Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
CAGL0L08514g3.488ON31231215820.0
TDEL0D055603.488ON3113136774e-87
YPR147C3.488ON3043126755e-87
TBLA0C044503.488ON3093136712e-86
Kpol_480.173.488ON3133136713e-86
Suva_16.4763.488ON3043126679e-86
Smik_16.4003.488ON3043126555e-84
Skud_16.4423.488ON3043126531e-83
NCAS0F035303.488ON3133166305e-80
TPHA0D042203.488ON3163216123e-77
Kwal_55.212193.488ON3023135921e-74
KLTH0F14740g3.488ON3023155879e-74
ZYRO0D10076g3.488ON3053135825e-73
SAKL0F02860g3.488ON3053115522e-68
NDAI0B058303.488ON3293345482e-67
AFR306C3.488ON3192885097e-62
Ecym_12413.488ON3052884548e-54
TDEL0G04830singletonON543128880.020
Ecym_32544.264ON67377780.31
TBLA0A053501.72ON35588730.97
Ecym_83238.638ON85677722.0
Skud_2.3318.524ON376131712.0
NCAS0B022608.524ON363121712.0
Smik_2.3458.524ON375142712.2
Kpol_274.38.120ON58178712.3
SAKL0F06402g3.442ON72150703.4
TDEL0B032508.524ON348159685.0
SAKL0H10450g8.524ON39241676.2
KAFR0E031208.524ON34639676.3
YBR204C (LDH1)8.524ON375131667.2
SAKL0D06886g1.321ON44774667.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0L08514g
         (312 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0L08514g Chr12 (932629..933567) [939 bp, 312 aa] {ON} simila...   613   0.0  
TDEL0D05560 Chr4 complement(1004217..1005152) [936 bp, 311 aa] {...   265   4e-87
YPR147C Chr16 complement(825645..826559) [915 bp, 304 aa] {ON} P...   264   5e-87
TBLA0C04450 Chr3 complement(1079139..1080068) [930 bp, 309 aa] {...   263   2e-86
Kpol_480.17 s480 (35641..36582) [942 bp, 313 aa] {ON} (35641..36...   263   3e-86
Suva_16.476 Chr16 complement(822104..823018) [915 bp, 304 aa] {O...   261   9e-86
Smik_16.400 Chr16 complement(697593..698507) [915 bp, 304 aa] {O...   256   5e-84
Skud_16.442 Chr16 complement(779364..780278) [915 bp, 304 aa] {O...   256   1e-83
NCAS0F03530 Chr6 complement(706175..707116) [942 bp, 313 aa] {ON...   247   5e-80
TPHA0D04220 Chr4 complement(912211..913161) [951 bp, 316 aa] {ON...   240   3e-77
Kwal_55.21219 s55 complement(734903..735811) [909 bp, 302 aa] {O...   232   1e-74
KLTH0F14740g Chr6 complement(1208120..1209028) [909 bp, 302 aa] ...   230   9e-74
ZYRO0D10076g Chr4 (850134..851051) [918 bp, 305 aa] {ON} similar...   228   5e-73
SAKL0F02860g Chr6 (242683..243600) [918 bp, 305 aa] {ON} similar...   217   2e-68
NDAI0B05830 Chr2 complement(1415309..1416298) [990 bp, 329 aa] {...   215   2e-67
AFR306C Chr6 complement(996001..996960) [960 bp, 319 aa] {ON} Sy...   200   7e-62
Ecym_1241 Chr1 (494505..495422) [918 bp, 305 aa] {ON} similar to...   179   8e-54
TDEL0G04830 Chr7 complement(891989..893620) [1632 bp, 543 aa] {O...    39   0.020
Ecym_3254 Chr3 (484386..486407) [2022 bp, 673 aa] {ON} similar t...    35   0.31 
TBLA0A05350 Chr1 (1311836..1312903) [1068 bp, 355 aa] {ON} Anc_1...    33   0.97 
Ecym_8323 Chr8 complement(657183..659753) [2571 bp, 856 aa] {ON}...    32   2.0  
Skud_2.331 Chr2 complement(599967..601097) [1131 bp, 376 aa] {ON...    32   2.0  
NCAS0B02260 Chr2 complement(374788..375879) [1092 bp, 363 aa] {O...    32   2.0  
Smik_2.345 Chr2 complement(618817..619944) [1128 bp, 375 aa] {ON...    32   2.2  
Kpol_274.3 s274 (2546..4291) [1746 bp, 581 aa] {ON} (2546..4291)...    32   2.3  
SAKL0F06402g Chr6 (487543..489708) [2166 bp, 721 aa] {ON} simila...    32   3.4  
TDEL0B03250 Chr2 complement(575015..576061) [1047 bp, 348 aa] {O...    31   5.0  
SAKL0H10450g Chr8 complement(897598..898776) [1179 bp, 392 aa] {...    30   6.2  
KAFR0E03120 Chr5 (623464..624504) [1041 bp, 346 aa] {ON} Anc_8.5...    30   6.3  
YBR204C Chr2 complement(632254..633381) [1128 bp, 375 aa] {ON}  ...    30   7.2  
SAKL0D06886g Chr4 complement(571478..572821) [1344 bp, 447 aa] {...    30   7.4  

