IHLQRFDEGTTLLSPK----------DNGMLIIDG- 609

Query: 658  QILSGVMDKSVLGDGKKHSVFYTILRDFGPQEAASAMNRMAKLCARYLGNRGFSIGISD- 716
            QI+ GV+DK  +G      + + + R+ GPQ  A     + K+   +L + GFS GI D 
Sbjct: 610  QIIFGVVDKKTVGSSSG-GLIHVVTREKGPQTCARLFGNIQKVVNFWLLHNGFSTGIGDT 668

Query: 717  VTPADDLKQKKEDLVEIAYAKCDELIDLYNKGKLETQPGCNEEQTLEAKIGGLLSKVREE 776
            +     +K+  E + E A  K +E+        L  + G    ++ E  +   L++ R++
Sbjct: 669  IADGATIKEITETIAE-AKKKVEEVTKEAQANLLTAKHGMTLRESFEDNVVRFLNEARDK 727

Query: 777  VGDVCINELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFP 836
             G +    L++ N    M + GSKGS +N++QM A VGQQ + G R+  GF DR+LPHF 
Sbjct: 728  AGRLAEVNLNDTNFVKQMVSAGSKGSFINIAQMSACVGQQSVEGKRIGFGFVDRTLPHFS 787

Query: 837  KNSKTPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDL 896
            K+  +P+SKGFV NS+  GL+P EF FHA+ GREGL+DTAVKTAETGY+ RRL+K+LED+
Sbjct: 788  KDDYSPESKGFVENSYLRGLTPQEFFFHAMGGREGLIDTAVKTAETGYIQRRLVKALEDI 847

Query: 897  SCQYDNTVRTSSNGIVQFTYGGDGLDPLEMEGNAQPV--NFNRSWDHAYNITFNNTDRGL 954
               YDNT R S   ++QF YG DG+D   +E  +       + +++  Y I   N    L
Sbjct: 848  MVHYDNTTRNSLGNVIQFIYGEDGIDASYIEKQSLDTIGGSDAAFEKKYRIDLMNVQNSL 907

Query: 955  LPYEIKK--------TVDNILKPLEKRLIRYDTLGR----------PVSAEDDKLDDYVD 996
             P  ++          +  +L    K+L++     R          P+     ++     
Sbjct: 908  DPTLLESGSEITGDLKLQTLLDEEYKQLVKDRAFLRNVFVDGESNWPLPVNIRRIIQNAQ 967

Query: 997  QH---DSERLFYASLREFMTDXXXXXXXXXXXXGLPKLIKKSELEGYDPENEHIDA-IVQ 1052
            Q    D  +    ++R+ +              G  ++I++++ +        + + +  
Sbjct: 968  QTFRIDHSKPSDLTIRDIIDSVNELQSKLLVLRGKSEIIERAQTDAVTLFCCLVRSRLAT 1027

Query: 1053 HSITQLYRITEDAVQKFLEIAISKYHRAKVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAG 1112
              + + YR+T++A    L    +++ R+ V PG  VG + AQSIGEP TQMTL TFHFAG
Sbjct: 1028 RRVLKEYRLTKEAFNWVLNNIEAQFLRSVVHPGEMVGVLAAQSIGEPATQMTLNTFHFAG 1087

Query: 1113 VASMNVTLGVPRIKEIINASKVISTPIINAVLVNN--NDERAARVVKGRIEKTLLSDVC- 1169
            VAS  VT GVPR+KEI+N +K + TP +   L ++  +D+  A++++  IE T L  V  
Sbjct: 1088 VASKKVTSGVPRLKEILNVAKNMKTPSLTVYLKDDYSSDQEKAKLIRSAIEHTTLKSVTV 1147

Query: 1170 ----YYIQD----VYKENMAYLQVKVDL------NTIDK-----LQLEL---TIEDIAIA 1207
                YY  D    V +E+   +Q+   L      +++D+     L+LEL    + D  + 
Sbjct: 1148 ASEIYYDPDPRSTVIEEDEEIIQLHFSLLDDEMESSLDQQSPWLLRLELDRAAMNDKDLT 1207

Query: 1208 ITRAPKLKIQT--SDVTVL----GKDKIAIN---VLPEGFGSKTSSTSLKEPTENDVFYR 1258
            + +  +   +T  +D+ V+      +K+ I    V P+   ++T      E  E+ +  +
Sbjct: 1208 MGQVGERIKETFKNDLFVIWSEDNAEKLIIRCRVVRPKSLDAET------EAEEDHMLKK 1261

Query: 1259 MQTLRRALPSIMVKGLNDIARAVINIRD------DGKRE------LLVEGYGLRDVMCTD 1306
            ++     L +I ++G+ +I R V+   D       G+ +      L  +G  L +VM   
Sbjct: 1262 IENT--MLENITLRGVENIERVVMMKYDRKVPNESGEYQKVPEWVLESDGVNLAEVMQVP 1319

Query: 1307 GVIGAKTATNHVLEIFNVLGIEAARASIIGEIDYTMSNHGMSVDPRHIQLLGDVMTFKGE 1366
            GV   +  TN  ++I  VLGIEA RA++  E+   +++ G  V+ RH+ LL DVMT +G 
Sbjct: 1320 GVDATRIYTNSFIDIMEVLGIEAGRAALYKEVYNVIASDGSYVNYRHMALLVDVMTTQGG 1379

Query: 1367 VLGITRFGLSKMRDSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGS 1426
            +  +TR G ++     L   SFE+T + LF+A    + D   GVSE ++LGQ   IGTG+
Sbjct: 1380 LTSVTRHGFNRSNTGALMRCSFEETVEILFEAGAAAELDDCRGVSENVLLGQMAPIGTGA 1439

Query: 1427 FKVV 1430
            F V+
Sbjct: 1440 FDVM 1443

>TBLA0F02170 Chr6 (535350..540530) [5181 bp, 1726 aa] {ON} Anc_7.314
            YDL140C
          Length = 1726

 Score =  724 bits (1868), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 514/1511 (34%), Positives = 781/1511 (51%), Gaps = 169/1511 (11%)

Query: 11   KRISGLEFSALSPADIVAQSELEISSRDLFDLENNRSPKEGGALDPRMGVSASSMECTTC 70
            + I  ++F   SP +I A S  +I   +  D    R+ K GG  DPR+G    +++C TC
Sbjct: 12   RTIKEVQFGLFSPEEIRAISVAKIRFPETMDETQTRA-KIGGLNDPRLGSIDRNLKCQTC 70

Query: 71   HGNLASCHGHFGHIKLALPVFHVGYFKATIQILQGICKTCSAILLSEQDKRHFLSELRRP 130
               +  C GHFGHI LA PVFH+G+     ++ + IC  C  +LL E +++  + ++ + 
Sbjct: 71   QEGMNECPGHFGHIDLAKPVFHIGFISKIKKVCECICMHCGKLLLDEHNEQ--MRQILKI 128

Query: 131  GVDNLRRMALLKKVLDQCKKQRRCLHCXXXXXXXXXXXXXXXXXSLKIIHDTFRWVGK-- 188
              D+ +R      +   CK +  C                     +   HD  + V +  
Sbjct: 129  K-DSKKR---FNAIWSLCKTKMIC------------------DTDVPSEHDPTQLVSRGG 166

Query: 189  ----KSTPEKD--KWIGDWKEV--LSHNPELERYVKRATDDLNPLKTLNLFKQIASEDCE 240
                + T  KD  K +G WK+    S   E E+ +      L+  + LN+FK I+ ED  
Sbjct: 167  CGNAQPTVRKDGLKLVGSWKKEKNTSDGDEPEQRI------LSTEEILNIFKHISPEDSI 220

Query: 241  LLGIDATNKAGRPETYIWRYIPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300
             +G +   +  RPE      +P PP  +RPS+   +S    EDDLT KL +I+  +  ++
Sbjct: 221  AMGFN--EEFSRPEWMFLTVLPVPPPPVRPSISFNES-QRGEDDLTFKLADILKANISLE 277

Query: 301  AGIEKGISINNMMEHWDYLQMTVAMYINSD-SINPAMLPGSSTGGGKVKPIRGFCQRLKG 359
                 G   + + E    LQ  VA Y+++D +  P  L  S       +P++    RLKG
Sbjct: 278  TLEHNGAPHHAIEEAESLLQFHVATYMDNDIAGQPQALQKSG------RPVKSIRARLKG 331

Query: 360  KQGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPQLVAKVLTFPEKVTRYNIKKLRQL 419
            K+GR RGNL GKRVDFS RTVIS DPNL +D+V VP+ +AK LT+PE VT YNI +L  L
Sbjct: 332  KEGRIRGNLMGKRVDFSARTVISGDPNLELDQVGVPKSIAKTLTYPEVVTPYNIDRLTHL 391

Query: 420  VQNGPNVHPGANYLLKKNEEARRNLRYGDRQKLANNLQYGDVVERHLEDGDVVLFNRQPS 479
            V+NGPN HPGA Y+++ N + R +LRY  R      LQYG  VERH+ D D VLFNRQPS
Sbjct: 392  VRNGPNEHPGAKYVIRDNGD-RIDLRYSKRAGDIQ-LQYGWKVERHIMDNDPVLFNRQPS 449

Query: 480  LHRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKN 539
            LH++S+++H  ++ P+ TFRLN  V +PYNADFDGDEMNLHVPQ+EE RAE   L  V  
Sbjct: 450  LHKMSMMAHRVRVMPFSTFRLNLSVTSPYNADFDGDEMNLHVPQSEETRAELSQLCAVPL 509

Query: 540  NLLTPKSGEPIIAATQDFITGSYLISHKDSFFDKASLTQLLSMMSDGSLQFD--IPPPAI 597
             +++ +S +P +   QD + G   ++ +D+F +   +  LL  + D    +D  IP PAI
Sbjct: 510  QIVSAQSNKPCMGIVQDTLCGIRKLTLRDNFIEFDQVLNLLYWVPD----WDGVIPTPAI 565

Query: 598  MKPCYLWTGKQVFSLLIKPNKNSPVKINLDA--KNKVYIPPKQKHYPNEMSQNDGFVIVR 655
            +KP  LW+GKQ+ S+ I      P  I+L    +   ++ PK          ++G +I+ 
Sbjct: 566  LKPKPLWSGKQILSIAI------PKGIHLQRFDEGTTFLSPK----------DNGMLIID 609

Query: 656  GSQILSGVMDKSVLGDGKKHSVFYTILRDFGPQEAASAMNRMAKLCARYLGNRGFSIGIS 715
            G QI+ GV+DK  +G      + + + R+ GPQ  A   + + K+   +  + GFS GI 
Sbjct: 610  G-QIIFGVVDKKTVGSSSG-GLIHVVTREKGPQICAKLFSNIQKVTNYWFLHNGFSTGIG 667

Query: 716  DVTPADDLKQKKEDLVEIAYAKCDELIDLYNKGKLETQPGCNEEQTLEAKIGGLLSKVRE 775
            D     +  ++    +  A  K +E+        L  + G    ++ E  +   L++ R+
Sbjct: 668  DTIADGETMREITGTIAEAKRKVEEVTKEAQANLLTAKHGMTLRESFEDNVVRFLNEARD 727

Query: 776  EVGDVCINELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHF 835
            + G +    L++ N    M + GSKGS +N++QM A VGQQ + G R+  GF DR+LPHF
Sbjct: 728  KAGRLAEVNLNDTNNVKQMVSAGSKGSFINIAQMSACVGQQSVEGKRIAFGFVDRTLPHF 787

Query: 836  PKNSKTPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLED 895
             K+  +P+SKGFV NS+  GL+P EF FHA+ GREGL+DTAVKTAETGY+ RRL+K+LED
Sbjct: 788  SKDDYSPESKGFVENSYLRGLTPQEFFFHAMGGREGLIDTAVKTAETGYIQRRLVKALED 847

Query: 896  LSCQYDNTVRTSSNGIVQFTYGGDGLDPLEMEGNAQPV--NFNRSWDHAYNITFNNTDRG 953
            +   YD+T R S   ++QF YG DG+D   +E  +       + +++  Y I   NT+  
Sbjct: 848  IMVHYDSTTRNSLGNVIQFVYGEDGIDAGHIEKQSIDTIGGSDAAFEKRYRIDLLNTENS 907

Query: 954  LLPYEIKKTVD--------NILKPLEKRLIRYDTLGRPVSAEDDKLDDYVDQHDSERLFY 1005
            L P  ++   +        N+L    K+L++  T  R V  + +   ++    + +R+  
Sbjct: 908  LNPSLLESGAEISGNLKLQNLLDVEYKQLVKDRTFLRTVFVDGEP--NWPLPVNIKRIVQ 965

Query: 1006 ASLREFMTDXXX---------XXXXXXXXXGLPKLIKKSELEGYDPENEHIDA------- 1049
             + + F  D                      L  L  KSE+     +    DA       
Sbjct: 966  NAQQTFKVDHSKPSDLTIPDIVHGVQDLQEKLLVLRDKSEIM----QKAQSDATTLFCCL 1021

Query: 1050 ----IVQHSITQLYRITEDAVQKFLEIAISKYHRAKVEPGTAVGAIGAQSIGEPGTQMTL 1105
                +    + Q +++ + + Q  L    +++ R+ V PG  VG + AQSIGEP TQMTL
Sbjct: 1022 IRSRLATRRVLQEFKLNKQSFQWVLNNVEAQFLRSVVHPGEMVGVLAAQSIGEPATQMTL 1081

Query: 1106 KTFHFAGVASMNVTLGVPRIKEIINASKVISTPIINAVL--VNNNDERAARVVKGRIEKT 1163
             TFHFAGVAS  VT GVPR+KEI+N +K + TP + A L      D+  A++++  IE T
Sbjct: 1082 NTFHFAGVASKKVTSGVPRLKEILNVAKNMKTPSLTAYLEPAYAADQEKAKLIRSAIEHT 1141

Query: 1164 LLSDVC-----YYIQD----VYKENMAYLQVKVDL------NTIDK-----LQLEL---T 1200
             L  V      YY  D    V  E+   +Q+   L       ++D+     L+LEL    
Sbjct: 1142 TLKSVTVASEIYYDPDPRTTVIAEDEEIMQLHFSLMDEETEKSLDQQSPWLLRLELDRAA 1201

Query: 1201 IEDIAIAITRAPKLKIQT--SDVTVL----GKDKIAIN---VLPEGFGSKTSSTSLKEPT 1251
            + D  + + +  +   +T  +D+ V+      +K+ I    V P+   ++T      E  
Sbjct: 1202 MNDKDLTMGQVGEKIRETFRNDLFVIWSEDNAEKLIIRCRVVRPKALDAET------EAE 1255

Query: 1252 ENDVFYRMQTLRRALPSIMVKGLNDIARAVINIRD------DGKRE------LLVEGYGL 1299
            E+ +  +++     L +I ++G+ +I R V+   D       G  E      L  +G  L
Sbjct: 1256 EDHMLKKIENT--MLENITLRGVENIERVVMMKYDRKIPGTSGAYEKVPEWVLETDGVNL 1313

Query: 1300 RDVMCTDGVIGAKTATNHVLEIFNVLGIEAARASIIGEIDYTMSNHGMSVDPRHIQLLGD 1359
             +VM   GV  ++  TN  ++I  VLGIEA RA++  E+   +++ G  V+ RH+ LL D
Sbjct: 1314 LEVMTVPGVDASRIYTNSFIDITEVLGIEAGRAALYKEVYNVIASDGSYVNYRHMALLVD 1373

Query: 1360 VMTFKGEVLGITRFGLSKMRDSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQT 1419
            VMT  G +  +TR G ++     L   SFE+T + LF+A    + D   GVSE +ILGQ 
Sbjct: 1374 VMTTNGSLTSVTRHGFNRSNTGALMRCSFEETVEILFEAGASAELDDCRGVSENVILGQM 1433

Query: 1420 MSIGTGSFKVV 1430
              IGTGSF V+
Sbjct: 1434 APIGTGSFDVM 1444

>YDL140C Chr4 complement(205360..210561) [5202 bp, 1733 aa] {ON}
            RPO21RNA polymerase II largest subunit B220, part of
            central core; phosphorylation of C-terminal heptapeptide
            repeat domain regulates association with transcription
            and splicing factors; similar to bacterial beta-prime
          Length = 1733

 Score =  724 bits (1869), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 522/1505 (34%), Positives = 780/1505 (51%), Gaps = 157/1505 (10%)

Query: 11   KRISGLEFSALSPADIVAQSELEISSRDLFDLENNRSPKEGGALDPRMGVSASSMECTTC 70
            + +  ++F   SP ++ A S  +I   +  D    R+ K GG  DPR+G    +++C TC
Sbjct: 12   RTVKEVQFGLFSPEEVRAISVAKIRFPETMDETQTRA-KIGGLNDPRLGSIDRNLKCQTC 70

Query: 71   HGNLASCHGHFGHIKLALPVFHVGYFKATIQILQGICKTCSAILLSEQDKRHFLSELRRP 130
               +  C GHFGHI LA PVFHVG+     ++ + +C  C  +LL E +      EL R 
Sbjct: 71   QEGMNECPGHFGHIDLAKPVFHVGFIAKIKKVCECVCMHCGKLLLDEHN------ELMRQ 124

Query: 131  GV---DNLRRMALLKKVLDQCKKQRRCLHCXXXXXXXXXXXXXXXXXSLKIIHDTFRWVG 187
             +   D+ +R A +  +   CK +   + C                        T R  G
Sbjct: 125  ALAIKDSKKRFAAIWTL---CKTK---MVCETDVPSEDDPTQLVSRGGCGNTQPTIRKDG 178

Query: 188  KK--STPEKDKWIGDWKEVLSHNPELERYVKRATDDLNPLKTLNLFKQIASEDCELLGID 245
             K   + +KD+  GD  E     PEL          L+  + LN+FK I+ +D   LG +
Sbjct: 179  LKLVGSWKKDRATGDADE-----PELRV--------LSTEEILNIFKHISVKDFTSLGFN 225

Query: 246  ATNKAGRPETYIWRYIPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIKAGIEK 305
                  RPE  I   +P PP  +RPS+   +S    EDDLT KL +I+  +  ++     
Sbjct: 226  EV--FSRPEWMILTCLPVPPPPVRPSISFNES-QRGEDDLTFKLADILKANISLETLEHN 282

Query: 306  GISINNMMEHWDYLQMTVAMYINSD-SINPAMLPGSSTGGGKVKPIRGFCQRLKGKQGRF 364
            G   + + E    LQ  VA Y+++D +  P  L  S       +P++    RLKGK+GR 
Sbjct: 283  GAPHHAIEEAESLLQFHVATYMDNDIAGQPQALQKSG------RPVKSIRARLKGKEGRI 336

Query: 365  RGNLSGKRVDFSGRTVISPDPNLSIDEVAVPQLVAKVLTFPEKVTRYNIKKLRQLVQNGP 424
            RGNL GKRVDFS RTVIS DPNL +D+V VP+ +AK LT+PE VT YNI +L QLV+NGP
Sbjct: 337  RGNLMGKRVDFSARTVISGDPNLELDQVGVPKSIAKTLTYPEVVTPYNIDRLTQLVRNGP 396

Query: 425  NVHPGANYLLKKNEEARRNLRYGDRQKLANNLQYGDVVERHLEDGDVVLFNRQPSLHRLS 484
            N HPGA Y+++ + + R +LRY  R      LQYG  VERH+ D D VLFNRQPSLH++S
Sbjct: 397  NEHPGAKYVIRDSGD-RIDLRYSKRAGDIQ-LQYGWKVERHIMDNDPVLFNRQPSLHKMS 454

Query: 485  ILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNNLLTP 544
            +++H  K+ P+ TFRLN  V +PYNADFDGDEMNLHVPQ+EE RAE   L  V   +++P
Sbjct: 455  MMAHRVKVIPYSTFRLNLSVTSPYNADFDGDEMNLHVPQSEETRAELSQLCAVPLQIVSP 514

Query: 545  KSGEPIIAATQDFITGSYLISHKDSFFDKASLTQLLSMMS-----DGSLQFDIPPPAIMK 599
            +S +P +   QD + G   ++ +D+F +   L Q+L+M+      DG     IP PAI+K
Sbjct: 515  QSNKPCMGIVQDTLCGIRKLTLRDTFIE---LDQVLNMLYWVPDWDGV----IPTPAIIK 567

Query: 600  PCYLWTGKQVFSLLIKPNKNSPVKINLDAKNKVYIPPKQKHYPNEMSQNDGFVIVRGSQI 659
            P  LW+GKQ+ S+ I PN    + +    +    + PK          ++G +I+ G QI
Sbjct: 568  PKPLWSGKQILSVAI-PNG---IHLQRFDEGTTLLSPK----------DNGMLIIDG-QI 612

Query: 660  LSGVMDKSVLGDGKKHSVFYTILRDFGPQEAASAMNRMAKLCARYLGNRGFSIGISDVTP 719
            + GV++K  +G      + + + R+ GPQ  A     + K+   +L + GFS GI D   
Sbjct: 613  IFGVVEKKTVGSSNG-GLIHVVTREKGPQVCAKLFGNIQKVVNFWLLHNGFSTGIGDTIA 671

Query: 720  ADDLKQKKEDLVEIAYAKCDELIDLYNKGK---LETQPGCNEEQTLEAKIGGLLSKVREE 776
              D    +E    IA AK  +++D+  + +   L  + G    ++ E  +   L++ R++
Sbjct: 672  --DGPTMREITETIAEAK-KKVLDVTKEAQANLLTAKHGMTLRESFEDNVVRFLNEARDK 728

Query: 777  VGDVCINELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFP 836
             G +    L +LN    M   GSKGS +N++QM A VGQQ + G R+  GF DR+LPHF 
Sbjct: 729  AGRLAEVNLKDLNNVKQMVMAGSKGSFINIAQMSACVGQQSVEGKRIAFGFVDRTLPHFS 788

Query: 837  KNSKTPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDL 896
            K+  +P+SKGFV NS+  GL+P EF FHA+ GREGL+DTAVKTAETGY+ RRL+K+LED+
Sbjct: 789  KDDYSPESKGFVENSYLRGLTPQEFFFHAMGGREGLIDTAVKTAETGYIQRRLVKALEDI 848

Query: 897  SCQYDNTVRTSSNGIVQFTYGGDGLDPLEMEGNAQPV--NFNRSWDHAYNITFNNTDRGL 954
               YDNT R S   ++QF YG DG+D   +E  +       + +++  Y +   NTD  L
Sbjct: 849  MVHYDNTTRNSLGNVIQFIYGEDGMDAAHIEKQSLDTIGGSDAAFEKRYRVDLLNTDHTL 908

Query: 955  LPYEIKKTVDNILKPLEKRLIRYDTLGRPVSAEDDKLDDYVDQH-------DSERLFYAS 1007
             P  + ++   IL  L+ +++  +   + V       + +VD         +  R+   +
Sbjct: 909  DP-SLLESGSEILGDLKLQVLLDEEYKQLVKDRKFLREVFVDGEANWPLPVNIRRIIQNA 967

Query: 1008 LREFMTDXXXXXXXXXXXXGLPKLIKKSELEGYDPENEHIDAIVQHSIT----------- 1056
             + F  D             L     +  L     +NE I    + ++T           
Sbjct: 968  QQTFHIDHTKPSDLTIKDIVLGVKDLQENLLVLRGKNEIIQNAQRDAVTLFCCLLRSRLA 1027

Query: 1057 -----QLYRITEDAVQKFLEIAISKYHRAKVEPGTAVGAIGAQSIGEPGTQMTLKTFHFA 1111
                 Q YR+T+ A    L    +++ R+ V PG  VG + AQSIGEP TQMTL TFHFA
Sbjct: 1028 TRRVLQEYRLTKQAFDWVLSNIEAQFLRSVVHPGEMVGVLAAQSIGEPATQMTLNTFHFA 1087

Query: 1112 GVASMNVTLGVPRIKEIINASKVISTPIINAVLVNNN--DERAARVVKGRIEKTLLSDVC 1169
            GVAS  VT GVPR+KEI+N +K + TP +   L   +  D+  A++++  IE T L  V 
Sbjct: 1088 GVASKKVTSGVPRLKEILNVAKNMKTPSLTVYLEPGHAADQEQAKLIRSAIEHTTLKSVT 1147

Query: 1170 -----YYIQD----VYKENMAYLQVKVDL------NTIDK-----LQLEL---TIEDIAI 1206
                 YY  D    V  E+   +Q+   L       + D+     L+LEL    + D  +
Sbjct: 1148 IASEIYYDPDPRSTVIPEDEEIIQLHFSLLDEEAEQSFDQQSPWLLRLELDRAAMNDKDL 1207

Query: 1207 AITRAPKLKIQT--SDVTVL----GKDKIAIN---VLPEGFGSKTSSTSLKEPTENDVFY 1257
             + +  +   QT  +D+ V+      +K+ I    V P+   ++T      E  E+ +  
Sbjct: 1208 TMGQVGERIKQTFKNDLFVIWSEDNDEKLIIRCRVVRPKSLDAET------EAEEDHMLK 1261

Query: 1258 RMQTLRRALPSIMVKGLNDIARAVINIRD------------DGKRELLVEGYGLRDVMCT 1305
            +++     L +I ++G+ +I R V+   D            + +  L  +G  L +VM  
Sbjct: 1262 KIENT--MLENITLRGVENIERVVMMKYDRKVPSPTGEYVKEPEWVLETDGVNLSEVMTV 1319

Query: 1306 DGVIGAKTATNHVLEIFNVLGIEAARASIIGEIDYTMSNHGMSVDPRHIQLLGDVMTFKG 1365
             G+   +  TN  ++I  VLGIEA RA++  E+   +++ G  V+ RH+ LL DVMT +G
Sbjct: 1320 PGIDPTRIYTNSFIDIMEVLGIEAGRAALYKEVYNVIASDGSYVNYRHMALLVDVMTTQG 1379

Query: 1366 EVLGITRFGLSKMRDSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTG 1425
             +  +TR G ++     L   SFE+T + LF+A    + D   GVSE +ILGQ   IGTG
Sbjct: 1380 GLTSVTRHGFNRSNTGALMRCSFEETVEILFEAGASAELDDCRGVSENVILGQMAPIGTG 1439

Query: 1426 SFKVV 1430
            +F V+
Sbjct: 1440 AFDVM 1444

>Smik_4.95 Chr4 complement(182198..187357) [5160 bp, 1719 aa] {ON}
            YDL140C (REAL)
          Length = 1719

 Score =  723 bits (1866), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 522/1505 (34%), Positives = 781/1505 (51%), Gaps = 157/1505 (10%)

Query: 11   KRISGLEFSALSPADIVAQSELEISSRDLFDLENNRSPKEGGALDPRMGVSASSMECTTC 70
            + +  ++F   SP ++ A S  +I   +  D    R+ K GG  DPR+G    +++C TC
Sbjct: 12   RTVKEVQFGLFSPEEVRAISVAKIRFPETMDETQTRA-KIGGLNDPRLGSIDRNLKCQTC 70

Query: 71   HGNLASCHGHFGHIKLALPVFHVGYFKATIQILQGICKTCSAILLSEQDKRHFLSELRRP 130
               +  C GHFGHI LA PVFHVG+     ++ + +C  C  +LL E +      EL R 
Sbjct: 71   QEGMNECPGHFGHIDLAKPVFHVGFIAKIKKVCECVCMHCGKLLLDEHN------ELMRQ 124

Query: 131  GV---DNLRRMALLKKVLDQCKKQRRCLHCXXXXXXXXXXXXXXXXXSLKIIHDTFRWVG 187
             +   D+ +R A +  +   CK +   + C                        T R  G
Sbjct: 125  ALAIKDSKKRFAAIWTL---CKTK---MVCETDVPSEDDPTQLVSRGGCGNTQPTVRKDG 178

Query: 188  KK--STPEKDKWIGDWKEVLSHNPELERYVKRATDDLNPLKTLNLFKQIASEDCELLGID 245
             K   + +KD+  GD +E     PEL          L+  + LN+FK I+ +D   LG +
Sbjct: 179  LKLVGSWKKDRASGDAEE-----PELRV--------LSTEEILNIFKHISVKDFTSLGFN 225

Query: 246  ATNKAGRPETYIWRYIPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIKAGIEK 305
                  RPE  I   +P PP  +RPS+   +S    EDDLT KL +I+  +  ++     
Sbjct: 226  EV--FSRPEWMILTCLPVPPPPVRPSISFNES-QRGEDDLTFKLADILKANISLETLEHN 282

Query: 306  GISINNMMEHWDYLQMTVAMYINSD-SINPAMLPGSSTGGGKVKPIRGFCQRLKGKQGRF 364
            G   + + E    LQ  VA Y+++D +  P  L  S       +P++    RLKGK+GR 
Sbjct: 283  GAPHHAIEEAESLLQFHVATYMDNDIAGQPQALQKSG------RPVKSIRARLKGKEGRI 336

Query: 365  RGNLSGKRVDFSGRTVISPDPNLSIDEVAVPQLVAKVLTFPEKVTRYNIKKLRQLVQNGP 424
            RGNL GKRVDFS RTVIS DPNL +D+V VP+ +AK LT+PE VT YNI +L QLV+NGP
Sbjct: 337  RGNLMGKRVDFSARTVISGDPNLELDQVGVPKSIAKTLTYPEVVTPYNIDRLTQLVRNGP 396

Query: 425  NVHPGANYLLKKNEEARRNLRYGDRQKLANNLQYGDVVERHLEDGDVVLFNRQPSLHRLS 484
            N HPGA Y+++ + + R +LRY  R      LQYG  VERH+ D D VLFNRQPSLH++S
Sbjct: 397  NEHPGAKYVIRDSGD-RIDLRYSKRAGDIQ-LQYGWKVERHIMDNDPVLFNRQPSLHKMS 454

Query: 485  ILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNNLLTP 544
            +++H  K+ P+ TFRLN  V +PYNADFDGDEMNLHVPQ+EE RAE   L  V   +++P
Sbjct: 455  MMAHRVKVIPYSTFRLNLSVTSPYNADFDGDEMNLHVPQSEETRAELSQLCAVPLQIVSP 514

Query: 545  KSGEPIIAATQDFITGSYLISHKDSFFDKASLTQLLSMMS-----DGSLQFDIPPPAIMK 599
            +S +P +   QD + G   ++ +D+F +   L Q+L+M+      DG     IP PAI+K
Sbjct: 515  QSNKPCMGIVQDTLCGIRKLTLRDTFIE---LDQVLNMLYWVPDWDGV----IPTPAIIK 567

Query: 600  PCYLWTGKQVFSLLIKPNKNSPVKINLDAKNKVYIPPKQKHYPNEMSQNDGFVIVRGSQI 659
            P  LW+GKQ+ S+ I PN    + +    +    + PK          ++G +I+ G QI
Sbjct: 568  PKPLWSGKQILSVAI-PNG---IHLQRFDEGTTLLSPK----------DNGMLIIDG-QI 612

Query: 660  LSGVMDKSVLGDGKKHSVFYTILRDFGPQEAASAMNRMAKLCARYLGNRGFSIGISDVTP 719
            + GV++K  +G      + + + R+ GPQ  A     + K+   +L + GFS GI D   
Sbjct: 613  IFGVVEKKTVGSSNG-GLIHVVTREKGPQVCAKLFGNIQKVVNFWLLHNGFSTGIGDTIA 671

Query: 720  ADDLKQKKEDLVEIAYAKCDELIDLYNKGK---LETQPGCNEEQTLEAKIGGLLSKVREE 776
              D    +E    IA AK  +++D+  + +   L  + G    ++ E  +   L++ R++
Sbjct: 672  --DGPTMREITETIAEAK-KKVLDVTKEAQANLLTAKHGMTLRESFEDNVVRFLNEARDK 728

Query: 777  VGDVCINELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFP 836
             G +    L +LN    M   GSKGS +N++QM A VGQQ + G R+  GF DR+LPHF 
Sbjct: 729  AGRLAEVNLKDLNNVKQMVMAGSKGSFINIAQMSACVGQQSVEGKRIAFGFVDRTLPHFS 788

Query: 837  KNSKTPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDL 896
            K+  +P+SKGFV NS+  GL+P EF FHA+ GREGL+DTAVKTAETGY+ RRL+K+LED+
Sbjct: 789  KDDYSPESKGFVENSYLRGLTPQEFFFHAMGGREGLIDTAVKTAETGYIQRRLVKALEDI 848

Query: 897  SCQYDNTVRTSSNGIVQFTYGGDGLDPLEMEGNAQPV--NFNRSWDHAYNITFNNTDRGL 954
               YDNT R S   ++QF YG DG+D   +E  +       + +++  Y I   NT+  L
Sbjct: 849  MVHYDNTTRNSLGNVIQFIYGEDGMDAAHIEKQSLDTIGGSDAAFEKRYRIDLLNTEHIL 908

Query: 955  LPYEIKKTVDNILKPLEKRLIRYDTLGRPVSAEDDKLDDYVDQHDS-------ERLFYAS 1007
             P  + ++   IL  L+ +++  +   + V       + +VD   +        R+   +
Sbjct: 909  DP-SLLESGSEILGDLKLQVLLDEEYKQLVKDRKFLREVFVDGEANWPLPVNIRRIIQNA 967

Query: 1008 LREFMTDXXXXXXXXXXXXGLPKLIKKSELEGYDPENEHIDAIVQHSIT----------- 1056
             + F  D             L     +  L     +NE I    + ++T           
Sbjct: 968  QQTFHIDHTKPSDLTIKDIVLGVKDLQGSLLVLRGKNEIIQNAQRDAVTLFCCLLRSRLA 1027

Query: 1057 -----QLYRITEDAVQKFLEIAISKYHRAKVEPGTAVGAIGAQSIGEPGTQMTLKTFHFA 1111
                 Q YR+T+ A    L    +++ R+ V PG  VG + AQSIGEP TQMTL TFHFA
Sbjct: 1028 TRRVLQEYRLTKQAFDWVLSNIEAQFLRSVVHPGEMVGVLAAQSIGEPATQMTLNTFHFA 1087

Query: 1112 GVASMNVTLGVPRIKEIINASKVISTPIINAVLVNNN--DERAARVVKGRIEKTLLSDVC 1169
            GVAS  VT GVPR+KEI+N +K + TP +   L   +  D+  A++++  IE T L  V 
Sbjct: 1088 GVASKKVTSGVPRLKEILNVAKNMKTPSLTVYLEPGHAADQEQAKLIRSAIEHTTLKSVT 1147

Query: 1170 -----YYIQD----VYKENMAYLQVKVDL------NTIDK-----LQLEL---TIEDIAI 1206
                 YY  D    V  E+   +Q+   L       + D+     L+LEL    + D  +
Sbjct: 1148 IASEIYYDPDPRSTVIPEDEEIIQLHFSLLDDEAEQSFDQQSPWLLRLELDRAAMNDKDL 1207

Query: 1207 AITRAPKLKIQT--SDVTVL----GKDKIAIN---VLPEGFGSKTSSTSLKEPTENDVFY 1257
             + +  +   QT  +D+ V+      +K+ I    V P+   ++T      E  E+ +  
Sbjct: 1208 TMGQVGERIKQTFKNDLFVIWSEDNDEKLIIRCRVVRPKSLDAET------EAEEDHMLK 1261

Query: 1258 RMQTLRRALPSIMVKGLNDIARAVINIRD------------DGKRELLVEGYGLRDVMCT 1305
            +++     L +I ++G+ +I R V+   D            + +  L  +G  L +VM  
Sbjct: 1262 KIENT--MLENITLRGVENIERVVMMKYDRKVPSPTGEYVKEPEWVLETDGVNLSEVMTV 1319

Query: 1306 DGVIGAKTATNHVLEIFNVLGIEAARASIIGEIDYTMSNHGMSVDPRHIQLLGDVMTFKG 1365
             G+   +  TN  ++I  VLGIEA RA++  E+   +++ G  V+ RH+ LL DVMT +G
Sbjct: 1320 PGIDATRIYTNSFIDIMEVLGIEAGRAALYKEVYNVIASDGSYVNYRHMALLVDVMTTQG 1379

Query: 1366 EVLGITRFGLSKMRDSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTG 1425
             +  +TR G ++     L   SFE+T + LF+A    + D   GVSE +ILGQ   IGTG
Sbjct: 1380 GLTSVTRHGFNRSNTGALMRCSFEETVEILFEAGASAELDDCRGVSENVILGQMAPIGTG 1439

Query: 1426 SFKVV 1430
            +F V+
Sbjct: 1440 AFDVM 1444

>Suva_4.104 Chr4
            complement(193257..193711,193754..193782,194161..198878)
            [5202 bp, 1733 aa] {ON} YDL140C (REAL)
          Length = 1733

 Score =  720 bits (1858), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 516/1504 (34%), Positives = 774/1504 (51%), Gaps = 155/1504 (10%)

Query: 11   KRISGLEFSALSPADIVAQSELEISSRDLFDLENNRSPKEGGALDPRMGVSASSMECTTC 70
            + +  ++F   SP ++ A S  +I   +  D    R+ K GG  DPR+G    +++C TC
Sbjct: 12   RTVKEVQFGLFSPEEVRAISVAKIRFPETMDETQTRA-KIGGLNDPRLGSIDRNLKCQTC 70

Query: 71   HGNLASCHGHFGHIKLALPVFHVGYFKATIQILQGICKTCSAILLSEQDKRHFLSELRRP 130
               +  C GHFGHI LA PVFHVG+     ++ + +C  C  +LL E +      EL R 
Sbjct: 71   QEGMNECPGHFGHIDLAKPVFHVGFIAKIKKVCECVCMHCGKLLLDEHN------ELMRQ 124

Query: 131  GV---DNLRRMALLKKVLDQCKKQRRCLHCXXXXXXXXXXXXXXXXXSLKIIHDTFRWVG 187
             +   D  +R   +  +   CK +   + C                        T R  G
Sbjct: 125  ALAIKDTKKRFGAIWTL---CKTK---MVCETDVPSENDPTQLVSRGGCGNTQPTVRKDG 178

Query: 188  KK--STPEKDKWIGDWKEVLSHNPELERYVKRATDDLNPLKTLNLFKQIASEDCELLGID 245
             K   + +KD+  GD  E     PEL          L+  + LN+FK I+++D   LG +
Sbjct: 179  LKLVGSWKKDRATGDADE-----PELRV--------LSTEEILNIFKHISAKDSSSLGFN 225

Query: 246  ATNKAGRPETYIWRYIPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIKAGIEK 305
                  RPE  I   +P PP  +RPS+   +S    EDDLT KL +I+  +  ++     
Sbjct: 226  EV--FSRPEWMILTCLPVPPPPVRPSISFNES-QRGEDDLTFKLADILKANISLETLEHN 282

Query: 306  GISINNMMEHWDYLQMTVAMYINSD-SINPAMLPGSSTGGGKVKPIRGFCQRLKGKQGRF 364
            G   + + E    LQ  VA Y+++D +  P  L  S       +P++    RLKGK+GR 
Sbjct: 283  GAPHHAIEEAESLLQFHVATYMDNDIAGQPQALQKSG------RPVKSIRARLKGKEGRI 336

Query: 365  RGNLSGKRVDFSGRTVISPDPNLSIDEVAVPQLVAKVLTFPEKVTRYNIKKLRQLVQNGP 424
            RGNL GKRVDFS RTVIS DPNL +D+V VP+ +AK LT+PE VT YNI +L QLV+NGP
Sbjct: 337  RGNLMGKRVDFSARTVISGDPNLELDQVGVPKSIAKTLTYPEVVTPYNIDRLTQLVRNGP 396

Query: 425  NVHPGANYLLKKNEEARRNLRYGDRQKLANNLQYGDVVERHLEDGDVVLFNRQPSLHRLS 484
            N HPGA Y+++ + + R +LRY  R      LQYG  VERH+ D D VLFNRQPSLH++S
Sbjct: 397  NEHPGAKYVIRDSGD-RIDLRYSKRAGDIQ-LQYGWKVERHIMDNDPVLFNRQPSLHKMS 454

Query: 485  ILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNNLLTP 544
            +++H  K+ P+ TFRLN  V +PYNADFDGDEMNLHVPQ+EE RAE   L  V   +++P
Sbjct: 455  MMAHRVKVIPYSTFRLNLSVTSPYNADFDGDEMNLHVPQSEETRAELSQLCAVPLQIVSP 514

Query: 545  KSGEPIIAATQDFITGSYLISHKDSFFDKASLTQLLSMMS-----DGSLQFDIPPPAIMK 599
            +S +P +   QD + G   ++ +D+F +   L Q+L+M+      DG     IP PAI+K
Sbjct: 515  QSNKPCMGIVQDTLCGIRKLTLRDTFIE---LDQVLNMLYWVPDWDGV----IPTPAIIK 567

Query: 600  PCYLWTGKQVFSLLIKPNKNSPVKINLDAKNKVYIPPKQKHYPNEMSQNDGFVIVRGSQI 659
            P  LW+GKQV S+ I PN    + +    +    + PK          ++G +I+ G QI
Sbjct: 568  PKPLWSGKQVLSVAI-PNG---IHLQRFDEGTTLLSPK----------DNGMLIIDG-QI 612

Query: 660  LSGVMDKSVLGDGKKHSVFYTILRDFGPQEAASAMNRMAKLCARYLGNRGFSIGISDVTP 719
            + GV++K  +G      + + + R+ GPQ  A     + K+   +L + GFS GI D   
Sbjct: 613  VFGVVEKKTVGSSNG-GLIHVVTREKGPQVCAKLFGNIQKVVNFWLLHNGFSTGIGDTIA 671

Query: 720  ADDLKQKKEDLVEIAYAKCDELIDLYNKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGD 779
                 ++  + +  A  K  ++        L  + G    ++ E  +   L++ R++ G 
Sbjct: 672  DGPTMREITETIADAKKKVFDVTKEAQANLLTAKHGMTLRESFEDNVVRFLNEARDKAGR 731

Query: 780  VCINELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNS 839
            +    L +LN    M   GSKGS +N++QM A VGQQ + G R+  GF DR+LPHF K+ 
Sbjct: 732  LAEVNLKDLNNVKQMVMAGSKGSFINIAQMSACVGQQSVEGKRIAYGFVDRTLPHFSKDD 791

Query: 840  KTPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQ 899
             +P+SKGFV NS+  GL+P EF FHA+ GREGL+DTAVKTAETGY+ RRL+K+LED+   
Sbjct: 792  YSPESKGFVENSYLRGLTPQEFFFHAMGGREGLIDTAVKTAETGYIQRRLVKALEDIMVH 851

Query: 900  YDNTVRTSSNGIVQFTYGGDGLDPLEMEGNAQPV--NFNRSWDHAYNITFNNTDRGLLPY 957
            YDNT R S   ++QF YG DG+D   +E  +       + +++  Y I   N D  L P 
Sbjct: 852  YDNTTRNSLGNVIQFIYGEDGMDASHIEKQSLDTIGGSDAAFEKRYRIDLLNPDHILDP- 910

Query: 958  EIKKTVDNILKPLE---------KRLIRYDTLGRPVSAEDDKLDDYVDQHDSERLFYASL 1008
             + ++   IL  L+         K+L++  +  R +  + +   ++    +  R+   + 
Sbjct: 911  SLLESGSEILGDLKLQVLLDEEYKQLVKDRSFLRHIFVDGEA--NWPLPVNIRRIIQNAQ 968

