Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
CAGL0L08536gsingletonON73733751e-48
NDAI0D048704.26ON87858650.46
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0L08536g
         (73 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0L08536g Chr12 (934441..934662) [222 bp, 73 aa] {ON} no simi...   149   1e-48
NDAI0D04870 Chr4 (1156902..1159538) [2637 bp, 878 aa] {ON} Anc_4...    30   0.46 

>CAGL0L08536g Chr12 (934441..934662) [222 bp, 73 aa] {ON} no
          similarity
          Length = 73

 Score =  149 bits (375), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 73/73 (100%), Positives = 73/73 (100%)

Query: 1  MKIPYRYLRFLKHTPIRGGTQLDLIEMSTVELLVFTMLSRVVNISIVRFSKNWSNRVRTG 60
          MKIPYRYLRFLKHTPIRGGTQLDLIEMSTVELLVFTMLSRVVNISIVRFSKNWSNRVRTG
Sbjct: 1  MKIPYRYLRFLKHTPIRGGTQLDLIEMSTVELLVFTMLSRVVNISIVRFSKNWSNRVRTG 60

Query: 61 FTSLAAPIARIYT 73
          FTSLAAPIARIYT
Sbjct: 61 FTSLAAPIARIYT 73

>NDAI0D04870 Chr4 (1156902..1159538) [2637 bp, 878 aa] {ON} Anc_4.26
           YLL032C
          Length = 878

 Score = 29.6 bits (65), Expect = 0.46,   Method: Composition-based stats.
 Identities = 16/58 (27%), Positives = 32/58 (55%), Gaps = 2/58 (3%)

Query: 6   RYLRFLKHTPIRGGTQLDLIEMSTVELLVFTMLSRVVNISIVRFSKNWSNRVRTGFTS 63
           RY   +   P +  + ++L ++  +E++    LS+  N +++RFSKN  N +   FT+
Sbjct: 565 RYNNVIIRCPFKNKSGIELAKLDLIEIVNNFKLSQ--NFNVIRFSKNQFNFILENFTT 620

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.329    0.139    0.407 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 6,552,855
Number of extensions: 176253
Number of successful extensions: 533
Number of sequences better than 10.0: 2
Number of HSP's gapped: 533
Number of HSP's successfully gapped: 2
Length of query: 73
Length of database: 53,481,399
Length adjustment: 45
Effective length of query: 28
Effective length of database: 48,321,429
Effective search space: 1353000012
Effective search space used: 1353000012
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.8 bits)
S2: 59 (27.3 bits)