>CAGL0L08514g Chr12 (932629..933567) [939 bp, 312 aa] {ON} similar
           to uniprot|Q06522 Saccharomyces cerevisiae YPR147c
          Length = 312

 Score =  613 bits (1582), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 299/312 (95%), Positives = 299/312 (95%)

Query: 1   MSVQGYHDSALPTCIIHIKPTVTNNDESSPLFVWIPGNPGLLEYYQEFLAKVHDKNPTWE 60
           MSVQGYHDSALPTCIIHIKPTVTNNDESSPLFVWIPGNPGLLEYYQEFLAKVHDKNPTWE
Sbjct: 1   MSVQGYHDSALPTCIIHIKPTVTNNDESSPLFVWIPGNPGLLEYYQEFLAKVHDKNPTWE 60

Query: 61  ILGISHAGTVIESSQLKKFRKNPLPIYDLKQQTQHXXXXXXXXXXXXXRELVIMGHSVGA 120
           ILGISHAGTVIESSQLKKFRKNPLPIYDLKQQTQH             RELVIMGHSVGA
Sbjct: 61  ILGISHAGTVIESSQLKKFRKNPLPIYDLKQQTQHKIDIINKINNDPNRELVIMGHSVGA 120

Query: 121 YIAQHVVSSPDLVGRVSKLGLITPTIRDIHKSSHGLIFTRVFNYISNVNEYLSFISSNIF 180
           YIAQHVVSSPDLVGRVSKLGLITPTIRDIHKSSHGLIFTRVFNYISNVNEYLSFISSNIF
Sbjct: 121 YIAQHVVSSPDLVGRVSKLGLITPTIRDIHKSSHGLIFTRVFNYISNVNEYLSFISSNIF 180

Query: 181 NKLIPAYWTKLLISFAMGCSFDEYHIILGTFLLLTQRETLRQVLGLAAHEMLEIRDDWAF 240
           NKLIPAYWTKLLISFAMGCSFDEYHIILGTFLLLTQRETLRQVLGLAAHEMLEIRDDWAF
Sbjct: 181 NKLIPAYWTKLLISFAMGCSFDEYHIILGTFLLLTQRETLRQVLGLAAHEMLEIRDDWAF 240

Query: 241 QENLLTKCKDNGTKLWLLFSDNDHWVSQHTQAELIKFLKDRYPELLLRVDVDKDIKHSFV 300
           QENLLTKCKDNGTKLWLLFSDNDHWVSQHTQAELIKFLKDRYPELLLRVDVDKDIKHSFV
Sbjct: 241 QENLLTKCKDNGTKLWLLFSDNDHWVSQHTQAELIKFLKDRYPELLLRVDVDKDIKHSFV 300

Query: 301 VKDVDLVTRRYF 312
           VKDVDLVTRRYF
Sbjct: 301 VKDVDLVTRRYF 312

>TDEL0D05560 Chr4 complement(1004217..1005152) [936 bp, 311 aa] {ON}
           Anc_3.488 YPR147C
          Length = 311