Query: 1009 REFMTDXXXXXXXXXXXXGLPKLIKKSELEGYDPENEHIDAIVQHSIT------------ 1056
            + F  D             +     +  L     +NE I    Q ++T            
Sbjct: 969  QTFHIDHTKPSDLTIKDIVIGVKDLQENLLVLRGKNEIIQNAQQDAVTLFCCLLRSRLAS 1028

Query: 1057 ----QLYRITEDAVQKFLEIAISKYHRAKVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAG 1112
                Q Y++T+ A +  L    +++ R+ V PG  VG + AQSIGEP TQMTL TFHFAG
Sbjct: 1029 RRVIQEYKLTKQAFEWVLSNIEAQFLRSVVHPGEMVGVLAAQSIGEPATQMTLNTFHFAG 1088

Query: 1113 VASMNVTLGVPRIKEIINASKVISTPIINAVLVNNN--DERAARVVKGRIEKTLLSDVC- 1169
            VAS  VT GVPR+KEI+N +K + TP +   L   +  D+  A+ ++  IE T L  V  
Sbjct: 1089 VASKKVTSGVPRLKEILNVAKNMKTPSLTVYLEPGHAADQEKAKFIRSAIEHTTLKSVTI 1148

Query: 1170 ----YYIQD----VYKENMAYLQVKVDL------NTIDK-----LQLEL---TIEDIAIA 1207
                YY  D    V  E+   +Q+   L       + D+     L+LEL    + D  + 
Sbjct: 1149 ASEIYYDPDPRSTVIPEDEEIIQLHFSLLDDEAEQSFDQQSPWLLRLELDRAAMNDKDLT 1208

Query: 1208 ITRAPKLKIQT--SDVTVL----GKDKIAIN---VLPEGFGSKTSSTSLKEPTENDVFYR 1258
            + +  +   QT  +D+ V+      +K+ I    V P+   ++T      E  E+ +  +
Sbjct: 1209 MGQVGERIKQTFKNDLFVIWSEDNDEKLIIRCRVVRPKSLDAET------EAEEDHMLKK 1262

Query: 1259 MQTLRRALPSIMVKGLNDIARAVINIRD------------DGKRELLVEGYGLRDVMCTD 1306
            ++     L +I ++G+ +I R V+   D            + +  L  +G  L +VM   
Sbjct: 1263 IENT--MLENITLRGVENIERVVMMKYDRKVPSPTGEYIKEPEWVLETDGVNLSEVMTVP 1320

Query: 1307 GVIGAKTATNHVLEIFNVLGIEAARASIIGEIDYTMSNHGMSVDPRHIQLLGDVMTFKGE 1366
            G+   +  TN  ++I  VLGIEA RA++  E+   +++ G  V+ RH+ LL DVMT +G 
Sbjct: 1321 GIDPTRIYTNSFIDIMEVLGIEAGRAALYKEVYNVIASDGSYVNYRHMALLVDVMTTQGG 1380

Query: 1367 VLGITRFGLSKMRDSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGS 1426
            +  +TR G ++     L   SFE+T + LF+A    + D   GVSE +ILGQ   IGTG+
Sbjct: 1381 LTSVTRHGFNRSNTGALMRCSFEETVEILFEAGASAELDDCRGVSENVILGQMAPIGTGA 1440

Query: 1427 FKVV 1430
            F V+
Sbjct: 1441 FDVM 1444

>KLLA0F05071g Chr6 complement(496371..501533) [5163 bp, 1720 aa] {ON}
            highly similar to uniprot|P04050 Saccharomyces cerevisiae
            YDL140C
          Length = 1720

 Score =  719 bits (1857), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 519/1504 (34%), Positives = 768/1504 (51%), Gaps = 154/1504 (10%)

Query: 11   KRISGLEFSALSPADIVAQSELEISSRDLFDLENNRSPKEGGALDPRMGVSASSMECTTC 70
            + I  ++F   SP ++   S  +I   +  D E+    K GG  DPR+G    + +C TC
Sbjct: 12   RTIKEVQFGLFSPEEVRGISVAKIEFPETMD-ESQMKAKIGGLNDPRLGSIDRNYKCQTC 70

Query: 71   HGNLASCHGHFGHIKLALPVFHVGYFKATIQILQGICKTCSAILLSEQDKRHFLSELRRP 130
               +A C GHFGHI+LA PVFH+G+     ++ + +C  C  +LL E       +E  R 
Sbjct: 71   GEGMAECPGHFGHIELAKPVFHIGFLSKIKKVCESVCMHCGKLLLDE------YNEQMRQ 124

Query: 131  GV---DNLRRMALLKKVLDQCKKQRRCLHCXXXXXXXXXXXXXXXXXSLK--IIHDTFRW 185
             +   D  RR      V   CK +  C                     ++  I  D    
Sbjct: 125  AIKIKDPKRR---FNAVWTLCKAKMVCETEVPSPDDPTVFLSRGGCGHIQPSIRKDGLSL 181

Query: 186  VGKKSTPEKDKWIGDWKEVLSHNPELERYVKRATDDLNPLKTLNLFKQIASEDCELLGID 245
            VG   T +KDK   D     S  PE     KR    ++  + LN+FK I+ ED   LG +
Sbjct: 182  VG---TWKKDKNADD-----SDQPE-----KRI---ISAEEILNVFKHISPEDGWRLGFN 225

Query: 246  ATNKAGRPETYIWRYIPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIKAGIEK 305
                  RPE  I   +P PP  +RPS+   +S    EDDLT KL +I+  +  ++     
Sbjct: 226  --EDFSRPEWMILTVLPVPPPPVRPSISFNES-QRGEDDLTYKLGDILKANINVQKLEIN 282

Query: 306  GISINNMMEHWDYLQMTVAMYINSDSINPAMLPGSSTGGGKVKPIRGFCQRLKGKQGRFR 365
            G   + + E    LQ  VA Y+++D    A  P +    G+  PI+    RLKGK+GR R
Sbjct: 283  GSPQHVIQESESLLQFHVATYMDNDI---AGQPQAVQKSGR--PIKSIRARLKGKEGRIR 337

Query: 366  GNLSGKRVDFSGRTVISPDPNLSIDEVAVPQLVAKVLTFPEKVTRYNIKKLRQLVQNGPN 425
            GNL GKRVDFS RTVIS DPNL +D+V VP+ +AK LT+PE VT YNI +L QLV+NGPN
Sbjct: 338  GNLMGKRVDFSARTVISGDPNLDLDQVGVPKSIAKTLTYPEVVTPYNIDRLTQLVRNGPN 397

Query: 426  VHPGANYLLKKNEEARRNLRYGDRQKLANNLQYGDVVERHLEDGDVVLFNRQPSLHRLSI 485
             HPGA Y+++++ + R +LRY  R      LQYG  VERH+ D D VLFNRQPSLH++S+
Sbjct: 398  EHPGAKYVIRESGD-RIDLRYSKRAGDIQ-LQYGWKVERHITDNDPVLFNRQPSLHKMSM 455

Query: 486  LSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNNLLTPK 545
            ++H  K+ P+ TFRLN  V +PYNADFDGDEMNLHVPQ+EE RAE   L  V   +++P+
Sbjct: 456  MAHRVKVMPYSTFRLNLSVTSPYNADFDGDEMNLHVPQSEETRAELSQLCAVPLQIVSPQ 515

Query: 546  SGEPIIAATQDFITGSYLISHKDSFFDKASLTQLLSMMSDGSLQFD--IPPPAIMKPCYL 603
            S +P +   QD + G   ++ +D+F +   +  +L  + D    +D  IP PAI+KP  L
Sbjct: 516  SNKPCMGIVQDTLCGIRKMTLRDTFIELDQVLNMLYWIPD----WDGIIPTPAILKPVPL 571

Query: 604  WTGKQVFSLLIKPNKNSPVKINLDAKNKVYIPPKQKHYPNEMSQNDGFVIVRGSQILSGV 663
            W+GKQV S+ I PN    + +        ++ PK          ++G +I+ G +I+ GV
Sbjct: 572  WSGKQVLSMAI-PNG---IHLQRFDDGTTFLSPK----------DNGMLIIDG-KIIFGV 616

Query: 664  MDKSVLGDGKKHSVFYTILRDFGPQEAASAMNRMAKLCARYLGNRGFSIGISDVTPADDL 723
            +DK  +G      + + + R+ GP+  A   + + K+   +L + GFSIGI D    +  
Sbjct: 617  VDKKTVGSSSG-GLIHVVTREKGPEICARLFSNIQKVVNYWLLHNGFSIGIGDTIADEKT 675

Query: 724  KQKKEDLVEIAYAKCDELIDLYNKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGDVCIN 783
             ++  + + +A  K +++        L  + G    ++ E  +   L++ R++ G     
Sbjct: 676  MREITEAIAVAKKKVEDVTKEAQANLLTAKHGMTLRESFEDNVVRYLNEARDKAGRSAEV 735

Query: 784  ELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSKTPQ 843
             L +LN    M + GSKGS +N++QM A VGQQ + G R+  GF DR+LPHF K+  +P+
Sbjct: 736  NLKDLNNVKQMVSAGSKGSFINIAQMSACVGQQSVEGKRIAFGFADRTLPHFSKDDYSPE 795

Query: 844  SKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYDNT 903
            SKGFV NS+  GL+P EF FHA+ GREGL+DTAVKTAETGY+ RRL+K+LED+   YD T
Sbjct: 796  SKGFVENSYLRGLTPQEFFFHAMGGREGLIDTAVKTAETGYIQRRLVKALEDIMVHYDGT 855

Query: 904  VRTSSNGIVQFTYGGDGLDPLEMEGNAQPV--NFNRSWDHAYNITFNNTDRGLLPYEIKK 961
             R S   ++QF YG DG+D   +E  +       + +++  Y I   N +  L P  + +
Sbjct: 856  TRNSLGNVIQFIYGEDGMDAAHIEKQSIDTIPGSDSAFERRYRIDLLNEEYALDP-SLLE 914

Query: 962  TVDNILKPLEKRLIRYDTLGRPVSAEDDKLDDYVD-QHDS------ERLFYASLREFMTD 1014
            +   I+   + +L+  D   + V         +VD +H+       +R+   S + F  D
Sbjct: 915  SGSEIIGDSKLQLLLNDEYKQLVDDRQILRRVFVDGEHNWPLPVNIKRIIQNSQQTFRID 974

Query: 1015 XXXXX--XXXXXXXGLPKLIKKSELEGYDPENEHIDAIVQHSIT---------------- 1056
                          G+ KL +K  L     +++ +    Q++IT                
Sbjct: 975  QTKPTDLTIEDVISGVRKLQEK--LLVVRGKSDILKEAQQNAITLFCCLLRSRLATRRVI 1032

Query: 1057 QLYRITEDAVQKFLEIAISKYHRAKVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASM 1116
            + YR+        L    +++ R+ V PG  VG + AQSIGEP TQMTL TFHFAGVAS 
Sbjct: 1033 EEYRLNRQTFDWVLNNIEAQFLRSIVHPGEMVGVLAAQSIGEPATQMTLNTFHFAGVASK 1092

Query: 1117 NVTLGVPRIKEIINASKVISTPIINAVLVNN--NDERAARVVKGRIEKTLLSDVCYYIQD 1174
             VT GVPR+KEI+N +K + TP +   L      D+  A+ ++  IE T L  V     +
Sbjct: 1093 KVTSGVPRLKEILNVAKNMKTPSLTVYLDPEYAADQEKAKEIRSAIEHTTLKSVT-VASE 1151

Query: 1175 VYKENMAYLQVKVDLNTIDKLQLELTIEDIAIAIT-RAPK-LKIQTSDVTVLGKDKIAIN 1232
            +Y +      V  D   I +L   L  E+   ++  ++P  L+++     +  KD     
Sbjct: 1152 IYYDPDPRSTVIEDDEEIIQLHFSLMDEETEKSLDYQSPWLLRLELDRAAMTDKDLTMGQ 1211

Query: 1233 VLPEGFGSKTSSTSLKEPTENDVFY------------RMQTLR----------------- 1263
            V     G K     +KE  +ND+F             R + +R                 
Sbjct: 1212 V-----GEK-----IKETFKNDLFVIWSEDNAEKLIIRCRVIRDPKTLDADVEAEEDHML 1261

Query: 1264 -----RALPSIMVKGLNDIARAVINIRD------DGKRE------LLVEGYGLRDVMCTD 1306
                   L  I ++G+ DI R V+   D       G+        L  +G  L +VM   
Sbjct: 1262 KKIENSMLEKITLRGVEDITRVVMMKYDRKVPSETGEYHKVPEWVLETDGVNLSEVMTVS 1321

Query: 1307 GVIGAKTATNHVLEIFNVLGIEAARASIIGEIDYTMSNHGMSVDPRHIQLLGDVMTFKGE 1366
            GV G++  TN  ++I NVLGIEA RA++  E+   +++ G  V+ RH+ LL DVMT +G 
Sbjct: 1322 GVDGSRIYTNSFIDIMNVLGIEAGRAALYREVYNVIASDGSYVNYRHMALLVDVMTSQGF 1381

Query: 1367 VLGITRFGLSKMRDSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGS 1426
            ++ +TR G ++     L   SFE+T + LF+A    + D   GVSE +ILGQ   IGTG+
Sbjct: 1382 LMSVTRHGFNRADTGALMRCSFEETVEILFEAGAAAELDDCRGVSENVILGQMAPIGTGA 1441

Query: 1427 FKVV 1430
            F V+
Sbjct: 1442 FDVM 1445

>Skud_4.114 Chr4 complement(201053..206233) [5181 bp, 1726 aa] {ON}
            YDL140C (REAL)
          Length = 1726

 Score =  719 bits (1857), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 520/1505 (34%), Positives = 776/1505 (51%), Gaps = 157/1505 (10%)

Query: 11   KRISGLEFSALSPADIVAQSELEISSRDLFDLENNRSPKEGGALDPRMGVSASSMECTTC 70
            + +  ++F   SP ++ A S  +I   +  D    R+ K GG  DPR+G    +++C TC
Sbjct: 12   RTVKEVQFGLFSPEEVRAISVAKIRFPETMDETQTRA-KIGGLNDPRLGSIDRNLKCQTC 70

Query: 71   HGNLASCHGHFGHIKLALPVFHVGYFKATIQILQGICKTCSAILLSEQDKRHFLSELRRP 130
               +  C GHFGHI LA PVFHVG+     ++ + +C  C  +LL E +      EL R 
Sbjct: 71   QEGMNECPGHFGHIDLAKPVFHVGFIAKIKKLCECVCMHCGKLLLDEHN------ELMRQ 124

Query: 131  GV---DNLRRMALLKKVLDQCKKQRRCLHCXXXXXXXXXXXXXXXXXSLKIIHDTFRWVG 187
             +   D+ +R A +  +   CK +   + C                        T R  G
Sbjct: 125  ALAIKDSKKRFAAIWTL---CKTK---MVCETDVPSENDPTQLVSRGGCGNTQPTVRKDG 178

Query: 188  KK--STPEKDKWIGDWKEVLSHNPELERYVKRATDDLNPLKTLNLFKQIASEDCELLGID 245
             K   + +KD+  GD  E     PEL          L+  + LN+FK I+ ED   LG +
Sbjct: 179  LKLVGSWKKDRASGDADE-----PELRV--------LSTEEILNIFKHISVEDFTSLGFN 225

Query: 246  ATNKAGRPETYIWRYIPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIKAGIEK 305
                  RPE  I   +P PP  +RPS+   +S    EDDLT KL +I+  +  ++     
Sbjct: 226  EV--FSRPEWMILTCLPVPPPPVRPSISFNES-QRGEDDLTFKLADILKANISLETLEHN 282

Query: 306  GISINNMMEHWDYLQMTVAMYINSD-SINPAMLPGSSTGGGKVKPIRGFCQRLKGKQGRF 364
            G   + + E    LQ  VA Y+++D +  P  L  S       +P++    RLKGK+GR 
Sbjct: 283  GAPHHAIEEAESLLQFHVATYMDNDIAGQPQALQKSG------RPVKSIRARLKGKEGRI 336

Query: 365  RGNLSGKRVDFSGRTVISPDPNLSIDEVAVPQLVAKVLTFPEKVTRYNIKKLRQLVQNGP 424
            RGNL GKRVDFS RTVIS DPNL +D+V VP+ +AK LT+PE VT YNI +L QLV+NGP
Sbjct: 337  RGNLMGKRVDFSARTVISGDPNLELDQVGVPKSIAKTLTYPEVVTPYNIDRLTQLVRNGP 396

Query: 425  NVHPGANYLLKKNEEARRNLRYGDRQKLANNLQYGDVVERHLEDGDVVLFNRQPSLHRLS 484
            N HPGA Y+++ + + R +LRY  R      LQYG  VERH+ D D VLFNRQPSLH++S
Sbjct: 397  NEHPGAKYVIRDSGD-RIDLRYSKRAGDIQ-LQYGWKVERHIMDNDPVLFNRQPSLHKMS 454

Query: 485  ILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNNLLTP 544
            +++H   + P+ TFRLN  V +PYNADFDGDEMNLHVPQ+EE RAE   L  V   +++P
Sbjct: 455  MMAHRVIVIPYSTFRLNLSVTSPYNADFDGDEMNLHVPQSEETRAELSQLCAVPLQIVSP 514

Query: 545  KSGEPIIAATQDFITGSYLISHKDSFFDKASLTQLLSMMS-----DGSLQFDIPPPAIMK 599
            +S +P +   QD + G   ++ +D+F +   L Q+L+M+      DG     IP PAI+K
Sbjct: 515  QSNKPCMGIVQDTLCGIRKLTLRDTFIE---LDQVLNMLYWVPDWDGV----IPTPAIIK 567

Query: 600  PCYLWTGKQVFSLLIKPNKNSPVKINLDA--KNKVYIPPKQKHYPNEMSQNDGFVIVRGS 657
            P  LW+GKQV S  I      P  I+L    +    + PK          ++G +I+ G 
Sbjct: 568  PKPLWSGKQVLSAAI------PSGIHLQRFDEGTTLLSPK----------DNGMLIIDG- 610

Query: 658  QILSGVMDKSVLGDGKKHSVFYTILRDFGPQEAASAMNRMAKLCARYLGNRGFSIGISD- 716
            QI+ GV++K  +G      + + + R+ GPQ  A     + K+   +L + GFS GI D 
Sbjct: 611  QIVFGVVEKKTVGSSNG-GLIHVVTREKGPQVCAKLFGNIQKVVNFWLLHNGFSTGIGDT 669

Query: 717  VTPADDLKQKKEDLVEIAYAKCDELIDLYNKGKLETQPGCNEEQTLEAKIGGLLSKVREE 776
            +     +++  E + E A  K  ++        L  + G    ++ E  +   L++ R++
Sbjct: 670  IADGPTMREITETIAE-AKKKVFDVTKEAQANLLTAKHGMTLRESFEDNVVRFLNEARDK 728

Query: 777  VGDVCINELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFP 836
             G +    L +LN    M   GSKGS +N++QM A VGQQ + G R+  GF DR+LPHF 
Sbjct: 729  AGRLAEVNLKDLNNVKQMVMAGSKGSFINIAQMSACVGQQSVEGKRIAFGFVDRTLPHFS 788

Query: 837  KNSKTPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDL 896
            K+  +P+SKGFV NS+  GL+P EF FHA+ GREGL+DTAVKTAETGY+ RRL+K+LED+
Sbjct: 789  KDDYSPESKGFVENSYLRGLTPQEFFFHAMGGREGLIDTAVKTAETGYIQRRLVKALEDI 848

Query: 897  SCQYDNTVRTSSNGIVQFTYGGDGLDPLEMEGNAQPV--NFNRSWDHAYNITFNNTDRGL 954
               YDNT R S   ++QF YG DG+D   +E  +       +++++  Y I   N +  L
Sbjct: 849  MVHYDNTTRNSLGNVIQFIYGEDGMDAAHIEKQSLDTIGGSDKAFEKRYRIDLLNPEHIL 908

Query: 955  LPYEIKKTVDNILKPLEKRLIRYDTLGRPVSAEDDKLDDYVDQHDS-------ERLFYAS 1007
             P  + ++   IL  L+ +++  +   + V       + +VD   +        R+   +
Sbjct: 909  DP-SLLESGSEILGDLKLQVLLDEEYKQLVKDRKFLREVFVDGEANWPMPVNIRRIIQNA 967

Query: 1008 LREFMTDXXXXXXXXXXXXGLPKLIKKSELEGYDPENEHIDAIVQHSIT----------- 1056
             + F  D             +     +  L     +NE I    Q ++T           
Sbjct: 968  QQTFHIDHTRPSDLTIKEIVIGVKDLQENLLVLRGKNEIIQNAQQDAVTLFCCLFRSRLA 1027

Query: 1057 -----QLYRITEDAVQKFLEIAISKYHRAKVEPGTAVGAIGAQSIGEPGTQMTLKTFHFA 1111
                 Q YR+T+ A +  L    +++ R+ V PG  VG + AQSIGEP TQMTL TFHFA
Sbjct: 1028 TRRILQEYRLTKQAFEWVLSNIEAQFLRSVVHPGEMVGVLAAQSIGEPATQMTLNTFHFA 1087

Query: 1112 GVASMNVTLGVPRIKEIINASKVISTPIINAVLVNNN--DERAARVVKGRIEKTLLSDVC 1169
            GVAS  VT GVPR+KEI+N +K + TP +   L   +  D+  A++++  IE T L  V 
Sbjct: 1088 GVASKKVTSGVPRLKEILNVAKNMKTPSLTVYLEPGHAADQEQAKLIRSAIEHTTLKSVT 1147

Query: 1170 -----YYIQD----VYKENMAYLQVKVDL------NTIDK-----LQLEL---TIEDIAI 1206
                 YY  D    V  E+   +Q+   L       + D+     L+LEL    + D  +
Sbjct: 1148 IASEIYYDPDPRSTVIPEDEEIIQLHFSLLDDEAEQSFDQQSPWLLRLELDRAAMNDKDL 1207

Query: 1207 AITRAPKLKIQT--SDVTVL----GKDKIAIN---VLPEGFGSKTSSTSLKEPTENDVFY 1257
             + +  +   QT  +D+ V+      +K+ I    V P+   ++T      E  E+ +  
Sbjct: 1208 TMGQVGERIKQTFKNDLFVIWSEDNDEKLIIRCRVVRPKSLDAET------EAEEDHMLK 1261

Query: 1258 RMQTLRRALPSIMVKGLNDIARAVINIRD------------DGKRELLVEGYGLRDVMCT 1305
            +++     L +I ++G+ +I R V+   D            + +  L  +G  L +VM  
Sbjct: 1262 KIENT--MLENITLRGVENIERVVMMKYDRKVPSPTGEYVKEPEWVLETDGVNLSEVMTV 1319

Query: 1306 DGVIGAKTATNHVLEIFNVLGIEAARASIIGEIDYTMSNHGMSVDPRHIQLLGDVMTFKG 1365
             G+   +  TN  ++I  VLGIEA RA++  E+   +++ G  V+ RH+ LL DVMT +G
Sbjct: 1320 PGIDPTRIYTNSFIDIMEVLGIEAGRAALYKEVYNVIASDGSYVNYRHMALLVDVMTTQG 1379

Query: 1366 EVLGITRFGLSKMRDSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTG 1425
             +  +TR G ++     L   SFE+T + LF+A    + D   GVSE +ILGQ   IGTG
Sbjct: 1380 GLTSVTRHGFNRSNTGALMRCSFEETVEILFEAGASAELDDCRGVSENVILGQMAPIGTG 1439

Query: 1426 SFKVV 1430
            +F V+
Sbjct: 1440 AFDVM 1444

>KAFR0B01060 Chr2 complement(197351..202408) [5058 bp, 1685 aa] {ON}
           Anc_7.314 YDL140C
          Length = 1685

 Score =  573 bits (1477), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 358/927 (38%), Positives = 510/927 (55%), Gaps = 69/927 (7%)

Query: 11  KRISGLEFSALSPADIVAQSELEISSRDLFDLENNRSPKEGGALDPRMGVSASSMECTTC 70
           + +  ++F   SP ++ A S  ++   +  D    R+ K GG  DPR+G    +++C TC
Sbjct: 12  RTVKEVQFGLFSPEEVRAISVAKVRFPETMDETQTRA-KIGGLNDPRLGSIDRNLKCQTC 70

Query: 71  HGNLASCHGHFGHIKLALPVFHVGYFKATIQILQGICKTCSAILLSEQDK--RHFLSELR 128
              +  C GHFGHI LA PVFHVG+     ++ + +C  C  +LL E ++  R  L +++
Sbjct: 71  QEGMNECPGHFGHIDLAKPVFHVGFISKIKKVCESVCMHCGKLLLDEHNEQMRQVL-KIK 129

Query: 129 RPGVDNLRRMALLKKVLDQCKKQRRCLHCXXXXXXXXXXXXXXXXXSLKIIHDTFRWVGK 188
            P             V   CK +   + C                        T R  G 
Sbjct: 130 DP-------KKRFNAVWSLCKTK---MICETDVPSENDPTQLISRGGCGNAQPTVRKDGL 179

Query: 189 KSTPEKDKWIGDWKE--VLSHNPELERYVKRATDDLNPLKTLNLFKQIASEDCELLGIDA 246
           K        +G WK+    S   E E+ V      L   + LN+FK I+ ED   LG D 
Sbjct: 180 K-------LVGSWKKDKATSDGEEPEQRV------LGVEEILNIFKHISPEDSTKLGFD- 225

Query: 247 TNKAGRPETYIWRYIPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIKAGIEKG 306
             +  RPE  I   +P PP  +RPS+   +S    EDDLT KL +I+  +  ++     G
Sbjct: 226 -EEFARPEWMILTVLPVPPPPVRPSISFNES-QRGEDDLTFKLADILKANISLETLEHNG 283

Query: 307 ISINNMMEHWDYLQMTVAMYINSD-SINPAMLPGSSTGGGKVKPIRGFCQRLKGKQGRFR 365
              + + E    LQ  VA Y+++D +  P  L  S       +P++    RLKGK+GR R
Sbjct: 284 APHHAIEEAESLLQFHVATYMDNDIAGQPQALQKSG------RPVKSIRARLKGKEGRIR 337

Query: 366 GNLSGKRVDFSGRTVISPDPNLSIDEVAVPQLVAKVLTFPEKVTRYNIKKLRQLVQNGPN 425
           GNL GKRVDFS RTVIS DPNL +D+V VP+ +A+ LT+PE VT YNI +L QLV+NGPN
Sbjct: 338 GNLMGKRVDFSARTVISGDPNLELDQVGVPKSIARTLTYPEVVTPYNIDRLTQLVRNGPN 397

Query: 426 VHPGANYLLKKNEEARRNLRYGDRQKLANNLQYGDVVERHLEDGDVVLFNRQPSLHRLSI 485
            HPGA Y+++ N + R +LRY  R      LQYG  VERH+ D D VLFNRQPSLH++S+
Sbjct: 398 EHPGAKYVIRDNGD-RIDLRYSKRAGDIQ-LQYGWKVERHIMDDDPVLFNRQPSLHKMSM 455

Query: 486 LSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNNLLTPK 545
           +SH  K+ P+ TFRLN  V +PYNADFDGDEMNLHVPQ+EE RAE   L  V   +++P+
Sbjct: 456 MSHRVKVVPYSTFRLNLSVTSPYNADFDGDEMNLHVPQSEETRAELSQLCAVPLQIVSPQ 515

Query: 546 SGEPIIAATQDFITGSYLISHKDSFFDKASLTQLLSMMSDGSLQFD--IPPPAIMKPCYL 603
           S +P +   QD + G  +++ KD+F +   +  +L  + D    +D  IP PAI+KP  L
Sbjct: 516 SNKPCMGIVQDTLCGIRILTLKDTFLEFDHVLNMLYWVPD----WDGIIPTPAILKPKPL 571

Query: 604 WTGKQVFSLLIKPNKNSPVKINLDA--KNKVYIPPKQKHYPNEMSQNDGFVIVRGSQILS 661
           WTGKQ+ S  I      P  I+L    +    + PK          ++G +I+ G QI+ 
Sbjct: 572 WTGKQILSAAI------PKGIHLQRFDEGTTLLSPK----------DNGMLIIDG-QIIF 614

Query: 662 GVMDKSVLGDGKKHSVFYTILRDFGPQEAASAMNRMAKLCARYLGNRGFSIGISD-VTPA 720
           GV+DK  +G      + + + R+ GPQ  +     + K+   +L + GFS GI D +   
Sbjct: 615 GVVDKKTVGSSSG-GLIHVVTREKGPQVCSRLFGNIQKVVNFWLLHNGFSTGIGDTIANG 673

Query: 721 DDLKQKKEDLVEIAYAKCDELIDLYNKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGDV 780
           + +K+  E + E A  K +E+        L  + G    ++ E  +   L++ R++ G +
Sbjct: 674 ETIKEITETIAE-AKKKVEEVTKEAQANLLTAKHGMTLRESFEDNVVRFLNEARDKAGRL 732

Query: 781 CINELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSK 840
               L++ N    M + GSKGS +N++QM A VGQQ + G R+  GF DR+LPHF K+  
Sbjct: 733 AEVNLNDTNYVKQMVSAGSKGSFINIAQMSACVGQQSVEGKRIGYGFVDRTLPHFSKDDY 792

Query: 841 TPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 900
           +P+SKGFV NS+  GL+P EF FHA+ GREGL+DTAVKTAETGY+ RRL+K+LED+   Y
Sbjct: 793 SPESKGFVENSYLRGLTPQEFFFHAMGGREGLIDTAVKTAETGYIQRRLVKALEDIMVHY 852

Query: 901 DNTVRTSSNGIVQFTYGGDGLDPLEME 927
           D T R S   I+QF YG DG+D   +E
Sbjct: 853 DGTTRNSLGNIIQFIYGEDGIDASHIE 879

 Score =  182 bits (461), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 139/422 (32%), Positives = 219/422 (51%), Gaps = 54/422 (12%)

Query: 1055 ITQLYRITEDAVQKFLEIAISKYHRAKVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVA 1114
            + Q YR+T+++    +    S++ R+ V PG  VG + AQSIGEP TQMTL TFHFAGVA
Sbjct: 1031 VIQEYRLTKESFDWVINNIESQFLRSVVHPGEMVGVLAAQSIGEPATQMTLNTFHFAGVA 1090

Query: 1115 SMNVTLGVPRIKEIINASKVISTPIINAVLVNN--NDERAARVVKGRIEKTLLSDVC--- 1169
            S  VT GVPR+KEI+N +K + TP +   L      D+  A+ ++  IE T L  V    
Sbjct: 1091 SKKVTSGVPRLKEILNVAKNMKTPSLTVYLEEKYAADQERAKYIRSAIEHTTLKSVTVAS 1150

Query: 1170 --YYIQD----VYKENMAYLQVKVDL------NTIDK-----LQLEL---TIEDIAIAIT 1209
              YY  D    V +++   +Q+   L       ++D+     L+LEL    + D  + + 
Sbjct: 1151 EIYYDPDPRSTVIEDDEEIIQLHFSLLDEEMEASLDQQSPWLLRLELDRAAMNDKDLTMG 1210

Query: 1210 RAPKLKIQT--SDVTVL----GKDKIAIN---VLPEGFGSKTSSTSLKEPTENDVFYRMQ 1260
            +  +   +T   D+ V+      +K+ I    V P+G  ++T      E  E+ +  +++
Sbjct: 1211 QVGERIKETFKKDLFVIWSEDNAEKLIIRCRVVRPKGLDAET------EAEEDHMLKKIE 1264

Query: 1261 TLRRALPSIMVKGLNDIARAVINIRD------DGKRE------LLVEGYGLRDVMCTDGV 1308
                 L +I ++G+ +I R V+   D       G+ +      L  +G  L +VM   GV
Sbjct: 1265 NT--MLENITLRGVENIERVVMMKYDRKVPSKTGEFQKVPEWVLETDGVNLAEVMTIPGV 1322

Query: 1309 IGAKTATNHVLEIFNVLGIEAARASIIGEIDYTMSNHGMSVDPRHIQLLGDVMTFKGEVL 1368
               +  TN  ++I  VLGIEA RA++  E+   +++ G  V+ RH+ LL DVMT +G + 
Sbjct: 1323 DTTRIYTNSFIDIMEVLGIEAGRAALYKEVYNVIASDGSYVNYRHMALLVDVMTCQGGLT 1382

Query: 1369 GITRFGLSKMRDSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFK 1428
             +TR G ++     L   SFE+T + LF+A    + D   GVSE ++LGQ   IGTG+F 
Sbjct: 1383 SVTRHGFNRANTGALMRCSFEETVEILFEAGASAELDDCRGVSENVLLGQMAPIGTGAFG 1442

Query: 1429 VV 1430
            V+
Sbjct: 1443 VM 1444

>ADR086C Chr4 complement(860406..865643) [5238 bp, 1745 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDL140C
           (RPO21)
          Length = 1745

 Score =  567 bits (1462), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 363/929 (39%), Positives = 511/929 (55%), Gaps = 73/929 (7%)

Query: 11  KRISGLEFSALSPADIVAQSELEISSRDLFDLENNRSPKEGGALDPRMGVSASSMECTTC 70
           + I  ++F   SP ++ A S  +I   +  D E     K GG  DPR+G    + +C TC
Sbjct: 12  RTIKEVQFGLFSPEEVRAISVAKIEFPETMD-ETQMRAKVGGLNDPRLGSIDRNFKCQTC 70

Query: 71  HGNLASCHGHFGHIKLALPVFHVGYFKATIQILQGICKTCSAILLSEQDKRHFLSELRRP 130
              +  C GHFGHI+LA PVFH+G+     ++ + +C  C  +LL E       +EL R 
Sbjct: 71  GEGMNDCPGHFGHIELAKPVFHIGFISKIKKVCECVCMHCGKLLLDE------YNELMRQ 124

Query: 131 GV---DNLRRMALLKKVLDQCKKQRRCLHCXXXXXXXXXXXXXXXXXSLK--IIHDTFRW 185
            +   D  RR      V   CK +  C                    + +  I  D    
Sbjct: 125 AIKIKDPKRR---FNAVWSLCKAKMVCDTEVPSEDDPSKYISRGGCGNAQPSIRKDGLSL 181

Query: 186 VGKKSTPEKDKWIGDWKEVLSHNPELERYVKRATDDLNPLKTLNLFKQIASEDCELLGID 245
           VG   T +KDK   D     +  PE     KR    ++  + LN+FK I+ ED   LG +
Sbjct: 182 VG---TWKKDKNAED-----ADQPE-----KRI---ISAEEILNVFKHISPEDSWRLGFN 225

Query: 246 ATNKAGRPETYIWRYIPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIKAGIEK 305
                 RPE  +   +P PP  +RPS+   +S    EDDLT KL +I+  +  ++     
Sbjct: 226 --EDFSRPEWMLLTVLPVPPPPVRPSISFNES-QRGEDDLTYKLGDILKANINVQRLEIN 282

Query: 306 GISINNMMEHWDYLQMTVAMYINSDSINPAMLPGSSTGGGKVKPIRGFCQRLKGKQGRFR 365
           G   + + E    LQ  VA Y+++D    A  P +    G+  PI+    RLKGK+GR R
Sbjct: 283 GSPQHVIQESESLLQFHVATYMDNDI---AGQPQAVQKSGR--PIKSIRARLKGKEGRIR 337

Query: 366 GNLSGKRVDFSGRTVISPDPNLSIDEVAVPQLVAKVLTFPEKVTRYNIKKLRQLVQNGPN 425
           GNL GKRVDFS RTVIS DPNL +D+V VP+ +AK LT+PE VT YNI +L QLV+NGPN
Sbjct: 338 GNLMGKRVDFSARTVISGDPNLDLDQVGVPKSIAKTLTYPEVVTPYNIDRLTQLVRNGPN 397

Query: 426 VHPGANYLLKKNEEARRNLRYGDRQKLANNLQYGDVVERHLEDGDVVLFNRQPSLHRLSI 485
            HPGA Y+++ N + R +LRY  R      LQYG  VERH+ D D VLFNRQPSLH++S+
Sbjct: 398 EHPGAKYVIRDNGD-RIDLRYSKRAGDIQ-LQYGWKVERHIMDDDPVLFNRQPSLHKMSM 455

Query: 486 LSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNNLLTPK 545
           ++H  K+ P+ TFRLN  V +PYNADFDGDEMNLHVPQ+EE RAE   L  V   +++P+
Sbjct: 456 MAHRVKVMPYSTFRLNLSVTSPYNADFDGDEMNLHVPQSEETRAELSQLCAVPLQIVSPQ 515

Query: 546 SGEPIIAATQDFITGSYLISHKDSFFDKASLTQLLSMMS-----DGSLQFDIPPPAIMKP 600
           S +P +   QD + G   ++ +D+F +   L Q+L+M+      DG     IP P I+KP
Sbjct: 516 SNKPCMGIVQDTLCGIRKMTLRDTFIE---LDQVLNMLYWIPDWDGV----IPTPTILKP 568

Query: 601 CYLWTGKQVFSLLIKPNKNSPVKINLDA--KNKVYIPPKQKHYPNEMSQNDGFVIVRGSQ 658
             LW+GKQ+ S+ I      P  I+L    +   Y+ PK          ++G +I+ G Q
Sbjct: 569 KPLWSGKQLLSMAI------PSGIHLQRFDEGTTYLSPK----------DNGMLIIDG-Q 611

Query: 659 ILSGVMDKSVLGDGKKHSVFYTILRDFGPQEAASAMNRMAKLCARYLGNRGFSIGISDVT 718
           I+ GV+DK  +G      + + + R+ GP+  A     + K+   +L + GFSIGI D  
Sbjct: 612 IIFGVVDKKTVGSSSG-GLIHVVTREKGPEVCAKLFGNIQKVVNYWLLHNGFSIGIGDTI 670

Query: 719 PADDLKQKKEDLVEIAYAKCDELIDLYNKGKLETQPGCNEEQTLEAKIGGLLSKVREEVG 778
             +   ++  D + +A  K +E+        L  + G    ++ E  +   L++ R++ G
Sbjct: 671 ADEKTMREITDAIALAKKKVEEVTKEAQANLLTAKHGMTLRESFEDNVVRYLNEARDKAG 730

Query: 779 DVCINELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKN 838
                 L +LN    M + GSKGS +N++QM A VGQQ + G R+  GF DR+LPHF K+
Sbjct: 731 RSAEVNLKDLNNVKQMVSAGSKGSFINIAQMSACVGQQSVEGKRIAFGFADRTLPHFSKD 790

Query: 839 SKTPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSC 898
             +P+SKGFV NS+  GL+P EF FHA+ GREGL+DTAVKTAETGY+ RRL+K+LED+  
Sbjct: 791 DYSPESKGFVENSYLRGLTPQEFFFHAMGGREGLIDTAVKTAETGYIQRRLVKALEDIMV 850

Query: 899 QYDNTVRTSSNGIVQFTYGGDGLDPLEME 927
            YD T R S   I+QF YG DG+D   +E
Sbjct: 851 HYDGTTRNSLGNIIQFVYGEDGMDAAHIE 879

 Score =  189 bits (481), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 140/420 (33%), Positives = 207/420 (49%), Gaps = 57/420 (13%)

Query: 1059 YRITEDAVQKFLEIAISKYHRAKVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNV 1118
            YR+T+   +  L    +++ R+ V PG  VG + AQSIGEP TQMTL TFHFAGVAS  V
Sbjct: 1035 YRLTKQTFEWVLNNIEAQFLRSIVHPGEMVGVLAAQSIGEPATQMTLNTFHFAGVASKKV 1094

Query: 1119 TLGVPRIKEIINASKVISTPIINAVLVNN--NDERAARVVKGRIEKTLLSDVCYYIQDVY 1176
            T GVPR+KEI+N +K + TP +   L  +   D+  A++++  IE T L  V    +  Y
Sbjct: 1095 TSGVPRLKEILNVAKNMKTPSLTVYLEESYATDQEKAKLIRSAIEHTTLKSVPVASEIYY 1154

Query: 1177 KENMAYLQVKVDLNTIDKLQLELTIEDIAIAITRAPKLKIQTSDVTVLGKDKIAINVLPE 1236
              + +   ++ D   I +L   L  E+   +      LK Q+  +  L  D++A+     
Sbjct: 1155 DPDPSSTVIEEDEEII-QLHFSLMDEETEAS------LKHQSPWLLRLELDRVAMTDKDL 1207

Query: 1237 GFGSKTSSTSLKEPTENDVFY------------RMQTLR--------------------- 1263
              G       +KE  +ND+F             R + +R                     
Sbjct: 1208 TMGQ--VGEKIKETFKNDLFVIWSEDNAEKLIIRCRVVRDPKTLDAEAEAEEDHMLKKIE 1265

Query: 1264 -RALPSIMVKGLNDIARAVINIRD------DGKRE------LLVEGYGLRDVMCTDGVIG 1310
               L SI ++G+ DI R V+   D       G+        L  +G  L +VM   GV  
Sbjct: 1266 NTMLESITLRGVQDITRVVMMKYDRKVPSETGEYHKIPEWVLETDGVNLSEVMSVPGVDP 1325

Query: 1311 AKTATNHVLEIFNVLGIEAARASIIGEIDYTMSNHGMSVDPRHIQLLGDVMTFKGEVLGI 1370
             +  TN  ++I NVLGIEA RA++  E+   +++ G  V+ RH+ LL DVMT +G ++ +
Sbjct: 1326 TRIYTNSFIDIMNVLGIEAGRAALYKEVYNVIASDGSYVNYRHMALLVDVMTSQGFLMSV 1385

Query: 1371 TRFGLSKMRDSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVV 1430
            TR G ++     L   SFE+T + LF+A    + D   GVSE +ILGQ   IGTGSF V+
Sbjct: 1386 TRHGFNRADTGALMRCSFEETVEILFEAGAAAELDDCSGVSENVILGQMAPIGTGSFDVM 1445

>TPHA0A03070 Chr1 complement(671766..676925) [5160 bp, 1719 aa] {ON}
           Anc_7.314 YDL140C
          Length = 1719

 Score =  566 bits (1459), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 355/937 (37%), Positives = 515/937 (54%), Gaps = 89/937 (9%)

Query: 11  KRISGLEFSALSPADIVAQSELEISSRDLFDLENNRSPKEGGALDPRMGVSASSMECTTC 70
           + +  ++F   SP ++ + S  +I   +  D    R+ K GG  DPR+G    +++C TC
Sbjct: 12  RTVKEVQFGLFSPEEVRSISVAKIKFPETMDETQTRA-KIGGLNDPRLGSIDRNLKCQTC 70

Query: 71  HGNLASCHGHFGHIKLALPVFHVGYFKATIQILQGICKTCSAILLSEQDK--RHFLSELR 128
              +  C GHFGHI LA PVFH+G+     ++ + IC  C  +LL E ++  R  +S   
Sbjct: 71  QEGMNECPGHFGHIDLAKPVFHIGFISKIKKVCECICMHCGKLLLDENNEQMRQVMSI-- 128

Query: 129 RPGVDNLRRMALLKKVLDQCKKQRRCLHCXXXXXXXXXXXXXXXXXSLKIIHDTFRWVGK 188
               D+ +R      +   CK +  C                     +    D  + + +
Sbjct: 129 ---KDSKKR---FNAIWTLCKTKTVC------------------ETDVPSEDDPTQLISR 164