 Score =  265 bits (677), Expect = 4e-87,   Method: Compositional matrix adjust.
 Identities = 137/313 (43%), Positives = 192/313 (61%), Gaps = 6/313 (1%)

Query: 1   MSVQGYHDSALPTCIIHIKPTVTNNDESSPLFVWIPGNPGLLEYYQEFLAKVHDKNPTWE 60
           M+ + Y   A PT I+H K          PLFVWIPGNPGL+EYY+EFL  +H ++P WE
Sbjct: 1   MAAREYIKCAYPTSIVHFKSISIRGKSECPLFVWIPGNPGLIEYYEEFLMLIHRQHPEWE 60

Query: 61  ILGISHAGTVIES-SQLKKFRKNPLPIYDLKQQTQHXXXXXXXXXXXXXRELVIMGHSVG 119
           +LGISHAG    S S+ +K  +N   +Y LKQQ  H             R L+IMGHSVG
Sbjct: 61  VLGISHAGMSTASVSKSEKSERND--VYSLKQQIDHKLEIIKDFSSTN-RPLIIMGHSVG 117

Query: 120 AYIAQHVVSSPDLVGRVSKLGLITPTIRDIHKSSHGLIFTRVFNYISNVNEYLSFISSNI 179
           AY+ QH+V S  LVG+V+K+GL+TPTI DIH S  G++ T+V  ++ ++ +   + SS +
Sbjct: 118 AYMVQHIVLSDKLVGKVAKMGLLTPTILDIHTSKKGVVLTKVLYWLKDLPQLAGWFSSLL 177

Query: 180 FNKLIPAYWTKLLISFAMGCSFDEYHIILGTFLLLTQRETLRQVLGLAAHEMLEIRDDWA 239
           F   +P++  ++L+SF MGC  +    +L T +LL   E ++Q LGL+ +EM EIR DWA
Sbjct: 178 FGFFLPSFILRILLSFFMGCHRNSSG-VLTTTVLLENGEFVKQALGLSVYEMEEIRSDWA 236

Query: 240 FQENLLTKCKDNGTKLWLLFSDNDHWVSQHTQAELIKFLKDRYPELLLRVDVDKDIKHSF 299
           FQ  L+  C + G   WLLFSD+DHWV+  T+ +LIKF +D Y    +++   K I HSF
Sbjct: 237 FQRRLIVHCNERGISTWLLFSDSDHWVADTTREDLIKFYRDHYRADKIKIHTCK-IPHSF 295

Query: 300 VVKDVDLVTRRYF 312
           V+     +   YF
Sbjct: 296 VLNHSKYLISEYF 308

>YPR147C Chr16 complement(825645..826559) [915 bp, 304 aa] {ON}
           Putative protein of unknown function; green fluorescent
           protein (GFP)-fusion protein localizes to the cytoplasm
           and is induced in response to the DNA-damaging agent MMS
          Length = 304

 Score =  264 bits (675), Expect = 5e-87,   Method: Compositional matrix adjust.
 Identities = 136/312 (43%), Positives = 183/312 (58%), Gaps = 8/312 (2%)

Query: 1   MSVQGYHDSALPTCIIHIKPTVTNNDESSPLFVWIPGNPGLLEYYQEFLAKVHDKNPTWE 60
           M+V+ Y  S LP  I++IKPTVT + E +PL VWIPGNPGLL YYQE L  +H K+P WE
Sbjct: 1   MTVKEYTKSKLPCSILNIKPTVTKSGEDAPLLVWIPGNPGLLYYYQEMLHHLHLKHPDWE 60

Query: 61  ILGISHAGTVIESSQLKKFRKNPLPIYDLKQQTQHXXXXXXXXXXXXXRELVIMGHSVGA 120
           ILGISHAG  + +        +  PI+ L+ Q  H             R+++IMGHSVGA
Sbjct: 61  ILGISHAGMTLNA-------HSNTPIFSLQDQVDHQVEVINNFSCKN-RKIIIMGHSVGA 112

Query: 121 YIAQHVVSSPDLVGRVSKLGLITPTIRDIHKSSHGLIFTRVFNYISNVNEYLSFISSNIF 180
           YI Q V  S  LVG V K+GL+TPT+ DIH S  G+  T    YI  +   +S  S   F
Sbjct: 113 YIVQKVCLSNKLVGSVQKVGLVTPTVMDIHTSEMGIKMTAALRYIPPLAHVVSLFSYIFF 172

Query: 181 NKLIPAYWTKLLISFAMGCSFDEYHIILGTFLLLTQRETLRQVLGLAAHEMLEIRDDWAF 240
             ++   +++ +I   MGC    Y  +L T + LT R+ +RQ LGLAA EM EI  +W F
Sbjct: 173 YWILSEGFSRFIIDKFMGCGSTGYQAVLSTRIFLTHRQFVRQSLGLAAQEMEEITTNWEF 232

Query: 241 QENLLTKCKDNGTKLWLLFSDNDHWVSQHTQAELIKFLKDRYPELLLRVDVDKDIKHSFV 300
           Q+  +  C++NG  +W LFS NDHWVS  T++ L  + KD+  +  L++DV   I HSFV
Sbjct: 233 QDRFINYCEENGISIWFLFSSNDHWVSGKTRSHLSDYYKDKVKQERLKIDVTDKIPHSFV 292

Query: 301 VKDVDLVTRRYF 312
           VK  +     +F
Sbjct: 293 VKHAEYAINAFF 304

>TBLA0C04450 Chr3 complement(1079139..1080068) [930 bp, 309 aa] {ON}
           Anc_3.488 YPR147C
          Length = 309

 Score =  263 bits (671), Expect = 2e-86,   Method: Compositional matrix adjust.
 Identities = 136/313 (43%), Positives = 181/313 (57%), Gaps = 5/313 (1%)

Query: 1   MSVQGYHDSALPTCIIHIKPTVTNN-DESSPLFVWIPGNPGLLEYYQEFLAKVHDKNPTW 59
           M++Q Y DS  PT I+H  P       E +PLF+WIPGNPGLLEYY + L  +HDK PTW
Sbjct: 1   MTIQIYPDSRYPTSIVHFPPAKDYKITEDTPLFIWIPGNPGLLEYYTKMLRSLHDKYPTW 60

Query: 60  EILGISHAGTVIESSQLKKFRKNPLPIYDLKQQTQHXXXXXXXXXXXXXRELVIMGHSVG 119
           EILG+SHAG +   +Q+K        +Y L +Q  H             R ++IMGHSVG
Sbjct: 61  EILGVSHAG-MSNGNQIKNVLSTK--VYTLDEQVSHKVEVINNFSSPK-RNIIIMGHSVG 116

Query: 120 AYIAQHVVSSPDLVGRVSKLGLITPTIRDIHKSSHGLIFTRVFNYISNVNEYLSFISSNI 179
           AY+AQ V+   +L+G V KLGL+TPT+ DIH+S  G+  TR FN    +  +L  +S+  
Sbjct: 117 AYMAQRVIMDSNLIGNVIKLGLVTPTVVDIHRSVKGIKMTRAFNLFRELPIFLGLLSTLA 176

Query: 180 FNKLIPAYWTKLLISFAMGCSFDEYHIILGTFLLLTQRETLRQVLGLAAHEMLEIRDDWA 239
           F+KL PA +T+ L++  MGC  ++ H    + + LT    ++Q LGLA+HEM  IRDDW 
Sbjct: 177 FSKLFPAIFTRWLLTIIMGCKNNDNHAADASTVFLTNGSFVKQCLGLASHEMKHIRDDWN 236

Query: 240 FQENLLTKCKDNGTKLWLLFSDNDHWVSQHTQAELIKFLKDRYPELLLRVDVDKDIKHSF 299
           FQ+ L+  C       W LFS  DHWVS  T+ ELI F +      +L V V   I HSF
Sbjct: 237 FQKRLIDYCNKENVSTWFLFSSTDHWVSDDTRNELINFYRTNCKSDILDVSVSNIIPHSF 296

Query: 300 VVKDVDLVTRRYF 312
           V+   D     YF
Sbjct: 297 VINFSDFTVNSYF 309