Query: 189 ------KSTPEKD--KWIGDWKEVLSHNP--ELERYVKRATDDLNPLKTLNLFKQIASED 238
                 + T  KD  K +G WK+  + N   E E+ V      LN  + LN+FK I+  D
Sbjct: 165 GGCGNAQPTIRKDGLKLVGSWKKDKATNDGDEPEQRV------LNTEEILNIFKHISVHD 218

Query: 239 CELLGIDATNKAGRPETYIWRYIPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSL 298
              LG +   +  RP+  I   +P PP  +RPS+   +S    EDDLT KL +I+  +  
Sbjct: 219 SNTLGFN--EQFARPDWMILTVLPVPPPPVRPSISFNES-QRGEDDLTFKLADILKANIS 275

Query: 299 IKAGIEKGISINNMMEHWDYLQMTVAMYINSD-SINPAMLPGSSTGGGKVKPIRGFCQRL 357
           ++     G   + + E    LQ  +A Y+++D +  P  L  S       +P++    RL
Sbjct: 276 LETLEHNGAPHHAIEEAESLLQFHIATYMDNDIAGQPQALQKSG------RPVKSIRARL 329

Query: 358 KGKQGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPQLVAKVLTFPEKVTRYNIKKLR 417
           KGK+GR RGNL GKRVDFS RTVIS DPNL +D+V VP+ +AK LT+PE VT YNI +L 
Sbjct: 330 KGKEGRIRGNLMGKRVDFSARTVISGDPNLELDQVGVPKSIAKTLTYPEVVTPYNIDRLT 389

Query: 418 QLVQNGPNVHPGANYLLKKNEEARRNLRYGDRQKLANNLQYGDVVERHLEDGDVVLFNRQ 477
           QLV+NGPN HPGA Y+++ N + R +LRY  R      LQYG  VERH+ D D VLFNRQ
Sbjct: 390 QLVRNGPNEHPGAKYVIRDNGD-RIDLRYSKRAGDIQ-LQYGWKVERHIMDNDPVLFNRQ 447

Query: 478 PSLHRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGV 537
           PSLH++S+++H  K+ P+ TFRLN  V +PYNADFDGDEMNLHVPQ+EE RAE   L  V
Sbjct: 448 PSLHKMSMMAHRVKVMPYSTFRLNLSVTSPYNADFDGDEMNLHVPQSEETRAELSQLCSV 507

Query: 538 KNNLLTPKSGEPIIAATQDFITGSYLISHKDSFFDKASLTQLLSMMS-----DGSLQFDI 592
              +++P+S +P +   QD + G   ++ +D F +   L QLL+M+      DG     I
Sbjct: 508 PLQIVSPQSNKPCMGIVQDTLCGIRKLTLRDCFIE---LDQLLNMLYWVPDWDGI----I 560

Query: 593 PPPAIMKPCYLWTGKQVFSLLIKPNKNSPVKINLDA--KNKVYIPPKQKHYPNEMSQNDG 650
           P PAI+KP  LW+GKQ+ S+ I      P  I+L    +    + PK          ++G
Sbjct: 561 PTPAIIKPVPLWSGKQILSIAI------PKGIHLQRFDEGTTMLSPK----------DNG 604

Query: 651 FVIVRGSQILSGVMDKSVLGDGKKHSVFYTILRDFGPQEAASAMNRMAKLCARYLGNRGF 710
            +I+ G QI+ GV+DK  +G      + + + R+ GPQ  A     + K+   +  + GF
Sbjct: 605 MLIIDG-QIIFGVVDKKTVGSSNG-GLIHVVTREKGPQICAKMFGNIQKVVNFWFLHNGF 662

Query: 711 SIGISDVTPADDLKQKKEDLVEIAYAKCDELIDLYNKGKLETQPGCNEEQTLEAKIGGLL 770
           S GI D        ++  + +  A  K +E+        L  + G    ++ E  +   L
Sbjct: 663 STGIGDTIADGGTMKEITETIADAKRKVEEVTKEAQANLLTAKHGMTLRESFEDNVVRFL 722

Query: 771 SKVREEVGDVCINELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDR 830
           ++ R++ G +    L++LN    M + GSKGS +N++QM A VGQQ + G R+  GF DR
Sbjct: 723 NEARDKAGRLAEVNLNDLNNVKQMVSAGSKGSFINIAQMSACVGQQSVEGKRIAFGFVDR 782

Query: 831 SLPHFPKNSKTPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLM 890
           +LPHF K+  +P+SKGFV NS+  GL+P EF FHA+ GREGL+DTAVKTAETGY+ RRL+
Sbjct: 783 TLPHFSKDDYSPESKGFVENSYLRGLTPQEFFFHAMGGREGLIDTAVKTAETGYIQRRLV 842

Query: 891 KSLEDLSCQYDNTVRTSSNGIVQFTYGGDGLDPLEME 927
           K+LED+   YD+T R S   ++QF YG DG+D   +E
Sbjct: 843 KALEDIMVHYDSTTRNSLGNVIQFVYGEDGIDAGHIE 879

 Score =  194 bits (492), Expect = 5e-49,   Method: Compositional matrix adjust.
 Identities = 148/422 (35%), Positives = 219/422 (51%), Gaps = 54/422 (12%)

Query: 1055 ITQLYRITEDAVQKFLEIAISKYHRAKVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVA 1114
            + Q YR+T+ A Q  L    S++ R+ V PG  VG + AQSIGEP TQMTL TFHFAGVA
Sbjct: 1031 VLQEYRLTKQAFQWVLNNIESQFLRSIVHPGEMVGVLAAQSIGEPATQMTLNTFHFAGVA 1090

Query: 1115 SMNVTLGVPRIKEIINASKVISTPIINAVLVNN--NDERAARVVKGRIEKTLLSDVC--- 1169
            S  VT GVPR+KEI+N +K + TP     L      D+  A++++  IE T L  V    
Sbjct: 1091 SKKVTSGVPRLKEILNVAKNMKTPSSTVYLDPEYATDQEKAKIIRSAIEHTTLKSVTVAS 1150

Query: 1170 --YYIQD----VYKENMAYLQVKVDL------NTIDK-----LQLEL---TIEDIAIAIT 1209
              YY  D    V  E+   +Q+   L        ID      L+LEL    + D  + + 
Sbjct: 1151 EIYYDPDPTTTVIAEDEEIIQLHYSLMDSETEKNIDNQSPWLLRLELDRAAMNDKDLTMV 1210

Query: 1210 RAPKLKIQT--SDVTVL----GKDKIAIN---VLPEGFGSKTSSTSLKEPTENDVFYRMQ 1260
            +  +   +T  +D++V+      DK+ I    V P+   ++T      E  E+ +  +++
Sbjct: 1211 QVGEKIKETFRNDLSVIWSEDNADKLIIRCRVVRPKSLDAET------EAEEDHMLKKIE 1264

Query: 1261 TLRRALPSIMVKGLNDIARAVINIRD------DGKRE------LLVEGYGLRDVMCTDGV 1308
                 L SI ++G+ DI R V+   D       G+ +      L  +G  L +VM   GV
Sbjct: 1265 NT--MLESITLRGVEDIERVVMMKYDRKMPSETGEYQKVPEWVLETDGVNLMEVMTVPGV 1322

Query: 1309 IGAKTATNHVLEIFNVLGIEAARASIIGEIDYTMSNHGMSVDPRHIQLLGDVMTFKGEVL 1368
             G++  TN  ++I  VLGIEA RA++  E+   +++ G  V+ RH+ LL DVMT +G + 
Sbjct: 1323 DGSRIYTNSFIDITEVLGIEAGRAALYREVYNVIASDGSYVNYRHMALLVDVMTTQGGLT 1382

Query: 1369 GITRFGLSKMRDSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFK 1428
             +TR G ++     L   SFE+T + LF+A    + D   GVSE +ILGQ   IGTG+F 
Sbjct: 1383 SVTRHGFNRSNTGALMRCSFEETVEILFEAGASAELDDCRGVSENVILGQMAPIGTGAFD 1442

Query: 1429 VV 1430
            V+
Sbjct: 1443 VM 1444

>CAGL0I03828g Chr9 complement(328922..334069) [5148 bp, 1715 aa]
           {ON} highly similar to uniprot|P04050 Saccharomyces
           cerevisiae YDL140c RPO21 DNA-directed RNA polymerase II
          Length = 1715

 Score =  565 bits (1457), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 359/956 (37%), Positives = 519/956 (54%), Gaps = 67/956 (7%)

Query: 11  KRISGLEFSALSPADIVAQSELEISSRDLFDLENNRSPKEGGALDPRMGVSASSMECTTC 70
           + +  ++F   SP +I A S  +I   +  D    R+ K GG  DPR+G    +++C TC
Sbjct: 12  RTVKEVQFGLFSPEEIRAISVAKIRLPETMDETQTRA-KIGGLNDPRLGSIDRNLKCQTC 70

Query: 71  HGNLASCHGHFGHIKLALPVFHVGYFKATIQILQGICKTCSAILLSEQDKRHFLSELRRP 130
              +  C GHFGHI LA PVFH+G+     ++ + +C  C  +LL E +      E  R 
Sbjct: 71  QEGMNECPGHFGHIDLAKPVFHIGFITKIKKVCESLCMHCGKLLLDEHN------EQMRQ 124

Query: 131 GVDNLRRMALLKKVLDQCKKQRRCLHCXXXXXXXXXXXXXXXXXSLK--IIHDTFRWVGK 188
            +           V   CK +  C                    + +  I  D  + VG 
Sbjct: 125 AIQIKDPKKRFNAVWSLCKTKMVCETDVPSEDDPTKLISRGGCGNTQPTIRKDGLKLVG- 183

Query: 189 KSTPEKDKWIGDWKEVLSHNPELERYVKRATDDLNPLKTLNLFKQIASEDCELLGIDATN 248
             + +KDK  GD  E     PE     +R    L+  + LN+FK I+ ED   LG +   
Sbjct: 184 --SWKKDKSTGDADE-----PE-----QRV---LSTEEILNIFKHISPEDSYRLGFN--E 226

Query: 249 KAGRPETYIWRYIPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIKAGIEKGIS 308
           +  RPE  I   +P PP  +RPS+   +S    EDDLT KL +I+  +  ++     G  
Sbjct: 227 EFARPEWMILTVLPVPPPPVRPSISFNES-QRGEDDLTFKLADILKANISLETLEHNGAP 285

Query: 309 INNMMEHWDYLQMTVAMYINSD-SINPAMLPGSSTGGGKVKPIRGFCQRLKGKQGRFRGN 367
            + + E    LQ  VA Y+++D +  P  L  S       +P++    RLKGK+GR RGN
Sbjct: 286 HHAVEEAESLLQFHVATYMDNDIAGQPQALQKSG------RPVKSIRARLKGKEGRIRGN 339

Query: 368 LSGKRVDFSGRTVISPDPNLSIDEVAVPQLVAKVLTFPEKVTRYNIKKLRQLVQNGPNVH 427
           L GKRVDFS RTVIS DPNL +D+V VP+ +A+ LT+PE VT YNI +L QLV+NGPN H
Sbjct: 340 LMGKRVDFSARTVISGDPNLELDQVGVPKSIARTLTYPEVVTPYNIDRLSQLVRNGPNEH 399

Query: 428 PGANYLLKKNEEARRNLRYGDRQKLANNLQYGDVVERHLEDGDVVLFNRQPSLHRLSILS 487
           PGA Y+++ N + R +LRY  R      LQYG  VERH+ D D VLFNRQPSLH++S+++
Sbjct: 400 PGAKYVIRDNGD-RIDLRYSKRSGDVQ-LQYGWKVERHIMDDDPVLFNRQPSLHKMSMMA 457

Query: 488 HYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNNLLTPKSG 547
           H  K+ P+ TFRLN  V +PYNADFDGDEMNLHVPQ+EE RAE   L  V   +++P+S 
Sbjct: 458 HRVKVVPYSTFRLNLSVTSPYNADFDGDEMNLHVPQSEETRAELSQLCAVPLQIVSPQSN 517

Query: 548 EPIIAATQDFITGSYLISHKDSFFDKASLTQLLSMMSDGSLQFD--IPPPAIMKPCYLWT 605
           +P +   QD + G   ++ +D+F +   +  +L  + D    +D  IP PAI+KP  LW+
Sbjct: 518 KPCMGIVQDTLCGIRKLTLRDTFLEFDQVLNMLYWVPD----WDGVIPTPAIIKPKPLWS 573

Query: 606 GKQVFSLLIKPNKNSPVKINLDA--KNKVYIPPKQKHYPNEMSQNDGFVIVRGSQILSGV 663
           GKQ+ S+ I      P  I+L    +    + PK          ++G +++ G +I+ GV
Sbjct: 574 GKQILSVAI------PKGIHLQRFDEGTTLLSPK----------DNGMLVIDG-EIIFGV 616

Query: 664 MDKSVLGDGKKHSVFYTILRDFGPQEAASAMNRMAKLCARYLGNRGFSIGISD-VTPADD 722
           +DK  +G      + + + R+ GP   A     + K+   +L + GFS GI D V     
Sbjct: 617 VDKKTVG-SSSGGLIHVVTREKGPTICARLFGNIQKVVNFWLLHNGFSTGIGDTVADGQT 675

Query: 723 LKQKKEDLVEIAYAKCDELIDLYNKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGDVCI 782
           +++  E + E A  K + +        L  + G    ++ E  +   L++ R+  G +  
Sbjct: 676 MREISETIAE-AKQKVEAVTKEAQANLLTAKHGMTLRESFEDNVVRFLNEARDRAGRLAE 734

Query: 783 NELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSKTP 842
             L +LN    M + GSKGS +N++QM A VGQQ + G R+  GF DR+LPHF K+  +P
Sbjct: 735 MNLKDLNNVKQMVSAGSKGSFINIAQMSACVGQQSVEGKRIGFGFVDRTLPHFSKDDYSP 794

Query: 843 QSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYDN 902
           +SKGFV NS+  GL+P EF FHA+ GREGL+DTAVKTAETGY+ RRL+K+LED+   YD 
Sbjct: 795 ESKGFVENSYLRGLTPQEFFFHAMGGREGLIDTAVKTAETGYIQRRLVKALEDIMVHYDG 854

Query: 903 TVRTSSNGIVQFTYGGDGLDPLEMEGNAQPV--NFNRSWDHAYNITFNNTDRGLLP 956
           T R S   ++QF YG DG+D   +E  +       +++++  Y I   NT   L P
Sbjct: 855 TTRNSLGNVIQFIYGEDGMDAGHIEKQSLDTMGGSDQAFERRYRIDLLNTSNSLEP 910

 Score =  183 bits (464), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 142/422 (33%), Positives = 218/422 (51%), Gaps = 54/422 (12%)

Query: 1055 ITQLYRITEDAVQKFLEIAISKYHRAKVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVA 1114
            + Q YR+T++A +  L    +++ R+ V PG  VG + AQSIGEP TQMTL TFHFAGVA
Sbjct: 1031 VLQEYRLTKEAFEWVLNNVEAQFLRSIVHPGEMVGVLAAQSIGEPATQMTLNTFHFAGVA 1090

Query: 1115 SMNVTLGVPRIKEIINASKVISTPIINAVL--VNNNDERAARVVKGRIEKTLLSDVC--- 1169
            S  VT GVPR+KEI+N +K + TP +   L    + D+  A++V+  IE T L  V    
Sbjct: 1091 SKKVTSGVPRLKEILNVAKNMKTPSLTVYLEPEYSADQEKAKLVRSAIEHTTLKSVTVAS 1150

Query: 1170 --YYIQD----VYKENMAYLQVKVDL------NTIDK-----LQLEL---TIEDIAIAIT 1209
              YY  D    V  E+   +Q+   L        +D+     L+LEL    + D  + + 
Sbjct: 1151 EIYYDPDPRSTVIPEDDEIIQLHFSLLDDETEKLLDQQSPWLLRLELDRAAMNDKDLTMG 1210

Query: 1210 RAPKLKIQT--SDVTVL----GKDKIAIN---VLPEGFGSKTSSTSLKEPTENDVFYRMQ 1260
            +  +    T  +D+ V+      +K+ I    V P+   ++T      E  E+ +  +++
Sbjct: 1211 QVGERIKDTFKNDLFVIWSEDNAEKLIIRCRVVRPKALDAET------EAEEDHMLKKIE 1264

Query: 1261 TLRRALPSIMVKGLNDIARAVINIRD------DGKRE------LLVEGYGLRDVMCTDGV 1308
                 L +I ++G+  I R V+   D       G+ +      L  +G  L +VM   GV
Sbjct: 1265 NT--MLENITLRGIEGIERVVMMKYDRKVPNETGEYQKVPEWVLETDGVNLSEVMTVPGV 1322

Query: 1309 IGAKTATNHVLEIFNVLGIEAARASIIGEIDYTMSNHGMSVDPRHIQLLGDVMTFKGEVL 1368
               +  TN  ++I  VLGIEA RA++  E+   +++ G  V+ RH+ LL DVMT +G + 
Sbjct: 1323 DPTRIYTNSFIDIMEVLGIEAGRAALYKEVYNVIASDGSYVNYRHMALLVDVMTTQGGLT 1382

Query: 1369 GITRFGLSKMRDSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFK 1428
             +TR G ++     L   SFE+T + LF+A    + D   GVSE +ILGQ   IGTG+F 
Sbjct: 1383 SVTRHGFNRSSTGALMRCSFEETVEILFEAGASAELDDCRGVSENVILGQMAPIGTGAFD 1442

Query: 1429 VV 1430
            V+
Sbjct: 1443 VM 1444

>Kwal_56.24489 s56 (1018237..1023423) [5187 bp, 1728 aa] {ON}
           YDL140C (RPO21) - RNA polymerase II large subunit
           [contig 161] FULL
          Length = 1728

 Score =  564 bits (1454), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 361/952 (37%), Positives = 517/952 (54%), Gaps = 92/952 (9%)

Query: 1   MKEVVIGETPKR-ISGLEFSALSPADIVAQSELEISSRDLFDLENNRSPKEGGALDPRMG 59
           M E      P R +  ++F   SP ++ A S  +I   +  D E     K GG  DPR+G
Sbjct: 1   MVEFPYSSAPLRTVKEVQFGMFSPEEVRAISVAKIEFPETMD-ETQMRAKVGGLNDPRLG 59

Query: 60  VSASSMECTTCHGNLASCHGHFGHIKLALPVFHVGYFKATIQILQGICKTCSAILLSEQD 119
               + +C TC   +  C GHFGHI+LA PVFH+GY     ++ + +C  C  +LL E  
Sbjct: 60  SIDRNFKCQTCGEGMNDCPGHFGHIELAKPVFHIGYISKIKKVCECVCMHCGKLLLDEH- 118

Query: 120 KRHFLSELRRPGV---DNLRRMALLKKVLDQCKKQRRCLHCXXXXXXXXXXXXXXXXXSL 176
                SEL +  +   D  RR      V   CK +  C                     +
Sbjct: 119 -----SELMKQAIKIKDPKRR---FNAVWSLCKVKMVC------------------ETEV 152

Query: 177 KIIHDTFRWVGK------KSTPEKD--KWIGDWKEVLSHNP--ELERYVKRATDDLNPLK 226
              +D  ++V +      + +  KD    +G WK+    +   + ER +  A +      
Sbjct: 153 PSDNDPSQYVSRGGCGNTQPSVRKDGLSLVGTWKKDKGADDADQPERRIISADE------ 206

Query: 227 TLNLFKQIASEDCELLGIDATNKAGRPETYIWRYIPAPPVCIRPSVMMQDSPASNEDDLT 286
            LN+FK I+ ED   LG +      RPE  I   +P PP  +RPS+   ++    EDDLT
Sbjct: 207 VLNVFKHISPEDSVRLGFN--EDFARPEWMILTVLPVPPPPVRPSISFNET-QRGEDDLT 263

Query: 287 VKLTEIVWTSSLIKAGIEKGISINNMMEHWDYLQMTVAMYINSD-SINPAMLPGSSTGGG 345
            KL +I+  +  ++     G   + + E    LQ  VA Y+++D +  P  L  S     
Sbjct: 264 YKLGDILKANINVQRLEINGSPQHVIQESEALLQFHVATYMDNDIAGQPQALQKSG---- 319

Query: 346 KVKPIRGFCQRLKGKQGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPQLVAKVLTFP 405
             +PI+    RLKGK+GR RGNL GKRVDFS RTVIS DPNL +D+V VP+ +A+ LT+P
Sbjct: 320 --RPIKSIRARLKGKEGRIRGNLMGKRVDFSARTVISGDPNLDLDQVGVPKSIARTLTYP 377

Query: 406 EKVTRYNIKKLRQLVQNGPNVHPGANYLLKKNEEARRNLRYGDRQKLANNLQYGDVVERH 465
           E VT YNI +L QLV+NGPN HPGA Y+++ N + R +LRY  R      LQYG  VERH
Sbjct: 378 EVVTPYNIDRLTQLVRNGPNEHPGAKYVIRDNGD-RIDLRYSKRAGDIQ-LQYGWKVERH 435

Query: 466 LEDGDVVLFNRQPSLHRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTE 525
           + D D VLFNRQPSLH++S+++H  K+ P+ TFRLN  V +PYNADFDGDEMNLHVPQ+E
Sbjct: 436 IIDEDPVLFNRQPSLHKMSMMAHRVKVMPYSTFRLNLSVTSPYNADFDGDEMNLHVPQSE 495

Query: 526 EARAEAINLMGVKNNLLTPKSGEPIIAATQDFITGSYLISHKDSFFDKASLTQLLSMMS- 584
           E RAE   L  V   +++ +S +P +   QD + G   ++ +D+F +   L Q+L+M+  
Sbjct: 496 ETRAELSQLCAVPQQIVSAQSNKPCMGIVQDTLCGVRKMTLRDTFIE---LEQVLNMLYW 552

Query: 585 ----DGSLQFDIPPPAIMKPCYLWTGKQVFSLLIKPNKNSPVKINLDA--KNKVYIPPKQ 638
               DG     IP P I+KP  LW+GKQ+ S+ I      P  I+L    +    + PK 
Sbjct: 553 IPDWDGV----IPTPIILKPKPLWSGKQILSIAI------PTGIHLQRFDEGTTLLSPK- 601

Query: 639 KHYPNEMSQNDGFVIVRGSQILSGVMDKSVLGDGKKHSVFYTILRDFGPQEAASAMNRMA 698
                    ++G +I+ G QI+ GV+DK  +G      + + + R+ GP+  A   + + 
Sbjct: 602 ---------DNGMLIIDG-QIIFGVVDKKTVGSSSG-GLIHVVTREKGPKICARLFSNLQ 650

Query: 699 KLCARYLGNRGFSIGISDVTPADDLKQKKEDLVEIAYAKCDELIDLYNKGKLETQPGCNE 758
           K+   +L + GFSIGI D    +   ++  D + +A  K +E+        L  + G   
Sbjct: 651 KVVNYWLLHNGFSIGIGDTIADEKSMREITDAIVVAKRKVEEVTKEAQANLLTAKHGMTL 710

Query: 759 EQTLEAKIGGLLSKVREEVGDVCINELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQII 818
            ++ E  +   L++ R++ G      L +LN    M + GSKGS +N++QM A VGQQ +
Sbjct: 711 RESFEDNVVRYLNEARDKAGRSAEVNLKDLNNVKQMVSAGSKGSFINIAQMSACVGQQSV 770

Query: 819 SGNRVPDGFQDRSLPHFPKNSKTPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVK 878
            G R+  GF DR+LPHF K+  +P+SKGFV NS+  GL+P EF FHA+ GREGL+DTAVK
Sbjct: 771 EGKRIAFGFADRTLPHFSKDDYSPESKGFVENSYLRGLTPQEFFFHAMGGREGLIDTAVK 830

Query: 879 TAETGYMSRRLMKSLEDLSCQYDNTVRTSSNGIVQFTYGGDGLDPLEMEGNA 930
           TAETGY+ RRL+K+LED+   YD T R S   ++QF YG DG+D   +E  A
Sbjct: 831 TAETGYIQRRLVKALEDIMVHYDGTTRNSLGNVIQFIYGEDGMDAAHIEKQA 882

 Score =  191 bits (486), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 139/429 (32%), Positives = 208/429 (48%), Gaps = 57/429 (13%)

Query: 1050 IVQHSITQLYRITEDAVQKFLEIAISKYHRAKVEPGTAVGAIGAQSIGEPGTQMTLKTFH 1109
            +    + Q YR+ +   +  L    +++ R+ V PG  VG + AQSIGEP TQMTL TFH
Sbjct: 1026 LASRRVIQEYRLNKQTFEWVLSNVEAQFLRSLVHPGEMVGVLAAQSIGEPATQMTLNTFH 1085

Query: 1110 FAGVASMNVTLGVPRIKEIINASKVISTPIINAVLVNNN--DERAARVVKGRIEKTLLSD 1167
            FAGVAS  VT GVPR+KEI+N +K + TP +   L   +  D+  A++++  IE T L  
Sbjct: 1086 FAGVASKKVTSGVPRLKEILNVAKNMKTPSLTVYLDEEHAADQEKAKLIRSAIEHTTLKS 1145

Query: 1168 VCYYIQDVYKENMAYLQVKVDLNTIDKLQLELTIEDIAIAITRAPKLKIQTSDVTVLGKD 1227
            +     ++Y +      V  D   I +L   L  E+   +      L  Q+  +  L  D
Sbjct: 1146 ITV-ASEIYYDPDPRSTVIEDDEEIIQLHFSLMDEETEQS------LDYQSPWLLRLELD 1198

Query: 1228 KIAINVLPEGFGSKTSSTSLKEPTENDVFY------------RMQTLR------------ 1263
            + A+N      G       +KE  +ND+F             R + +R            
Sbjct: 1199 RAAMNDKDLTMGQ--VGEKIKETFKNDLFVIWSEDNAEKLVIRCRVVRDPKTLDAEAEAE 1256

Query: 1264 ----------RALPSIMVKGLNDIARAVINIRDDG------------KRELLVEGYGLRD 1301
                        L SI ++G+ DI R V+   D              +  L  +G  L +
Sbjct: 1257 EDHMLKRIENTMLESITLRGVEDITRVVMMKYDRKVPSPAGDYHKIPEWVLETDGVNLAE 1316

Query: 1302 VMCTDGVIGAKTATNHVLEIFNVLGIEAARASIIGEIDYTMSNHGMSVDPRHIQLLGDVM 1361
            VMC  GV  A+  TN  ++I NVLGIEA RA++  E+   +++ G  V+ RH+ LL DVM
Sbjct: 1317 VMCVPGVDPARIYTNSFIDIMNVLGIEAGRAALYKEVYNVIASDGSYVNYRHMALLVDVM 1376

Query: 1362 TFKGEVLGITRFGLSKMRDSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMS 1421
            T +G ++ +TR G ++     L   SFE+T + LF+A    + D   GVSE ++LGQ   
Sbjct: 1377 TSQGFLMSVTRHGFNRSDTGALMRCSFEETVEILFEAGAAAELDDCRGVSENVLLGQVAP 1436

Query: 1422 IGTGSFKVV 1430
            IGTG+F V+
Sbjct: 1437 IGTGAFDVM 1445

>KLTH0H02046g Chr8 complement(182788..188010) [5223 bp, 1740 aa]
           {ON} highly similar to uniprot|P04050 Saccharomyces
           cerevisiae YDL140C
          Length = 1740

 Score =  563 bits (1452), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 366/969 (37%), Positives = 524/969 (54%), Gaps = 94/969 (9%)

Query: 1   MKEVVIGETPKR-ISGLEFSALSPADIVAQSELEISSRDLFDLENNRSPKEGGALDPRMG 59
           M E      P R +  ++F   SP ++ A S  +I   +  D E     K GG  DPR+G
Sbjct: 1   MVEFPYSSAPLRTVKEVQFGIFSPEEVRAISVAKIEFPETMD-ETQMRAKVGGLNDPRLG 59

Query: 60  VSASSMECTTCHGNLASCHGHFGHIKLALPVFHVGYFKATIQILQGICKTCSAILLSEQD 119
               + +C TC   +  C GHFGHI+LA PVFH+GY     ++ + +C  C  +LL E  
Sbjct: 60  SIDRNYKCQTCGEGMNDCPGHFGHIELAKPVFHIGYISKIKKVCECVCMHCGKLLLDEH- 118

Query: 120 KRHFLSELRRPGV---DNLRRMALLKKVLDQCKKQRRCLHCXXXXXXXXXXXXXXXXXSL 176
                SEL R  +   D  RR      V   CK +  C                     +
Sbjct: 119 -----SELMRQAIKIKDPKRR---FNAVWSLCKAKMVC------------------ETEV 152

Query: 177 KIIHDTFRWVGK------KSTPEKD--KWIGDWKEVLSHNP--ELERYVKRATDDLNPLK 226
              +D  ++V +      + +  KD    +G WK+    +   + ER V  A +      
Sbjct: 153 PSDNDPAQYVSRGGCGNTQPSVRKDGLSLVGTWKKDKGADDADQPERRVISADE------ 206

Query: 227 TLNLFKQIASEDCELLGIDATNKAGRPETYIWRYIPAPPVCIRPSVMMQDSPASNEDDLT 286
            LN+FK I+ ED   LG +      RPE  I   +P PP  +RPS+   ++    EDDLT
Sbjct: 207 VLNVFKHISPEDSVRLGFN--EDFARPEWMILTVLPVPPPPVRPSISFNET-QRGEDDLT 263

Query: 287 VKLTEIVWTSSLIKAGIEKGISINNMMEHWDYLQMTVAMYINSD-SINPAMLPGSSTGGG 345
            KL +I+  +  ++     G   + + E    LQ  VA Y+++D +  P  L  S     
Sbjct: 264 YKLGDILKANINVQRLEINGSPQHVIQESEALLQFHVATYMDNDIAGQPQALQKSG---- 319

Query: 346 KVKPIRGFCQRLKGKQGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPQLVAKVLTFP 405
             +PI+    RLKGK+GR RGNL GKRVDFS RTVIS DPNL +D+V VP+ +A+ LT+P
Sbjct: 320 --RPIKSIRARLKGKEGRIRGNLMGKRVDFSARTVISGDPNLDLDQVGVPKSIARTLTYP 377

Query: 406 EKVTRYNIKKLRQLVQNGPNVHPGANYLLKKNEEARRNLRYGDRQKLANNLQYGDVVERH 465
           E VT YNI +L QLV+NGPN HPGA Y+++ N + R +LRY  R      LQYG  VERH
Sbjct: 378 EVVTPYNIDRLTQLVRNGPNEHPGAKYIIRDNGD-RIDLRYSKRAGDIQ-LQYGWKVERH 435

Query: 466 LEDGDVVLFNRQPSLHRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTE 525
           + D D VLFNRQPSLH++S+++H  K+ P+ TFRLN  V +PYNADFDGDEMNLHVPQ+E
Sbjct: 436 IIDEDPVLFNRQPSLHKMSMMAHRVKVMPYSTFRLNLSVTSPYNADFDGDEMNLHVPQSE 495

Query: 526 EARAEAINLMGVKNNLLTPKSGEPIIAATQDFITGSYLISHKDSFFDKASLTQLLSMMS- 584
           E RAE   L  V   +++ +S +P +   QD + G   ++ +D+F +   L Q+L+M+  
Sbjct: 496 ETRAELSQLCAVPQQIVSAQSNKPCMGIVQDTLCGVRKMTLRDTFIE---LDQVLNMLYW 552

Query: 585 ----DGSLQFDIPPPAIMKPCYLWTGKQVFSLLIKPNKNSPVKINLDA--KNKVYIPPKQ 638
               DG     IP P I+KP  LW+GKQ+ S+ I      P  I+L    +    + PK 
Sbjct: 553 IPDWDGV----IPTPIILKPKPLWSGKQILSIAI------PSGIHLQRFDEGTTLLSPK- 601

Query: 639 KHYPNEMSQNDGFVIVRGSQILSGVMDKSVLGDGKKHSVFYTILRDFGPQEAASAMNRMA 698
                    ++G +I+ G QI+ GV+DK  +G      + + + R+ GP+  A   + + 
Sbjct: 602 ---------DNGMLIIDG-QIIFGVVDKKTVGSSSG-GLIHVVTREKGPKICARLFSNLQ 650

Query: 699 KLCARYLGNRGFSIGISDVTPADDLKQKKEDLVEIAYAKCDELIDLYNKGKLETQPGCNE 758
           K+   +L + GFSIGI D    +   ++  + + +A  K +E+        L  + G   
Sbjct: 651 KVVNFWLLHNGFSIGIGDTIADEKSMREITEAIIVAKRKVEEVTKEAQANLLTAKHGMTL 710

Query: 759 EQTLEAKIGGLLSKVREEVGDVCINELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQII 818
            ++ E  +   L++ R++ G      L +LN    M + GSKGS +N++QM A VGQQ +
Sbjct: 711 RESFEDSVVRYLNEARDKAGRSAEVNLKDLNNVKQMVSAGSKGSFINIAQMSACVGQQSV 770

Query: 819 SGNRVPDGFQDRSLPHFPKNSKTPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVK 878
            G R+  GF DR+LPHF K+  +P+SKGFV NS+  GL+P EF FHA+ GREGL+DTAVK
Sbjct: 771 EGKRIAFGFADRTLPHFSKDDYSPESKGFVENSYLRGLTPQEFFFHAMGGREGLIDTAVK 830

Query: 879 TAETGYMSRRLMKSLEDLSCQYDNTVRTSSNGIVQFTYGGDGLDPLEMEGNAQPVNFNRS 938
           TAETGY+ RRL+K+LED+   YD T R S   ++QF YG DG+D   +E   Q ++   S
Sbjct: 831 TAETGYIQRRLVKALEDIMVHYDGTTRNSLGNVIQFIYGEDGMDAAHIE--KQTIDTIAS 888

Query: 939 WDHAYNITF 947
            D A+   F
Sbjct: 889 SDAAFERRF 897

 Score =  192 bits (488), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 140/424 (33%), Positives = 209/424 (49%), Gaps = 57/424 (13%)

Query: 1055 ITQLYRITEDAVQKFLEIAISKYHRAKVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVA 1114
            + Q YR+ +   +  L    S++ R+ V PG  VG + AQSIGEP TQMTL TFHFAGVA
Sbjct: 1031 VIQEYRLNKQTFEWVLSNVESQFLRSIVHPGEMVGVLAAQSIGEPATQMTLNTFHFAGVA 1090

Query: 1115 SMNVTLGVPRIKEIINASKVISTPIINAVLVNNN--DERAARVVKGRIEKTLLSDVCYYI 1172
            S  VT GVPR+KEI+N +K + TP +   L  ++  D+  A++++  IE T L  +    
Sbjct: 1091 SKKVTSGVPRLKEILNVAKNMKTPSLTVYLDKDHAADQEKAKLIRSAIEHTTLKSITVAS 1150

Query: 1173 QDVYKENMAYLQVKVDLNTIDKLQLELTIEDIAIAITRAPKLKIQTSDVTVLGKDKIAIN 1232
            +  Y  +     ++ D   I   QL  ++ D     +    L  Q+  +  L  D+ A+N
Sbjct: 1151 EIYYDPDPRSTVIEEDEEII---QLHFSLMDEETEQS----LDYQSPWLLRLELDRAAMN 1203

Query: 1233 VLPEGFGSKTSSTSLKEPTENDVFY------------RMQTLR----------------- 1263
                  G       +KE  +ND+F             R + +R                 
Sbjct: 1204 DKDLTMGQ--VGEKIKETFKNDLFVIWSEDNAEKLIIRCRVVRDPKTLDAEAEAEEDHML 1261

Query: 1264 -----RALPSIMVKGLNDIARAVINIRD------DGKRE------LLVEGYGLRDVMCTD 1306
                   L SI ++G+ DI R V+   D       G+        L  +G  L +VMC  
Sbjct: 1262 KRIENTMLESITLRGVEDITRVVMMKYDRKVPSPTGEYHKVPEWVLETDGVNLAEVMCVP 1321

Query: 1307 GVIGAKTATNHVLEIFNVLGIEAARASIIGEIDYTMSNHGMSVDPRHIQLLGDVMTFKGE 1366
            GV  A+  TN  ++I NVLGIEA RA++  E+   +++ G  V+ RH+ LL DVMT +G 
Sbjct: 1322 GVDPARIYTNSFIDIMNVLGIEAGRAALYKEVYNVIASDGSYVNYRHMALLVDVMTSQGF 1381

Query: 1367 VLGITRFGLSKMRDSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGS 1426
            ++ +TR G ++     L   SFE+T + LF+A    + D   GVSE ++LGQ   IGTG+
Sbjct: 1382 LMSVTRHGFNRSDTGALMRCSFEETVEILFEAGAAAELDDCRGVSENVLLGQVAPIGTGA 1441

Query: 1427 FKVV 1430
            F V+
Sbjct: 1442 FDVM 1445

>Kwal_55.21464 s55 (850323..851285) [963 bp, 320 aa] {OFF} YOR116C
            (RPO31) - RNA polymerase III large subunit [contig 130]
            FULL
          Length = 320

 Score =  519 bits (1336), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 250/312 (80%), Positives = 281/312 (90%)

Query: 1144 LVNNNDERAARVVKGRIEKTLLSDVCYYIQDVYKENMAYLQVKVDLNTIDKLQLELTIED 1203
            LVN NDERAARVVKGRIEKTLLSDV +YIQDVYK+N+++LQVK+DL TI+KLQLELTIED
Sbjct: 4    LVNMNDERAARVVKGRIEKTLLSDVAFYIQDVYKDNLSFLQVKIDLGTIEKLQLELTIED 63

Query: 1204 IAIAITRAPKLKIQTSDVTVLGKDKIAINVLPEGFGSKTSSTSLKEPTENDVFYRMQTLR 1263
            IA+AITRA KLKI   DV+++GKDK+ INV PEG   K+ STS KEP EN++FYR+Q LR
Sbjct: 64   IAVAITRASKLKIAAQDVSIIGKDKVNINVYPEGSKLKSISTSAKEPIENELFYRVQHLR 123

Query: 1264 RALPSIMVKGLNDIARAVINIRDDGKRELLVEGYGLRDVMCTDGVIGAKTATNHVLEIFN 1323
            R+LP I+VKGL DIARAVINI+ DG RELLVEGYGLRDVM TDGV+G KT TNH+LE+ +
Sbjct: 124  RSLPGIVVKGLPDIARAVINIKSDGSRELLVEGYGLRDVMTTDGVVGHKTKTNHILEVVS 183

Query: 1324 VLGIEAARASIIGEIDYTMSNHGMSVDPRHIQLLGDVMTFKGEVLGITRFGLSKMRDSVL 1383
            VLGIEAAR SI+GEIDYTMSNHGMSVDPRH+QLLGDVMT+KGEVLGITRFGLSKMRDSVL
Sbjct: 184  VLGIEAARTSIVGEIDYTMSNHGMSVDPRHVQLLGDVMTYKGEVLGITRFGLSKMRDSVL 243

Query: 1384 QLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVVKNTDIAEDELKPK 1443
            QLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTG+FKVVK T+++ +ELKPK
Sbjct: 244  QLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGAFKVVKGTNLSSEELKPK 303

Query: 1444 RTLFESLTSNVA 1455
             TLFESL  N A
Sbjct: 304  ATLFESLCGNTA 315

>TDEL0C02320 Chr3 complement(403851..409034) [5184 bp, 1727 aa] {ON}
           Anc_7.314 YDL140C
          Length = 1727

 Score =  563 bits (1450), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 359/968 (37%), Positives = 527/968 (54%), Gaps = 91/968 (9%)

Query: 11  KRISGLEFSALSPADIVAQSELEISSRDLFDLENNRSPKEGGALDPRMGVSASSMECTTC 70
           + +  ++F   SP ++ A S  +I   +  D    R+ K GG  DPR+G    +++C TC
Sbjct: 12  RTVKEVQFGLFSPEEVRAISVAKIRFPETMDETQTRA-KIGGLNDPRLGSIDRNLKCQTC 70

Query: 71  HGNLASCHGHFGHIKLALPVFHVGYFKATIQILQGICKTCSAILLSEQDKRHFLSELRRP 130
              +  C GHFGHI LA PVFH+G+     ++ + +C  C  +LL + ++     ++R+ 
Sbjct: 71  QEGMNECPGHFGHIDLAKPVFHIGFITKIKKVCECVCMHCGKLLLDDHNE-----QMRQA 125

Query: 131 GV--DNLRRMALLKKVLDQCKKQRRCLHCXXXXXXXXXXXXXXXXXSLKIIHDTFRWVGK 188
               D+ +R      +   CK +  C                     +    D  + + +
Sbjct: 126 CKIKDSKKR---FNAIWTLCKTKMIC------------------ESDVPSEEDPTKLISR 164

Query: 189 ------KSTPEKD--KWIGDWK-EVLSHNPEL-ERYVKRATDDLNPLKTLNLFKQIASED 238
                 + T  KD  K +G WK E  + +PE  E+ +      L   + LN+FK I+ ED
Sbjct: 165 GGCGNAQPTVRKDGLKLVGSWKKEKNTGDPEEPEQRI------LTMEEILNIFKHISKED 218

Query: 239 CELLGIDATNKAGRPETYIWRYIPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSL 298
              LG +   +  RPE  I   +P PP  +RPS+   +S    EDDLT KL +I+  +  
Sbjct: 219 SNRLGFN--EEFARPEWMILTVLPVPPPPVRPSISFNES-QRGEDDLTFKLADILKANIS 275

Query: 299 IKAGIEKGISINNMMEHWDYLQMTVAMYINSD-SINPAMLPGSSTGGGKVKPIRGFCQRL 357
           ++     G   + + E    LQ  VA Y+++D +  P  L  S       +P++    RL
Sbjct: 276 LETLEHNGAPHHAIEEAESLLQFHVATYMDNDIAGQPQALQKSG------RPVKSIRARL 329

Query: 358 KGKQGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPQLVAKVLTFPEKVTRYNIKKLR 417
           KGK+GR RGNL GKRVDFS RTVIS DPNL +D+V VP+ +AK LT+PE VT YNI +L 
Sbjct: 330 KGKEGRIRGNLMGKRVDFSARTVISGDPNLELDQVGVPKSIAKTLTYPEVVTPYNIDRLT 389

Query: 418 QLVQNGPNVHPGANYLLKKNEEARRNLRYGDRQKLANNLQYGDVVERHLEDGDVVLFNRQ 477
            LV+NGPN HPGA Y+++ N + R +LRY  R      LQYG  VERH+ D D VLFNRQ
Sbjct: 390 FLVRNGPNEHPGAKYVIRDNGD-RIDLRYSKRAGDIQ-LQYGWKVERHIMDNDPVLFNRQ 447

Query: 478 PSLHRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGV 537
           PSLH++S+++H  K+ P+ TFRLN  V +PYNADFDGDEMNLHVPQ+EE RAE   L  V
Sbjct: 448 PSLHKMSMMAHRVKVMPYSTFRLNLSVTSPYNADFDGDEMNLHVPQSEETRAELSQLCAV 507

Query: 538 KNNLLTPKSGEPIIAATQDFITGSYLISHKDSFFDKASLTQLLSMMS-----DGSLQFDI 592
              +++P+S +P +   QD + G   ++ +D+F +   L Q+L+M+      DG     I
Sbjct: 508 PLQIVSPQSNKPCMGIVQDTLCGIRKLTLRDNFIE---LDQVLNMLYWVPDWDGV----I 560