>Kpol_480.17 s480 (35641..36582) [942 bp, 313 aa] {ON}
           (35641..36582) [942 nt, 314 aa]
          Length = 313

 Score =  263 bits (671), Expect = 3e-86,   Method: Compositional matrix adjust.
 Identities = 136/313 (43%), Positives = 194/313 (61%), Gaps = 6/313 (1%)

Query: 3   VQGYHDSALPTCIIHIKP-TVTNNDESSPLFVWIPGNPGLLEYYQEFLAKVHDKNPTWEI 61
           V+ + DS  PT I+H+ P T   + E SPLFVWIPGNPGLLEYY +FLA VH KNPTWE+
Sbjct: 4   VKVFEDSIYPTSIVHLDPLTKELSPEDSPLFVWIPGNPGLLEYYVDFLALVHKKNPTWEV 63

Query: 62  LGISHAGTVIESSQLKK--FRKNPLPIYDLKQQTQHXXXXXXXXXXXXXRELVIMGHSVG 119
           LGISHAG   + ++ KK     +   ++DL++Q QH             R L+IMGHSVG
Sbjct: 64  LGISHAGMSYDGNEKKKKTSSNDKFKVFDLEEQVQHKVDIINKFSSKN-RPLIIMGHSVG 122

Query: 120 AYIAQHVVSSPDLVGRVSKLGLITPTIRDIHKSSHGLIFTRVFNYISNVNEYLSFISSNI 179
           AY+ Q V+ +  L G++ K+G +TPT+ DIH S  G+  T+VFN+ SN+  ++ +IS  I
Sbjct: 123 AYLTQRVIMTNKLNGKLIKVGYLTPTVVDIHLSDKGIKMTKVFNWTSNLPHHVGWISQFI 182

Query: 180 FNKLIPAYWTKLLISFAMGCSFDEYHIILGTFLLLTQRETLRQVLGLAAHEMLEIRDDWA 239
           F+KL+P ++ K  IS  + CS D  + +L +  LL     + Q LGLA +EM  I DDW 
Sbjct: 183 FHKLLPLFFVKFFISKMIKCSEDS-NAVLASGTLLRNANLIEQALGLATYEMEAIHDDWG 241

Query: 240 FQENLLTKCKDNGTKLWLLFSDNDHWVSQHTQAELIKFLKDRYPELLLRVDVDKDIKHSF 299
           F + L+  C + G K W LF+++DHWV+  T+ E+I F +       +R+D+D  I H+F
Sbjct: 242 FHKKLIDYCNETGVKTWFLFAEDDHWVAHSTRKEVIDFYQYHNKPENIRIDIDT-IPHAF 300

Query: 300 VVKDVDLVTRRYF 312
           V+K    +  +YF
Sbjct: 301 VIKKSKYIVDQYF 313

>Suva_16.476 Chr16 complement(822104..823018) [915 bp, 304 aa] {ON}
           YPR147C (REAL)
          Length = 304

 Score =  261 bits (667), Expect = 9e-86,   Method: Compositional matrix adjust.
 Identities = 136/312 (43%), Positives = 184/312 (58%), Gaps = 8/312 (2%)

Query: 1   MSVQGYHDSALPTCIIHIKPTVTNNDESSPLFVWIPGNPGLLEYYQEFLAKVHDKNPTWE 60
           MS+Q Y  S LP  I++IKPTVT ++E +PL VWIPGNPGLL YYQE +  +H K+P WE
Sbjct: 1   MSIQEYTKSKLPCSILNIKPTVTTDNEDAPLLVWIPGNPGLLHYYQEMIHHLHLKHPDWE 60

Query: 61  ILGISHAGTVIESSQLKKFRKNPLPIYDLKQQTQHXXXXXXXXXXXXXRELVIMGHSVGA 120
           ILGISHAG       +    ++  PI+ L+ Q  H             R+++IMGHSVGA
Sbjct: 61  ILGISHAG-------MSSNARSNTPIFSLQDQVDHQVKVINNFSHDN-RKIIIMGHSVGA 112

Query: 121 YIAQHVVSSPDLVGRVSKLGLITPTIRDIHKSSHGLIFTRVFNYISNVNEYLSFISSNIF 180
           YI Q V  S +LVG V+K+GLITPT+ DIH S  G+  T  F+Y+  +   LSFIS   F
Sbjct: 113 YIVQKVCLSNELVGSVTKVGLITPTVMDIHASEMGVKMTTAFHYVPALAHVLSFISYVFF 172

Query: 181 NKLIPAYWTKLLISFAMGCSFDEYHIILGTFLLLTQRETLRQVLGLAAHEMLEIRDDWAF 240
             ++    +KL+I   MGC       +L T L LT R+ +RQ LGLA+ E+ EI  +W F
Sbjct: 173 YWVLSEGLSKLIIDKFMGCGTAGRRAVLSTRLFLTHRQFVRQSLGLASQELKEITTNWEF 232

Query: 241 QENLLTKCKDNGTKLWLLFSDNDHWVSQHTQAELIKFLKDRYPELLLRVDVDKDIKHSFV 300
           Q+  +  C++ G   W LFS  DHWV+  T+  L  +  D+  +  LR+DV   + HSFV
Sbjct: 233 QDKFINHCEEKGIFTWFLFSTKDHWVNDETRKHLSHYYHDKVKQEHLRIDVTDKMPHSFV 292

Query: 301 VKDVDLVTRRYF 312
           VK  +     +F
Sbjct: 293 VKHAEYAINAFF 304

>Smik_16.400 Chr16 complement(697593..698507) [915 bp, 304 aa] {ON}
           YPR147C (REAL)
          Length = 304

 Score =  256 bits (655), Expect = 5e-84,   Method: Compositional matrix adjust.
 Identities = 132/312 (42%), Positives = 180/312 (57%), Gaps = 8/312 (2%)

Query: 1   MSVQGYHDSALPTCIIHIKPTVTNNDESSPLFVWIPGNPGLLEYYQEFLAKVHDKNPTWE 60
           M +Q Y  S  P  I++IKPT+T +DE + L VWIPGNPGLL YYQE L  +H K+P WE
Sbjct: 1   MPIQEYTKSKFPCSILNIKPTITRSDEDAALLVWIPGNPGLLYYYQEMLQYLHSKHPDWE 60

Query: 61  ILGISHAGTVIESSQLKKFRKNPLPIYDLKQQTQHXXXXXXXXXXXXXRELVIMGHSVGA 120
           ILGISHAG  + +        +  P+Y L+ Q  H             R+++IMGHSVGA
Sbjct: 61  ILGISHAGMTLNA-------HSNTPVYSLQDQVDHQVEVINNFSHEN-RKIIIMGHSVGA 112

Query: 121 YIAQHVVSSPDLVGRVSKLGLITPTIRDIHKSSHGLIFTRVFNYISNVNEYLSFISSNIF 180
           YI Q V  S +LVG V K+GL+TPT+ DIH S  G+  T   +YI  +   +S  S   F
Sbjct: 113 YILQKVCLSHNLVGTVQKVGLVTPTVMDIHTSEMGVKLTTALHYIPPLAHVVSLFSYIFF 172

Query: 181 NKLIPAYWTKLLISFAMGCSFDEYHIILGTFLLLTQRETLRQVLGLAAHEMLEIRDDWAF 240
             ++   +++ +I   MGC       +L T + LT ++ +RQ LGLA+ EM EI  +W F
Sbjct: 173 YWILSEGFSRFIIDKFMGCGSTSCQAVLSTRIFLTHKQFVRQSLGLASQEMEEITTNWEF 232

Query: 241 QENLLTKCKDNGTKLWLLFSDNDHWVSQHTQAELIKFLKDRYPELLLRVDVDKDIKHSFV 300
           Q+  +  C+ NGT +W LFS NDHWVS  T++ L  + KD+  +  L +DV   I HSFV
Sbjct: 233 QDKFINYCEQNGTLIWFLFSSNDHWVSGKTRSHLSHYYKDKVDQNRLEIDVTDKIPHSFV 292

Query: 301 VKDVDLVTRRYF 312
           VK        +F
Sbjct: 293 VKHAKYAINTFF 304

>Skud_16.442 Chr16 complement(779364..780278) [915 bp, 304 aa] {ON}
           YPR147C (REAL)
          Length = 304