Query: 593 PPPAIMKPCYLWTGKQVFSLLIKPNKNSPVKINLDA--KNKVYIPPKQKHYPNEMSQNDG 650
           P PAI+KP  LWTGKQ+ S+ I      P  I+L    +    + PK          ++G
Sbjct: 561 PTPAIIKPKPLWTGKQILSIAI------PKGIHLQRFDEGTTLLSPK----------DNG 604

Query: 651 FVIVRGSQILSGVMDKSVLGDGKKHSVFYTILRDFGPQEAASAMNRMAKLCARYLGNRGF 710
            +I+ G +I+ GV+DK  +G      + + + R+ GPQ  A     + K+   +  + GF
Sbjct: 605 MLIIDG-KIIFGVVDKKTVGSSSG-GLIHVVTREKGPQICARLFGNIQKVVNYWFLHNGF 662

Query: 711 SIGISDVTPADDLKQKKEDLVEIAYAKCDELIDLYNKGKLETQPGCNEEQTLEAKIGGLL 770
           S GI D        ++  + +  A  K +++        L  + G    ++ E  +   L
Sbjct: 663 STGIGDTIADGQTMREITETIADAKKKVEDVTKEAQANLLTAKHGMTLRESFEDNVVRFL 722

Query: 771 SKVREEVGDVCINELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDR 830
           ++ R++ G +    L +LN    M + GSKGS +N++QM A VGQQ + G R+  GF DR
Sbjct: 723 NEARDKAGRLAEVNLKDLNNVKQMVSAGSKGSFINIAQMSACVGQQSVEGKRIAFGFVDR 782

Query: 831 SLPHFPKNSKTPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLM 890
           +LPHF K+  +P+SKGFV NS+  GL+P EF FHA+ GREGL+DTAVKTAETGY+ RRL+
Sbjct: 783 TLPHFSKDDYSPESKGFVENSYLRGLTPQEFFFHAMGGREGLIDTAVKTAETGYIQRRLV 842

Query: 891 KSLEDLSCQYDNTVRTSSNGIVQFTYGGDGLDPLEMEGNAQPV--NFNRSWDHAYNITFN 948
           K+LED+   YD+T R S   ++QF YG DG+D   +E  A       + +++  Y I   
Sbjct: 843 KALEDIMVHYDSTTRNSLGNVIQFVYGEDGMDASHIEKQAIDTIGGSDSAFEKRYRIDLL 902

Query: 949 NTDRGLLP 956
           N D  L P
Sbjct: 903 NPDHLLDP 910

 Score =  160 bits (406), Expect = 8e-39,   Method: Compositional matrix adjust.
 Identities = 125/401 (31%), Positives = 200/401 (49%), Gaps = 35/401 (8%)

Query: 1055 ITQLYRITEDAVQKFLEIAISKYHRAKVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVA 1114
            + + YR+T+ A +  L     ++ R+ V PG  VG + AQSIGEP TQMTL TFHFAGVA
Sbjct: 1031 VIEEYRLTKQAFEWVLNNIEIQFLRSIVHPGEMVGVLAAQSIGEPATQMTLNTFHFAGVA 1090

Query: 1115 SMNVTLGVPRIKEIINASKVISTPIINAVLVN---------NNDERAARVVKG----RIE 1161
            S  VT GVPR+      +K I + I +  L +         + D R+  + +     ++ 
Sbjct: 1091 SKKVTSGVPRLXXXXEKAKFIRSAIEHTTLKSVTVASEIYYDPDPRSTVIAEDEEIIQLH 1150

Query: 1162 KTLLSDVCYYIQDVYKENMAYLQVKVDLNTIDKLQLELTIEDIAIAITRAPKLKIQTSDV 1221
             +LL D      D  +++   L++++D   ++    +LT+  +   I    K     +D+
Sbjct: 1151 FSLLDDETEKSLD--QQSPWLLRLELDRAAMN--DKDLTMGQVGEKIKETFK-----NDL 1201

Query: 1222 TVLGKDKIAINVLPEGFGSKTSSTSLKEPTENDVFYRMQTLRRALPSIMVKGLNDIARAV 1281
             V+  +  A  ++      +  S  ++   E D   + +     L +I ++G+ +I R V
Sbjct: 1202 FVIWSEDNAEKLIIRCRVVRPKSMDIETEAEEDHMLK-KIENTMLENITLRGVENIERVV 1260

Query: 1282 INIRD------DGKRE------LLVEGYGLRDVMCTDGVIGAKTATNHVLEIFNVLGIEA 1329
            +   D       G+        L  +G  L +VM   GV   +  TN  ++I  VLGIEA
Sbjct: 1261 MMKYDRKVPSATGEYHKVPEWVLETDGVNLSEVMTVPGVDSKRIYTNSFIDIMEVLGIEA 1320

Query: 1330 ARASIIGEIDYTMSNHGMSVDPRHIQLLGDVMTFKGEVLGITRFGLSKMRDSVLQLASFE 1389
             RA++  E+   +++ G  V+ RH+ LL DVMT +G +  +TR G ++     L   SFE
Sbjct: 1321 GRAALYKEVYNVIASDGSYVNYRHMALLVDVMTTQGGLTSVTRHGFNRSATGALMRCSFE 1380

Query: 1390 KTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVV 1430
            +T + LF+A    + D   GVSE +ILGQ   IGTGSF V+
Sbjct: 1381 ETVEILFEAGACAEMDDCRGVSENVILGQMAPIGTGSFDVM 1421

>NDAI0A02130 Chr1 complement(477808..482997) [5190 bp, 1729 aa] {ON}
           Anc_7.314
          Length = 1729

 Score =  561 bits (1447), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 354/955 (37%), Positives = 513/955 (53%), Gaps = 65/955 (6%)

Query: 11  KRISGLEFSALSPADIVAQSELEISSRDLFDLENNRSPKEGGALDPRMGVSASSMECTTC 70
           + +  ++F   SP ++ A S  +I   +  D    R+ K GG  DPR+G    +++C TC
Sbjct: 12  RTVKEVQFGLFSPEEVRAISVAKIRFPETMDETQTRA-KIGGLNDPRLGSIDRNLKCQTC 70

Query: 71  HGNLASCHGHFGHIKLALPVFHVGYFKATIQILQGICKTCSAILLSEQDKRHFLSELRRP 130
              +  C GHFGHI LA PV HVG+     ++ + +C  C  +LL E +      E  R 
Sbjct: 71  QEGMNECPGHFGHIDLAKPVLHVGFIAKIKKVCESVCMHCGKLLLDEHN------EQMRQ 124

Query: 131 GVDNLRRMALLKKVLDQCKKQRRCLHCXXXXXXXXXXXXXXXXXSLKIIHDTFRWVGKKS 190
            +           V + CK +   + C                        T R  G K 
Sbjct: 125 AIAIKDSKKRFNAVWNLCKTK---MICDTDVPSDDDPTQLISRGGCGNAQPTVRKDGLK- 180

Query: 191 TPEKDKWIGDWKEVLSHNP--ELERYVKRATDDLNPLKTLNLFKQIASEDCELLGIDATN 248
                  +G WK+  + N   E E+ V      L+  + LN+FK I+ ED   LG +   
Sbjct: 181 ------LVGSWKKEKNTNDGDEPEQRV------LSTEEILNIFKHISPEDSTRLGFN--E 226

Query: 249 KAGRPETYIWRYIPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIKAGIEKGIS 308
           +  RPE  I   +P PP  +RPS+   +S    EDDLT KL +I+  +  ++     G  
Sbjct: 227 EFARPEWMILNVLPVPPPPVRPSISFNES-QRGEDDLTFKLADILKANISLETLEHNGAP 285

Query: 309 INNMMEHWDYLQMTVAMYINSD-SINPAMLPGSSTGGGKVKPIRGFCQRLKGKQGRFRGN 367
            + + E    LQ  VA Y+++D +  P  L  S       +P++    RLKGK+GR RGN
Sbjct: 286 HHAIEEAESLLQFHVATYMDNDIAGQPQALQKSG------RPVKSIRARLKGKEGRIRGN 339

Query: 368 LSGKRVDFSGRTVISPDPNLSIDEVAVPQLVAKVLTFPEKVTRYNIKKLRQLVQNGPNVH 427
           L GKRVDFS RTVIS DPNL +D+V VP+ +A+ LT+PE VT YNI +L QLV+NGPN H
Sbjct: 340 LMGKRVDFSARTVISGDPNLELDQVGVPKSIARTLTYPEVVTPYNIDRLTQLVRNGPNEH 399

Query: 428 PGANYLLKKNEEARRNLRYGDRQKLANNLQYGDVVERHLEDGDVVLFNRQPSLHRLSILS 487
           PGA Y+++ N + R +LRY  R      LQYG  VERH+ D D VLFNRQPSLH++S+++
Sbjct: 400 PGAKYVIRDNGD-RIDLRYSKRAGDIQ-LQYGWKVERHITDNDPVLFNRQPSLHKMSMMA 457

Query: 488 HYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNNLLTPKSG 547
           H  K+ P+ TFRLN  V +PYNADFDGDEMNLHVPQ+EE RAE   L  V   +++ +S 
Sbjct: 458 HRVKVIPYSTFRLNLSVTSPYNADFDGDEMNLHVPQSEETRAELSQLCAVPLQIVSAQSN 517

Query: 548 EPIIAATQDFITGSYLISHKDSFFDKASLTQLLSMMSDGSLQFD--IPPPAIMKPCYLWT 605
           +P +   QD + G   ++ +D+F +   +  +L  + D    +D  IP PAI+KP  LW+
Sbjct: 518 KPCMGIVQDTLCGIRKLTLRDTFLEFDEVLNMLYWVPD----WDGVIPTPAIIKPKPLWS 573

Query: 606 GKQVFSLLIKPNKNSPVKINLDA--KNKVYIPPKQKHYPNEMSQNDGFVIVRGSQILSGV 663
           GKQV S+ I      P  I+L    +    + PK          ++G ++V G QI+ GV
Sbjct: 574 GKQVLSIAI------PRGIHLQRFDEGTTLLSPK----------DNGMLVVDG-QIIFGV 616

Query: 664 MDKSVLGDGKKHSVFYTILRDFGPQEAASAMNRMAKLCARYLGNRGFSIGISDVTPADDL 723
           +DK  +G      + + + R+ GP   A     + K+   +L + GFS GI D       
Sbjct: 617 VDKKTVG-SSNGGLIHVVTREKGPTICAKLFGNIQKVVNFWLLHNGFSTGIGDTIADGST 675

Query: 724 KQKKEDLVEIAYAKCDELIDLYNKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGDVCIN 783
            ++  + +  A  K +++        L  + G    ++ E  +   L++ R++ G +   
Sbjct: 676 IKEITETIADAKRKVEDVTKEAQSNLLTAKHGMTLRESFEDNVVRFLNEARDKAGRLAEM 735

Query: 784 ELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSKTPQ 843
            L++LN    M + GSKGS +N++QM A VGQQ + G R+  GF DR+LPHF K+  +P+
Sbjct: 736 NLNDLNNVKQMVSAGSKGSFINIAQMSACVGQQSVEGKRIGYGFVDRTLPHFSKDDYSPE 795

Query: 844 SKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYDNT 903
           SKGFV NS+  GL+P EF FHA+ GREGL+DTAVKTAETGY+ RRL+K+LED+   YD T
Sbjct: 796 SKGFVENSYLRGLTPQEFFFHAMGGREGLIDTAVKTAETGYIQRRLVKALEDIMVHYDGT 855

Query: 904 VRTSSNGIVQFTYGGDGLDPLEMEGNAQPV--NFNRSWDHAYNITFNNTDRGLLP 956
            R S   ++QF YG DG+D   +E  +       + +++  Y I   N    L P
Sbjct: 856 ARNSLGNVIQFIYGEDGMDAAHIEKQSLDTIGGSDAAFEKRYRIDLMNPKNALDP 910

 Score =  187 bits (475), Expect = 6e-47,   Method: Compositional matrix adjust.
 Identities = 141/422 (33%), Positives = 222/422 (52%), Gaps = 54/422 (12%)

Query: 1055 ITQLYRITEDAVQKFLEIAISKYHRAKVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVA 1114
            I Q YR+T+ A +  L    +++ R+ V PG  VG + AQSIGEP TQMTL TFHFAGVA
Sbjct: 1031 ILQEYRLTKQAFEWVLNNVEAQFLRSVVHPGEMVGVLAAQSIGEPATQMTLNTFHFAGVA 1090

Query: 1115 SMNVTLGVPRIKEIINASKVISTPIINAVLVNN--NDERAARVVKGRIEKTLLSDVC--- 1169
            S  VT GVPR+KEI+N +K + TP +   L ++  +D+  A+ ++  IE T L  +    
Sbjct: 1091 SKKVTSGVPRLKEILNVAKNMKTPSLTVYLKDDYSSDQEKAKFIRSAIEHTTLKSITVAS 1150

Query: 1170 --YYIQD----VYKENMAYLQVKVDL------NTIDK-----LQLEL---TIEDIAIAIT 1209
              YY  D    V  E+   +Q+   L       ++D+     L+LEL    + D  + + 
Sbjct: 1151 EIYYDPDPRSTVIPEDDEIIQLHFSLLDDETEQSLDRQSPWLLRLELDRAAMNDKDLTMG 1210

Query: 1210 RAPKLKIQT--SDVTVL----GKDKIAIN---VLPEGFGSKTSSTSLKEPTENDVFYRMQ 1260
            +  +   +T  +D+ V+      +K+ I    V P+   ++T      E  E+ +  +++
Sbjct: 1211 QVGERIKETFRNDLFVIWSEDNAEKLIIRCRVVRPKSMDAET------EAEEDHMLKKIE 1264

Query: 1261 TLRRALPSIMVKGLNDIARAVINIRD------DGKRE------LLVEGYGLRDVMCTDGV 1308
                 L +I ++G+ +I R V+   D       G+ +      L  +G  L +VM   GV
Sbjct: 1265 NT--MLENITLRGVENIERVVMMKYDRKVPSQSGEYQKVPEWVLETDGVNLSEVMTVPGV 1322

Query: 1309 IGAKTATNHVLEIFNVLGIEAARASIIGEIDYTMSNHGMSVDPRHIQLLGDVMTFKGEVL 1368
               +  TN  ++I  VLGIEA RA++  E+   +++ G  V+ RH+ LL DVMT +G + 
Sbjct: 1323 DATRIYTNSFIDITEVLGIEAGRAALYREVYNVIASDGSYVNYRHMALLVDVMTTQGALT 1382

Query: 1369 GITRFGLSKMRDSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFK 1428
             ITR G ++     L  +SFE+T + LF+A    + D   GVSE ++LGQ   IGTG+F 
Sbjct: 1383 SITRHGFNRASTGALMRSSFEETVEILFEAGASAELDDCRGVSENVLLGQMAPIGTGAFD 1442

Query: 1429 VV 1430
            V+
Sbjct: 1443 VM 1444

>SAKL0F10472g Chr6 (808869..814061) [5193 bp, 1730 aa] {ON} highly
           similar to uniprot|P04050 Saccharomyces cerevisiae
           YDL140C
          Length = 1730

 Score =  561 bits (1447), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 362/956 (37%), Positives = 517/956 (54%), Gaps = 67/956 (7%)

Query: 11  KRISGLEFSALSPADIVAQSELEISSRDLFDLENNRSPKEGGALDPRMGVSASSMECTTC 70
           + I  ++F   SP ++ A S  +I   +  D E     K GG  DPR+G    + +C TC
Sbjct: 12  RTIKEVQFGLFSPEEVRAISVAKIEFPETMD-ETQMRAKVGGLNDPRLGSIDRNYKCQTC 70

Query: 71  HGNLASCHGHFGHIKLALPVFHVGYFKATIQILQGICKTCSAILLSEQDKRHFLSELRRP 130
              +  C GHFGHI+LA PVFH+G+     ++ + +C  C  +LL E +++   +   + 
Sbjct: 71  GEGMNDCPGHFGHIELAKPVFHIGFLSRIKKVCECVCMHCGKLLLDEHNEQMKQAIKIKD 130

Query: 131 GVDNLRRMALLKKVLDQCKKQRRCLHCXXXXXXXXXXXXXXXXXSLKIIHDTFRWVGKKS 190
                  +  L KV   C+ +                          I  D    VG   
Sbjct: 131 PKRRFNAVWTLSKVKMICETEVPS----EDDPTKYISRGGCGNTQPSIRKDGLSLVG--- 183

Query: 191 TPEKDKWIGDWKEVLSHNPELERYVKRATDDLNPLKTLNLFKQIASEDCELLGIDATNKA 250
           T +KDK   D     +  PE     KR    ++  + LN+FK I  ED   LG +     
Sbjct: 184 TWKKDKNADD-----ADQPE-----KRI---ISAEEVLNVFKHICPEDSWRLGFN--EDF 228

Query: 251 GRPETYIWRYIPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIKAGIEKGISIN 310
            RPE  +   +P PP  +RPS+   ++    EDDLT KL +I+  +  ++     G   +
Sbjct: 229 ARPEWMLLTVLPVPPPPVRPSISFNET-QRGEDDLTYKLGDILKANINVQRLEINGSPQH 287

Query: 311 NMMEHWDYLQMTVAMYINSD-SINPAMLPGSSTGGGKVKPIRGFCQRLKGKQGRFRGNLS 369
            + E    LQ  VA Y+++D +  P  L  S       +PI+    RLKGK+GR RGNL 
Sbjct: 288 VIQESEALLQFHVATYMDNDIAGQPQALQKSG------RPIKSIRARLKGKEGRIRGNLM 341

Query: 370 GKRVDFSGRTVISPDPNLSIDEVAVPQLVAKVLTFPEKVTRYNIKKLRQLVQNGPNVHPG 429
           GKRVDFS RTVIS DPNL +D+V VP+ +AK LT+PE VT YNI +L QLV+NGPN HPG
Sbjct: 342 GKRVDFSARTVISGDPNLDLDQVGVPKSIAKTLTYPEVVTPYNIDRLTQLVRNGPNEHPG 401

Query: 430 ANYLLKKNEEARRNLRYGDRQKLANNLQYGDVVERHLEDGDVVLFNRQPSLHRLSILSHY 489
           A Y+++ N + R +LRY  R      LQYG  VERH+ D D VLFNRQPSLH++S+++H 
Sbjct: 402 AKYVIRDNGD-RIDLRYSKRAGDIQ-LQYGWKVERHIIDNDPVLFNRQPSLHKMSMMAHR 459

Query: 490 AKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNNLLTPKSGEP 549
            K+ P+ TFRLN  V +PYNADFDGDEMNLHVPQ+EE RAE   L  V   +++P+S +P
Sbjct: 460 VKVMPYSTFRLNLSVTSPYNADFDGDEMNLHVPQSEETRAELSQLCAVPLQIVSPQSNKP 519

Query: 550 IIAATQDFITGSYLISHKDSFFDKASLTQLLSMMS-----DGSLQFDIPPPAIMKPCYLW 604
            +   QD + G   ++ +D+F +   L Q+L+M+      DG     IP P I+KP  LW
Sbjct: 520 CMGIVQDTLCGVRKMTLRDTFIE---LDQVLNMLYWVPDWDGV----IPTPTILKPKPLW 572

Query: 605 TGKQVFSLLIKPNKNSPVKINLDA--KNKVYIPPKQKHYPNEMSQNDGFVIVRGSQILSG 662
           +GKQ+ S+ I      P  I+L    +    + PK          ++G +IV G QI+ G
Sbjct: 573 SGKQILSMAI------PKGIHLQRFDEGTTLLSPK----------DNGMLIVDG-QIIFG 615

Query: 663 VMDKSVLGDGKKHSVFYTILRDFGPQEAASAMNRMAKLCARYLGNRGFSIGISDVTPADD 722
           V+DK  +G      + + + R+ GPQ  A   + + K+   +L + GFSIGI D      
Sbjct: 616 VVDKKTVG-SSNGGLIHIVTREKGPQICARLFSNIQKVVNYWLLHNGFSIGIGDTIADQK 674

Query: 723 LKQKKEDLVEIAYAKCDELIDLYNKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGDVCI 782
             ++  + + +A  K + +        L  + G    ++ E  +   L++ R++ G    
Sbjct: 675 TMREITEAIAVAKKKVENVTKEAQANLLTAKHGMTLRESFEDNVVRYLNEARDKAGRSAE 734

Query: 783 NELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSKTP 842
             L +LN    M + GSKGS +N++QM A VGQQ + G R+  GF DR+LPHF K+  +P
Sbjct: 735 VNLKDLNNVKQMVSAGSKGSFINIAQMSACVGQQSVEGKRIAFGFADRTLPHFSKDDYSP 794

Query: 843 QSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYDN 902
           +SKGFV NS+  GL+P EF FHA+ GREGL+DTAVKTAETGY+ RRL+K+LED+   YD 
Sbjct: 795 ESKGFVENSYLRGLTPQEFFFHAMGGREGLIDTAVKTAETGYIQRRLVKALEDIMVHYDG 854

Query: 903 TVRTSSNGIVQFTYGGDGLDPLEMEGNA--QPVNFNRSWDHAYNITFNNTDRGLLP 956
           T R S   I+QF YG DG+D   +E  +       +R+++  Y I   N D  L P
Sbjct: 855 TTRNSLGNIIQFIYGEDGMDAAHIEKQSIDTIAGSDRAFERRYRIDLLNPDNALDP 910

 Score =  189 bits (479), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 139/429 (32%), Positives = 209/429 (48%), Gaps = 57/429 (13%)

Query: 1050 IVQHSITQLYRITEDAVQKFLEIAISKYHRAKVEPGTAVGAIGAQSIGEPGTQMTLKTFH 1109
            +    + + Y++T+   Q  L    +++ R+ V PG  VG + AQSIGEP TQMTL TFH
Sbjct: 1026 LASRRVIEEYKLTKQTFQWVLNNVEAQFLRSIVHPGEMVGVLAAQSIGEPATQMTLNTFH 1085

Query: 1110 FAGVASMNVTLGVPRIKEIINASKVISTPIINAVLVNNN--DERAARVVKGRIEKTLLSD 1167
            FAGVAS  VT GVPR+KEI+N +K + TP +   L +    D+  A++++  IE T L  
Sbjct: 1086 FAGVASKKVTSGVPRLKEILNVAKNMKTPSLTVYLESEESADQEKAKLIRSAIEHTTLKS 1145

Query: 1168 VCYYIQDVYKENMAYLQVKVDLNTIDKLQLELTIEDIAIAITRAPKLKIQTSDVTVLGKD 1227
            V     ++Y +      V  D   I +L   L  E+   ++        Q+  +  L  D
Sbjct: 1146 VTV-ASEIYYDPDPRSTVIEDDEEIIQLHFSLMDEETEQSLDH------QSPWLLRLELD 1198

Query: 1228 KIAINVLPEGFGSKTSSTSLKEPTENDVFY------------RMQTLR------------ 1263
            + A+N      G       +KE  +ND+F             R + +R            
Sbjct: 1199 RAAMNDKDLTMGQ--VGEKIKETFKNDLFVIWSEDNAEKLIIRCRVVRDPKTLDAEAEAE 1256

Query: 1264 ----------RALPSIMVKGLNDIARAVINIRD------DGKRE------LLVEGYGLRD 1301
                        L SI ++G+ DI R V+   D       G+ +      L  +G  L +
Sbjct: 1257 EDHMLKKIENTMLESITLRGVEDITRVVMMKYDRKTPSATGEYQKVPEWVLETDGVNLAE 1316

Query: 1302 VMCTDGVIGAKTATNHVLEIFNVLGIEAARASIIGEIDYTMSNHGMSVDPRHIQLLGDVM 1361
            VM   GV   +  TN  ++I NVLGIEA RA++  E+   +++ G  V+ RH+ LL DVM
Sbjct: 1317 VMSVPGVDSTRIYTNSFIDIMNVLGIEAGRAALYKEVYNVIASDGSYVNYRHMALLVDVM 1376

Query: 1362 TFKGEVLGITRFGLSKMRDSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMS 1421
            T +G ++ +TR G ++     L   SFE+T + LF+A    + D   GVSE +ILGQ   
Sbjct: 1377 TSQGFLMSVTRHGFNRSDTGALMRCSFEETVEILFEAGAAAELDNCRGVSENVILGQMAP 1436

Query: 1422 IGTGSFKVV 1430
            IGTG+F V+
Sbjct: 1437 IGTGAFDVM 1445

>NCAS0A13900 Chr1 (2728572..2733722) [5151 bp, 1716 aa] {ON}
           Anc_7.314
          Length = 1716

 Score =  558 bits (1439), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 350/927 (37%), Positives = 509/927 (54%), Gaps = 69/927 (7%)

Query: 11  KRISGLEFSALSPADIVAQSELEISSRDLFDLENNRSPKEGGALDPRMGVSASSMECTTC 70
           + +  ++F   SP ++   S  +I   +  D    R+ K GG  DPR+G    +++C TC
Sbjct: 12  RTVKEVQFGLFSPEEVRGISVAKIRFPETMDETQTRA-KIGGLNDPRLGSIDRNLKCQTC 70

Query: 71  HGNLASCHGHFGHIKLALPVFHVGYFKATIQILQGICKTCSAILLSEQDKRHFLSELRRP 130
              +  C GHFGHI LA PVFHVG+     ++ + +C  C  +LL E ++     ++R+ 
Sbjct: 71  QEGMNECPGHFGHIDLAKPVFHVGFIAKIKKVCESVCMHCGKLLLDEHNE-----QMRQA 125

Query: 131 GV--DNLRRMALLKKVLDQCKKQRRCLHCXXXXXXXXXXXXXXXXXSLKIIHDTFRWVGK 188
               D+ +R      V   CK +   + C                        + R  G 
Sbjct: 126 MAIKDSKKR---FNAVWTLCKTK---MICETDVPSDDDPTTLISRGGCGNAQPSIRKDGL 179

Query: 189 KSTPEKDKWIGDWKEV--LSHNPELERYVKRATDDLNPLKTLNLFKQIASEDCELLGIDA 246
           K        +G WK+    S   E E+ V      L+  + LN+FK I+ ED   +G   
Sbjct: 180 K-------LVGSWKKEKNTSDGDEPEQRV------LSTEEILNIFKHISPEDSTRMGF-- 224

Query: 247 TNKAGRPETYIWRYIPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIKAGIEKG 306
           + +  RPE  I   +P PP  +RPS+   +S    EDDLT KL +I+  +  ++     G
Sbjct: 225 SEEFARPEWMILCVLPVPPPPVRPSISFNES-QRGEDDLTFKLADILKANISLETLEHNG 283

Query: 307 ISINNMMEHWDYLQMTVAMYINSD-SINPAMLPGSSTGGGKVKPIRGFCQRLKGKQGRFR 365
              + + E    LQ  VA Y+++D +  P  L  S       +P++    RLKGK+GR R
Sbjct: 284 APHHAIEEAESLLQFHVATYMDNDIAGQPQALQKSG------RPVKSIRARLKGKEGRIR 337

Query: 366 GNLSGKRVDFSGRTVISPDPNLSIDEVAVPQLVAKVLTFPEKVTRYNIKKLRQLVQNGPN 425
           GNL GKRVDFS RTVIS DPNL +D+V VP+ +A+ LT+PE VT YNI +L QLV+NGPN
Sbjct: 338 GNLMGKRVDFSARTVISGDPNLELDQVGVPKSIARTLTYPEVVTPYNIDRLTQLVRNGPN 397

Query: 426 VHPGANYLLKKNEEARRNLRYGDRQKLANNLQYGDVVERHLEDGDVVLFNRQPSLHRLSI 485
            HPGA Y+++ N + R +LRY  R      LQYG  VERH+ D D VLFNRQPSLH++S+
Sbjct: 398 EHPGAKYVIRDNGD-RIDLRYSKRAGDIQ-LQYGWKVERHIMDDDPVLFNRQPSLHKMSM 455

Query: 486 LSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNNLLTPK 545
           ++H  K+ P+ TFRLN  V +PYNADFDGDEMNLHVPQ+EE RAE   L  V   +++ +
Sbjct: 456 MAHRVKVIPYSTFRLNLSVTSPYNADFDGDEMNLHVPQSEETRAELSQLCAVPLQIVSAQ 515

Query: 546 SGEPIIAATQDFITGSYLISHKDSFFDKASLTQLLSMMSDGSLQFD--IPPPAIMKPCYL 603
           S +P +   QD + G   ++ +D+F +   +  +L  + D    +D  IP PA++KP  L
Sbjct: 516 SNKPCMGIVQDTLCGIRKLTLRDTFIEFDQVLNMLYWVPD----WDGVIPTPAVLKPKPL 571

Query: 604 WTGKQVFSLLIKPNKNSPVKINLDA--KNKVYIPPKQKHYPNEMSQNDGFVIVRGSQILS 661
           WTGKQV S  I      P  I+L    +    + PK          ++G +++ G QI+ 
Sbjct: 572 WTGKQVLSAAI------PKGIHLQRFDEGTTLLSPK----------DNGMLVIDG-QIIF 614

Query: 662 GVMDKSVLGDGKKHSVFYTILRDFGPQEAASAMNRMAKLCARYLGNRGFSIGISD-VTPA 720
           GV+DK  +G      + + + R+ GP   A     + K+   +L + GFS GI D +   
Sbjct: 615 GVVDKKTVGSSSG-GLIHVVTREKGPTICARLFGNIQKIVNFWLLHNGFSTGIGDTIADG 673

Query: 721 DDLKQKKEDLVEIAYAKCDELIDLYNKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGDV 780
             +K+  E + E A  K +++        L  + G    ++ E  +   L++ R++ G +
Sbjct: 674 QTIKEITETIAE-AKKKVEDVTKEAQANLLTAKHGMTLRESFEDNVVRFLNEARDKAGRL 732

Query: 781 CINELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSK 840
               L++LN    M + GSKGS +N++QM A VGQQ + G R+  GF DR+LPHF K+  
Sbjct: 733 AEVNLNDLNNVKQMVSAGSKGSFINIAQMSACVGQQSVEGKRIGFGFVDRTLPHFSKDDY 792

Query: 841 TPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 900
           +P+SKGFV NS+  GL+P EF FHA+ GREGL+DTAVKTAETGY+ RRL+K+LED+   Y
Sbjct: 793 SPESKGFVENSYLRGLTPQEFFFHAMGGREGLIDTAVKTAETGYIQRRLVKALEDIMVHY 852

Query: 901 DNTVRTSSNGIVQFTYGGDGLDPLEME 927
           D T R S   ++QF YG DG+D   +E
Sbjct: 853 DGTTRNSLGNVIQFIYGEDGIDAAHIE 879

 Score =  188 bits (477), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 141/422 (33%), Positives = 221/422 (52%), Gaps = 54/422 (12%)

Query: 1055 ITQLYRITEDAVQKFLEIAISKYHRAKVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVA 1114
            I Q Y++T+ A Q  L    S++ R+ V PG  VG + AQSIGEP TQMTL TFHFAGVA
Sbjct: 1031 ILQEYKLTKQAFQWVLNNVESQFLRSVVHPGEMVGVLAAQSIGEPATQMTLNTFHFAGVA 1090

Query: 1115 SMNVTLGVPRIKEIINASKVISTPIINAVLVN--NNDERAARVVKGRIEKTLLSDVC--- 1169
            S  VT GVPR+KEI+N +K + TP +   L +  ++D+  A+ ++  IE T L  +    
Sbjct: 1091 SKKVTSGVPRLKEILNVAKNMKTPSLTVYLKDGYSSDQEKAKFIRSAIEHTTLKSITVAS 1150

Query: 1170 --YYIQD----VYKENMAYLQVKVDL------NTIDK-----LQLEL---TIEDIAIAIT 1209
              YY  D    V  E+   +Q+   L       ++D+     L+LEL    + D  + + 
Sbjct: 1151 EIYYDPDPRSTVIPEDDEIIQLHFSLMDDETEQSLDRQSPWLLRLELDRAAMNDKDLTMG 1210

Query: 1210 RAPKLKIQT--SDVTVL----GKDKIAIN---VLPEGFGSKTSSTSLKEPTENDVFYRMQ 1260
            +  +   +T  +D+ V+      +K+ I    V P+   ++T      E  E+ +  +++
Sbjct: 1211 QVGERIKETFKNDLFVIWSEDNAEKLIIRCRVVRPKSLDAET------EAEEDHMLKKIE 1264

Query: 1261 TLRRALPSIMVKGLNDIARAVINIRD------DGKRE------LLVEGYGLRDVMCTDGV 1308
                 L +I ++G+ +I R V+   D       G+ E      L  +G  L +VM   G+
Sbjct: 1265 NT--MLENITLRGVENIERVVMMKYDRKVPSATGEYEKVPEWVLETDGVNLSEVMTVPGI 1322

Query: 1309 IGAKTATNHVLEIFNVLGIEAARASIIGEIDYTMSNHGMSVDPRHIQLLGDVMTFKGEVL 1368
               +  TN  ++I  VLGIEA RA++  E+   +++ G  V+ RH+ LL DVMT +G + 
Sbjct: 1323 DATRIYTNSFIDIMEVLGIEAGRAALYREVYNVIASDGSYVNYRHMALLVDVMTTQGGLT 1382

Query: 1369 GITRFGLSKMRDSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFK 1428
             +TR G ++     L   SFE+T + LF+A    + D   GVSE ++LGQ   IGTG+F 
Sbjct: 1383 SVTRHGFNRASTGALMRCSFEETVEILFEAGASAELDDCRGVSENVLLGQMAPIGTGAFD 1442

Query: 1429 VV 1430
            V+
Sbjct: 1443 VM 1444

>Kpol_162.1 s162 complement(211..4146) [3936 bp, 1311 aa] {ON}
           complement(211..4146) [3936 nt, 1312 aa]
          Length = 1311

 Score =  487 bits (1253), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 261/585 (44%), Positives = 365/585 (62%), Gaps = 30/585 (5%)

Query: 348 KPIRGFCQRLKGKQGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPQLVAKVLTFPEK 407
           +P++    RLKGK+GR RGNL GKRVDFS RTVIS DPNL +D+V VP+ +AK LT+PE 
Sbjct: 2   RPVKSIRARLKGKEGRIRGNLMGKRVDFSARTVISGDPNLELDQVGVPKSIAKTLTYPEV 61

Query: 408 VTRYNIKKLRQLVQNGPNVHPGANYLLKKNEEARRNLRYGDRQKLANNLQYGDVVERHLE 467
           VT YNI +L QLV+NGPN HPGA Y+++ N + R +LRY  R      LQYG  VERH+ 
Sbjct: 62  VTPYNIDRLTQLVRNGPNEHPGAKYVIRDNGD-RIDLRYSKRAGDIQ-LQYGWKVERHIM 119

Query: 468 DGDVVLFNRQPSLHRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEA 527
           D D VLFNRQPSLH++S+++H  K+ P+ TFRLN  V +PYNADFDGDEMNLHVPQ+EE 
Sbjct: 120 DNDPVLFNRQPSLHKMSMMAHRVKVMPYSTFRLNLSVTSPYNADFDGDEMNLHVPQSEET 179

Query: 528 RAEAINLMGVKNNLLTPKSGEPIIAATQDFITGSYLISHKDSFFDKASLTQLLSMMSDGS 587
           RAE   L  V   +++P+S +P +   QD + G   ++ +DSF +   +  +L  + D  
Sbjct: 180 RAELSQLCAVPMQIVSPQSNKPCMGIVQDTLCGIRKLTLRDSFIEFDQVLNMLYWVPD-- 237

Query: 588 LQFD--IPPPAIMKPCYLWTGKQVFSLLIKPNKNSPVKINLDA--KNKVYIPPKQKHYPN 643
             +D  IP PAI+KP  LWTGKQ+ S+ I      P  I+L    +    + PK      
Sbjct: 238 --WDGVIPQPAILKPKPLWTGKQILSIAI------PKGIHLQRFDEGTTMLSPK------ 283

Query: 644 EMSQNDGFVIVRGSQILSGVMDKSVLGDGKKHSVFYTILRDFGPQEAASAMNRMAKLCAR 703
               ++G +++ G QI+ GV+DK  +G      + + + R+ GPQ  A     + K+   
Sbjct: 284 ----DNGMLVIDG-QIVFGVVDKKTVGSSSG-GLIHVVTREKGPQVCAKMFGNIQKVVNF 337

Query: 704 YLGNRGFSIGISD-VTPADDLKQKKEDLVEIAYAKCDELIDLYNKGKLETQPGCNEEQTL 762
           +L + GFS GI D +   + +K+  E + E A  K +E+        L  + G    ++ 
Sbjct: 338 WLLHNGFSTGIGDTIADGETMKEITETIAE-AKKKVEEVTKEAQANLLTAKHGMTLRESF 396

Query: 763 EAKIGGLLSKVREEVGDVCINELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNR 822
           E  +   L++ R++ G +    L++ N    M + GSKGS +N++QM A VGQQ + G R
Sbjct: 397 EDNVVRFLNEARDKAGRLAEVNLNDTNNVKQMVSAGSKGSFINIAQMSACVGQQSVEGKR 456

Query: 823 VPDGFQDRSLPHFPKNSKTPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAET 882
           +  GF DR+LPHF K+  +P+SKGFV NS+  GL+P EF FHA+ GREGL+DTAVKTAET
Sbjct: 457 IAFGFVDRTLPHFSKDDYSPESKGFVENSYLRGLTPQEFFFHAMGGREGLIDTAVKTAET 516

Query: 883 GYMSRRLMKSLEDLSCQYDNTVRTSSNGIVQFTYGGDGLDPLEME 927
           GY+ RRL+K+LED+   YD+T R S   ++QF YG DG+D   +E
Sbjct: 517 GYIQRRLVKALEDIMVHYDSTTRNSLGNVIQFVYGEDGIDASYIE 561

 Score =  182 bits (461), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 143/422 (33%), Positives = 214/422 (50%), Gaps = 54/422 (12%)

Query: 1055 ITQLYRITEDAVQKFLEIAISKYHRAKVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVA 1114
            + + YR+T+ A    L    S++ R+ V PG  VG + AQSIGEP TQMTL TFHFAGVA
Sbjct: 713  VLEEYRLTKQAFDWVLSNIESQFLRSIVHPGEMVGVLAAQSIGEPATQMTLNTFHFAGVA 772

Query: 1115 SMNVTLGVPRIKEIINASKVISTPIINAVLVNNN--DERAARVVKGRIEKTLLSDVC--- 1169
            S  VT GVPR+KEI+N +K + TP     L      D+  A+ ++  IE T L  V    
Sbjct: 773  SKKVTSGVPRLKEILNVAKNMKTPSSTVYLEPEYAIDQEKAKFIRSAIEHTTLKSVTVAS 832

Query: 1170 --YYIQD----VYKENMAYLQVKVDL------NTIDK-----LQLEL---TIEDIAIAIT 1209
              YY  D    V  ++   +Q+   L        +D      L+LEL    + D  + + 
Sbjct: 833  EIYYDPDPRSTVIPDDEEIIQLHFSLLDDETEKALDNQSPWLLRLELDRAAMNDKDLTMG 892

Query: 1210 RAPKLKIQT--SDVTVL----GKDKIAIN---VLPEGFGSKTSSTSLKEPTENDVFYRMQ 1260
            +  +   +T  +D+ V+      DK+ I    V P+   ++T      E  E+ +  +++
Sbjct: 893  QVGEKIKETFKNDLFVIWSEDNADKLIIRCRVVRPKSLDAET------EAEEDHMLKKIE 946

Query: 1261 TLRRALPSIMVKGLNDIARAVINIRD------DGKRE------LLVEGYGLRDVMCTDGV 1308
                 L SI ++G+ DI R V+   D      +G  E      L  +G  L +VM   GV
Sbjct: 947  NT--MLESITLRGVEDIERVVMMKYDRKMPSENGAYEKVPEWVLETDGVNLLEVMTVTGV 1004

Query: 1309 IGAKTATNHVLEIFNVLGIEAARASIIGEIDYTMSNHGMSVDPRHIQLLGDVMTFKGEVL 1368
               +  TN  ++I  VLGIEA RA++  E+   +++ G  V+ RH+ LL DVMT +G + 
Sbjct: 1005 DPTRIYTNSFIDITEVLGIEAGRAALYREVYNVIASDGSYVNYRHMALLVDVMTTQGSLT 1064

Query: 1369 GITRFGLSKMRDSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFK 1428
             +TR G ++     L   SFE+T + LF+A    + D   GVSE +ILGQ   +GTG+F 
Sbjct: 1065 SVTRHGFNRSNTGALMRCSFEETVEILFEAGASAELDDCRGVSENVILGQMAPVGTGAFD 1124

Query: 1429 VV 1430
            V+
Sbjct: 1125 VM 1126

>Kwal_26.6979 s26 complement(150350..155314) [4965 bp, 1654 aa] {ON}
            YOR341W (RPA190) - RNA polymerase I subunit 190 (alpha)
            [contig 46] FULL
          Length = 1654

 Score =  452 bits (1164), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 323/989 (32%), Positives = 502/989 (50%), Gaps = 135/989 (13%)

Query: 247  TNKAGRPETYIWRYIPAPPVCIR-PSVMMQDSPASNEDDLTVKLTEIVWTSSLIK----- 300
            + K  R + +    +  PP   R PS + ++   ++++ L   L++I+ TS LI+     
Sbjct: 340  SKKIVRADMFFLEVVIVPPTRFRLPSKLGEEIHENSQNQL---LSKILTTSLLIRDLNEE 396

Query: 301  ---------AGIEKGISINNMMEHWDYLQMTVAMYINSDSINPAMLPGSSTGGGKVKPIR 351
                     +  +K +  N +M  +  +Q  V  +I+S            + GGKV PI 
Sbjct: 397  MSKLQKDKVSAQDKIVIFNRLMNAFVTIQNDVNAFIDSTK-------AQGSAGGKV-PIP 448

Query: 352  GFCQRLKGKQGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPQLVAKVLTFPEKVTRY 411
            G  Q L+ K+G FR ++ GKRV+++ R+VISPDPN+  +E+ VP + A  LT+PE VT Y
Sbjct: 449  GVKQALEKKEGLFRKHMMGKRVNYAARSVISPDPNIETNEIGVPPVFATKLTYPEPVTSY 508

Query: 412  NIKKLRQLVQNGPNVHPGANYLLKKNEEARRNLRYG----DRQKLANNL----------Q 457
            NI +LRQ V NGP+  PGA+ +  +NE+       G     R+ LAN L           
Sbjct: 509  NIAELRQAVINGPDKWPGASQI--QNEDGSLVSLVGMTTEQRKALANQLLTPSSHSSTHS 566

Query: 458  YGDVVERHLEDGDVVLFNRQPSLHRLSILSHYAKIRPW-RTFRLNECVCTPYNADFDGDE 516
                V RH+++ D+V+ NRQP+LH+ S++ H  ++ P  +T RL+      YNADFDGDE
Sbjct: 567  LNKKVYRHIKNRDIVIMNRQPTLHKASMMGHKVRVLPGEKTLRLHYANTGAYNADFDGDE 626

Query: 517  MNLHVPQTEEARAEAINLMGVKNNLLTPKSGEPIIAATQDFITGSYLISHKDSFFDKASL 576
            MN+H PQ E ARAEA NL    +  LTP SG P+    QD I+    ++ KDSFF +   
Sbjct: 627  MNMHFPQNENARAEAFNLANTDSQYLTPTSGSPVRGLIQDHISAGVWLTSKDSFFTREEY 686

Query: 577  TQLLSMM---SDGSL---QFDIPPPAIMKPCYLWTGKQVFS-LLIKPNKNSPVKINLDAK 629
             Q +       DG     +    PPA+MKP  LWTGKQ+ + +L+         INL +K
Sbjct: 687  QQYIYGCIRPEDGHATRNKLVTVPPAVMKPVPLWTGKQIITTVLLNVTPADMPGINLISK 746

Query: 630  NKVYIPPKQKHYPNEMSQNDGFVIVRGSQILSGVMDKSVLGDGKKHSVFYTILRDFGPQE 689
            NK+    K  ++    ++ND  VI +  ++L G++DKS  G   K+ + +++   +GP  
Sbjct: 747  NKI----KNDYWGKHSTEND--VIFKNGELLCGILDKSQYG-ASKYGIVHSLHEVYGPAV 799

Query: 690  AASAMNRMAKLCARYLGNRGFSIGISDVTPADDLKQKKEDLV----EIAYAKCDELIDL- 744
            +A  ++ + +L   Y+    F+ G+ D+   DD  + + D++    ++  A   E+ +L 
Sbjct: 800  SAKVLSVLGRLFTNYITATAFTCGMDDLRLTDDGNKWRSDILKTSTDVGRAAAAEVTNLD 859

Query: 745  ----YNKGKL-----ETQPGCNEEQTLEAKIGGLLSKVREEVGDVCI-----NELDNLNA 790
                 N  +L     E     N+   L+A     ++ +  +V   C+      +  N N+
Sbjct: 860  PDVSANDTELLKRLEEILRDDNKLGILDAVTSSKVNTITSQVVSKCVPGGTMKKFPN-NS 918

Query: 791  PLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSKTPQSKGFVRN 850
               MA  G+KGS +NVSQ++ ++GQQ + G RVP     ++LP F        + G+++ 
Sbjct: 919  MQAMALSGAKGSNVNVSQIMCLLGQQALEGRRVPVMISGKTLPSFKPFETDAMAGGYIKG 978

Query: 851  SFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYDNTVRTSSNG 910
             F+SG+ P E+ FH ++GREGL+DTAVKT+ +GY+ R L K LE +   YDN+VR +   
Sbjct: 979  RFYSGIRPQEYYFHCMAGREGLIDTAVKTSRSGYLQRCLTKQLEGVHISYDNSVRDADGT 1038

Query: 911  IVQFTYGGDGLDPLEMEGNAQPVNFNRSWDHAYNITFNNTDRGLLPYEIKKTVDNI---- 966
            ++QF YGGD +D  +            S    +    +N D  L  Y     ++++    
Sbjct: 1039 LIQFLYGGDAVDVTQ-----------ESHMTEFKFCADNYDALLKKYNPSALIEHLDVES 1087

Query: 967  -LKPLEKRLIRYDTLGR-PVSAEDDKLDDYVDQHDSERLFYASLREFMTDXXXXXXXXXX 1024
             LK  +K L       R P  A+  K D  V + +  + +  S+ E   D          
Sbjct: 1088 ALKYSKKALKNRKKNERVPHFAQKVKYDPVVSKFNPSK-YLGSVSENFQD---------- 1136

Query: 1025 XXGLPKLIKKSELEGY-DPENEHIDAIVQHSITQLYRITEDAV--QKFLEIAISKYHRAK 1081
                       +LE + D  NE            L++ + D+V  +KF  +   KY R+ 
Sbjct: 1137 -----------KLESFIDSNNE------------LFK-SRDSVNEKKFRALMQLKYMRSL 1172

Query: 1082 VEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEII-NASKVISTPII 1140
            + PG AVG I +QS+GEP TQMTL TFHFAG  + NVTLG+PR++EII  AS  I TP +
Sbjct: 1173 INPGEAVGIIASQSVGEPSTQMTLNTFHFAGHGAANVTLGIPRMREIIMTASAAIKTPQM 1232

Query: 1141 N-AVLVNNNDERAARVVKGRIEKTLLSDV 1168
               +L +  D +A    K  I K +LS+V
Sbjct: 1233 TLPILADVTDSQADTFCKS-ITKVMLSEV 1260

 Score = 83.6 bits (205), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 48/162 (29%), Positives = 88/162 (54%), Gaps = 2/162 (1%)

Query: 1270 MVKGLNDIARAVINIRDDGKRELLVEGYGLRDVMCTDGVIGAKTAT-NHVLEIFNVLGIE 1328
            +++ + +I R V    ++GKR L+ EG   +++   D  +     T N V  +    G+E
Sbjct: 1487 VIREVKNIDRCVHPEPENGKRILVTEGVNFQEMWDQDAFVDVNGITSNDVSSVLKTYGVE 1546

Query: 1329 AARASIIGEIDYTMSNHGMSVDPRHIQLLGDVMTFKGEVLGITRFGLSKMRDSVLQLASF 1388
            AAR +I+ EI+   S + +SV  RH+ L+ D+MT +G  L   R G+     S++++ S+
Sbjct: 1547 AARNTIVNEINNVFSRYAISVSFRHLDLIADMMTRQGTYLAFNRQGMETSTSSLMKM-SY 1605

Query: 1389 EKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVV 1430
            E T   L  A    + + ++  S  ++LG+  ++GTG+F V+
Sbjct: 1606 ETTCQFLTKAVLDNESENLDSPSARLVLGKLNNVGTGAFDVL 1647

 Score = 50.4 bits (119), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 30/116 (25%), Positives = 54/116 (46%), Gaps = 3/116 (2%)

Query: 13  ISGLEFSALSPADIVAQSELEISSRDLFDLENNRSPKEGGALDPRMGVSASSMECTTCHG 72
           I+ ++F  ++  DI   S ++I++  + D  N   P  GG  D  +G    ++ C TC  
Sbjct: 11  ITSVDFGVMTAQDIRNFSAMQITNPTVLD--NLGHPISGGLYDLALGAFLRNL-CATCGL 67

Query: 73  NLASCHGHFGHIKLALPVFHVGYFKATIQILQGICKTCSAILLSEQDKRHFLSELR 128
           +   C GH GHI+L +P ++  +F      L+  C  C    L   +   +  +L+
Sbjct: 68  DEKFCPGHQGHIELPVPCYNPLFFSQLYIYLRSSCLYCHGFRLKAPEVHRYACKLK 123

>ZYRO0D04532g Chr4 (374177..379180) [5004 bp, 1667 aa] {ON} highly
            similar to uniprot|P10964 Saccharomyces cerevisiae
            YOR341W RPA190 RNA polymerase I subunit largest subunit
            of RNA polymerase I
          Length = 1667

 Score =  452 bits (1162), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 322/982 (32%), Positives = 499/982 (50%), Gaps = 125/982 (12%)

Query: 249  KAGRPETYIWRYIPAPPVCIR-PSVMMQDSPASNEDDLTVKLTEIVWTSSLI-------- 299
            K+  P+ +    +  PP   R PS + ++   + ++ L   L++++ TS LI        
Sbjct: 349  KSVTPDVFFMEVVLVPPTRFRLPSKLGEEVHENTQNQL---LSKVLTTSLLIRDLNDEMS 405

Query: 300  -----KAGIE-KGISINNMMEHWDYLQMTVAMYINSDSINPAMLPGSSTGGGKVKPIRGF 353
                 K  +E + +  + +M  +  +Q  V  +I+S            + GGKV PI G 
Sbjct: 406  NLQKDKVSVEDRRVIFSRLMNAFVTIQNDVNSFIDSTK-------AQGSTGGKV-PIPGV 457

Query: 354  CQRLKGKQGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPQLVAKVLTFPEKVTRYNI 413
             Q L+ K+G FR ++ GKRV+ + R+VISPDPN+  +E+ VP + A  LT+PE VT YNI
Sbjct: 458  KQALEKKEGLFRKHMMGKRVNHAARSVISPDPNIETNEIGVPPVFATKLTYPEPVTSYNI 517

Query: 414  KKLRQLVQNGPNVHPGANYLLKKNEEARR----NLRYGDRQKLANNL----------QYG 459
             +LRQ V NGP+  PGA  +  +NE+        +    R  LAN L             
Sbjct: 518  AELRQAVINGPDKWPGATQI--QNEDGSLVSLVGMTLEQRNALANQLLTPSSNPATHTLN 575

Query: 460  DVVERHLEDGDVVLFNRQPSLHRLSILSHYAKIRPW-RTFRLNECVCTPYNADFDGDEMN 518
              V RH+++ D+V+ NRQP+LH+ S++ H  ++ P  +T RL+      YNADFDGDEMN
Sbjct: 576  KKVFRHIKNRDIVIMNRQPTLHKASMMGHKVRVLPGEKTLRLHYANTGAYNADFDGDEMN 635

Query: 519  LHVPQTEEARAEAINLMGVKNNLLTPKSGEPIIAATQDFITGSYLISHKDSFFDKASLTQ 578
            +H PQ E AR+EA NL    +  LTP SG P+    QD I+    +++KDSFF +    Q
Sbjct: 636  MHFPQNENARSEAFNLANTDSQYLTPTSGSPLRGLIQDHISAGVWLTNKDSFFTRDQYQQ 695

Query: 579  LLSMM---SDGSL---QFDIPPPAIMKPCYLWTGKQVFSLLIKPNKNSPVK-INLDAKNK 631
             +       DG     +    PPA+MKP  LWTGKQ+ + +I     + +  INL +KNK
Sbjct: 696  YIYGCIRPEDGHSTRPKIVTVPPAVMKPVPLWTGKQIITTVIMNVTPADMPGINLLSKNK 755

Query: 632  VYIPPKQKHYPNEMSQNDGFVIVRGSQILSGVMDKSVLGDGKKHSVFYTILRDFGPQEAA 691
            +    K +++    ++N+  VI +   +L G++DKS  G   K+ + +++   +GP+ AA
Sbjct: 756  I----KNEYWGQGSTENE--VIFKDGALLCGILDKSQYG-ASKYGIVHSLHEVYGPETAA 808

Query: 692  SAMNRMAKLCARYLGNRGFSIGISDVTPADDLKQKKEDLV----EIAYAKCDELIDL--- 744
              ++ + +L   ++ N  FS G+ D+    +  + ++DL+    ++      E+ +L   
Sbjct: 809  KVLSVLGRLFTNFITNTAFSCGMDDLRLTAEGNKDRKDLLKTSTDVGRQAAAEVTNLPTD 868

Query: 745  --YNKGKL-----ETQPGCNEEQTLEA----KIGGLLSKVREEVGDVCINELDNLNAPLI 793
               N  +L     E     N+   L+A    K+  + SKV   V      +    N+   
Sbjct: 869  TPSNDPELLKRLEEILRDDNKSGILDAVTSSKVNSVTSKVVSTVIPKGTMKKFPQNSMQA 928

Query: 794  MATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSKTPQSKGFVRNSFF 853
            MA  G+KGST+NVSQ++ ++GQQ + G RVP     ++LP F        + G+++  F+
Sbjct: 929  MALSGAKGSTVNVSQIMCLLGQQALEGRRVPVMVSGKTLPSFKPFETDSMAGGYIKGRFY 988

Query: 854  SGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYDNTVRTSSNGIVQ 913
            SG+ P E+ FH ++GREGL+DTAVKT+ +GY+ R L K LE +   YDNTVR     +VQ
Sbjct: 989  SGIKPQEYYFHCMAGREGLIDTAVKTSRSGYLQRCLTKQLEGIHVSYDNTVRDGDGTLVQ 1048

Query: 914  FTYGGDGLDPLEMEGNAQPVNFNRSWDHAYNITFNNTDRGLLPYEIKKTVDNI-----LK 968
            F YGGD +D  +     Q           ++    N D  L  Y     V+++     LK
Sbjct: 1049 FLYGGDAVDTTKESHMTQ-----------FDFCLENYDALLRKYNPSALVEHLDVESALK 1097

Query: 969  PLEKRLIRYDTLGR-PVSAEDDKLDDYVDQHDSERLFYASLREFMTDXXXXXXXXXXXXG 1027
              +K L     + + P     DK D  + +++  + +  S+ E   D             
Sbjct: 1098 YSKKALKSRKKIDKEPHYKNSDKYDPVLSKYNPAK-YLGSVSEKFQD------------- 1143

Query: 1028 LPKLIKKSELEGYDPENEHIDAIVQHSITQLYRITEDAVQKFLEIAISKYHRAKVEPGTA 1087
                    +LEG+   + H   +  HS      I E   +KF  +   KY R+ V PG A
Sbjct: 1144 --------KLEGF--LDSHSKQLKLHS-----GINE---KKFRALMQLKYMRSLVNPGEA 1185

Query: 1088 VGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEII-NASKVISTPIINAVLVN 1146
            VG I AQS+GEP TQMTL TFHFAG  + NVTLG+PR++EI+  AS  I TP ++  + N
Sbjct: 1186 VGIIAAQSVGEPSTQMTLNTFHFAGHGAANVTLGIPRMREIVMTASAAIKTPQMSLPVWN 1245

Query: 1147 NNDERAARVVKGRIEKTLLSDV 1168
            +  +  A +    I K +LS+V
Sbjct: 1246 HVSDDQASIFCKSITKVVLSEV 1267

 Score = 72.8 bits (177), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 38/116 (32%), Positives = 65/116 (56%), Gaps = 1/116 (0%)

Query: 1315 TNHVLEIFNVLGIEAARASIIGEIDYTMSNHGMSVDPRHIQLLGDVMTFKGEVLGITRFG 1374
            +N V  +    G+EAAR +I+ EI+   S + +SV  RH+ L+ D+MT +G  L   R G
Sbjct: 1546 SNDVAAVLRTYGVEAARNTIVYEINNVFSRYAISVSFRHLDLIADLMTRQGNYLAFNRQG 1605

Query: 1375 LSKMRDSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVV 1430
            +     S +++ S+E T   L  A     ++ ++  S  I+LG+  ++GTG+F V+
Sbjct: 1606 METSTSSFMKM-SYETTCQFLTKAVLDNDREKLQSPSARIVLGKLNNVGTGAFDVL 1660

 Score = 50.4 bits (119), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 33/116 (28%), Positives = 53/116 (45%), Gaps = 3/116 (2%)

Query: 13  ISGLEFSALSPADIVAQSELEISSRDLFDLENNRSPKEGGALDPRMGVSASSMECTTCHG 72
           IS ++F+  S  +I   S  +I++  + D  N   P  GG  D  +G    ++ C TC  
Sbjct: 11  ISSVDFNVFSAEEIRNLSAKQITNPTVLD--NLGHPISGGLYDLALGAFLRNL-CATCGL 67

Query: 73  NLASCHGHFGHIKLALPVFHVGYFKATIQILQGICKTCSAILLSEQDKRHFLSELR 128
           +   C GH GHI+L +P ++  +F      L+  C  C    L   +   F  +LR
Sbjct: 68  DEKFCPGHQGHIELPVPCYNPLFFSQLYIYLRSSCLYCHRFRLRSIEVNRFACKLR 123

>TPHA0H02800 Chr8 (659254..664200) [4947 bp, 1648 aa] {ON} Anc_7.51
            YOR341W
          Length = 1648

 Score =  447 bits (1150), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 336/1129 (29%), Positives = 543/1129 (48%), Gaps = 193/1129 (17%)

Query: 247  TNKAGRPETYIWRYIPAPPVCIR-PSVMMQDSPASNEDDLTVKLTEIVWTSSLIK----- 300
            T K  + + +    +  PP   R PS +  +   ++++ L   L++I+ TS LI+     
Sbjct: 340  TGKIVKADDFFMDVVLVPPTRFRLPSKLGDEVHENSQNQL---LSKILTTSLLIRDLNDE 396

Query: 301  ---------AGIEKGISINNMMEHWDYLQMTVAMYINSDSINPAMLPGSSTGGGKVKPIR 351
                     A  ++ I  + +M  +  +Q  V  +I+S               GK+ P+ 
Sbjct: 397  ISKLQKDKVALDDRRIIFSRLMNAFVTIQNDVNSFIDSSK-------AQGNNSGKL-PVP 448

Query: 352  GFCQRLKGKQGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPQLVAKVLTFPEKVTRY 411
            G  Q L+ K+G FR ++ GKRV+++ R+VISPDPN+  DE+ VP + A  LT+PE VT Y
Sbjct: 449  GVKQALEKKEGLFRKHMMGKRVNYAARSVISPDPNIETDEIGVPPVFATKLTYPEPVTSY 508

Query: 412  NIKKLRQLVQNGPNVHPGANYLLKKNEEARR----NLRYGDRQKLANNLQ---------- 457
            NI +LRQ V NGP+  PGA  +  +NE+        +    R+ LAN L           
Sbjct: 509  NIAELRQAVINGPDKWPGATQI--QNEDGSLVSLIGMTVEQRKALANQLMTPSSNPATHT 566

Query: 458  YGDVVERHLEDGDVVLFNRQPSLHRLSILSHYAKIRPW-RTFRLNECVCTPYNADFDGDE 516
                V RH+++ DVV+ NRQP+LH+ S++ H  ++ P  +T RL+      YNADFDGDE
Sbjct: 567  LNKKVYRHIKNRDVVIMNRQPTLHKASMMGHKVRVLPGEKTLRLHYANTGAYNADFDGDE 626

Query: 517  MNLHVPQTEEARAEAINLMGVKNNLLTPKSGEPIIAATQDFITGSYLISHKDSFFDKASL 576
            MN+H PQ E ARAEA NL    +  LTP SG P+    QD I+    ++ KDS+F +   
Sbjct: 627  MNMHFPQNENARAEAFNLANTDSQYLTPTSGSPVRGLIQDHISAGVWLTSKDSYFTREQY 686

Query: 577  TQLLSMM---SDG---SLQFDIPPPAIMKPCYLWTGKQVFSLLIKPNKNSPVK---INLD 627
             Q +       DG   + +    PPAI+KP  LWTGKQ+ + ++     SPV    INL 
Sbjct: 687  QQYIYGCIRPEDGHSANNKLLTIPPAIIKPVPLWTGKQIITTVLL--NVSPVDMPGINLK 744

Query: 628  AKNKVYIPPKQKHYPNEMSQNDGFVIVRGSQILSGVMDKSVLGDGKKHSVFYTILRDFGP 687
            +KNK+    K +++     +N+  V+ +   +L G++DKS  G   K+ + + +   +GP
Sbjct: 745  SKNKI----KDEYWGQHSEENE--VLFKDGALLCGILDKSQYG-ASKYGIVHALQEVYGP 797

Query: 688  QEAASAMNRMAKLCARYLGNRGFSIGISDVTPADDLKQKKEDLVEIAYAKCDELIDLYNK 747
            + AA  ++ + +L   Y+ N  F+ G+ D+   D+  + + D+++ +           ++
Sbjct: 798  EVAAKVLSVLGRLFTNYITNTAFTCGMDDLRLTDEGNKWRTDILKTSV----------DR 847

Query: 748  GKLETQPGCNEEQTLEAKIGGLLSKVREEVGD---------VCINELDNLNAPLI----- 793
            G+       N E+   A    LL ++ E + D         V  ++++ + + ++     
Sbjct: 848  GRQAAVEVTNLEKDTSADDSELLKRLEEILRDDNKSGILDAVTSSKVNAITSQVVSKCVP 907

Query: 794  --------------MATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNS 839
                          MA  G+KGS +NVSQ++ ++GQQ + G RVP     ++LP F    
Sbjct: 908  GGTMKRFPENSMQSMALSGAKGSNVNVSQIMCLLGQQALEGRRVPIMVSGKTLPSFKPFE 967

Query: 840  KTPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQ 899
                + G+++  F+SG+ P E+ FH ++GREGL+DTAVKT+ +GY+ R L K LE +   
Sbjct: 968  TDAMAGGYIKGRFYSGIKPQEYYFHCMAGREGLIDTAVKTSRSGYLQRCLTKQLEGVHVS 1027

Query: 900  YDNTVRTSSNGIVQFTYGGDGLDPLEMEGNAQPVNFNRSWDHAYNITFNNTDRGLLPYEI 959
            YDNTVR     +++F YGGD +D  +            S+ + ++   +N D  L  Y  
Sbjct: 1028 YDNTVRDGDGTLIEFLYGGDAVDVTK-----------ESYMNQFDFCLDNYDSLLKRYNP 1076

Query: 960  KK-----TVDNILKPLEKRLI-RYDTLGRPVSAEDDKLDDYVDQHDSERLFYASLREFMT 1013
                    VD+ LK  +K L  R      P   ++ K D  + +++  + +  S+ E   
Sbjct: 1077 AALIDFLDVDSALKYSKKTLKHRKKNKNVPHYLQNIKYDPVLAKYNPAK-YLGSVSEKFQ 1135

Query: 1014 DXXXXXXXXXXXXGLPKLIKKSELEGYDPENEHIDAIVQHSITQLYRITEDAVQ-KFLEI 1072
            D                     +LE +   N           +QL++  +   + KF  +
Sbjct: 1136 D---------------------KLENFLDSN-----------SQLFKSHKSVNEKKFRAL 1163

Query: 1073 AISKYHRAKVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEII-NA 1131
               KY R+ + PG AVG I +QS+GEP TQMTL TFHFAG  + NVTLG+PR++EII  A
Sbjct: 1164 MQLKYMRSLINPGEAVGIIASQSVGEPSTQMTLNTFHFAGHGAANVTLGIPRMREIIMTA 1223

Query: 1132 SKVISTPIINAVLVNNNDERAARVVKGRIEKTLLSDVC---------------------Y 1170
            S  I TP +   ++++  +  A +    I K +LS+V                      +
Sbjct: 1224 SAAIKTPQMTLPILDDVTDDQADIFAKSISKVILSEVIDSVSVTETTTSQSRSYVISMKF 1283

Query: 1171 YIQDVYKE--------------NMAYLQVKVDLNTIDKLQLELTIEDIAIAITRAPKLKI 1216
            Y QD Y E              N     +++ ++   K Q + T  D+ IAI   PK ++
Sbjct: 1284 YEQDEYNEEYDISKEELQNVVANNFLTSLEIAIHKEIKKQKKTTASDVGIAI---PKAQL 1340

Query: 1217 QTSDVTVLGKDKIAINVLPEGFGSKTSSTSLKEPTENDVFYRMQTLRRA 1265
              + V  L    +  N   +       + S  EP E+++    +T+R A
Sbjct: 1341 ALAAVEGLSSKVMEDNDEEQSRKKTKQAVSYDEPDEDEI----ETMREA 1385

 Score = 84.0 bits (206), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 51/167 (30%), Positives = 89/167 (53%), Gaps = 12/167 (7%)

Query: 1270 MVKGLNDIARAVINIRDDGKRELLVEGYGLR------DVMCTDGVIGAKTATNHVLEIFN 1323
            +V+ + +I R V    ++GKR L+ EG   +      D +  DG+      +N V  +  
Sbjct: 1481 VVRQVPNIDRCVHPNAENGKRVLVTEGVNFQAMWEQNDFVNVDGI-----TSNDVSSVLK 1535

Query: 1324 VLGIEAARASIIGEIDYTMSNHGMSVDPRHIQLLGDVMTFKGEVLGITRFGLSKMRDSVL 1383
              G+EAAR +I+ EI+   S + +SV  RH+ L+ D+MT +G  L   R G+     S++
Sbjct: 1536 TYGVEAARNTIVNEINNVFSRYAISVSFRHLDLIADMMTRQGSYLAFNRQGMETSTSSLM 1595

Query: 1384 QLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVV 1430
            ++ S+E T   L  A    +++ +   S  I+LG+  ++GTG+F V+
Sbjct: 1596 KM-SYETTCQFLTKAVLDNEREELNSPSARIVLGKLNNVGTGAFDVL 1641

 Score = 50.1 bits (118), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 32/116 (27%), Positives = 55/116 (47%), Gaps = 3/116 (2%)

Query: 13  ISGLEFSALSPADIVAQSELEISSRDLFDLENNRSPKEGGALDPRMGVSASSMECTTCHG 72
           I+ ++FS LS  +I   S  +I++  + D  N   P  GG  D  +G    ++ C+TC  
Sbjct: 11  ITSVDFSILSAEEIRNLSTKQITNPTVLD--NLGHPISGGLYDLALGAFLRNL-CSTCGL 67

Query: 73  NLASCHGHFGHIKLALPVFHVGYFKATIQILQGICKTCSAILLSEQDKRHFLSELR 128
           +   C GH GHI+L +P ++  +F      L+  C  C    L   +   +  +L+
Sbjct: 68  DEKFCPGHQGHIELPVPCYNPLFFNQLYIYLRSSCLFCHHFRLRSVEVHRYTCKLK 123

>NCAS0F00730 Chr6 complement(143500..148524) [5025 bp, 1674 aa] {ON}
            Anc_7.51 YOR341W
          Length = 1674

 Score =  446 bits (1148), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 321/986 (32%), Positives = 504/986 (51%), Gaps = 125/986 (12%)

Query: 245  DATNKAGRPETYIWRYIPAPPVCIR-PSVMMQDSPASNEDDLTVKLTEIVWTSSLIK--- 300
            + +NKA   + +    +  P    R PS +  +   ++++ L   L++I+ TS LI+   
Sbjct: 352  NMSNKAVSADMFFMDVVVVPATRFRLPSKLGDEVHENSQNQL---LSKILTTSLLIRDLN 408

Query: 301  -----------AGIEKGISINNMMEHWDYLQMTVAMYINSDSINPAMLPGSSTGGGKVKP 349
                       +  ++ I  + +M  +  +Q  V  +I+S            T GGK+ P
Sbjct: 409  DEMSKLQKDKVSADDRRIIFSRLMNAFVTIQNDVNAFIDSTK-------AQGTAGGKL-P 460

Query: 350  IRGFCQRLKGKQGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPQLVAKVLTFPEKVT 409
            I G  Q L+ K+G FR ++ GKRV+++ R+VISPDPN+  +E+ VP + A  LT+PE VT
Sbjct: 461  IPGVKQALEKKEGLFRKHMMGKRVNYAARSVISPDPNIETNEIGVPPVFATKLTYPEPVT 520

Query: 410  RYNIKKLRQLVQNGPNVHPGANYLLKKNEEARR----NLRYGDRQKLANNLQ-------- 457
             YNI +LRQ V NGP+  PGA  +  +NE+        +    R+ LAN L         
Sbjct: 521  SYNIAELRQAVINGPDKWPGATQI--QNEDGSLVSLIGMSTEQRKALANQLMTPSSNITT 578

Query: 458  --YGDVVERHLEDGDVVLFNRQPSLHRLSILSHYAKIRPW-RTFRLNECVCTPYNADFDG 514
                  V RH+++ D+V+ NRQP+LH+ S++ H  ++ P  +T RL+      YNADFDG
Sbjct: 579  HTLNKKVYRHIKNRDIVIMNRQPTLHKASMMGHKVRVLPGEKTLRLHYANTGAYNADFDG 638

Query: 515  DEMNLHVPQTEEARAEAINLMGVKNNLLTPKSGEPIIAATQDFITGSYLISHKDSFFDKA 574
            DEMN+H PQ E ARAEA NL    +  LTP SG P+    QD I+    ++ KDSFF + 
Sbjct: 639  DEMNMHFPQNENARAEASNLANTDSQYLTPTSGSPVRGLIQDHISAGVWLTSKDSFFTRE 698

Query: 575  SLTQLLSMM---SDGSL---QFDIPPPAIMKPCYLWTGKQVFS---LLIKPNKNSPVKIN 625
               Q +       DG     +    PP I KP  LWTGKQ+ S   L I P  N P  IN
Sbjct: 699  QYQQYIYGCIRPEDGHATRSKLITMPPTIHKPVPLWTGKQIISTVLLNITP-ANMP-GIN 756

Query: 626  LDAKNKVYIPPKQKHYPNEMSQNDGFVIVRGSQILSGVMDKSVLGDGKKHSVFYTILRDF 685
            L + NK+    K +++     +N+  V+ +  ++L G++DKS  G   K  + +++   +
Sbjct: 757  LKSSNKI----KNEYWGTGSQENE--VLFKNGELLCGILDKSQYG-ASKFGIVHSLHEVY 809

Query: 686  GPQEAASAMNRMAKLCARYLGNRGFSIGISDVTPADDLKQKKEDL----VEIAYAKCDEL 741
            GP  AA  ++ + +L   Y+ +  F+ G+ D+   ++  + + D+    V+       E+
Sbjct: 810  GPSVAAKVLSVLGRLFTNYIMSTAFTCGMDDLRLTEEGNKWRSDILKTSVDTGREAAAEV 869

Query: 742  IDL-----YNKGKL-----ETQPGCNEEQTLEAKIGGLLSKVREEVGDVCINELDNLNAP 791
             +L      N  +L     E     N+   L+A     ++ +  +V   C+ +      P
Sbjct: 870  TNLDKDTPANDPELLKRLQEILRDNNKSGILDAVTSSKVNSITSKVVSKCVPDGTMKKFP 929

Query: 792  L----IMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSKTPQSKGF 847
                  MA  G+KGS +NVSQ++ ++GQQ + G RVP     ++LP F        + G+
Sbjct: 930  YNSMQAMALSGAKGSNVNVSQIMCLLGQQALEGRRVPVMVSGKTLPSFKPYETDAMAGGY 989

Query: 848  VRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYDNTVRTS 907
            V+  F+SG+ P E+ FH ++GREGL+DTAVKT+ +GY+ R L K LE +   YDN+VR +
Sbjct: 990  VKGRFYSGIKPQEYYFHCMAGREGLIDTAVKTSRSGYLQRCLTKQLEGIHISYDNSVRDT 1049

Query: 908  SNGIVQFTYGGDGLDPLEMEGNAQPVNFNRSWDHAYNITFNNTDRGLLPYEIKKTVDNIL 967
               ++QF YGGD +D   +   +    F+   D+ Y+   N  +   L   +   V++ L
Sbjct: 1050 DGTLIQFLYGGDAVD---VTKESHMTEFDFCLDN-YDALLNKYNPSALIEHLD--VESAL 1103

Query: 968  KPLEKRLI-RYDTLGRPVSAEDDKLDDYVDQHDSERLFYASLREFMTDXXXXXXXXXXXX 1026
            K  +K L  R   +  P   ++ K D  + + +  + +  S+ E   D            
Sbjct: 1104 KYSKKSLKNRKKHIKEPHYKQNIKYDPVLSKFNPAK-YLGSVSEKFQD------------ 1150

Query: 1027 GLPKLIKKSELEGYDPENEHIDAIVQHSITQLYRITEDAV--QKFLEIAISKYHRAKVEP 1084
                     +LEGY  +N           ++L++ + D+V  +KF  +   KY R+ + P
Sbjct: 1151 ---------KLEGYLDKN-----------SKLFK-SHDSVNEKKFRALMQLKYMRSLINP 1189

Query: 1085 GTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEII-NASKVISTPIINAV 1143
            G AVG I +QS+GEP TQMTL TFHFAG  + NVTLG+PR++EII  AS  I TP +   
Sbjct: 1190 GEAVGIIASQSVGEPSTQMTLNTFHFAGHGAANVTLGIPRMREIIMTASAAIKTPQMTLP 1249

Query: 1144 LVNN-NDERAARVVKGRIEKTLLSDV 1168
            + N+ +DE+A    K  I K +LS+V
Sbjct: 1250 IWNDVSDEQADTFCKS-ISKVVLSEV 1274

 Score = 83.2 bits (204), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 55/188 (29%), Positives = 93/188 (49%), Gaps = 16/188 (8%)

Query: 1257 YRMQTLRRALPSIMVKGLNDIARAVINIRD-------------DGKRELLVEGYGLRDVM 1303
            +R++        +MV  + DI R  I IR+             +GKR L+ EG     + 
Sbjct: 1480 FRLELAADTEKLLMVNIIEDICRKSI-IREVPHIDRCIHPEPENGKRVLVTEGVNFEAMW 1538

Query: 1304 CTDGVIGAKTAT-NHVLEIFNVLGIEAARASIIGEIDYTMSNHGMSVDPRHIQLLGDVMT 1362
              +  I     T N V  +    G+EAAR +I+ EI+   S + +SV  RH+ L+ D+MT
Sbjct: 1539 DQEAFIDVDGITSNDVASVLKTYGVEAARNTIVNEINNVFSRYAISVSFRHLDLIADMMT 1598

Query: 1363 FKGEVLGITRFGLSKMRDSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSI 1422
             +G  L   R G+     S++++ S+E T   L  A    +++ +E  S  I++G+  ++
Sbjct: 1599 RQGTYLAFNRQGMESSTSSLMKM-SYETTLQFLTKAVLDNEREELESPSARIVMGKLNNV 1657

Query: 1423 GTGSFKVV 1430
            GTGSF ++
Sbjct: 1658 GTGSFDIL 1665

 Score = 50.4 bits (119), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 33/116 (28%), Positives = 55/116 (47%), Gaps = 3/116 (2%)

Query: 13  ISGLEFSALSPADIVAQSELEISSRDLFDLENNRSPKEGGALDPRMGVSASSMECTTCHG 72
           I+ ++F  L+  +I   S  +I++  + D  N   P  GG  D  +G    ++ C+TC  
Sbjct: 11  ITSVDFGILTSDEIRQLSAKQITNPTVLD--NLGHPITGGLYDLSLGAFLRNL-CSTCGL 67

Query: 73  NLASCHGHFGHIKLALPVFHVGYFKATIQILQGICKTCSAILLSEQDKRHFLSELR 128
           +   C GH GHI+L +P ++  +F      L+  C  C    L   +   F S+LR
Sbjct: 68  DEKFCPGHQGHIELPVPCYNPLFFNQLYIYLRTSCLFCHHFRLRSIEVHRFASKLR 123

>CAGL0E05500g Chr5 (539213..544144) [4932 bp, 1643 aa] {ON} highly
            similar to uniprot|P10964 Saccharomyces cerevisiae
            YOR341w RPA190 DNA-directed RNA polymerase I
          Length = 1643

 Score =  446 bits (1146), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 318/984 (32%), Positives = 490/984 (49%), Gaps = 125/984 (12%)

Query: 247  TNKAGRPETYIWRYIPAPPVCIR-PSVMMQDSPASNEDDLTVKLTEIVWTSSLI------ 299
            + K  + + +    +  PP   R PS +  +   ++++ L   L++I+ TS LI      
Sbjct: 332  SRKLVKADMFFMDVLVVPPTRFRLPSKLGDEVHENSQNQL---LSKILTTSLLIRDLNDE 388

Query: 300  -------KAGIE-KGISINNMMEHWDYLQMTVAMYINSDSINPAMLPGSSTGGGKVKPIR 351
                   K  +E + I  + +M  +  +Q  V  +I+S              GGKV PI 
Sbjct: 389  LSTLQKDKVSLEDRRIIFSRLMNAFVTIQNDVNSFIDSTK-------AQGNTGGKV-PIP 440

Query: 352  GFCQRLKGKQGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPQLVAKVLTFPEKVTRY 411
            G  Q L+ K+G FR ++ GKRV+++ R+VISPDPN+  +E+ VP + A  LT+PE VT Y
Sbjct: 441  GVKQALEKKEGLFRKHMMGKRVNYAARSVISPDPNIETNEIGVPPVFATKLTYPEPVTSY 500

Query: 412  NIKKLRQLVQNGPNVHPGANYLLKKNEEARR----NLRYGDRQKLANNLQ---------- 457
            NI +LRQ + NGP+  PGA+ +  +NE+        +    R+ LAN L           
Sbjct: 501  NIAELRQAIINGPDKWPGASQI--QNEDGSLISLVGMTLEQRKALANQLMTPSSNPYTHT 558

Query: 458  YGDVVERHLEDGDVVLFNRQPSLHRLSILSHYAKIRPW-RTFRLNECVCTPYNADFDGDE 516
                V RH+++ D+VL NRQP+LH+ S++ H  ++ P  +T RL+      YNADFDGDE
Sbjct: 559  LNKKVYRHIKNRDIVLMNRQPTLHKASMMGHKVRVLPGEKTLRLHYANTGAYNADFDGDE 618

Query: 517  MNLHVPQTEEARAEAINLMGVKNNLLTPKSGEPIIAATQDFITGSYLISHKDSFFDKASL 576
            MN+H PQ E ARAEA NL    +  LTP SG P+    QD I+    +++KDSFF +   
Sbjct: 619  MNMHFPQNENARAEAFNLANTDSQYLTPTSGSPVRGLIQDHISAGVWLTNKDSFFTREQY 678

Query: 577  TQLLSMM---SDGSL---QFDIPPPAIMKPCYLWTGKQVFS-LLIKPNKNSPVKINLDAK 629
             Q +       DG     +    PPAI KP  LWTGKQ+ + +L+         INL + 
Sbjct: 679  QQYIYGCIRPEDGHATRAKLVTLPPAIHKPIPLWTGKQIITTVLLNVTPPDMPGINLKSS 738

Query: 630  NKVYIPPKQKHYPNEMSQNDGFVIVRGSQILSGVMDKSVLGDGKKHSVFYTILRDFGPQE 689
            NK+    K +++     +ND  VI +  Q+L G++DKS  G   K+ + +++   +GP+ 
Sbjct: 739  NKI----KNEYWGKHSEEND--VIFKDGQLLCGILDKSQYG-ASKYGIVHSLHEVYGPET 791

Query: 690  AASAMNRMAKLCARYLGNRGFSIGISDVTPADDLKQKKEDL----VEIAYAKCDELIDLY 745
            AA  ++ + +L   Y+ N  F+ G+ D+    D  + + D+    V+I      E+ +L 
Sbjct: 792  AAKVLSVLGRLFTNYIMNTAFTCGMDDLRLTSDGNKWRSDILKESVDIGRQAAAEVTNL- 850

Query: 746  NKGKLETQPGC-----------NEEQTLEAKIGGLLSKVREEVGDVCI--NELDNL--NA 790
            +K      P             N+   L+A     ++ +  +V   C+    +     N+
Sbjct: 851  DKDTPSNDPELLKRLEEILRDNNKLGILDAVSSAKVNTITSKVVSQCVPGGTMKKFPENS 910

Query: 791  PLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSKTPQSKGFVRN 850
               MA  G+KGS +NVSQ++ ++GQQ + G RVP     ++LP F        + G+++ 
Sbjct: 911  MQAMALSGAKGSNVNVSQIMCLLGQQALEGRRVPVMVSGKTLPSFKPYETDAMAGGYIKG 970

Query: 851  SFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYDNTVRTSSNG 910
             F+SG+ P E+ FH ++GREGL+DTAVKT+ +GY+ R L K LE +   YDN+VR +   
Sbjct: 971  RFYSGIKPQEYYFHCMAGREGLIDTAVKTSRSGYLQRCLTKQLEGVHISYDNSVRDADGT 1030

Query: 911  IVQFTYGGDGLDPLEMEGNAQPVNFNRSWDHAYNITFNNTDRGLLPYEIKKTVDNILKPL 970
            ++QF YGGD +D ++            S    +N   +N D  L  Y     V+++   +
Sbjct: 1031 LIQFLYGGDAVDVIK-----------ESHMTEFNFCLDNYDALLKKYNPSALVEHV--DV 1077

Query: 971  EKRLIRYD--TLGRPVSAEDDKLDDYVDQHDSERLFY-ASLREFMTDXXXXXXXXXXXXG 1027
            E  L +Y   TL      +D+K       H  + L Y   L ++                
Sbjct: 1078 ETAL-KYSKKTLKNRKKHKDEK-------HYKQTLKYDPVLSKYNPAKYLGAVSENFQDK 1129

Query: 1028 LPKLIKKSE--LEGYDPENEHIDAIVQHSITQLYRITEDAVQKFLEIAISKYHRAKVEPG 1085
            L   + KS    + Y+  NE                     +KF  +   KY R+ + PG
Sbjct: 1130 LELFLDKSSKTFKEYESINE---------------------KKFRALMQLKYMRSLINPG 1168

Query: 1086 TAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEII-NASKVISTPIINAVL 1144
             AVG I +QS+GEP TQMTL TFHFAG  + NVTLG+PR++EII  AS  I TP +   +
Sbjct: 1169 EAVGIIASQSVGEPSTQMTLNTFHFAGHGAANVTLGIPRMREIIMTASAAIKTPQMTLPI 1228

Query: 1145 VNNNDERAARVVKGRIEKTLLSDV 1168
             N+  +  A      I K +LS+V
Sbjct: 1229 WNDVSDETADTFCKSISKVILSEV 1252

 Score = 83.6 bits (205), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 53/176 (30%), Positives = 90/176 (51%), Gaps = 16/176 (9%)

Query: 1269 IMVKGLNDIARAVINIR-------------DDGKRELLVEGYGLRDVMCTDGVIGAKTAT 1315
            +MV  + DI R  I IR             ++GKR L+ EG   + +   +  I     T
Sbjct: 1465 LMVNIVEDICRKTI-IRQVPHIDRCIRPEPENGKRVLVTEGVNFQAMWDQEAFIDVDGIT 1523

Query: 1316 -NHVLEIFNVLGIEAARASIIGEIDYTMSNHGMSVDPRHIQLLGDVMTFKGEVLGITRFG 1374
             N +  +    G+EAAR +I+ EI+   S + +SV  RH+ L+ D+MT +G  L   R G
Sbjct: 1524 SNDIASVLQTYGVEAARNTIVNEINNVFSRYAISVSFRHLDLIADMMTRQGTYLAFNRQG 1583

Query: 1375 LSKMRDSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVV 1430
            +     S++++ S+E T   L  A    +++ +E  S  I+LG+  ++GTG+F ++
Sbjct: 1584 METSTSSLMKM-SYETTCQFLTKAVLDNEREQLESPSARIVLGKLNNVGTGAFDIL 1638

 Score = 53.5 bits (127), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 35/116 (30%), Positives = 53/116 (45%), Gaps = 3/116 (2%)

Query: 13  ISGLEFSALSPADIVAQSELEISSRDLFDLENNRSPKEGGALDPRMGVSASSMECTTCHG 72
           IS ++F  L+ ADI   S   I++  + D  N   P  GG  D  +G    ++ C TC  
Sbjct: 11  ISSVDFGILTSADIRNLSAKRITNPTVLD--NLGHPISGGLYDLALGAFLRNL-CGTCGL 67

Query: 73  NLASCHGHFGHIKLALPVFHVGYFKATIQILQGICKTCSAILLSEQDKRHFLSELR 128
           +   C GH GHI+L +P ++  +F      L+  C  C    L   D   +  +LR
Sbjct: 68  DEKFCPGHQGHIELPVPCYNPLFFNQLYIYLRSACLFCHHFKLKSLDVHRYACKLR 123

>KLLA0F23243g Chr6 (2165407..2170368) [4962 bp, 1653 aa] {ON} highly
            similar to uniprot|P10964 Saccharomyces cerevisiae
            YOR341W RPA190 RNA polymerase I subunit largest subunit
            of RNA polymerase I
          Length = 1653

 Score =  444 bits (1142), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 317/983 (32%), Positives = 493/983 (50%), Gaps = 127/983 (12%)

Query: 254  ETYIWRYIPAPPVCIR-PSVMMQDSPASNEDDLTVKLTEIVWTSSLIK------------ 300
            + +    +  PP   R PS +  +   + ++ L   L++I+ TS LI+            
Sbjct: 353  DMFFMEVLIVPPTRFRLPSKLGDEVHENTQNQL---LSKILTTSLLIRDLNDEMSRLQKD 409