 Score =  256 bits (653), Expect = 1e-83,   Method: Compositional matrix adjust.
 Identities = 132/312 (42%), Positives = 181/312 (58%), Gaps = 8/312 (2%)

Query: 1   MSVQGYHDSALPTCIIHIKPTVTNNDESSPLFVWIPGNPGLLEYYQEFLAKVHDKNPTWE 60
           M VQ Y  S LP  I++IKP+V   +E +PL VWIPGNPGLL YYQE L  +H K+P WE
Sbjct: 1   MPVQEYTKSTLPCSILNIKPSVATENEDAPLLVWIPGNPGLLYYYQEMLQHLHSKHPDWE 60

Query: 61  ILGISHAGTVIESSQLKKFRKNPLPIYDLKQQTQHXXXXXXXXXXXXXRELVIMGHSVGA 120
           ILG+SHAG  + +        +  PI+ L+ Q  H             R+++IMGHSVGA
Sbjct: 61  ILGVSHAGMTLNA-------HSNTPIFSLQDQVDHQVEVINNFSHEN-RKIIIMGHSVGA 112

Query: 121 YIAQHVVSSPDLVGRVSKLGLITPTIRDIHKSSHGLIFTRVFNYISNVNEYLSFISSNIF 180
           YI Q V  S  LVG V K+GLITPT+ DIH S  G+  T V +YI  +   +S +S   F
Sbjct: 113 YILQKVCLSDKLVGSVRKIGLITPTVMDIHTSEMGVKMTAVLHYIPPLAHVVSLLSYVFF 172

Query: 181 NKLIPAYWTKLLISFAMGCSFDEYHIILGTFLLLTQRETLRQVLGLAAHEMLEIRDDWAF 240
             ++    ++ +I   MGC    Y  +L T +LLT ++ +RQ LGLA+ EM EI  +W F
Sbjct: 173 YWILSEGLSRFVIDKFMGCGSTGYQAVLSTRILLTHKQFVRQSLGLASQEMKEITTNWEF 232

Query: 241 QENLLTKCKDNGTKLWLLFSDNDHWVSQHTQAELIKFLKDRYPELLLRVDVDKDIKHSFV 300
           Q+  +  C++N   +W LFS  DHWV+  T+  L  + KD+  +  L++DV   I HSFV
Sbjct: 233 QDEFINYCQENEIFIWFLFSTKDHWVADKTRTHLSHYYKDKIKQERLKIDVTDKIPHSFV 292

Query: 301 VKDVDLVTRRYF 312
           VK  +     +F
Sbjct: 293 VKHAEYAVNTFF 304

>NCAS0F03530 Chr6 complement(706175..707116) [942 bp, 313 aa] {ON}
           Anc_3.488 YPR147C
          Length = 313

 Score =  247 bits (630), Expect = 5e-80,   Method: Compositional matrix adjust.
 Identities = 135/316 (42%), Positives = 181/316 (57%), Gaps = 7/316 (2%)

Query: 1   MSVQGYHDSALPTCIIHIKPTVTNNDESSPLFVWIPGNPGLLEYYQEFLAKVHDKNPTWE 60
           MSV+ Y D   PTC++HI P  T   E +P+FVWIPGNPG+LEYYQE L  +H+K+PTWE
Sbjct: 1   MSVEAYDDDEFPTCVVHILPIKTA--EINPVFVWIPGNPGILEYYQEMLINLHEKHPTWE 58

Query: 61  ILGISHAGTVIESSQL-KKFRKNPLPIYDLKQQTQHXXXXXXXXXXXXXRELVIMGHSVG 119
           IL ISH G   +++ L K   ++   ++ LK+Q QH               + I GHSVG
Sbjct: 59  ILAISHIGMNTKTTSLFKGSHQDNSRVFTLKEQIQHKIKIINNFVKDSNVPIYISGHSVG 118

Query: 120 AYIAQHVVSSPDLVGRVSKLGLITPTIRDIHKSSHGLIFTRVFNY-ISNVNEYLSFISSN 178
           AY+ Q +V+S +L+G+V K+GLITPTI DIH S  G   TR   +    +   LSF+   
Sbjct: 119 AYMVQKIVASDELIGQVLKMGLITPTIIDIHLSEKGKSMTRYARWSCRQLPHILSFLCYI 178