Query: 301  --AGIEKGISINNMMEHWDYLQMTVAMYINSDSINPAMLPGSSTGGGKVKPIRGFCQRLK 358
              +  ++ +  N +M  +  +Q  V  +I+S           S+ G KV PI G  Q L+
Sbjct: 410  KVSADDRKVIFNRLMNAFVTIQNDVNAFIDSTK-------AQSSSGNKV-PIPGLKQALE 461

Query: 359  GKQGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPQLVAKVLTFPEKVTRYNIKKLRQ 418
             K+G FR ++ GKRV+++ R+VISPDPN+  +E+ VP + A  LT+PE VT YN+ +LRQ
Sbjct: 462  KKEGLFRKHMMGKRVNYAARSVISPDPNIETNEIGVPPVFATKLTYPEPVTAYNVAELRQ 521

Query: 419  LVQNGPNVHPGANYLLKKNEEARR----NLRYGDRQKLANNL---QYGDV-------VER 464
             V NGP+  PGA  +  +NE+        +    R+ LAN L      DV       V R
Sbjct: 522  AVINGPDKWPGATQI--QNEDGSFVSLVGMTLEQRKALANQLLTPSTHDVAHSINKKVYR 579

Query: 465  HLEDGDVVLFNRQPSLHRLSILSHYAKIRPW-RTFRLNECVCTPYNADFDGDEMNLHVPQ 523
            H+++ DVV+ NRQP+LH+ S++ H  ++ P  +T RL+      YNADFDGDEMN+H PQ
Sbjct: 580  HIKNRDVVIMNRQPTLHKASMMGHKVRVLPGEKTLRLHYANTGAYNADFDGDEMNMHFPQ 639

Query: 524  TEEARAEAINLMGVKNNLLTPKSGEPIIAATQDFITGSYLISHKDSFFDKASLTQLLSMM 583
             E A+AEA+NL    +  LTP SG P+    QD I+    ++ KDSFF +    Q +   
Sbjct: 640  NENAKAEALNLANTDSQYLTPTSGSPVRGLIQDHISAGVWLTSKDSFFTREQYQQYIYGC 699

Query: 584  ---SDGSL---QFDIPPPAIMKPCYLWTGKQVFS--LLIKPNKNSPVKINLDAKNKVYIP 635
                DG     +    PPA+MKP  LWTGKQ+ +  LL     N P  INL++KNK+   
Sbjct: 700  IRPEDGHATRNKLVTIPPAVMKPEPLWTGKQIITTVLLNTCPANMP-GINLNSKNKI--- 755

Query: 636  PKQKHYPNEMSQNDGFVIVRGSQILSGVMDKSVLGDGKKHSVFYTILRDFGPQEAASAMN 695
             K +++     +N+  V+ +  Q+L G++DKS  G   K  + +++   +GP  AA  ++
Sbjct: 756  -KNEYWGKSSEENN--VVFKDGQLLCGILDKSQYG-ASKFGIVHSLHEVYGPDVAAKVLS 811

Query: 696  RMAKLCARYLGNRGFSIGISDVTPADDLKQKKEDL----VEIAYAKCDELIDL-----YN 746
             + +L   Y+    F+ G+ D+    +  + + D+    V+I      E+ +L      +
Sbjct: 812  VLGRLFTNYITATAFTCGMDDLRLTAEGNKWRNDILQTSVDIGRVAAAEVTNLDKDVKSD 871

Query: 747  KGKL-----ETQPGCNEEQTLEAKIGGLLSKVREEVGDVCINELDNLNAPL----IMATC 797
             G+L     E     N+   L+A     ++ +  +V   C+ +      P      MA  
Sbjct: 872  DGELLKRLEEILRDDNKLGILDAITSSKVNSITSQVVSKCVPDGTMKKFPYNSMQAMALS 931

Query: 798  GSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSKTPQSKGFVRNSFFSGLS 857
            G+KGS +NVSQ++ ++GQQ + G RVP     ++LP F       ++ G+++  F+SG+ 
Sbjct: 932  GAKGSNVNVSQIMCLLGQQALEGRRVPVMVSGKTLPSFKPFETDARAGGYIKGRFYSGIR 991

Query: 858  PPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYDNTVRTSSNGIVQFTYG 917
            P E+ FH ++GREGL+DTAVKT+ +GY+ R L K LE +   YDN+VR     ++QF YG
Sbjct: 992  PQEYYFHCMAGREGLIDTAVKTSRSGYLQRCLTKQLEGVHISYDNSVRDGDGTLIQFLYG 1051

Query: 918  GDGLDPLEMEGNAQPVNFNRSWDHAYNITFNNTDRGLLPYEIKKTVDNI-----LKPLEK 972
            GD +D +  E +     F            +N D  L  Y     VD++     LK  +K
Sbjct: 1052 GDAVD-ITKESHMTEFKF----------CVDNYDALLKKYNPSALVDHLDVESALKYSKK 1100

Query: 973  RLI-RYDTLGRPVSAEDDKLDDYVDQHDSERLFYASLREFMTDXXXXXXXXXXXXGLPKL 1031
             L  R      P  A+  K D  + + +  +   A    F                L K 
Sbjct: 1101 TLKNRKKNSKLPHYAQTSKYDPVLSKFNPSKYLGAVSENFQDK-------------LEKF 1147

Query: 1032 IKKSELEGYDPENEHIDAIVQHSITQLYRITEDAVQKFLEIAISKYHRAKVEPGTAVGAI 1091
            I  S  + +  ++E+++                  +KF  +   KY R+ + PG AVG I
Sbjct: 1148 I--STNDDFFKKDENVNE-----------------KKFRALMQLKYMRSLINPGEAVGII 1188

Query: 1092 GAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEII-NASKVISTPIINAVLVNNNDE 1150
             +QS+GEP TQMTL TFHFAG  + NVTLG+PR++EII  AS  I TP +   + ++  +
Sbjct: 1189 ASQSVGEPSTQMTLNTFHFAGHGAANVTLGIPRMREIIMTASAAIKTPQLTMPIRDDVSD 1248

Query: 1151 RAARVVKGRIEKTLLSDVCYYIQ 1173
              A      I K +LS+V   +Q
Sbjct: 1249 ELADTFCKNITKVMLSEVIDKVQ 1271

 Score = 80.1 bits (196), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 48/162 (29%), Positives = 85/162 (52%), Gaps = 2/162 (1%)

Query: 1270 MVKGLNDIARAVINIRDDGKRELLVEGYGLRDVMCTDGVIGAK-TATNHVLEIFNVLGIE 1328
            +++ +  I R V    ++GKR L+ EG   + +   D  I      +N V  +    G+E
Sbjct: 1488 IIRQVPHIDRCVHPEPENGKRVLVTEGVNFQAMWDQDDFIDINGIRSNDVAAVLKTYGVE 1547

Query: 1329 AARASIIGEIDYTMSNHGMSVDPRHIQLLGDVMTFKGEVLGITRFGLSKMRDSVLQLASF 1388
            AAR +I+ EI+   S + +SV  RH+ L+ D+MT +G  L   R G+     S++++ S+
Sbjct: 1548 AARNTIVNEINNVFSRYAISVSFRHLDLIADMMTRQGNYLAFNRQGMESSTSSLMKM-SY 1606

Query: 1389 EKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVV 1430
            E T   L  A    + + ++  S  I++G+   +GTGSF ++
Sbjct: 1607 ETTCQFLTKAVLDNEHEELKSPSAKIVMGKLNGVGTGSFDLL 1648

 Score = 52.0 bits (123), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 35/133 (26%), Positives = 61/133 (45%), Gaps = 12/133 (9%)

Query: 13  ISGLEFSALSPADIVAQSELEISSRDLFDLENNRSPKEGGALDPRMGVSASSMECTTCHG 72
           I+ ++FS L+  +I   S  ++++  + D  N   P +GG  D  +G    ++ C TC  
Sbjct: 11  ITSIDFSVLTSDEIRKLSAKQVTNPTVLD--NLGHPIQGGLYDLALGAFLKNL-CATCGL 67

Query: 73  NLASCHGHFGHIKLALPVFHVGYFKATIQILQGICKTCSAILLSEQDKRHFLSELR---- 128
           +   C GH GHI+L +P ++  +F      L+  C  C    L   +   +  +LR    
Sbjct: 68  DEKFCPGHQGHIELPVPCYNPLFFNQLYIYLRSSCLFCHHFRLKSSEVHLYACKLRLLQY 127

Query: 129 -----RPGVDNLR 136
                R  +DN+R
Sbjct: 128 ALIDERYQIDNIR 140

>KLTH0D01628g Chr4 complement(157597..162561) [4965 bp, 1654 aa] {ON}
            highly similar to uniprot|P10964 Saccharomyces cerevisiae
            YOR341W RPA190 RNA polymerase I subunit largest subunit
            of RNA polymerase I
          Length = 1654

 Score =  442 bits (1138), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 317/988 (32%), Positives = 497/988 (50%), Gaps = 133/988 (13%)

Query: 247  TNKAGRPETYIWRYIPAPPVCIR-PSVMMQDSPASNEDDLTVKLTEIVWTSSLI------ 299
            + K  R + +    +  PP   R PS + ++   + ++ L   L++I+ TS LI      
Sbjct: 341  SKKLVRADMFFLEVVIVPPTRFRLPSKLGEEIHENTQNQL---LSKILTTSLLIRDLNEE 397

Query: 300  -------KAGIE-KGISINNMMEHWDYLQMTVAMYINSDSINPAMLPGSSTGGGKVKPIR 351
                   K  +E K +  N +M  +  +Q  V  +I+S              GGKV PI 
Sbjct: 398  MSKLQKDKVSVEDKKVIFNRLMNAFVTIQNDVNAFIDSTK-------AQGNTGGKV-PIP 449

Query: 352  GFCQRLKGKQGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPQLVAKVLTFPEKVTRY 411
            G  Q L+ K+G FR ++ GKRV+++ R+VISPDPN+  +E+ VP + A  LT+PE VT Y
Sbjct: 450  GVKQALEKKEGLFRKHMMGKRVNYAARSVISPDPNIETNEIGVPPVFATKLTYPEPVTSY 509

Query: 412  NIKKLRQLVQNGPNVHPGANYLLKKNEEARRNLRYG----DRQKLANNL----------Q 457
            NI +LRQ V NGP+  PGA  +  +NE+       G     R+ LAN L           
Sbjct: 510  NIAELRQAVINGPDKWPGATQI--QNEDGSLVSLVGMTTEQRKALANQLLTPSSHSATHS 567

Query: 458  YGDVVERHLEDGDVVLFNRQPSLHRLSILSHYAKIRPW-RTFRLNECVCTPYNADFDGDE 516
                V RH+++ D+V+ NRQP+LH+ S++ H  ++ P  +T RL+      YNADFDGDE
Sbjct: 568  LNKKVYRHIKNRDIVIMNRQPTLHKASMMGHKVRVLPGEKTLRLHYANTGAYNADFDGDE 627

Query: 517  MNLHVPQTEEARAEAINLMGVKNNLLTPKSGEPIIAATQDFITGSYLISHKDSFFDKASL 576
            MN+H PQ E ARAEA NL    +  LTP SG P+    QD I+    +++KDSFF +   
Sbjct: 628  MNMHFPQNENARAEAFNLANTDSQYLTPTSGSPVRGLIQDHISAGVWLTNKDSFFTREEY 687

Query: 577  TQLLSMM---SDGSL---QFDIPPPAIMKPCYLWTGKQVFS-LLIKPNKNSPVKINLDAK 629
             Q +       DG     +    PPA+ KP  LWTGKQ+ + +L+         INL +K
Sbjct: 688  QQYIYGCIRPEDGHATRNKLLTVPPAVFKPVPLWTGKQIITTVLLNVTPADMPGINLLSK 747

Query: 630  NKVYIPPKQKHYPNEMSQNDGFVIVRGSQILSGVMDKSVLGDGKKHSVFYTILRDFGPQE 689
            NK+    K +++    ++ND  V+ +  ++L G++DKS  G   K+ + +++   +GP  
Sbjct: 748  NKI----KNEYWGKGSTEND--VVFKNGELLCGILDKSQYG-ASKYGIVHSLHEVYGPDV 800

Query: 690  AASAMNRMAKLCARYLGNRGFSIGISDVTPADDLKQKKEDLV----EIAYAKCDELIDL- 744
            +A  ++ + +L   Y+    F+ G+ D+   ++  + + D++    ++      E+ +L 
Sbjct: 801  SAKVLSVLGRLFTNYITATAFTCGMDDLRLTEEGNKWRSDILKTSTDVGRVAAAEVTNLD 860

Query: 745  ----YNKGKL-----ETQPGCNEEQTLEAKIGGLLSKVREEVGDVCI-----NELDNLNA 790
                 N  +L     E     N+   L+A     ++ +  +V   C+      +  N N+
Sbjct: 861  KDVSANDSELLKRLEEILRDDNKLGILDAVTSSKVNSITSQVVSKCVPDGTMKKFPN-NS 919

Query: 791  PLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSKTPQSKGFVRN 850
               MA  G+KGS +NVSQ++ ++GQQ + G RVP     ++LP F        + G+++ 
Sbjct: 920  MQAMALSGAKGSNVNVSQIMCLLGQQALEGRRVPVMVSGKTLPSFKPFETDAMAGGYIKG 979

Query: 851  SFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYDNTVRTSSNG 910
             F+SG+ P E+ FH ++GREGL+DTAVKT+ +GY+ R L K LE +   YDN+VR +   
Sbjct: 980  RFYSGIKPQEYYFHCMAGREGLIDTAVKTSRSGYLQRCLTKQLEGVHISYDNSVRDADGT 1039

Query: 911  IVQFTYGGDGLDPLEMEGNAQPVNFNRSWDHAYNITFNNTDRGLLPYEIKKTVDNI---- 966
            ++QF YGGD +D  +     Q           +    +N D  L  Y     ++++    
Sbjct: 1040 LIQFLYGGDAVDVTQESHMTQ-----------FKFCADNYDALLKKYNPAALIEHLDVES 1088

Query: 967  -LKPLEKRLI-RYDTLGRPVSAEDDKLDDYVDQHDSERLFYASLREFMTDXXXXXXXXXX 1024
             LK  +K L  R  T   P  ++  K D  V + +  + +  S+ E   D          
Sbjct: 1089 ALKYSKKALKHRKKTEKVPHYSQKVKYDPVVSKFNPSK-YLGSVSENFQD---------- 1137

Query: 1025 XXGLPKLIKKSELEGYDPENEHIDAIVQHSITQLYRITEDAV--QKFLEIAISKYHRAKV 1082
                       +LE +   N             L++ + D V  +KF  +   KY R+ +
Sbjct: 1138 -----------KLESFIDSN-----------NDLFK-SRDTVSEKKFRALMQLKYMRSLI 1174

Query: 1083 EPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEII-NASKVISTPIIN 1141
             PG AVG I +QS+GEP TQMTL TFHFAG  + NVTLG+PR++EII  AS  I TP + 
Sbjct: 1175 NPGEAVGIIASQSVGEPSTQMTLNTFHFAGHGAANVTLGIPRMREIIMTASAAIKTPQMT 1234

Query: 1142 -AVLVNNNDERAARVVKGRIEKTLLSDV 1168
              +L +  D +A    K  + K +LS+V
Sbjct: 1235 LPILADVTDPQADTFCKS-VTKVMLSEV 1261

 Score = 84.7 bits (208), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 50/162 (30%), Positives = 88/162 (54%), Gaps = 2/162 (1%)

Query: 1270 MVKGLNDIARAVINIRDDGKRELLVEGYGLRDVMCTDGVIGAKTAT-NHVLEIFNVLGIE 1328
            +++ + +I R V    ++GKR L+ EG   +++   D  I     T N V  +    G+E
Sbjct: 1487 VIREVKNIDRCVHPEPENGKRILVTEGVNFQEMWDQDAFIDVNGITSNDVASVLKTYGVE 1546

Query: 1329 AARASIIGEIDYTMSNHGMSVDPRHIQLLGDVMTFKGEVLGITRFGLSKMRDSVLQLASF 1388
            AAR +I+ EI+   S + +SV  RH+ L+ D+MT +G  L   R G+     S++++ S+
Sbjct: 1547 AARNTIVNEINNVFSRYAISVSFRHLDLIADMMTRQGTYLAFNRQGMETSTSSLMKM-SY 1605

Query: 1389 EKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVV 1430
            E T   L  A    + + ++  S  I+LG+  ++GTG+F V+
Sbjct: 1606 ETTCQFLTKAVLDNECENLDSPSARIVLGKLNNVGTGAFDVL 1647

 Score = 51.6 bits (122), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 30/116 (25%), Positives = 54/116 (46%), Gaps = 3/116 (2%)

Query: 13  ISGLEFSALSPADIVAQSELEISSRDLFDLENNRSPKEGGALDPRMGVSASSMECTTCHG 72
           I+ ++F  ++  DI   S ++I++  + D  N   P  GG  D  +G    ++ C TC  
Sbjct: 11  ITSVDFGVMTAQDIRNFSAMQITNPTVLD--NLGHPISGGLYDLALGAFLRNL-CATCGL 67

Query: 73  NLASCHGHFGHIKLALPVFHVGYFKATIQILQGICKTCSAILLSEQDKRHFLSELR 128
           +   C GH GHI+L +P ++  +F      L+  C  C    L   +   +  +L+
Sbjct: 68  DEKFCPGHQGHIELPVPCYNPLFFSQLYIFLRSSCLYCHGFRLKASEVHRYACKLK 123

>TBLA0E01930 Chr5 (468692..473671) [4980 bp, 1659 aa] {ON} Anc_7.51
            YOR341W
          Length = 1659

 Score =  437 bits (1123), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 310/985 (31%), Positives = 492/985 (49%), Gaps = 127/985 (12%)

Query: 247  TNKAGRPETYIWRYIPAPPVCIR-PSVMMQDSPASNEDDLTVKLTEIVWTSSLI------ 299
            + K  +P+ +    I  PP   R PS +  +   + ++ L   L++I+ TS LI      
Sbjct: 348  SKKLVKPDAFFMDVIVVPPTRFRLPSKLGDEVHENTQNQL---LSKILTTSLLIRDLNDE 404

Query: 300  -------KAGIE-KGISINNMMEHWDYLQMTVAMYINSDSINPAMLPGSSTGGGKVKPIR 351
                   K  +E + +  + +M  +  +Q  V  +I+S           +TGG  V P  
Sbjct: 405  MSKLQKDKVSLEDRRVIFSRLMNAFVTIQNDVNSFIDSSKAQ------GNTGGNDVIP-- 456

Query: 352  GFCQRLKGKQGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPQLVAKVLTFPEKVTRY 411
            G  Q L+ K+G FR ++ GKRV+++ R+VISPDPN+  +E+ VP + A  LT+PE VT Y
Sbjct: 457  GVKQALEKKEGLFRKHMMGKRVNYAARSVISPDPNIETNEIGVPPVFAVKLTYPEPVTSY 516

Query: 412  NIKKLRQLVQNGPNVHPGANYLLKKNEEARR----NLRYGDRQKLANNLQ---------- 457
            NI +LRQ V NGP+  PGA  +  +NE+        +    R+ LAN L           
Sbjct: 517  NIAELRQAVINGPDKWPGA--IQIQNEDGTLVSLIGMTLEQRKALANQLMTPSSNSSSHV 574

Query: 458  YGDVVERHLEDGDVVLFNRQPSLHRLSILSHYAKIRPW-RTFRLNECVCTPYNADFDGDE 516
                V RH+++ D+V+ NRQP+LH+ S++ H  ++ P  +T RL+      YNADFDGDE
Sbjct: 575  LNKKVYRHIKNRDIVIMNRQPTLHKASMMGHKVRVLPGEKTLRLHYANTGAYNADFDGDE 634

Query: 517  MNLHVPQTEEARAEAINLMGVKNNLLTPKSGEPIIAATQDFITGSYLISHKDSFFDKASL 576
            MN+H PQ E ARAE++ L    +  LTP SG P+    QD I+    +++KDSFF +   
Sbjct: 635  MNMHFPQNENARAESLFLANTDSQYLTPTSGSPVRGLIQDHISAGVWLTNKDSFFTREQY 694

Query: 577  TQLLSMM---SDGSL---QFDIPPPAIMKPCYLWTGKQVFS-LLIKPNKNSPVKINLDAK 629
             Q +       DG     +    PP I KP  LWTGKQ+ + +L+    +    INL +K
Sbjct: 695  QQYIYGCIRPEDGHATRAKIVTLPPTIFKPIPLWTGKQIITTVLLNITPSDMPGINLHSK 754

Query: 630  NKVYIPPKQKHYPNEMSQNDGFVIVRGSQILSGVMDKSVLGDGKKHSVFYTILRDFGPQE 689
            NK+    K +++    ++N+  VI +   +L G++DK+  G  K + + +++   +GP  
Sbjct: 755  NKI----KNEYWGKGSNENE--VIFKDGALLCGILDKNQYGSSK-YGIVHSLHELYGPDV 807

Query: 690  AASAMNRMAKLCARYLGNRGFSIGISDVTPADDLKQKKEDL----VEIAYAKCDELIDLY 745
            AA  ++ + +L   Y+    F+ G+ D+   D+  + + D+    V+       E+ +L 
Sbjct: 808  AAKVLSVLGRLFTNYITATAFTCGMDDLRLTDEGNKWRRDILKTSVDTGRQAAAEVTNLS 867

Query: 746  N----------KGKLETQPGCNEEQTLEAKIGGLLSKVREEVGDVCI--NELDNL--NAP 791
                       K   E     N+   L+A     ++ +  +V   C+    +     N+ 
Sbjct: 868  KDTPADDPELLKRLEEILRDDNKSGILDAVTSSKVNAITSKVVSTCVPGGTMKKFPYNSM 927

Query: 792  LIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSKTPQSKGFVRNS 851
              MA  G+KGS +NVSQ++ ++GQQ + G RVP     ++LP F        + G+++  
Sbjct: 928  QAMALSGAKGSNVNVSQIMCLLGQQALEGRRVPTMVSGKTLPSFKPYETDAMAGGYIKGR 987

Query: 852  FFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYDNTVRTSSNGI 911
            F+SG+ P E+ FH ++GREGL+DTAVKT+ +GY+ R L K LE +   YDNTVR     +
Sbjct: 988  FYSGIKPQEYYFHCMAGREGLIDTAVKTSRSGYLQRCLTKQLEGVHISYDNTVRDGDGTL 1047

Query: 912  VQFTYGGDGLDPLEMEGNAQPVNFNRSWDHAYNITFNNTDRGLLPYEIKKTVDNI----- 966
            ++F YGGD +D  +            S+   +     N D  +  Y     ++++     
Sbjct: 1048 IEFLYGGDAVDVTK-----------ESYMTQFKFCLENYDGLVKKYNPSALIEHLNVESA 1096

Query: 967  LKPLEKRL-IRYDTLGRPVSAEDDKLDDYVDQHDSERLFYASLREFMTDXXXXXXXXXXX 1025
            LK  +K L  R      P   ++ K D  + +++  + +  S+ E   D           
Sbjct: 1097 LKYSKKALKYRKKHSSVPHYLQNSKYDPVLAKYNPSK-YLGSVSEKFQD----------- 1144

Query: 1026 XGLPKLIKKSELEGYDPENEHIDAIVQHSITQLYRITEDAVQ-KFLEIAISKYHRAKVEP 1084
                      +LE +  EN           ++L + TE   + KF  +   KY R+ ++P
Sbjct: 1145 ----------KLEEFLNEN-----------SKLVKSTEGVNEKKFRALMQLKYMRSLIDP 1183

Query: 1085 GTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEII-NASKVISTPIINAV 1143
            G +VG I +QS+GEP TQMTL TFHFAG  + NVTLG+PR++EII  AS  I TP +N  
Sbjct: 1184 GESVGIIASQSVGEPSTQMTLNTFHFAGHGAANVTLGIPRMREIIMTASSSIKTPQMNLP 1243

Query: 1144 LVNNNDERAARVVKGRIEKTLLSDV 1168
            ++N+   + A      I K LLS V
Sbjct: 1244 ILNDVSNQQAETFCKSITKVLLSQV 1268

 Score = 88.6 bits (218), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 50/162 (30%), Positives = 86/162 (53%), Gaps = 2/162 (1%)

Query: 1270 MVKGLNDIARAVINIRDDGKRELLVEGYGLRDVMCTDGVIGA-KTATNHVLEIFNVLGIE 1328
            +++ + +I R V    ++G R L+ EG   + +   D  I   K  +N V  +    G+E
Sbjct: 1492 VIREVPNIERCVYPEANNGDRSLITEGVNFQAMWDQDTFIDVDKITSNDVSAVLRTYGVE 1551

Query: 1329 AARASIIGEIDYTMSNHGMSVDPRHIQLLGDVMTFKGEVLGITRFGLSKMRDSVLQLASF 1388
            AAR +I+ EID   S + +SV  RH+ L+ D+MT +G  L   R G+     S++++ S+
Sbjct: 1552 AARNTIVNEIDRVFSTYAISVSSRHLDLIADMMTRQGTYLAFNRQGMETSTSSLMKM-SY 1610

Query: 1389 EKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVV 1430
            E T   L  A    + + +   S  I+LG+  ++GTGSF ++
Sbjct: 1611 ETTCQFLTKAVLDNEHEELNSPSARIVLGKLNNVGTGSFDIL 1652

 Score = 49.3 bits (116), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 32/116 (27%), Positives = 53/116 (45%), Gaps = 3/116 (2%)

Query: 13  ISGLEFSALSPADIVAQSELEISSRDLFDLENNRSPKEGGALDPRMGVSASSMECTTCHG 72
           I+ ++F  LS   I   S  +I++  + D  N   P  GG  D  +G    ++ C+TC  
Sbjct: 11  ITSVDFEILSSDQIRNLSAKQITNPTVLD--NLGHPISGGLYDLALGAFLRNL-CSTCGQ 67

Query: 73  NLASCHGHFGHIKLALPVFHVGYFKATIQILQGICKTCSAILLSEQDKRHFLSELR 128
           +   C GH GHI+L +P ++  +F      L+  C  C    L   D   +  +L+
Sbjct: 68  DEKFCPGHQGHIELPVPCYNPLFFNQLFIYLRSSCLYCHHFRLKSLDTHLYSCKLK 123

>Skud_15.506 Chr15 (901437..906434) [4998 bp, 1665 aa] {ON} YOR341W
            (REAL)
          Length = 1665

 Score =  435 bits (1118), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 313/982 (31%), Positives = 494/982 (50%), Gaps = 121/982 (12%)

Query: 247  TNKAGRPETYIWRYIPAPPVCIR-PSVMMQDSPASNEDDLTVKLTEIVWTSSLI------ 299
            + K  + +++    I  PP   R PS +  +   ++++ L   L++++ TS LI      
Sbjct: 346  SRKVVKADSFFMDVIVVPPTRFRLPSKLGDEVHENSQNQL---LSKVLTTSLLIRDLNDD 402

Query: 300  -------KAGIE-KGISINNMMEHWDYLQMTVAMYINSDSINPAMLPGSSTGGGKVKPIR 351
                   K  +E + +  + +M  +  +Q  V  +I+S               GKV PI 
Sbjct: 403  LSKLQKDKVSLEDRKVIFSRLMNAFVTIQNDVNAFIDSTK-------AQGRTSGKV-PIP 454

Query: 352  GFCQRLKGKQGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPQLVAKVLTFPEKVTRY 411
            G  Q L+ K+G FR ++ GKRV+++ R+VISPDPN+  +E+ VP + A  LT+PE VT Y
Sbjct: 455  GVKQALEKKEGLFRKHMMGKRVNYAARSVISPDPNIETNEIGVPPVFAVKLTYPEPVTAY 514

Query: 412  NIKKLRQLVQNGPNVHPGANYLLKKNEEARR----NLRYGDRQKLANNL----------Q 457
            NI +LRQ V NGP+  PGA  +  +NE+        + +  R+ LAN L           
Sbjct: 515  NIAELRQAVINGPDKWPGATQI--QNEDGSLVSLIGMSFEQRKALANQLLTPSSNVSTHT 572

Query: 458  YGDVVERHLEDGDVVLFNRQPSLHRLSILSHYAKIRP-WRTFRLNECVCTPYNADFDGDE 516
                V RH+++ DVVL NRQP+LH+ S++ H  ++ P  +T RL+      YNADFDGDE
Sbjct: 573  LNKKVYRHIKNRDVVLMNRQPTLHKASMMGHKVRVLPNEKTLRLHYANTGAYNADFDGDE 632

Query: 517  MNLHVPQTEEARAEAINLMGVKNNLLTPKSGEPIIAATQDFITGSYLISHKDSFFDKASL 576
            MN+H PQ E ARAEA+NL    +  LTP SG P+    QD I+    ++ KDSFF +   
Sbjct: 633  MNMHFPQNENARAEALNLANTDSQYLTPTSGSPVRGLIQDHISAGVWLTSKDSFFTREQY 692

Query: 577  TQLLSMM---SDGSL---QFDIPPPAIMKPCYLWTGKQVFS-LLIKPNKNSPVKINLDAK 629
             Q +       DG     +    PP I KP  LWTGKQ+ + +L+         INL +K
Sbjct: 693  QQYIYGCIRPEDGHTTRSKIVTLPPTIFKPYPLWTGKQIITTVLLNVTPPDMPGINLISK 752

Query: 630  NKVYIPPKQKHYPNEMSQNDGFVIVRGSQILSGVMDKSVLGDGKKHSVFYTILRDFGPQE 689
            NK+    K +++     +++  V+ +   +L G++DKS  G   K+ + +++   +GP+ 
Sbjct: 753  NKI----KNEYWGKGSLESE--VLFKDGALLCGILDKSQYG-ASKYGIVHSLHEVYGPEV 805

Query: 690  AASAMNRMAKLCARYLGNRGFSIGISDVTPADDLKQKKEDL----VEIAYAKCDELIDLY 745
            AA  ++ + +L   Y+    F+ G+ D+    +  + + D+    V+       E+ +L 
Sbjct: 806  AAKVLSVLGRLFTNYITATAFTCGMDDLRLTAEGNKWRTDILKTSVDTGRQAAAEVTNLD 865

Query: 746  N----------KGKLETQPGCNEEQTLEAKIGGLLSKVREEVGDVCINELDNLNAPL--- 792
                       K   E     N+   L+A     ++ +  +V   C+ +      P    
Sbjct: 866  KETPSDDPELLKRLQEILRDNNKSGILDAVTSSKVNVITSQVVSKCVPDGTMKKFPCNSM 925

Query: 793  -IMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSKTPQSKGFVRNS 851
              MA  G+KGS +NVSQ++ ++GQQ + G RVP     ++LP F        + G+V+  
Sbjct: 926  QAMALSGAKGSNVNVSQIMCLLGQQALEGRRVPVMVSGKTLPSFKPYETDAMAGGYVKGR 985

Query: 852  FFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYDNTVRTSSNGI 911
            F+SG+ P E+ FH ++GREGL+DTAVKT+ +GY+ R L K LE +   YDN++R +   +
Sbjct: 986  FYSGIKPQEYYFHCMAGREGLIDTAVKTSRSGYLQRCLTKQLEGVHVSYDNSIRDADGTL 1045

Query: 912  VQFTYGGDGLDPLEMEGNAQPVNFNRSWDHAYNITFNNTDRGLLPYEIKKTVDNILKPLE 971
            +QF YGGD +D   +   +    F    D+ Y +        L+ +     V++ LK  +
Sbjct: 1046 IQFMYGGDAVD---ITKESHMTQFEFCLDNYYALLKKYNPSALIEH---LDVESALKYSK 1099

Query: 972  KRL-IRYDTLGRPVSAEDDKLDDYVDQHDSERLFYASLREFMTDXXXXXXXXXXXXGLPK 1030
            K L  R      P   +  K D  + ++   + +  S+ E   D                
Sbjct: 1100 KTLKYRKKHSKEPHYKQSMKYDPVLAKYSPAK-YLGSVSENFQD---------------- 1142

Query: 1031 LIKKSELEGYDPENEHIDAIVQHSITQLYRITEDAV--QKFLEIAISKYHRAKVEPGTAV 1088
                 +LE +  EN           ++L++ T D V  +KF  +   KY R+ + PG AV
Sbjct: 1143 -----KLESFLDEN-----------SKLFKST-DGVNEKKFRALMQLKYMRSLINPGEAV 1185

Query: 1089 GAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEII-NASKVISTPIINAVLVNN 1147
            G I +QS+GEP TQMTL TFHFAG  + NVTLG+PR++EI+  AS  I TP +   + ++
Sbjct: 1186 GIIASQSVGEPSTQMTLNTFHFAGHGAANVTLGIPRLREIVMTASAAIKTPQMTLPIWDD 1245

Query: 1148 -NDERAARVVKGRIEKTLLSDV 1168
             +DE+A    K  I K LLS+V
Sbjct: 1246 VSDEQADTFCKS-ISKVLLSEV 1266

 Score = 83.2 bits (204), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 50/162 (30%), Positives = 86/162 (53%), Gaps = 2/162 (1%)

Query: 1270 MVKGLNDIARAVINIRDDGKRELLVEGYGLRDVMCTDGVIGAKTAT-NHVLEIFNVLGIE 1328
            +++ +  I R V    ++GKR L+ EG   + +   +  I     T N V  +    G+E
Sbjct: 1498 IIRQIPRIDRCVHPEPENGKRVLVTEGVNFQAMWDQEAFIDVDGITSNDVAAVLKTYGVE 1557

Query: 1329 AARASIIGEIDYTMSNHGMSVDPRHIQLLGDVMTFKGEVLGITRFGLSKMRDSVLQLASF 1388
            AAR +I+ EI+   S + +SV  RH+ LL D+MT +G  L   R G+     S +++ S+
Sbjct: 1558 AARNTIVNEINNVFSRYAISVSFRHLDLLADMMTRQGTYLAFNRQGMETSTSSFMKM-SY 1616

Query: 1389 EKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVV 1430
            E T   L  A    +++ ++  S  I++G+  ++GTGSF V+
Sbjct: 1617 ETTCQFLTKAVLDNEREQLDSPSARIVVGKLNNVGTGSFDVL 1658

 Score = 48.9 bits (115), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 31/116 (26%), Positives = 54/116 (46%), Gaps = 3/116 (2%)

Query: 13  ISGLEFSALSPADIVAQSELEISSRDLFDLENNRSPKEGGALDPRMGVSASSMECTTCHG 72
           I+ ++F  L+  +I   S  +I++  + D  N   P  GG  D  +G    ++ C+TC  
Sbjct: 11  ITSVDFGILTAKEIRNLSAKQITNPTVLD--NLGHPVSGGLYDLALGAFLRNL-CSTCGL 67

Query: 73  NLASCHGHFGHIKLALPVFHVGYFKATIQILQGICKTCSAILLSEQDKRHFLSELR 128
           +   C GH GHI+L +P ++  +F      L+  C  C    L   +   +  +LR
Sbjct: 68  DEKFCPGHQGHIELPVPCYNPLFFNQLYIYLRASCLFCHHFRLKSVEVHRYACKLR 123

>YOR341W Chr15 (960987..965981) [4995 bp, 1664 aa] {ON}  RPA190RNA
            polymerase I largest subunit A190
          Length = 1664

 Score =  434 bits (1117), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 313/982 (31%), Positives = 495/982 (50%), Gaps = 121/982 (12%)

Query: 247  TNKAGRPETYIWRYIPAPPVCIR-PSVMMQDSPASNEDDLTVKLTEIVWTSSLI------ 299
            + K  + +++    +  PP   R PS + ++   ++++ L   L++++ TS LI      
Sbjct: 346  SRKLVKADSFFMDVLVVPPTRFRLPSKLGEEVHENSQNQL---LSKVLTTSLLIRDLNDD 402

Query: 300  -------KAGIE-KGISINNMMEHWDYLQMTVAMYINSDSINPAMLPGSSTGGGKVKPIR 351
                   K  +E + +  + +M  +  +Q  V  +I+S               GKV PI 
Sbjct: 403  LSKLQKDKVSLEDRRVIFSRLMNAFVTIQNDVNAFIDSTK-------AQGRTSGKV-PIP 454

Query: 352  GFCQRLKGKQGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPQLVAKVLTFPEKVTRY 411
            G  Q L+ K+G FR ++ GKRV+++ R+VISPDPN+  +E+ VP + A  LT+PE VT Y
Sbjct: 455  GVKQALEKKEGLFRKHMMGKRVNYAARSVISPDPNIETNEIGVPPVFAVKLTYPEPVTAY 514

Query: 412  NIKKLRQLVQNGPNVHPGANYLLKKNEEARR----NLRYGDRQKLANNL----------Q 457
            NI +LRQ V NGP+  PGA  +  +NE+        +    R+ LAN L           
Sbjct: 515  NIAELRQAVINGPDKWPGATQI--QNEDGSLVSLIGMSVEQRKALANQLLTPSSNVSTHT 572

Query: 458  YGDVVERHLEDGDVVLFNRQPSLHRLSILSHYAKIRP-WRTFRLNECVCTPYNADFDGDE 516
                V RH+++ DVVL NRQP+LH+ S++ H  ++ P  +T RL+      YNADFDGDE
Sbjct: 573  LNKKVYRHIKNRDVVLMNRQPTLHKASMMGHKVRVLPNEKTLRLHYANTGAYNADFDGDE 632

Query: 517  MNLHVPQTEEARAEAINLMGVKNNLLTPKSGEPIIAATQDFITGSYLISHKDSFFDKASL 576
            MN+H PQ E ARAEA+NL    +  LTP SG P+    QD I+    ++ KDSFF +   
Sbjct: 633  MNMHFPQNENARAEALNLANTDSQYLTPTSGSPVRGLIQDHISAGVWLTSKDSFFTREQY 692

Query: 577  TQLLSMM---SDGSL---QFDIPPPAIMKPCYLWTGKQVFS-LLIKPNKNSPVKINLDAK 629
             Q +       DG     +    PP I KP  LWTGKQ+ + +L+         INL +K
Sbjct: 693  QQYIYGCIRPEDGHTTRSKIVTLPPTIFKPYPLWTGKQIITTVLLNVTPPDMPGINLISK 752

Query: 630  NKVYIPPKQKHYPNEMSQNDGFVIVRGSQILSGVMDKSVLGDGKKHSVFYTILRDFGPQE 689
            NK+    K +++     +N+  V+ +   +L G++DKS  G   K+ + +++   +GP+ 
Sbjct: 753  NKI----KNEYWGKGSLENE--VLFKDGALLCGILDKSQYG-ASKYGIVHSLHEVYGPEV 805

Query: 690  AASAMNRMAKLCARYLGNRGFSIGISDVTPADDLKQKKEDL----VEIAYAKCDELIDLY 745
            AA  ++ + +L   Y+    F+ G+ D+    +  + + D+    V+       E+ +L 
Sbjct: 806  AAKVLSVLGRLFTNYITATAFTCGMDDLRLTAEGNKWRTDILKTSVDTGREAAAEVTNLD 865

Query: 746  N----------KGKLETQPGCNEEQTLEAKIGGLLSKVREEVGDVCINELDNLNAPL--- 792
                       K   E     N+   L+A     ++ +  +V   C+ +      P    
Sbjct: 866  KDTPADDPELLKRLQEILRDNNKSGILDAVTSSKVNAITSQVVSKCVPDGTMKKFPCNSM 925

Query: 793  -IMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSKTPQSKGFVRNS 851
              MA  G+KGS +NVSQ++ ++GQQ + G RVP     ++LP F        + G+V+  
Sbjct: 926  QAMALSGAKGSNVNVSQIMCLLGQQALEGRRVPVMVSGKTLPSFKPYETDAMAGGYVKGR 985

Query: 852  FFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYDNTVRTSSNGI 911
            F+SG+ P E+ FH ++GREGL+DTAVKT+ +GY+ R L K LE +   YDN++R +   +
Sbjct: 986  FYSGIKPQEYYFHCMAGREGLIDTAVKTSRSGYLQRCLTKQLEGVHVSYDNSIRDADGTL 1045

Query: 912  VQFTYGGDGLDPLEMEGNAQPVNFNRSWDHAYNITFNNTDRGLLPYEIKKTVDNILKPLE 971
            VQF YGGD +D   +   +    F    D+ Y +        L+ +     V++ LK  +
Sbjct: 1046 VQFMYGGDAID---ITKESHMTQFEFCLDNYYALLKKYNPSALIEH---LDVESALKYSK 1099

Query: 972  KRL-IRYDTLGRPVSAEDDKLDDYVDQHDSERLFYASLREFMTDXXXXXXXXXXXXGLPK 1030
            K L  R      P   +  K D  + +++  + +  S+ E   D                
Sbjct: 1100 KTLKYRKKHSKEPHYKQSVKYDPVLAKYNPAK-YLGSVSENFQD---------------- 1142

Query: 1031 LIKKSELEGYDPENEHIDAIVQHSITQLYRITEDAV--QKFLEIAISKYHRAKVEPGTAV 1088
                 +LE +  +N           ++L++ + D V  +KF  +   KY R+ + PG AV
Sbjct: 1143 -----KLESFLDKN-----------SKLFK-SSDGVNEKKFRALMQLKYMRSLINPGEAV 1185

Query: 1089 GAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEII-NASKVISTPIINAVLVNN 1147
            G I +QS+GEP TQMTL TFHFAG  + NVTLG+PR++EI+  AS  I TP +   + N+
Sbjct: 1186 GIIASQSVGEPSTQMTLNTFHFAGHGAANVTLGIPRLREIVMTASAAIKTPQMTLPIWND 1245

Query: 1148 -NDERAARVVKGRIEKTLLSDV 1168
             +DE+A    K  I K LLS+V
Sbjct: 1246 VSDEQADTFCKS-ISKVLLSEV 1266

 Score = 82.4 bits (202), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 49/162 (30%), Positives = 86/162 (53%), Gaps = 2/162 (1%)

Query: 1270 MVKGLNDIARAVINIRDDGKRELLVEGYGLRDVMCTDGVIGAKTAT-NHVLEIFNVLGIE 1328
            +++ +  I R V    ++GKR L+ EG   + +   +  I     T N V  +    G+E
Sbjct: 1497 IIRQIPHIDRCVHPEPENGKRVLVTEGVNFQAMWDQEAFIDVDGITSNDVAAVLKTYGVE 1556

Query: 1329 AARASIIGEIDYTMSNHGMSVDPRHIQLLGDVMTFKGEVLGITRFGLSKMRDSVLQLASF 1388
            AAR +I+ EI+   S + +SV  RH+ L+ D+MT +G  L   R G+     S +++ S+
Sbjct: 1557 AARNTIVNEINNVFSRYAISVSFRHLDLIADMMTRQGTYLAFNRQGMETSTSSFMKM-SY 1615

Query: 1389 EKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVV 1430
            E T   L  A    +++ ++  S  I++G+  ++GTGSF V+
Sbjct: 1616 ETTCQFLTKAVLDNEREQLDSPSARIVVGKLNNVGTGSFDVL 1657

 Score = 48.9 bits (115), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 31/116 (26%), Positives = 54/116 (46%), Gaps = 3/116 (2%)

Query: 13  ISGLEFSALSPADIVAQSELEISSRDLFDLENNRSPKEGGALDPRMGVSASSMECTTCHG 72
           I+ ++F  L+  +I   S  +I++  + D  N   P  GG  D  +G    ++ C+TC  
Sbjct: 11  ITSVDFGILTAKEIRNLSAKQITNPTVLD--NLGHPVSGGLYDLALGAFLRNL-CSTCGL 67

Query: 73  NLASCHGHFGHIKLALPVFHVGYFKATIQILQGICKTCSAILLSEQDKRHFLSELR 128
           +   C GH GHI+L +P ++  +F      L+  C  C    L   +   +  +LR
Sbjct: 68  DEKFCPGHQGHIELPVPCYNPLFFNQLYIYLRASCLFCHHFRLKSVEVHRYACKLR 123

>Smik_15.519 Chr15 (910592..915589) [4998 bp, 1665 aa] {ON} YOR341W
            (REAL)
          Length = 1665

 Score =  433 bits (1114), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 313/981 (31%), Positives = 491/981 (50%), Gaps = 119/981 (12%)

Query: 247  TNKAGRPETYIWRYIPAPPVCIR-PSVMMQDSPASNEDDLTVKLTEIVWTSSLI------ 299
            + K  + +++    I  PP   R PS + ++   ++++ L   L++++ TS LI      
Sbjct: 346  SRKLVKADSFFMDVIVVPPTRFRLPSKLGEEVHENSQNQL---LSKVLTTSLLIRDLNDD 402

Query: 300  -------KAGIE-KGISINNMMEHWDYLQMTVAMYINSDSINPAMLPGSSTGGGKVKPIR 351
                   K  +E + +  + +M  +  +Q  V  +I+S               GKV P+ 
Sbjct: 403  LSKLQKDKVSLEDRRVIFSRLMNAFVTIQNDVNAFIDSTK-------AQGRTSGKV-PVP 454

Query: 352  GFCQRLKGKQGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPQLVAKVLTFPEKVTRY 411
            G  Q L+ K+G FR ++ GKRV+++ R+VISPDPN+  +E+ VP + A  LT+PE VT Y
Sbjct: 455  GVKQALEKKEGLFRKHMMGKRVNYAARSVISPDPNIETNEIGVPPVFAVKLTYPEPVTAY 514

Query: 412  NIKKLRQLVQNGPNVHPGANYLLKKNEEARR----NLRYGDRQKLANNL----------Q 457
            NI +LRQ V NGP+  PGA  +  +NE+        +    R+ LAN L           
Sbjct: 515  NIAELRQAVINGPDKWPGATQI--QNEDGSLVSLIGMSLEQRKALANQLLTPSSNVSTHT 572

Query: 458  YGDVVERHLEDGDVVLFNRQPSLHRLSILSHYAKIRP-WRTFRLNECVCTPYNADFDGDE 516
                V RH+++ DVVL NRQP+LH+ S++ H  ++ P  +T RL+      YNADFDGDE
Sbjct: 573  LNKKVYRHIKNRDVVLMNRQPTLHKASMMGHKVRVLPNEKTLRLHYANTGAYNADFDGDE 632

Query: 517  MNLHVPQTEEARAEAINLMGVKNNLLTPKSGEPIIAATQDFITGSYLISHKDSFFDKASL 576
            MN+H PQ E ARAEA+NL    +  LTP SG P+    QD I+    ++ KDSFF +   
Sbjct: 633  MNMHFPQNENARAEALNLANTDSQYLTPTSGSPVRGLIQDHISAGVWLTSKDSFFTREQY 692

Query: 577  TQLLSMM---SDGSL---QFDIPPPAIMKPCYLWTGKQVFS-LLIKPNKNSPVKINLDAK 629
             Q +       DG     +    PP I KP  LWTGKQ+ + +L+         INL +K
Sbjct: 693  QQYIYGCIRPEDGHTTRSKIVTLPPTIFKPYPLWTGKQIITTVLLNVTPPDMPGINLLSK 752

Query: 630  NKVYIPPKQKHYPNEMSQNDGFVIVRGSQILSGVMDKSVLGDGKKHSVFYTILRDFGPQE 689
            NK+    K +++     +N+  V+ +   +L G++DKS  G   K+ + +++   +GP+ 
Sbjct: 753  NKI----KNEYWGKGSLENE--VLFKDGALLCGILDKSQYG-ASKYGIVHSLHEVYGPEV 805

Query: 690  AASAMNRMAKLCARYLGNRGFSIGISDVTPADDLKQKKEDL----VEIAYAKCDELIDLY 745
            AA  ++ + +L   Y+    F+ G+ D+    +  + + D+    V+       E+ +L 
Sbjct: 806  AAKVLSVLGRLFTNYITATAFTCGMDDLRLTAEGNKWRTDILKTSVDTGRQAAAEVTNLD 865

Query: 746  N----------KGKLETQPGCNEEQTLEAKIGGLLSKVREEVGDVCINELDNLNAPL--- 792
                       K   E     N+   L+A     ++ +  +V   C+ +      P    
Sbjct: 866  KDTPADDPELLKRLQEILRDNNKSGILDAVTSSKVNSITSQVVSKCVPDGTMKKFPYNSM 925

Query: 793  -IMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSKTPQSKGFVRNS 851
              MA  G+KGS +NVSQ++ ++GQQ + G RVP     ++LP F        + G+V+  
Sbjct: 926  QAMALSGAKGSNVNVSQIMCLLGQQALEGRRVPVMVSGKTLPSFKPYETDAMAGGYVKGR 985

Query: 852  FFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYDNTVRTSSNGI 911
            F+SG+ P E+ FH ++GREGL+DTAVKT+ +GY+ R L K LE +   YDN++R +   +
Sbjct: 986  FYSGIKPQEYYFHCMAGREGLIDTAVKTSRSGYLQRCLTKQLEGVHVSYDNSIRDADGTL 1045

Query: 912  VQFTYGGDGLDPLEMEGNAQPVNFNRSWDHAYNITFNNTDRGLLPYEIKKTVDNILKPLE 971
            VQF YGGD +D   +   +    F    D+ Y +        L+ +     V++ LK  +
Sbjct: 1046 VQFMYGGDAID---ITKESHMTQFEFCLDNYYALLKKYNPSALIEH---LDVESALKYSK 1099

Query: 972  KRL-IRYDTLGRPVSAEDDKLDDYVDQHDSERLFYASLREFMTDXXXXXXXXXXXXGLPK 1030
            K L  R   +  P   +  K D  + +++  + +  S+ E   D                
Sbjct: 1100 KTLKYRKKHIKEPHYKQSIKYDPVLAKYNPAK-YLGSVSENFQDKLESF----------- 1147

Query: 1031 LIKKSEL-EGYDPENEHIDAIVQHSITQLYRITEDAVQKFLEIAISKYHRAKVEPGTAVG 1089
            L K S+L +  D  NE                     +KF  +   KY R+ + PG AVG
Sbjct: 1148 LDKGSKLFKSADGVNE---------------------KKFRALMQLKYMRSLINPGEAVG 1186

Query: 1090 AIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEII-NASKVISTPIINAVLVNN- 1147
             I +QS+GEP TQMTL TFHFAG  + NVTLG+PR++EI+  AS  I TP +   + ++ 
Sbjct: 1187 IIASQSVGEPSTQMTLNTFHFAGHGAANVTLGIPRLREIVMTASAAIKTPQMTLPIWDDV 1246

Query: 1148 NDERAARVVKGRIEKTLLSDV 1168
            +DE+A    K  I K LLS+V
Sbjct: 1247 SDEQADTFCKS-ISKVLLSEV 1266

 Score = 82.4 bits (202), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 49/162 (30%), Positives = 86/162 (53%), Gaps = 2/162 (1%)

Query: 1270 MVKGLNDIARAVINIRDDGKRELLVEGYGLRDVMCTDGVIGAKTAT-NHVLEIFNVLGIE 1328
            +++ +  I R V    ++GKR L+ EG   + +   +  I     T N V  +    G+E
Sbjct: 1498 IIRQIPHIDRCVHPEPENGKRVLVTEGVNFQAMWDQEAFIDVDGITSNDVAAVLKTYGVE 1557

Query: 1329 AARASIIGEIDYTMSNHGMSVDPRHIQLLGDVMTFKGEVLGITRFGLSKMRDSVLQLASF 1388
            AAR +I+ EI+   S + +SV  RH+ L+ D+MT +G  L   R G+     S +++ S+
Sbjct: 1558 AARNTIVNEINNVFSRYAISVSFRHLDLIADMMTRQGTYLAFNRQGMETSTSSFMKM-SY 1616

Query: 1389 EKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVV 1430
            E T   L  A    +++ ++  S  I++G+  ++GTGSF V+
Sbjct: 1617 ETTCQFLTKAVLDNEREQLDSPSARIVVGKLNNVGTGSFDVL 1658

 Score = 49.3 bits (116), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 31/116 (26%), Positives = 54/116 (46%), Gaps = 3/116 (2%)

Query: 13  ISGLEFSALSPADIVAQSELEISSRDLFDLENNRSPKEGGALDPRMGVSASSMECTTCHG 72
           I+ ++F  L+  +I   S  +I++  + D  N   P  GG  D  +G    ++ C+TC  
Sbjct: 11  ITSVDFGILTAKEIRNLSAKQITNPTVLD--NLGHPVSGGLYDLALGAFLRNL-CSTCGL 67

Query: 73  NLASCHGHFGHIKLALPVFHVGYFKATIQILQGICKTCSAILLSEQDKRHFLSELR 128
           +   C GH GHI+L +P ++  +F      L+  C  C    L   +   +  +LR
Sbjct: 68  DEKFCPGHQGHIELPVPCYNPLFFNQLYIYLRASCLFCHHFRLKSVEVHRYACKLR 123

>NDAI0H01200 Chr8 complement(280165..285174) [5010 bp, 1669 aa] {ON}
            Anc_7.51
          Length = 1669

 Score =  432 bits (1110), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 310/973 (31%), Positives = 492/973 (50%), Gaps = 117/973 (12%)

Query: 254  ETYIWRYIPAPPVCIR-PSVMMQDSPASNEDDLTVKLTEIVWTSSLIK------AGIEKG 306
            + +    I  PP   R PS +  +   ++++ L   L++I+ T+ LI+      + ++K 
Sbjct: 356  DMFFMDVIVVPPTRFRLPSKLGDEIHENSQNQL---LSKILTTALLIRDLNDEMSKLQKD 412

Query: 307  -ISINN-------MMEHWDYLQMTVAMYINSDSINPAMLPGSSTGGGKVKPIRGFCQRLK 358
             +S+++       +M  +  +Q  V  +I+S            T GGKV PI G  Q L+
Sbjct: 413  KVSVDDRRVIFSRLMNAFVTIQNDVNAFIDSTK-------AQGTTGGKV-PIPGVKQALE 464

Query: 359  GKQGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPQLVAKVLTFPEKVTRYNIKKLRQ 418
             K+G FR ++ GKRV+++ R+VISPDPN+  +E+ VP + A  LT+PE VT YNI +LRQ
Sbjct: 465  KKEGLFRKHMMGKRVNYAARSVISPDPNIETNEIGVPPVFATKLTYPEPVTSYNIAELRQ 524

Query: 419  LVQNGPNVHPGANYLLKKNEEARR----NLRYGDRQKLANNLQ----------YGDVVER 464
             V NGP+  PGA  +  +NE+        +    R+ LAN L               V R
Sbjct: 525  AVINGPDKWPGAAQI--QNEDGSLVSLVGMSAEQRKALANQLMTPSSNVGTHTLNKKVYR 582

Query: 465  HLEDGDVVLFNRQPSLHRLSILSHYAKIRPW-RTFRLNECVCTPYNADFDGDEMNLHVPQ 523
            H+++ D+V+ NRQP+LH+ S++ H  ++ P  +T RL+      YNADFDGDEMN+H PQ
Sbjct: 583  HIKNRDIVIMNRQPTLHKASMMGHKVRVLPGEKTLRLHYANTGAYNADFDGDEMNMHFPQ 642

Query: 524  TEEARAEAINLMGVKNNLLTPKSGEPIIAATQDFITGSYLISHKDSFFDKASLTQLLSMM 583
             E ARAEA NL    +  LTP SG P+    QD I+    ++ KDSFF +    Q +   
Sbjct: 643  NENARAEAFNLANTDSQYLTPTSGSPVRGLIQDHISAGVWLTSKDSFFTREQYQQYIYGC 702

Query: 584  ---SDGSL---QFDIPPPAIMKPCYLWTGKQVFS-LLIKPNKNSPVKINLDAKNKVYIPP 636
                DG     +    PP I KP  LWTGKQ+ S +L+         INL + NK+    
Sbjct: 703  IRPEDGHATRPKLITLPPTIYKPVPLWTGKQIISTVLLNVTPADMPGINLTSSNKI---- 758

Query: 637  KQKHYPNEMSQNDGFVIVRGSQILSGVMDKSVLGDGKKHSVFYTILRDFGPQEAASAMNR 696
            K +++    S N+  V+ +  ++L G++DKS  G   K  + +++   +GP  AA  ++ 
Sbjct: 759  KNEYWGK--SSNENEVLFKNGELLCGILDKSQYG-ASKFGIVHSLHEVYGPSIAAKVLSV 815

Query: 697  MAKLCARYLGNRGFSIGISDVTPADDLKQKKEDL----VEIAYAKCDELIDL-----YNK 747
            + +L   Y+ +  F+ G+ D+  +++  + + D+    V+       E+ +L      + 
Sbjct: 816  LGRLFTNYIMSTAFTCGMDDLRLSEEGNKWRSDILKTSVDTGREAAAEVTNLDKDTAADD 875

Query: 748  GKL-----ETQPGCNEEQTLEAKIGGLLSKVREEVGDVCINELDNLNAPL----IMATCG 798
             +L     E     N+   L+A     ++ +  +V   C+ +      P      MA  G
Sbjct: 876  AELLKRLEEILRDNNKSGILDAVTSSKVNSITSKVVSKCVPDGTMKKFPYNSMQAMALSG 935

Query: 799  SKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSKTPQSKGFVRNSFFSGLSP 858
            +KGS +NVSQ++ ++GQQ + G RVP     ++LP F        + G+++  F+SG+ P
Sbjct: 936  AKGSNVNVSQIMCLLGQQALEGRRVPVMVSGKTLPSFKPYETDAMAGGYIKGRFYSGIKP 995

Query: 859  PEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYDNTVRTSSNGIVQFTYGG 918
             E+ FH ++GREGL+DTAVKT+ +GY+ R L K LE +   YDN+VR     ++QF YGG
Sbjct: 996  QEYYFHCMAGREGLIDTAVKTSRSGYLQRCLTKQLEGVHVSYDNSVRDGDGTLIQFLYGG 1055

Query: 919  DGLDPLEMEGNAQPVNFNRSWDHAYNITFNNTDRGLLPYEIKKTVDNILKPLEKRLIRYD 978
            D +D   +   +    F+   D+ Y+   N  +   L   +   V+  LK  +K L    
Sbjct: 1056 DAVD---VTKESHMTEFDFCLDN-YDALLNKYNPSALIEHLD--VETALKYSKKTLKNRK 1109

Query: 979  TLGRPVSAEDDKLDDYVDQHDSERLFYASLREFMTDXXXXXXXXXXXXGLPKLIKKSELE 1038
               +    ++    D V    +   +  S+ E   D                     +LE
Sbjct: 1110 KHAKEAHHKNATKYDPVLSKFNPAKYLGSVSEKFQD---------------------KLE 1148

Query: 1039 GYDPENEHIDAIVQHSITQLYRITEDAVQ-KFLEIAISKYHRAKVEPGTAVGAIGAQSIG 1097
             Y  +N           ++L++  ++  + KF  +   KY R+ + PG AVG I +QS+G
Sbjct: 1149 SYLDKN-----------SKLFKSHDNVSEKKFRALMQLKYMRSLINPGEAVGIIASQSVG 1197

Query: 1098 EPGTQMTLKTFHFAGVASMNVTLGVPRIKEII-NASKVISTPIIN-AVLVNNNDERAARV 1155
            EP TQMTL TFHFAG  + NVTLG+PR++EII  AS  I TP +   +  + +DE+A   
Sbjct: 1198 EPSTQMTLNTFHFAGHGAANVTLGIPRMREIIMTASAAIKTPQMTLPIWQDVSDEQADTF 1257

Query: 1156 VKGRIEKTLLSDV 1168
             K  I K +LS+V
Sbjct: 1258 CKS-ISKVVLSEV 1269

 Score = 83.6 bits (205), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 49/162 (30%), Positives = 86/162 (53%), Gaps = 2/162 (1%)

Query: 1270 MVKGLNDIARAVINIRDDGKRELLVEGYGLRDVMCTDGVIGAKTAT-NHVLEIFNVLGIE 1328
            +++ +  I R V    ++GKR L+ EG     +   +  I     T N V  +    G+E
Sbjct: 1502 IIREVPHIDRCVHPEPENGKRVLVTEGVNFEAMWDQEAFIDVDGITSNDVASVLKTYGVE 1561

Query: 1329 AARASIIGEIDYTMSNHGMSVDPRHIQLLGDVMTFKGEVLGITRFGLSKMRDSVLQLASF 1388
            AAR +I+ EI+   S + +SV  RH+ L+ D+MT +G  L   R G+     S++++ S+
Sbjct: 1562 AARNTIVNEINNVFSRYAISVSYRHLDLIADMMTRQGTYLAFNRQGMESSTSSLMKM-SY 1620

Query: 1389 EKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVV 1430
            E T   L  A    +++ +E  S  I++G+  ++GTGSF ++
Sbjct: 1621 ETTLQFLTKAVLDNEREELESPSARIVMGKLNNVGTGSFDIL 1662

 Score = 49.7 bits (117), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 31/116 (26%), Positives = 56/116 (48%), Gaps = 3/116 (2%)

Query: 13  ISGLEFSALSPADIVAQSELEISSRDLFDLENNRSPKEGGALDPRMGVSASSMECTTCHG 72
           I+ ++F  L+  +I   S  +I++  + D  N   P  GG  D  +G    ++ C++C  
Sbjct: 11  ITSVDFGILTSEEIRQLSAKQITNPTVLD--NLGHPISGGLYDLSLGAFLRNL-CSSCGL 67

Query: 73  NLASCHGHFGHIKLALPVFHVGYFKATIQILQGICKTCSAILLSEQDKRHFLSELR 128
           +   C GH GHI+L +P ++  +F      L+  C  C  + L + +   F  +LR
Sbjct: 68  DEKFCPGHQGHIELPVPCYNPLFFNQLYIYLRTSCLFCHHLKLKQIEVHRFACKLR 123

>KAFR0K00540 Chr11 complement(114196..119184) [4989 bp, 1662 aa] {ON}
            Anc_7.51 YOR341W
          Length = 1662

 Score =  432 bits (1110), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 306/979 (31%), Positives = 490/979 (50%), Gaps = 128/979 (13%)

Query: 254  ETYIWRYIPAPPVCIR-PSVMMQDSPASNEDDLTVKLTEIVWTSSLIK------------ 300
            + +    +  PP   R PS + ++   ++++ L   L++I+ TS LI+            
Sbjct: 352  DAFFMDVVVVPPTRFRLPSKLGEEVHENSQNQL---LSKILTTSLLIRDLNDEMSKLQKD 408

Query: 301  --AGIEKGISINNMMEHWDYLQMTVAMYINSDSINPAMLPGSSTGGGKVKPIRGFCQRLK 358
              +  ++ I  + +M  +  +Q  V  +I+S               GKV P+ G  Q L+
Sbjct: 409  KVSVDDRRIIFSRLMNAFVTIQNDVNAFIDSTK-------AQGNTSGKV-PVPGVKQALE 460

Query: 359  GKQGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPQLVAKVLTFPEKVTRYNIKKLRQ 418
             K+G FR ++ GKRV+++ R+VISPDPN+  +E+ VP + A  LT+PE VT +NI +LRQ
Sbjct: 461  KKEGLFRKHMMGKRVNYAARSVISPDPNIETNEIGVPPVFATKLTYPEPVTSFNIAELRQ 520

Query: 419  LVQNGPNVHPGANYLLKKNEEARR----NLRYGDRQKLANNLQ-----------YGDVVE 463
             V NGP+  PGA  +  +NE+        +    R+ LAN L                V 
Sbjct: 521  AVINGPDKWPGATQI--QNEDGSLVSLIGMSAEQRKALANQLMTPTSHNGATHTLNKKVY 578

Query: 464  RHLEDGDVVLFNRQPSLHRLSILSHYAKIRPW-RTFRLNECVCTPYNADFDGDEMNLHVP 522
            RH+++ D+V+ NRQP+LH+ S++ H  ++ P  +T RL+      YNADFDGDEMN+H P
Sbjct: 579  RHIKNRDIVIMNRQPTLHKASMMGHKVRVLPGEKTLRLHYANTGAYNADFDGDEMNMHFP 638

Query: 523  QTEEARAEAINLMGVKNNLLTPKSGEPIIAATQDFITGSYLISHKDSFFDKASLTQLLSM 582
            Q E ARAEA NL    +  LTP SG P+    QD I+    +++KDSFF +    Q +  
Sbjct: 639  QNENARAEAFNLANTDSQYLTPTSGSPVRGLIQDHISAGVWLTNKDSFFTREQYQQYIYG 698

Query: 583  M---SDGSL---QFDIPPPAIMKPCYLWTGKQVFS-LLIKPNKNSPVKINLDAKNKVYIP 635
                 DG     +    PPA+MKP  LWTGKQ+ + +L+         INL + NK+   
Sbjct: 699  CIRPEDGHATRAKLATVPPAVMKPVPLWTGKQIITTVLLNITPPDMPGINLKSSNKI--- 755

Query: 636  PKQKHYPNEMSQNDGFVIVRGSQILSGVMDKSVLGDGKKHSVFYTILRDFGPQEAASAMN 695
             K  ++    ++N+  VI +  ++L G++DKS  G   K+ + + +   +GP  +A A++
Sbjct: 756  -KNDYWGKGSNENE--VIFKNGELLCGILDKSQYG-ASKYGIIHCLHEVYGPDVSAKALS 811

Query: 696  RMAKLCARYLGNRGFSIGISDVTPADD-LKQKKEDL---VEIAYAKCDELIDL-----YN 746
             + +L   Y+    F+ G+ D+   ++  K +KE L   V+       E+ +L      N
Sbjct: 812  VLGRLFTNYITATAFTCGMDDLRLTEEGNKWRKEILKTSVDTGREAAAEVTNLPKDTPSN 871

Query: 747  KGKL-----ETQPGCNEEQTLEAKIGGLLSKVREEVGDVCI--NELDNL--NAPLIMATC 797
              +L     E     N+   L+A     ++ +  +V   C+    +     N+   MA  
Sbjct: 872  DPELLKRLEEIIRDNNKSGILDAVTSSKVNTITSKVVSTCVPGGTMKKFPENSMQSMALS 931

Query: 798  GSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSKTPQSKGFVRNSFFSGLS 857
            G+KGS +NVSQ++ ++GQQ + G RVP     ++LP F       ++ G+++  F+SG+ 
Sbjct: 932  GAKGSNVNVSQIMCLLGQQALEGRRVPVMVSGKTLPSFKPYETDARAGGYIKGRFYSGIR 991

Query: 858  PPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYDNTVRTSSNGIVQFTYG 917
            P E+ FH ++GREGL+DTAVKTA +GY+ R L K LE +   YDN++R +   ++Q  YG
Sbjct: 992  PQEYYFHCMAGREGLIDTAVKTASSGYLQRCLTKQLEGVHVSYDNSIRDADGTLIQMLYG 1051

Query: 918  GDGLDPLEMEGNAQPVNFNRSWDHAYNITFNNTDRGLLPYEIKKTVDNI-----LKPLEK 972
            GD +D  +            S    +N    N D  L  Y     ++++     LK  +K
Sbjct: 1052 GDAIDVTK-----------ESHLTKFNFCLENYDALLKKYNPSALIEHLDVETALKYSKK 1100

Query: 973  RLIRYDTLGRPVSAEDD-KLDDYVDQHDSERLFYASLREFMTDXXXXXXXXXXXXGLPKL 1031
             L       +    +   K D  + +++  + +  S+ E   D                 
Sbjct: 1101 SLKYRKKHAKEAHYQQTVKYDPILSKYNPAK-YLGSVSENFQD----------------- 1142

Query: 1032 IKKSELEGYDPENEHIDAIVQHSITQLYRITEDAVQ-KFLEIAISKYHRAKVEPGTAVGA 1090
                +LE +  +N           ++L +  ED  + KF  +   KY R+ + PG AVG 
Sbjct: 1143 ----QLENFLHDN-----------SKLLKSHEDVNEKKFRALMQLKYMRSLINPGEAVGI 1187

Query: 1091 IGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEII-NASKVISTPIINAVLVNNND 1149
            I +QS+GEP TQMTL TFHFAG  + NVTLG+PR++EII  AS  I TP +   ++++  
Sbjct: 1188 IASQSVGEPSTQMTLNTFHFAGHGAANVTLGIPRLREIIMTASAAIKTPQMTLPILDDVT 1247

Query: 1150 ERAARVVKGRIEKTLLSDV 1168
            +  A      I K +LS+V
Sbjct: 1248 DEQADTFAKSISKVVLSEV 1266

 Score = 81.3 bits (199), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 51/167 (30%), Positives = 88/167 (52%), Gaps = 12/167 (7%)

Query: 1270 MVKGLNDIARAVINIRDDGKRELLVEG------YGLRDVMCTDGVIGAKTATNHVLEIFN 1323
            +++ +  I R V    ++GKR L+ EG      +   D +  DG+      +N V  +  
Sbjct: 1495 VIRQVPKIDRCVHPEPENGKRVLVTEGVNFNAMWDQEDFIDVDGI-----RSNDVSAVLK 1549

Query: 1324 VLGIEAARASIIGEIDYTMSNHGMSVDPRHIQLLGDVMTFKGEVLGITRFGLSKMRDSVL 1383
              G+EAAR +++ EI+   S + +SV  RH+ LL D+MT +G  L   R G+     S++
Sbjct: 1550 TYGVEAARNTVVNEINNVFSRYAISVSFRHLDLLADMMTRQGTYLAFNRQGMETSTSSLM 1609

Query: 1384 QLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVV 1430
            ++ S+E T   L  A    +++ +   S  I+LG+  ++GTGSF V+
Sbjct: 1610 KM-SYETTCQFLTKAVLDNEREELNTPSARIVLGKLNNVGTGSFDVL 1655

 Score = 55.8 bits (133), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 35/116 (30%), Positives = 56/116 (48%), Gaps = 3/116 (2%)

Query: 13  ISGLEFSALSPADIVAQSELEISSRDLFDLENNRSPKEGGALDPRMGVSASSMECTTCHG 72
           I+ ++FS L+  DI + S  +I +  + D  N   P  GG  D  +G    ++ CTTC  
Sbjct: 11  ITSVDFSILTSKDIRSLSAKQIINPTVLD--NLGHPISGGLYDLSLGAFLRNL-CTTCGL 67

Query: 73  NLASCHGHFGHIKLALPVFHVGYFKATIQILQGICKTCSAILLSEQDKRHFLSELR 128
           +   C GH GHI+L +PV++  +F      L+  C  C    L   +   F  +L+
Sbjct: 68  DEKFCPGHVGHIELPVPVYNPLFFNQLYIYLRSSCLFCHHFRLKSAEVHRFALKLK 123

>Suva_8.391 Chr8 (702691..707688) [4998 bp, 1665 aa] {ON} YOR341W
            (REAL)
          Length = 1665

 Score =  430 bits (1106), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 312/982 (31%), Positives = 494/982 (50%), Gaps = 121/982 (12%)

Query: 247  TNKAGRPETYIWRYIPAPPVCIR-PSVMMQDSPASNEDDLTVKLTEIVWTSSLI------ 299
            + K  + +++    I  PP   R PS +  +   ++++ L   L++++ T+ LI      
Sbjct: 346  SRKLVKADSFFMDVIVVPPTRFRLPSKLGDEVHENSQNQL---LSKVLTTALLIRDLNDD 402

Query: 300  -------KAGIE-KGISINNMMEHWDYLQMTVAMYINSDSINPAMLPGSSTGGGKVKPIR 351
                   K  +E + +  + +M  +  +Q  V  +I+S               GKV PI 
Sbjct: 403  LSKLQKDKVSLEDRRVIFSRLMNAFVTIQNDVNAFIDSTK-------AQGRTSGKV-PIP 454

Query: 352  GFCQRLKGKQGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPQLVAKVLTFPEKVTRY 411
            G  Q L+ K+G FR ++ GKRV+++ R+VISPDPN+  +E+ VP + A  LT+PE VT Y
Sbjct: 455  GVKQALEKKEGLFRKHMMGKRVNYAARSVISPDPNIETNEIGVPPVFAVKLTYPEPVTAY 514

Query: 412  NIKKLRQLVQNGPNVHPGANYLLKKNEEARR----NLRYGDRQKLANNL----------Q 457
            NI +LRQ V NGP+  PGA  +  +NE+        +    R+ LAN L           
Sbjct: 515  NIAELRQAVINGPDKWPGATQI--QNEDGSLVSLIGMSLEQRKALANQLLTPSSNVSTHT 572

Query: 458  YGDVVERHLEDGDVVLFNRQPSLHRLSILSHYAKIRP-WRTFRLNECVCTPYNADFDGDE 516
                V RH+++ DVVL NRQP+LH+ S++ H  ++ P  +T RL+      YNADFDGDE
Sbjct: 573  LNKKVYRHIKNRDVVLMNRQPTLHKASMMGHKVRVLPNEKTLRLHYANTGAYNADFDGDE 632

Query: 517  MNLHVPQTEEARAEAINLMGVKNNLLTPKSGEPIIAATQDFITGSYLISHKDSFFDKASL 576
            MN+H PQ E ARAEA+NL    +  LTP SG P+    QD I+    ++ KDSFF +   
Sbjct: 633  MNMHFPQNENARAEALNLANTDSQYLTPTSGSPVRGLIQDHISAGVWLTSKDSFFTREQY 692

Query: 577  TQLLSMM---SDGSL---QFDIPPPAIMKPCYLWTGKQVFS-LLIKPNKNSPVKINLDAK 629
             Q +       DG     +    PPAI KP  LWTGKQ+ + +L+         INL + 
Sbjct: 693  QQYIYGCIRPEDGHTTRNKIITLPPAIFKPYPLWTGKQIITTVLLNVTPPDMPGINLIST 752

Query: 630  NKVYIPPKQKHYPNEMSQNDGFVIVRGSQILSGVMDKSVLGDGKKHSVFYTILRDFGPQE 689
            NK+    K +++     +N+  V+ +   +L G++DKS  G   K+ + +++   +GP+ 
Sbjct: 753  NKI----KNEYWGKGSLENE--VLFKDGALLCGILDKSQYG-ASKYGIVHSLHEVYGPEV 805

Query: 690  AASAMNRMAKLCARYLGNRGFSIGISDVTPADDLKQKKEDL----VEIAYAKCDELIDLY 745
            AA  ++ + +L   Y+    F+ G+ D+    +  + + D+    V+       E+ +L 
Sbjct: 806  AAKVLSVLGRLFTNYITATAFTCGMDDLRLTAEGNKWRTDILKTSVDTGRQAAAEVTNLN 865

Query: 746  N----------KGKLETQPGCNEEQTLEAKIGGLLSKVREEVGDVCINELDNLNAPL--- 792
                       K   E     N+   L+A     ++ +  +V   C+ +      P    
Sbjct: 866  KDTPADDAELLKRLQEILRDNNKSGILDAVTSSKVNVITSQVVSKCVPDGTMKKFPCNSM 925

Query: 793  -IMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSKTPQSKGFVRNS 851
              MA  G+KGS +NVSQ++ ++GQQ + G RVP     ++LP F        + G+V+  
Sbjct: 926  QAMALSGAKGSNVNVSQIMCLLGQQALEGRRVPVMVSGKTLPSFKPYETDAMAGGYVKGR 985

Query: 852  FFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYDNTVRTSSNGI 911
            F+SG+ P E+ FH ++GREGL+DTAVKT+ +GY+ R L K LE +   YDN++R +   +
Sbjct: 986  FYSGIKPQEYYFHCMAGREGLIDTAVKTSRSGYLQRCLTKQLEGVHVSYDNSIRDADGTL 1045

Query: 912  VQFTYGGDGLDPLEMEGNAQPVNFNRSWDHAYNITFNNTDRGLLPYEIKKTVDNILKPLE 971
            VQF YGGD +D   +   +    F    D+ Y +        L+ +     V++ LK  +
Sbjct: 1046 VQFMYGGDAVD---ITKESHMTQFEFCLDNYYALLKKYNPSALIEH---LDVESALKYSK 1099

Query: 972  KRL-IRYDTLGRPVSAEDDKLDDYVDQHDSERLFYASLREFMTDXXXXXXXXXXXXGLPK 1030
            K L  R      P   +  K D  + +++  + +  S+ E   D                
Sbjct: 1100 KTLKYRKKHSKEPHYKQAVKYDPVLAKYNPAK-YLGSVSENFQD---------------- 1142

Query: 1031 LIKKSELEGYDPENEHIDAIVQHSITQLYRITEDAV--QKFLEIAISKYHRAKVEPGTAV 1088
                 +LE +  +N           ++L++ + D V  +KF  +   KY R+ + PG AV
Sbjct: 1143 -----KLESFLDKN-----------SKLFK-SADGVNEKKFRALMQLKYMRSLINPGEAV 1185

Query: 1089 GAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEII-NASKVISTPIINAVLVNN 1147
            G I +QS+GEP TQMTL TFHFAG  + NVTLG+PR++EI+  AS  I TP +   + ++
Sbjct: 1186 GIIASQSVGEPSTQMTLNTFHFAGHGAANVTLGIPRLREIVMTASSAIKTPQMTLPIWDD 1245

Query: 1148 -NDERAARVVKGRIEKTLLSDV 1168
             +DE+A    K  I K LLS+V
Sbjct: 1246 VSDEQADTFCKS-ISKVLLSEV 1266

 Score = 81.3 bits (199), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 48/162 (29%), Positives = 86/162 (53%), Gaps = 2/162 (1%)

Query: 1270 MVKGLNDIARAVINIRDDGKRELLVEGYGLRDVMCTDGVIGAKTAT-NHVLEIFNVLGIE 1328
            +++ +  I R V    ++GKR L+ EG   + +   +  I     T N V  +    G+E
Sbjct: 1498 IIRQIPRIDRCVHPEPENGKRVLVTEGVNFQAMWDQEAFIDVDGITSNDVAAVLRTYGVE 1557

Query: 1329 AARASIIGEIDYTMSNHGMSVDPRHIQLLGDVMTFKGEVLGITRFGLSKMRDSVLQLASF 1388
            AAR +++ EI+   S + +SV  RH+ L+ D+MT +G  L   R G+     S +++ S+
Sbjct: 1558 AARNTVVNEINNVFSRYAISVSFRHLDLIADMMTRQGTYLAFNRQGMETSTSSFMKM-SY 1616

Query: 1389 EKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVV 1430
            E T   L  A    +++ ++  S  I++G+  ++GTGSF V+
Sbjct: 1617 ETTCQFLTKAVLDNEREQLDSPSARIVVGRLNNVGTGSFDVL 1658

 Score = 47.8 bits (112), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 30/116 (25%), Positives = 54/116 (46%), Gaps = 3/116 (2%)

Query: 13  ISGLEFSALSPADIVAQSELEISSRDLFDLENNRSPKEGGALDPRMGVSASSMECTTCHG 72
           I+ ++F  L+  +I   S  +I++  + D  N   P  GG  D  +G    ++ C+TC  
Sbjct: 11  ITSVDFGILTAKEIRNLSAKQITNPTVLD--NLGHPVSGGLYDLALGAFLRNL-CSTCGL 67

Query: 73  NLASCHGHFGHIKLALPVFHVGYFKATIQILQGICKTCSAILLSEQDKRHFLSELR 128
           +   C GH GHI+L +P ++  +F      L+  C  C    L   +   +  +L+
Sbjct: 68  DEKFCPGHQGHIELPVPCYNPLFFNQLYIYLRASCLFCHHFRLKSVEVHRYACKLK 123

>KNAG0D04970 Chr4 (905179..910194) [5016 bp, 1671 aa] {ON} Anc_7.51
            YOR341W
          Length = 1671

 Score =  429 bits (1104), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 303/967 (31%), Positives = 487/967 (50%), Gaps = 118/967 (12%)

Query: 261  IPAPPVCIR-PSVMMQDSPASNEDDLTVKLTEIVWTSSLIK--------------AGIEK 305
            I  PP   R PS M ++   ++++ L   L++I+ T+ LI+              +  ++
Sbjct: 364  IVVPPTRFRLPSKMGEEIHENSQNQL---LSKILTTALLIRDLNDEMSKLQKDKVSVDDR 420

Query: 306  GISINNMMEHWDYLQMTVAMYINSDSINPAMLPGSSTGGGKVKPIRGFCQRLKGKQGRFR 365
             I  + +M  +  +Q  V  +I+S           STGG    P+ G  Q L+ K+G FR
Sbjct: 421  RIIFSRLMNGFVTIQNDVNAFIDSTKAQ------GSTGGNV--PVPGVKQALEKKEGLFR 472

Query: 366  GNLSGKRVDFSGRTVISPDPNLSIDEVAVPQLVAKVLTFPEKVTRYNIKKLRQLVQNGPN 425
             ++ GKRV+++ R+VISPDPN+  +E+ VP + A  LT+PE VT YNI +LRQ V NGP+
Sbjct: 473  KHMMGKRVNYAARSVISPDPNIETNEIGVPPVFATKLTYPEPVTSYNIAELRQAVINGPD 532

Query: 426  VHPGANYLLKKNEEARR----NLRYGDRQKLANNLQ-----------YGDVVERHLEDGD 470
              PGA  L  +NE+        +    R+ LAN L                V RH+++ D
Sbjct: 533  KWPGA--LQIQNEDGSLVSLIGMTLEQRKALANQLMTPSYVGGATHTLNKKVYRHIKNRD 590

Query: 471  VVLFNRQPSLHRLSILSHYAKIRPW-RTFRLNECVCTPYNADFDGDEMNLHVPQTEEARA 529
            +V+ NRQP+LH+ S++ H  ++ P  +T RL+      YNADFDGDEMN+H PQ E ARA
Sbjct: 591  IVIMNRQPTLHKASMMGHKVRVLPGEKTLRLHYANTGAYNADFDGDEMNMHFPQNENARA 650

Query: 530  EAINLMGVKNNLLTPKSGEPIIAATQDFITGSYLISHKDSFFDKASLTQLLSMM---SDG 586
            EA NL    +  LTP SG P+    QD I+    ++ KDSFF +    Q +       DG
Sbjct: 651  EAFNLANTDSQYLTPTSGSPVRGLIQDHISAGVWLTSKDSFFTREQYQQYIYGCIRPEDG 710

Query: 587  SL---QFDIPPPAIMKPCYLWTGKQVFS-LLIKPNKNSPVKINLDAKNKVYIPPKQKHYP 642
                 +    PPA+ KP  LWTGKQ+ + +L+         INL + NK+    K +++ 
Sbjct: 711  HATRPKLVTVPPAVWKPVPLWTGKQIITTVLLNVTPADMPGINLKSNNKI----KNEYWG 766

Query: 643  NEMSQNDGFVIVRGSQILSGVMDKSVLGDGKKHSVFYTILRDFGPQEAASAMNRMAKLCA 702
                +N+  V+ +  ++L G++DK+  G   K+ + +++   +GP  AA  ++ + +L  
Sbjct: 767  KSSEENE--VLFKNGELLCGILDKNQYG-ASKYGIVHSLHEVYGPDIAAKVLSVLGRLFT 823

Query: 703  RYLGNRGFSIGISDVTPADDLKQKKEDL----VEIAYAKCDELIDLYN----------KG 748
             Y+    F+ G+ D+    +  + ++D+    V+       E+ +L            K 
Sbjct: 824  NYIMATAFTCGMDDLRLTAEGNKWRKDILKTSVDTGREAAAEVTNLEKDTTADDPELLKR 883

Query: 749  KLETQPGCNEEQTLEAKIGGLLSKVREEVGDVCINELDNLNAPL----IMATCGSKGSTL 804
              E     N+   L+A     ++ +  +V   C+ +      P      MA  G+KGS +
Sbjct: 884  LQEVLRDNNKSGILDAVTSSKVNAITSKVVSTCVPDGTMKKFPYNSMQAMALSGAKGSNV 943

Query: 805  NVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSKTPQSKGFVRNSFFSGLSPPEFLFH 864
            NVSQ++ ++GQQ + G RVP     ++LP F        + G+V+  F+SG+ P E+ FH
Sbjct: 944  NVSQIMCLLGQQALEGRRVPVMVSGKTLPSFKPYETDAMAGGYVKGRFYSGIKPQEYYFH 1003

Query: 865  AISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYDNTVRTSSNGIVQFTYGGDGLDPL 924
             ++GREGL+DTAVKT+ +GY+ R L K LE +   YDN+VR     ++QF YGG   D +
Sbjct: 1004 CMAGREGLIDTAVKTSRSGYLQRCLTKQLEGVHVSYDNSVRDGDGTLIQFLYGG---DAV 1060

Query: 925  EMEGNAQPVNFNRSWDHAYNITFNNTDRGLLPYEIKKTVDNILKPLEKRL-IRYDTLGRP 983
            ++   +    F+   ++ Y+      +   L   +   V++ LK  +K L  R       
Sbjct: 1061 DVTKESHMTKFDFCLEN-YDALLKKYNPSALIEHLD--VESALKYSKKSLKYRKKHAKEA 1117

Query: 984  VSAEDDKLDDYVDQHDSERLFYASLREFMTDXXXXXXXXXXXXGLPKLIKKSELEGYDPE 1043
               +  K D  + +++  + +  S+ E   D                     +LE +  +
Sbjct: 1118 HYKQSPKYDPVLAKYNPAK-YLGSVSEKFQD---------------------KLETFIDK 1155

Query: 1044 NEHIDAIVQHSITQLYRITED-AVQKFLEIAISKYHRAKVEPGTAVGAIGAQSIGEPGTQ 1102
            N           ++L++  +D + +KF  +   KY R+ + PG AVG I +QS+GEP TQ
Sbjct: 1156 N-----------SKLFKHNDDISEKKFRALMQLKYMRSLINPGEAVGIIASQSVGEPSTQ 1204

Query: 1103 MTLKTFHFAGVASMNVTLGVPRIKEII-NASKVISTPIINAVLVNNNDERAARVVKGRIE 1161
            MTL TFHFAG  + NVTLG+PR++EII  AS  I TP +   ++++  ++ A      I 
Sbjct: 1205 MTLNTFHFAGHGAANVTLGIPRMREIIMTASAAIKTPQMTLPILDDVSDQQADTFSKSIS 1264

Query: 1162 KTLLSDV 1168
            K LLS+V
Sbjct: 1265 KVLLSEV 1271

 Score = 79.7 bits (195), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 49/160 (30%), Positives = 84/160 (52%), Gaps = 12/160 (7%)

Query: 1277 IARAVINIRDDGKRELLVEGYGLR------DVMCTDGVIGAKTATNHVLEIFNVLGIEAA 1330
            I R V    ++GKR L+ EG   +      D +  DG+      +N V  +  V G+EAA
Sbjct: 1508 IDRCVHPEPENGKRVLVTEGVNFQAMWDQEDFIDVDGI-----TSNDVSAVLKVYGVEAA 1562

Query: 1331 RASIIGEIDYTMSNHGMSVDPRHIQLLGDVMTFKGEVLGITRFGLSKMRDSVLQLASFEK 1390
            R +I+ EI      + +SV  RH+ L+ D+MT +G  L   R G+     S++++ S+E 
Sbjct: 1563 RNTIVNEISNVFGRYAISVSFRHLDLIADMMTRQGTYLAFNRQGMETSTSSLMKM-SYET 1621

Query: 1391 TTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVV 1430
            T   L  A    +++ ++  S  I++G+  ++GTGSF ++
Sbjct: 1622 TCQFLTKAVLDHERENLDSPSARIVVGKLNNVGTGSFDIL 1661

 Score = 53.9 bits (128), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 34/117 (29%), Positives = 54/117 (46%), Gaps = 3/117 (2%)

Query: 12  RISGLEFSALSPADIVAQSELEISSRDLFDLENNRSPKEGGALDPRMGVSASSMECTTCH 71
           RIS ++F   S  ++ A S  +I++  + D  N   P  GG  D  +G    +M C +C 
Sbjct: 10  RISSVDFDVFSAKEVRALSVKQITNPTVLD--NLGHPISGGLYDLALGAFLRNM-CASCG 66

Query: 72  GNLASCHGHFGHIKLALPVFHVGYFKATIQILQGICKTCSAILLSEQDKRHFLSELR 128
            +   C GH GHI+L +P ++  +F      L+  C  C    L   +   F  +LR
Sbjct: 67  LDEKFCPGHLGHIELPVPCYNPLFFNQLYIYLRSSCLFCYRFRLKALEVHAFAMKLR 123

>ADR374C Chr4 complement(1372609..1377531) [4923 bp, 1640 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YOR341W
            (RPA190)
          Length = 1640

 Score =  426 bits (1096), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 313/979 (31%), Positives = 490/979 (50%), Gaps = 125/979 (12%)

Query: 252  RPETYIWRYIPAPPVCIR-PSVMMQDSPASNEDDLTVKLTEIVWTSSLI----------- 299
            + + +    I  PP   R PS +  +   + ++ L   L++I+ TS LI           
Sbjct: 331  KADMFFMEVIVVPPTRFRLPSKLGDEVHENTQNQL---LSKILTTSLLIRDLNEEMSKLQ 387

Query: 300  --KAGIE-KGISINNMMEHWDYLQMTVAMYINSDSINPAMLPGSSTGGGKVKPIRGFCQR 356
              K  +E + I  N +M  +  +Q  V  +I+S            + GGKV PI G  Q 
Sbjct: 388  KDKVSLEDRKIIFNRLMNAFVTIQNDVNAFIDSTK-------AQGSTGGKV-PIPGVKQA 439

Query: 357  LKGKQGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPQLVAKVLTFPEKVTRYNIKKL 416
            L+ K+G FR ++ GKRV+++ R+VISPDPN+  +E+ VP + A  LT+PE VT YNI ++
Sbjct: 440  LEKKEGLFRKHMMGKRVNYAARSVISPDPNIETNEIGVPPVFATKLTYPEPVTAYNIAEM 499

Query: 417  RQLVQNGPNVHPGANYLLKKNEEARR----NLRYGDRQKLANNLQ----YGDV------V 462
            RQ V NGP+  PGA  +  +NE+        +    R+ LAN L     +G        V
Sbjct: 500  RQAVINGPDKWPGATQI--QNEDGSLVSLVGMTSDQRKALANQLMTPSTHGSTHTLNKKV 557

Query: 463  ERHLEDGDVVLFNRQPSLHRLSILSHYAKIRPW-RTFRLNECVCTPYNADFDGDEMNLHV 521
             RH+++ D+V+ NRQP+LH+ S++ H  ++ P  +T RL+      YNADFDGDEMN+H 
Sbjct: 558  YRHIKNRDIVIMNRQPTLHKASMMGHKVRVLPGEKTLRLHYANTGAYNADFDGDEMNMHF 617

Query: 522  PQTEEARAEAINLMGVKNNLLTPKSGEPIIAATQDFITGSYLISHKDSFFDKASLTQLLS 581
            PQ E AR+EA  L    +  LTP SG P+    QD I+    +++KDSFF +    Q + 
Sbjct: 618  PQNENARSEAFTLANTDSQYLTPTSGSPVRGLIQDHISAGVWLTNKDSFFTREQYQQYIY 677

Query: 582  MM---SDGSL---QFDIPPPAIMKPCYLWTGKQVFS-LLIKPNKNSPVKINLDAKNKVYI 634
                  DG     +    PPA++KP  LWTGKQ+ + +L+         INL +KNK+  
Sbjct: 678  GCIRPEDGHASRSKIITVPPAVVKPVPLWTGKQIITTVLLNATPADIPGINLVSKNKI-- 735

Query: 635  PPKQKHYPNEMSQNDGFVIVRGSQILSGVMDKSVLGDGKKHSVFYTILRDFGPQEAASAM 694
              K +++     +N+  VI +   +L G++DKS  G   K+ + +++   +GP  ++  +
Sbjct: 736  --KNEYWGKSSYENE--VIFKNGALLCGILDKSQYG-ASKYGIVHSLHELYGPDVSSKVL 790

Query: 695  NRMAKLCARYLGNRGFSIGISDVTPADDLKQKKEDLV----EIAYAKCDELIDLYN---- 746
            + + +L   Y+ +  F+ G+ D+   D+  + + D++    +I  A   E+ +L      
Sbjct: 791  SILGRLFTNYITSTAFTCGMDDLRLTDEGNKWRIDILKKSTDIGRAAAAEVTNLGGDVRP 850

Query: 747  ------KGKLETQPGCNEEQTLEAKIGGLLSKVREEVGDVCINELDNLNAPL----IMAT 796
                  K   E     N+   L+A     ++ +  EV   C+ +      P      MA 
Sbjct: 851  DDAELLKRLEEILRDDNKLGILDAVTSSKVNTITSEVVSKCVPDGTMKKFPYNSMQAMAL 910

Query: 797  CGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSKTPQSKGFVRNSFFSGL 856
             G+KGS +NVSQ++ ++GQQ + G RVP     ++LP F       ++ G+++  F+SG+
Sbjct: 911  SGAKGSNVNVSQIMCLLGQQALEGRRVPVMVSGKTLPSFKPFETDAKAGGYIKGRFYSGI 970

Query: 857  SPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYDNTVRTSSNGIVQFTY 916
             P E+ FH ++GREGL+DTAVKT+ +GY+ R L K LE +   YDNTVR     +VQF Y
Sbjct: 971  KPQEYYFHCMAGREGLIDTAVKTSRSGYLQRCLTKQLEGVHVSYDNTVRDGDGTLVQFLY 1030

Query: 917  GGDGLDPLEMEGNAQPVNFNRSWDHAYNITFNNTDRGLLPYEIKKT-----VDNILKPLE 971
            GGD +D  +            S    +    +N D  L  Y          V++ LK  +
Sbjct: 1031 GGDAIDVTK-----------ESHMSEFKFCVDNYDALLKRYNPSALIQHLDVESALKYSK 1079

Query: 972  KRLI-RYDTLGRPVSAEDDKLDDYVDQHDSERLFYASLREFMTDXXXXXXXXXXXXGLPK 1030
            K +  R   L  P  A  DK D  + +++  + F  S+ E   D                
Sbjct: 1080 KAMKNRKKNLNLPHYARHDKYDPVLSKYNPSK-FLGSVSENFQD---------------- 1122

Query: 1031 LIKKSELEGYDPENEHIDAIVQHSITQLYRITEDAVQKFLEIAISKYHRAKVEPGTAVGA 1090
                 +LE +   N  +    Q ++ +         +KF  +   KY R+ + PG AVG 
Sbjct: 1123 -----KLESFIDSNASLFK-GQATVNE---------KKFRALMQLKYMRSLINPGEAVGI 1167

Query: 1091 IGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEII-NASKVISTPIINAVLVNNND 1149
            I +QS+GEP TQMTL TFHFAG  + NVTLG+PR++EII  AS  I TP +   ++ +  
Sbjct: 1168 IASQSVGEPSTQMTLNTFHFAGHGAANVTLGIPRMREIIMTASAAIKTPQMTLPILPDVT 1227

Query: 1150 ERAARVVKGRIEKTLLSDV 1168
            +  A +      K +LS+V
Sbjct: 1228 DETADIFCKNTTKVILSEV 1246

 Score = 83.2 bits (204), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 49/162 (30%), Positives = 88/162 (54%), Gaps = 2/162 (1%)

Query: 1270 MVKGLNDIARAVINIRDDGKRELLVEGYGLRDVMCTDGVIGAKTAT-NHVLEIFNVLGIE 1328
            ++K + +I R V    ++GKR L+ EG   + +   +  I     T N V  +    G+E
Sbjct: 1473 VIKEVPNIDRCVHPEPENGKRVLVTEGVNFQAMWDQEAFIDVNGITSNDVSAVLKTYGVE 1532

Query: 1329 AARASIIGEIDYTMSNHGMSVDPRHIQLLGDVMTFKGEVLGITRFGLSKMRDSVLQLASF 1388
            AAR +I+ EI+   S + +SV  RH+ L+ D+MT +G  L   R G+     S++++ S+
Sbjct: 1533 AARNTIVNEINNVFSRYAISVSYRHLDLIADMMTRQGTYLAFNRQGMESSTSSLMKM-SY 1591

Query: 1389 EKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVV 1430
            E T   L  A    +++ ++  S  ++LG+  S+GTG+F ++
Sbjct: 1592 ETTCQFLTKAVLDNEREELKSPSAKLVLGKLNSVGTGAFDIL 1633

 Score = 52.0 bits (123), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 33/116 (28%), Positives = 55/116 (47%), Gaps = 3/116 (2%)

Query: 13  ISGLEFSALSPADIVAQSELEISSRDLFDLENNRSPKEGGALDPRMGVSASSMECTTCHG 72
           IS ++FS +S A+I A S  +I++  + D   +  P  GG  D  +G    ++ C TC  
Sbjct: 11  ISSVDFSVMSAAEIRALSVKQITNPTVLDHLGH--PIRGGLYDLSLGAFLRNL-CATCGL 67

Query: 73  NLASCHGHFGHIKLALPVFHVGYFKATIQILQGICKTCSAILLSEQDKRHFLSELR 128
           +   C GH GHI+L +P +   +F      L+  C  C    L   +   +  +L+
Sbjct: 68  DEKFCSGHQGHIELPVPCYSPLFFNQLYIYLRSSCLYCHHFRLKAVEVHRYACKLK 123

>SAKL0B10736g Chr2 (925889..930841) [4953 bp, 1650 aa] {ON} highly
            similar to uniprot|P10964 Saccharomyces cerevisiae
            YOR341W RPA190 RNA polymerase I subunit largest subunit
            of RNA polymerase I
          Length = 1650

 Score =  417 bits (1071), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 312/977 (31%), Positives = 487/977 (49%), Gaps = 121/977 (12%)

Query: 252  RPETYIWRYIPAPPVCIR-PSVMMQDSPASNEDDLTVKLTEIVWTSSLIK---------- 300
            + + +    +  PP   R PS +  +   + ++ L   L++I+ TS LI+          
Sbjct: 340  KADMFFMEVVVVPPTRFRLPSKLGDEVHENTQNQL---LSKILTTSLLIRDLNDEMSKLQ 396

Query: 301  ----AGIEKGISINNMMEHWDYLQMTVAMYINSDSINPAMLPGSSTGGGKVKPIRGFCQR 356
                +  ++ +  N +M  +  +Q  V  +I+       +       GGKV PI G  Q 
Sbjct: 397  KDKVSVDDRKVIFNRLMNAFVTIQNDVNAFID-------VTKAQGNTGGKV-PIPGVKQA 448

Query: 357  LKGKQGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPQLVAKVLTFPEKVTRYNIKKL 416
            L+ K+G FR ++ GKRV+++ R+VISPDPN+  +E+ VP + A  LT+PE VT YNI +L
Sbjct: 449  LEKKEGLFRKHMMGKRVNYAARSVISPDPNIETNEIGVPPVFATKLTYPEPVTAYNIAEL 508

Query: 417  RQLVQNGPNVHPGANYLLKKNEEARR----NLRYGDRQKLANNLQYGDV----------V 462
            RQ V NGP+  PGA  +  +NE+        +    R+ LAN L               V
Sbjct: 509  RQAVINGPDKWPGATQI--QNEDGSLVSLIGMTLEQRKALANQLMTPSTHNSTHILNKKV 566

Query: 463  ERHLEDGDVVLFNRQPSLHRLSILSHYAKIRPW-RTFRLNECVCTPYNADFDGDEMNLHV 521
             RH+++ D+V+ NRQP+LH+ S++ H  ++ P  +T RL+      YNADFDGDEMN+H 
Sbjct: 567  YRHIKNRDIVIMNRQPTLHKASMMGHKVRVLPGEKTLRLHYANTGAYNADFDGDEMNMHF 626

Query: 522  PQTEEARAEAINLMGVKNNLLTPKSGEPIIAATQDFITGSYLISHKDSFFDKASLTQLLS 581
            PQ E ARAEA NL    +  LTP SG P+    QD I+    ++ KDSFF +    Q + 
Sbjct: 627  PQNENARAEAFNLANTDSQYLTPTSGSPVRGLIQDHISAGVWLTSKDSFFTREQYQQYIY 686

Query: 582  MM---SDGSL---QFDIPPPAIMKPCYLWTGKQVFS-LLIKPNKNSPVKINLDAKNKVYI 634
                  DG     +    PPA++KP  LWTGKQ+ + +L+         INL +KNK+  
Sbjct: 687  GCIRPEDGHATRNKIVTVPPAVVKPVPLWTGKQIITTVLLNSTPPEMPGINLISKNKI-- 744

Query: 635  PPKQKHYPNEMSQNDGFVIVRGSQILSGVMDKSVLGDGKKHSVFYTILRDFGPQEAASAM 694
               +  Y  E S N+  VI +  ++L G++DKS  G   K  + +++   +GP  A   +
Sbjct: 745  ---KNEYWGEGS-NESEVIFKNGELLCGILDKSQYG-ASKFGIVHSLHEVYGPDIAGKVL 799

Query: 695  NRMAKLCARYLGNRGFSIGISDVTPADDLKQKKEDL----VEIAYAKCDELIDLYNKGKL 750
            + + +L   Y+    F+ G+ D+   ++  + + ++    V+I  A   E+ +L    K 
Sbjct: 800  SVLGRLFTNYITATAFTCGMDDLRLTEEGNKWRTEILKTSVDIGRAAAAEVTNLEGDVKA 859

Query: 751  ----------ETQPGCNEEQTLEAKIGGLLSKVREEVGDVCINELDNLNAPL----IMAT 796
                      E     N+   L+A     ++ +  +V   C+ +      P      MA 
Sbjct: 860  DDPELLKRLEEILRDDNKLGILDAVTSSKVNVITSQVVSKCVPDGTMKKFPYNSMQAMAL 919

Query: 797  CGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSKTPQSKGFVRNSFFSGL 856
             G+KGS +NVSQ++ ++GQQ + G RVP     ++LP F       ++ G+++  F+SG+
Sbjct: 920  SGAKGSNVNVSQIMCLLGQQALEGRRVPVMVSGKTLPSFKPFETDARAGGYIKGRFYSGI 979

Query: 857  SPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYDNTVRTSSNGIVQFTY 916
             P E+ FH ++GREGL+DTAVKT+ +GY+ R L K LE +   YDNTVR     ++QF Y
Sbjct: 980  RPQEYYFHCMAGREGLIDTAVKTSRSGYLQRCLTKQLEGVHISYDNTVRDGDGTLIQFLY 1039

Query: 917  GGDGLDPLEMEGNAQPVNFNRSWDHAYNITFNNTDRGLLPYEIKKTVDNILKPLEKRLI- 975
            GGD    +++   +    F    D+ Y+      +   L   +   V++ LK  +K +  
Sbjct: 1040 GGDA---VDVTKESHMTEFKFCVDN-YDALLKKYNPSALIEHLD--VESALKYSKKAMKN 1093

Query: 976  RYDTLGRPVSAEDDKLDDYVDQHDSERLFYASLREFMTDXXXXXXXXXXXXGLPKLIKKS 1035
            R      P  A + K D  + +++  + +  S+ E   D             L K I  +
Sbjct: 1094 RKKNEKIPHYAHNIKYDPVLSKYNPSK-YLGSVSENFQDK------------LEKFIDSN 1140

Query: 1036 E--LEGYDPENEHIDAIVQHSITQLYRITEDAVQKFLEIAISKYHRAKVEPGTAVGAIGA 1093
               L+  D  NE                     +KF  +   KY R+ + PG AVG I +
Sbjct: 1141 SKLLKSKDNVNE---------------------KKFRALMQLKYMRSLINPGEAVGIIAS 1179

Query: 1094 QSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEII-NASKVISTPIIN-AVLVNNNDER 1151
            QS+GEP TQMTL TFHFAG  + NVTLG+PR++EII  AS  I TP +   +L +  D++
Sbjct: 1180 QSVGEPSTQMTLNTFHFAGHGAANVTLGIPRMREIIMTASAAIKTPQMTLPILPDVTDDQ 1239

Query: 1152 AARVVKGRIEKTLLSDV 1168
            A    K  I K +LS+V
Sbjct: 1240 ADTFCKS-ITKVMLSEV 1255

 Score = 82.8 bits (203), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 48/156 (30%), Positives = 83/156 (53%), Gaps = 2/156 (1%)

Query: 1276 DIARAVINIRDDGKRELLVEGYGLRDVMCTDGVIGAKTAT-NHVLEIFNVLGIEAARASI 1334
            +I R V    ++GKR L+ EG   + +   +  I     T N V  +    G+EAAR +I
Sbjct: 1489 NIDRCVHPEPENGKRVLVTEGVNFQSMWDQEAFIDVNGITSNDVASVLKTYGVEAARNTI 1548

Query: 1335 IGEIDYTMSNHGMSVDPRHIQLLGDVMTFKGEVLGITRFGLSKMRDSVLQLASFEKTTDH 1394
            + EI+   S + +SV  RH+ L+ D+MT +G  L   R G+     S++++ S+E T   
Sbjct: 1549 VNEINNVFSRYAISVSFRHLDLIADMMTRQGTYLAFNRQGMESSTSSLMKM-SYETTCQF 1607

Query: 1395 LFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVV 1430
            L  A    +++ ++  S  I++G+   +GTGSF ++
Sbjct: 1608 LTKAVLDNEREELKSPSAKIVMGKLNGVGTGSFDIL 1643

 Score = 48.5 bits (114), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 31/116 (26%), Positives = 53/116 (45%), Gaps = 3/116 (2%)

Query: 13  ISGLEFSALSPADIVAQSELEISSRDLFDLENNRSPKEGGALDPRMGVSASSMECTTCHG 72
           I  ++FS L+  +I   S  +I++  + D  N   P  GG  D  +G    ++ C TC  
Sbjct: 11  IISVDFSVLTAQEIRKLSAKQITNPTVLD--NLGHPISGGLYDLSLGAFLRNL-CATCGL 67

Query: 73  NLASCHGHFGHIKLALPVFHVGYFKATIQILQGICKTCSAILLSEQDKRHFLSELR 128
           +   C GH GHI+L +P ++  +F      L+  C  C    L   +   +  +L+
Sbjct: 68  DEKFCPGHQGHIELPVPCYNPLFFNQLYIYLRSSCLYCHHFRLKTSEVHRYACKLK 123

>Kpol_1040.3 s1040 complement(6642..11612) [4971 bp, 1656 aa] {ON}
            complement(6642..11612) [4971 nt, 1657 aa]
          Length = 1656

 Score =  380 bits (975), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 239/739 (32%), Positives = 387/739 (52%), Gaps = 91/739 (12%)

Query: 247  TNKAGRPETYIWRYIPAPPVCIR-PSVMMQDSPASNEDDLTVKLTEIVWTSSLIK----- 300
            + K  + +T+    +  PP   R PS +  +   + ++ L   L++I+ TS LI+     
Sbjct: 341  SRKLVKADTFFMEVVLVPPTRFRLPSKLGDEVHENTQNQL---LSKILTTSLLIRDLNDE 397

Query: 301  ---------AGIEKGISINNMMEHWDYLQMTVAMYINSDSINPAMLPGSSTGGGKVKPIR 351
                     +  ++ +  + +M  +  +Q  V  +I+S              GGKV PI 
Sbjct: 398  MSKLQKDKVSLQDRRVIFSRLMNAFVTIQNDVNAFIDSTK-------AQGNTGGKV-PIP 449

Query: 352  GFCQRLKGKQGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPQLVAKVLTFPEKVTRY 411
            G  Q L+ K+G FR ++ GKRV+++ R+VISPDPN+  +E+ VP + A  LT+PE VT Y
Sbjct: 450  GVKQALEKKEGLFRKHMMGKRVNYAARSVISPDPNIETNEIGVPPVFATKLTYPEPVTSY 509

Query: 412  NIKKLRQLVQNGPNVHPGANYLLKKNEEARR----NLRYGDRQKLANNLQ---------- 457
            NI +LRQ V NGP+  PGA+ +  +NE+        +    R+ LAN L           
Sbjct: 510  NIAELRQAVINGPDKWPGASQI--QNEDGSLVSLIGMTLEQRKALANQLMTPSSNIATHT 567

Query: 458  YGDVVERHLEDGDVVLFNRQPSLHRLSILSHYAKIRPW-RTFRLNECVCTPYNADFDGDE 516
                V RH+++ D+V+ NRQP+LH+ S++ H  ++ P  +T RL+      YNADFDGDE
Sbjct: 568  LNKKVYRHIKNRDIVIMNRQPTLHKASMMGHKVRVLPGEKTLRLHYANTGAYNADFDGDE 627

Query: 517  MNLHVPQTEEARAEAINLMGVKNNLLTPKSGEPIIAATQDFITGSYLISHKDSFFDKASL 576
            MN+H PQ E ARAEA NL    +  LTP SG P+    QD I+    ++ KDSFF +   
Sbjct: 628  MNMHFPQNENARAEAFNLANTDSQYLTPTSGSPVRGLIQDHISAGVWLTSKDSFFTREQY 687

Query: 577  TQLL------SMMSDGSLQFDIPPPAIMKPCYLWTGKQVFS-LLIKPNKNSPVKINLDAK 629
             Q +              +    PPA+ KP  LWTGKQ+ + +L+    +    INL++ 
Sbjct: 688  QQYIYGCIRPEHGHTTRSKIVTVPPAVFKPVPLWTGKQIITTVLLNVTPSDMPGINLNSS 747

Query: 630  NKVYIPPKQKHYPNEMSQNDGFVIVRGSQILSGVMDKSVLGDGKKHSVFYTILRDFGPQE 689
            NK+    K +++ N  ++ND  VI +  ++L G++DKS  G   K+ + +++   +GP  
Sbjct: 748  NKI----KNEYWGNGSTEND--VIFKNGELLCGILDKSQYG-ASKYGIVHSLHEVYGPDV 800

Query: 690  AASAMNRMAKLCARYLGNRGFSIGISDVTPADDLKQKKEDLVEIAY-----AKCDELIDL 744
            AA  ++ + +L   Y+    F+ G+ D+   D+  + ++D+++ +      A C+     
Sbjct: 801  AAKVLSVLGRLFTNYITATAFTCGMDDLRLTDEGNKWRKDILKTSVDTGRQAACEVT--- 857

Query: 745  YNKGKLETQPGCNEEQTLE--------------------AKIGGLLSKVREE-VGDVCIN 783
                 LE +   ++ + L+                    +K+  + SKV  + V D  + 
Sbjct: 858  ----NLEKETASDDSELLKRLEEILRDDNKSGILDAVTSSKVNSITSKVVSKCVPDGTMK 913

Query: 784  ELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSKTPQ 843
            +    N+   MA  G+KGS +NVSQ++ ++GQQ + G RVP     ++LP F        
Sbjct: 914  KFP-YNSMQAMALSGAKGSNVNVSQIMCLLGQQALEGRRVPTMVSGKTLPSFKPFETDAM 972

Query: 844  SKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYDNT 903
            + G+++  F+SG+ P E+ FH ++GREGL+DTAVKT+ +GY+ R L K LE +   YDN+
Sbjct: 973  AGGYIKGRFYSGIKPQEYYFHCMAGREGLIDTAVKTSRSGYLQRCLTKQLEGVHISYDNS 1032

Query: 904  VRTSSNGIVQFTYGGDGLD 922
            VR     ++QF YGGD +D
Sbjct: 1033 VRDGDGTLIQFLYGGDSVD 1051

 Score = 95.1 bits (235), Expect = 9e-19,   Method: Compositional matrix adjust.
 Identities = 49/103 (47%), Positives = 67/103 (65%), Gaps = 1/103 (0%)

Query: 1067 QKFLEIAISKYHRAKVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIK 1126
            +KF  +   KY R+ + PG +VG I +QS+GEP TQMTL TFHFAG  + NVTLG+PR++
Sbjct: 1159 KKFRALMQLKYMRSLINPGESVGIIASQSVGEPSTQMTLNTFHFAGHGAANVTLGIPRMR 1218

Query: 1127 EII-NASKVISTPIINAVLVNNNDERAARVVKGRIEKTLLSDV 1168
            EII  AS  I TP +   ++++  +  A V    I K LLS+V
Sbjct: 1219 EIIMTASAAIKTPQMTLPILDDVSDDQADVFSKSISKVLLSEV 1261

 Score = 83.2 bits (204), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 54/176 (30%), Positives = 90/176 (51%), Gaps = 16/176 (9%)

Query: 1269 IMVKGLNDIARAVINIR-------------DDGKRELLVEGYGLRDVMCTDGVIGAKTAT 1315
            +MV  + DI R  + IR             ++GKR L+ EG   + +   +  IG    T
Sbjct: 1476 LMVNIVEDICRKTV-IRQVPFIDRCVHPEPENGKRVLVTEGVNFQAMWDQEAFIGVDGIT 1534

Query: 1316 -NHVLEIFNVLGIEAARASIIGEIDYTMSNHGMSVDPRHIQLLGDVMTFKGEVLGITRFG 1374
             N V  +    G+EAAR +I+ EI+   S + +SV  RH+ L+ D+MT +G  L   R G
Sbjct: 1535 SNDVSAVLKTYGVEAARNTIVNEINNVFSRYAISVSFRHLDLIADMMTRQGTYLAFNRQG 1594

Query: 1375 LSKMRDSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVV 1430
            +     S++++ S+E T   L  A    + + ++  S  I+LG+  ++GTG+F V+
Sbjct: 1595 METSTSSLMKM-SYETTCQFLTKAVLDNENEELKSPSARIVLGKLNNVGTGAFDVL 1649

 Score = 48.9 bits (115), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 31/116 (26%), Positives = 55/116 (47%), Gaps = 3/116 (2%)

Query: 13  ISGLEFSALSPADIVAQSELEISSRDLFDLENNRSPKEGGALDPRMGVSASSMECTTCHG 72
           I+ ++FS L+  +I   S  +I++  + D  N   P  GG  D  +G    ++ C+TC  
Sbjct: 11  ITSIDFSILTAQEIRNLSAKQITNPTVLD--NLGHPISGGLYDLALGAFLRNL-CSTCGL 67

Query: 73  NLASCHGHFGHIKLALPVFHVGYFKATIQILQGICKTCSAILLSEQDKRHFLSELR 128
           +   C GH GHI+L +P ++  +F      L+  C  C    L   +   +  +L+
Sbjct: 68  DEKFCPGHQGHIELPVPCYNPLFFNQLYIYLRSSCLFCHHFRLRSIEVHRYTCKLK 123

>TDEL0H04000 Chr8 (680730..685727) [4998 bp, 1665 aa] {ON} Anc_7.51
            YOR341W
          Length = 1665

 Score =  378 bits (970), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 244/729 (33%), Positives = 387/729 (53%), Gaps = 67/729 (9%)

Query: 245  DATNKAGRPETYIWRYIPAPPVCIR-PSVMMQDSPASNEDDLTVKLTEIVWTSSLIK--- 300
            + + K  + + +    +  PP   R PS M ++   + ++ L   L++I+ TS LI+   
Sbjct: 343  NVSRKVVKADNFFMEVVLVPPTRFRLPSKMGEEVHENTQNQL---LSKILTTSLLIRDLN 399

Query: 301  ---AGIEKG-ISINNMMEHWDYLQMTVAMYINSDSINPAMLPGSSTGGGKVK-PIRGFCQ 355
               + I+K  +S+++    +  L M   + I +D +N  +    + G    K P+ G  Q
Sbjct: 400  DEMSTIQKDKVSVDDRRVIFSRL-MNAFVTIQND-VNAFIDSTKAQGSASSKIPVPGVKQ 457

Query: 356  RLKGKQGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPQLVAKVLTFPEKVTRYNIKK 415
             L+ K+G FR ++ GKRV+++ R+VISPDPN+  +E+ VP + A  LT+PE VT YNI +
Sbjct: 458  ALEKKEGLFRKHMMGKRVNYAARSVISPDPNIETNEIGVPPVFATKLTYPEPVTAYNIAE 517

Query: 416  LRQLVQNGPNVHPGANYLLKKNEEARR----NLRYGDRQKLANNLQ----------YGDV 461
            LRQ V NGP+  PGA+ +  +NE+        +    R+ LAN L               
Sbjct: 518  LRQAVINGPDKWPGASQI--QNEDGTLVSLVGMTLEQRKALANQLMTPSSNVSTHPLNKK 575

Query: 462  VERHLEDGDVVLFNRQPSLHRLSILSHYAKIRPW-RTFRLNECVCTPYNADFDGDEMNLH 520
            V RH+++ DVVL NRQP+LH+ S++ H  ++ P  +T RL+      YNADFDGDEMN+H
Sbjct: 576  VYRHIKNRDVVLMNRQPTLHKASMMGHKVRVLPGEKTLRLHYANTGAYNADFDGDEMNMH 635

Query: 521  VPQTEEARAEAINLMGVKNNLLTPKSGEPIIAATQDFITGSYLISHKDSFFDKASLTQLL 580
             PQ E ARAEA NL    +  LTP SG P+    QD I+    ++ KDSFF +    Q +
Sbjct: 636  FPQNENARAEAFNLANTDSQYLTPTSGSPVRGLIQDHISAGVWLTSKDSFFTREEYQQYI 695

Query: 581  --------SMMSDGSLQFDIPPPAIMKPCYLWTGKQVFS-LLIKPNKNSPVKINLDAKNK 631
                       S G +     PPA++KP  LWTGKQ+ S +L+         INL++ NK
Sbjct: 696  YGCIRPEHGHASRGKIV--TMPPAVLKPVPLWTGKQIISTVLLNVTPADMPGINLESNNK 753

Query: 632  VYIPPKQKHYPNEMSQNDGFVIVRGSQILSGVMDKSVLGDGKKHSVFYTILRDFGPQEAA 691
            +    K +++    ++ND  VI +  +++ G++DKS  G   K+ + +++   +GP+ AA
Sbjct: 754  I----KNEYWGKGSTEND--VIFKNGELVCGILDKSQYG-ASKYGIVHSLHEVYGPEVAA 806

Query: 692  SAMNRMAKLCARYLGNRGFSIGISDVT-PADDLKQKKEDL---VEIAYAKCDELIDLYN- 746
              ++ + +L   Y+    F+ G+ D+   A+  K + E L   ++I      E+ +L   
Sbjct: 807  KVLSVLGRLFTNYITATAFTCGMDDLRLTAEGNKSRSEILKTSIDIGRQAAAEVTNLDKD 866

Query: 747  ---------KGKLETQPGCNEEQTLEAKIGGLLSKVREEVGDVCINELDNLNAPL----I 793
                     K   E     N+   L+A     ++ V  +V   C+ +      P      
Sbjct: 867  TPSDDVELLKRLEEILRDENKSGILDAVTSSKVNTVTSKVVSTCVPDGTMKKFPYNSMQA 926

Query: 794  MATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSKTPQSKGFVRNSFF 853
            MA  G+KGS +NVSQ++ ++GQQ + G RVP     ++LP F        + G+++  F+
Sbjct: 927  MALSGAKGSNVNVSQIMCLLGQQALEGRRVPVMVSGKTLPSFKPFETDSMAGGYIKGRFY 986

Query: 854  SGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYDNTVRTSSNGIVQ 913
            SG+ P E+ FH ++GREGL+DTAVKT+ +GY+ R L K LE +   YDN+VR     ++Q
Sbjct: 987  SGIKPQEYYFHCMAGREGLIDTAVKTSRSGYLQRCLTKQLEGVHISYDNSVRDGDGSLIQ 1046

Query: 914  FTYGGDGLD 922
            F YGGD +D
Sbjct: 1047 FLYGGDAVD 1055

 Score = 93.2 bits (230), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 68/207 (32%), Positives = 105/207 (50%), Gaps = 23/207 (11%)

Query: 1065 AVQKFLEIAISKYHRAKVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPR 1124
            + ++F  +   KY R+ + PG AVG I +QS+GEP TQMTL TFHFAG  + NVTLG+PR
Sbjct: 1161 SAKRFRALMQLKYMRSLINPGEAVGIIASQSVGEPSTQMTLNTFHFAGHGAANVTLGIPR 1220

Query: 1125 IKEII-NASKVISTPIINAVLVNNNDERAARVVKGRIEKTLLSDVCYYIQDV-------- 1175
            ++EII  AS  I TP +   + ++  +  A +    I K +LS+V   +  +        
Sbjct: 1221 MREIIMTASSAIKTPQMTLPIWDDVSDEQADLFCKSISKVVLSEVVDKVTVIETTGSSDG 1280

Query: 1176 ------YKENMAYLQVKVDLNTIDKLQLELTIEDIAIAITRAPKLKIQTSDVTVLGKDKI 1229
                  Y  NM +   K + N     Q +++ E++   I+     +++T+ +  + K K 
Sbjct: 1281 NAPSRSYAINMKFFS-KEEYNE----QYDVSAEELQNVISNKFLTQLETAILKEVKKQKK 1335

Query: 1230 AINVLPE-GFGSKTSSTSLKEPTENDV 1255
                LPE G    TS  +L E  E  V
Sbjct: 1336 T--SLPEVGVAVPTSHVALNEAAEGSV 1360

 Score = 82.0 bits (201), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 49/162 (30%), Positives = 86/162 (53%), Gaps = 2/162 (1%)

Query: 1270 MVKGLNDIARAVINIRDDGKRELLVEGYGLRDVMCTDGVIGAKTAT-NHVLEIFNVLGIE 1328
            +++ +  I R V +   + KR L+ EG   + +   +  I     T N V  +    G+E
Sbjct: 1497 VIREVPHIDRCVHSEPVNNKRMLVTEGVNFQAMWDQEAFIDVDAITSNDVASVLRTYGVE 1556

Query: 1329 AARASIIGEIDYTMSNHGMSVDPRHIQLLGDVMTFKGEVLGITRFGLSKMRDSVLQLASF 1388
            AAR +I+ EI+   S + +SV  RH+ L+ D+MT +G  L   R G+     S++++ S+
Sbjct: 1557 AARNTIVNEINNVFSRYAISVSFRHLDLIADMMTRQGTYLAFNRQGMETSTSSLMKM-SY 1615

Query: 1389 EKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVV 1430
            E T   L  A    +++ +E  S  I+LG+  ++GTGSF ++
Sbjct: 1616 ETTCQFLTKAVLDNEREELESPSARIVLGKLSNVGTGSFDLL 1657

 Score = 54.7 bits (130), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 33/116 (28%), Positives = 57/116 (49%), Gaps = 3/116 (2%)

Query: 13  ISGLEFSALSPADIVAQSELEISSRDLFDLENNRSPKEGGALDPRMGVSASSMECTTCHG 72
           I+ L+F+ L+P DI   S  +I++  + D  N   P  GG  D  +G    ++ C+TC  
Sbjct: 11  ITSLDFNILTPQDIRNLSAKQITNPTVLD--NLGHPISGGLYDLSLGAFLRNL-CSTCGL 67

Query: 73  NLASCHGHFGHIKLALPVFHVGYFKATIQILQGICKTCSAILLSEQDKRHFLSELR 128
           +   C GH GHI+L +P ++  +F      L+  C  C    L + +   +  +L+
Sbjct: 68  DEKFCPGHQGHIELPVPCYNPLFFNQLYIYLRSCCLFCHHFRLKKVEVHRYACKLK 123

>Kpol_1019.27 s1019 complement(51067..52161) [1095 bp, 364 aa] {ON}
           complement(51067..52161) [1095 nt, 365 aa]
          Length = 364

 Score = 85.5 bits (210), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 83/286 (29%), Positives = 129/286 (45%), Gaps = 30/286 (10%)

Query: 11  KRISGLEFSALSPADIVAQSELEISSRDLFDLENNRSPKEGGALDPRMGVSASSMECTTC 70
           + I  ++F   SP ++ A S  +I   +  D    R+ K GG  DPR+G    +++C TC
Sbjct: 12  RTIKEVQFGLFSPEEVRAISVAKIRFPETMDETQTRA-KIGGLNDPRLGSIDRNVKCQTC 70

Query: 71  HGNLASCHGHFGHIKLALPVFHVGYFKATIQILQGICKTCSAILLSEQDKRHFLS-ELRR 129
              +  C GHFGHI LA PVFH+G+     ++ + +C  C  +LL E +++   + +++ 
Sbjct: 71  QEGMNECPGHFGHIDLAKPVFHIGFISKIKKVCECVCMHCGKLLLDEHNEQMNQAIKIKD 130

Query: 130 PGVDNLRRMALLKKVLDQCKKQRRCLHCXXXXXXXXXXXXXXXXXSLKIIHDTFRWVGKK 189
           P             V   CK +   + C                        T R  G  
Sbjct: 131 P-------KKRFNAVWTLCKTK---MICETDVPSEDDPTKLVSRGGCGNAQPTIRKDGL- 179

Query: 190 STPEKDKWIGDWKEVLSHN--PELERYVKRATDDLNPLKTLNLFKQIASEDCELLGIDAT 247
                 K +G WK+  + N   E E+ V      L+  + LN+FK I+SED   LG +  
Sbjct: 180 ------KLVGSWKKDKNTNDGDEPEQRV------LSTEEILNIFKHISSEDYIRLGFN-- 225

Query: 248 NKAGRPETYIWRYIPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIV 293
            +  RPE  +   +P PP  +RPS+   +S    EDDLT KL +I+
Sbjct: 226 EEFARPEWMLLTVLPVPPPPVRPSISFNES-QRGEDDLTFKLADIL 270

>TDEL0A04130 Chr1 complement(735166..736587) [1422 bp, 473 aa] {ON}
           Anc_5.550 YML017W
          Length = 473

 Score = 35.8 bits (81), Expect = 0.92,   Method: Compositional matrix adjust.
 Identities = 37/116 (31%), Positives = 52/116 (44%), Gaps = 15/116 (12%)

Query: 360 KQGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVP-QLVAKVLTFPEKVTRYNIKKLRQ 418
           K+ R +G L     D +GR  I+P    +    A P    +K+L   EKV + +I+  R 
Sbjct: 173 KEYRLKGELLKDSKDDAGRPYIAPRHKSNPFGSAKPVDTQSKILDIEEKVGKLHIEDTRI 232

Query: 419 LVQ-----NGPNVHPGANYLLKKNEEARRNLRYGDRQKLANNLQYGDVVERHLEDG 469
           L +      GP + PG   LLKK  E          Q+    L Y DVV++  EDG
Sbjct: 233 LRRLSGGDPGPVLQPGKVTLLKKTPE---------EQEKKKPLSYLDVVKKSAEDG 279

>KAFR0H02320 Chr8 (443614..444762) [1149 bp, 382 aa] {ON} Anc_8.696
           YPL168W
          Length = 382

 Score = 34.7 bits (78), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 26/96 (27%), Positives = 48/96 (50%), Gaps = 3/96 (3%)

Query: 869 REGLVDTAVKTAETGYMSRRLMKSLEDLSCQYDNTVRTSSNGIVQFTYGGDGLDPLEMEG 928
           R+ + D  +    T Y+   +++ LE  +   ++  +  SN I++ +   +GL P E +G
Sbjct: 155 RKPVFDIGLHPENTDYLDV-ILEQLEKNTVNTNDLYQIISN-IIEESNEREGLQPNE-KG 211

Query: 929 NAQPVNFNRSWDHAYNITFNNTDRGLLPYEIKKTVD 964
           N + +N N   ++ + I   NT + L   E KKT D
Sbjct: 212 NTKDINLNSLKNYLHEIDIQNTHKNLFLTEQKKTYD 247

>KAFR0C03730 Chr3 (759382..761757) [2376 bp, 791 aa] {ON} 
          Length = 791

 Score = 34.3 bits (77), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 23/65 (35%), Positives = 34/65 (52%), Gaps = 1/65 (1%)

Query: 412 NIKKLRQL-VQNGPNVHPGANYLLKKNEEARRNLRYGDRQKLANNLQYGDVVERHLEDGD 470
           +IK L +L   N   V+     L    E+ + +LR   +++  +NLQ    +E HL DGD
Sbjct: 81  SIKNLEKLSFANPAKVNSLIQTLSTSIEDLKHDLRLSLKEESVSNLQSELSLETHLIDGD 140

Query: 471 VVLFN 475
            VLFN
Sbjct: 141 YVLFN 145

>TPHA0H01440 Chr8 complement(322547..325174) [2628 bp, 875 aa] {ON}
           Anc_5.359
          Length = 875

 Score = 34.3 bits (77), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 25/80 (31%), Positives = 36/80 (45%), Gaps = 1/80 (1%)

Query: 315 HWDYLQMTVAMYINSDSINPAMLPGSSTGGGKVKPIRGFCQRLKGKQGRFRGNLSGKRVD 374
           H+DY++ +    I        +  GSS   G + PIR F  + K  QGRF  N++ + VD
Sbjct: 203 HYDYIEDSTEKKIYPTLDGYDIRDGSSGTKGSL-PIRLFTAKGKSHQGRFAMNVTRRVVD 261

Query: 375 FSGRTVISPDPNLSIDEVAV 394
                   P P   +D V V
Sbjct: 262 LFSELFEIPYPLPKLDIVCV 281

>Ecym_6361 Chr6 (706378..711711) [5334 bp, 1777 aa] {ON} similar to
            Ashbya gossypii AFR074C
          Length = 1777

 Score = 33.1 bits (74), Expect = 7.1,   Method: Compositional matrix adjust.
 Identities = 28/104 (26%), Positives = 48/104 (46%), Gaps = 16/104 (15%)

Query: 1214 LKIQTSDVTVLGKDKIAI--NVLPEGF----GSKTSSTSLKEPTENDVFYRMQTLRRALP 1267
            L + TS + VLG   IA    ++P+        K S+  L+E  +  V     ++ + +P
Sbjct: 1361 LAVLTSTIYVLGVKSIAFYPKIVPQALEIFESVKDSNDELREQLQLSVILLFASMLKRIP 1420

Query: 1268 SIMVKGLNDIARAVINIRDDGKRE--------LLVEGYGLRDVM 1303
            S +   L D+ R V  +  DG +E        L+VE   L++V+
Sbjct: 1421 SFLQSNLADVLRVV--LFADGVQESIRLYVTTLIVEHIDLKEVL 1462

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.135    0.392 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 151,637,611
Number of extensions: 6719915
Number of successful extensions: 18321
Number of sequences better than 10.0: 70
Number of HSP's gapped: 18381
Number of HSP's successfully gapped: 184
Length of query: 1459
Length of database: 53,481,399
Length adjustment: 122
Effective length of query: 1337
Effective length of database: 39,492,147
Effective search space: 52801000539
Effective search space used: 52801000539
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 72 (32.3 bits)