Query: 179 IFNKLIPAYWTKLLISFAMGCSFDEYHIILGTFLLLTQRETLRQVLGLAAHEMLEIRDDW 238
           +F  L+P      +I + MGC  D     + T L LT    +RQ LGLA  EM  I DDW
Sbjct: 179 VFGWLVPGILRSYIIGYVMGCHHDS-QAAISTELFLTGPNFVRQSLGLAQEEMDTIHDDW 237

Query: 239 AFQENLLTKCKDNGTKLWLLFSDNDHWVSQHTQAELIKFLKDRY--PELLLRVDVDKDIK 296
            FQ  L+  C  N  K+  LFS  DHWV + T+ E+I+F ++R    + LL++DV     
Sbjct: 238 QFQAELIEYCLKNSIKIQFLFSATDHWVREATRKEIIQFYQERCKGAKALLKIDVSDQFP 297

Query: 297 HSFVVKDVDLVTRRYF 312
           HSFVV+    V   YF
Sbjct: 298 HSFVVRRSKYVVEHYF 313

>TPHA0D04220 Chr4 complement(912211..913161) [951 bp, 316 aa] {ON}
           Anc_3.488 YPR147C
          Length = 316

 Score =  240 bits (612), Expect = 3e-77,   Method: Compositional matrix adjust.
 Identities = 131/321 (40%), Positives = 181/321 (56%), Gaps = 14/321 (4%)

Query: 1   MSVQGYHDSALPTCIIHIKPT---------VTNNDESSPLFVWIPGNPGLLEYYQEFLAK 51
           M++  + DS  PT I+ IK T         +T  D+ SPLFVWIPGNPGLLEYY+EFL  
Sbjct: 1   MTITVFKDSKFPTSILSIKGTYVADELSVDLTKTDKLSPLFVWIPGNPGLLEYYEEFLKL 60

Query: 52  VHDKNPTWEILGISHAGTVIESSQLKKFRKNPLPIYDLKQQTQHXXXXXXXXXXXXXREL 111
           +H KNP W+ILGISHAG    +S LK   +N   +Y L +Q  H             REL
Sbjct: 61  LHVKNPEWDILGISHAGMSSGNSNLK---ENECSVYTLDEQIHH-KIEIINKFAAYGREL 116

Query: 112 VIMGHSVGAYIAQHVVSSPDLVGRVSKLGLITPTIRDIHKSSHGLIFTRVFNYISNVNEY 171
           ++MGHSVGA++AQ VV S  L G+V K+GL+ PT+ DIH S  G   + + N+I N+ + 
Sbjct: 117 IVMGHSVGAFMAQKVVMSNKLEGKVKKIGLLMPTVIDIHLSEKGTQISTILNWIPNLPQL 176

Query: 172 LSFISSNIFNKLIPAYWTKLLISFAMGCSFDEYHIILGTFLLLTQRETLRQVLGLAAHEM 231
             ++S  IF   +P    K +ISF M  + +E      T+  L     + Q LGLA +EM
Sbjct: 177 AGWVSEKIFGGFLPITLVKFIISFFMELN-NENKAAHATYTFLKDSNFVEQSLGLAKYEM 235

Query: 232 LEIRDDWAFQENLLTKCKDNGTKLWLLFSDNDHWVSQHTQAELIKFLKDRYPELLLRVDV 291
             IR DW FQ  L+  C  N  +LW LF+++DHWVS  T++ELI+  ++          +
Sbjct: 236 QIIRHDWEFQRELVKMCNVNQIELWTLFAESDHWVSNQTRSELIELYRNSVNSDYYSYSI 295

Query: 292 DKDIKHSFVVKDVDLVTRRYF 312
              + H+FV+K+   V   YF
Sbjct: 296 TDQVPHAFVIKNSCHVVDNYF 316

>Kwal_55.21219 s55 complement(734903..735811) [909 bp, 302 aa] {ON}
           YPR147C - Hypothetical ORF [contig 131] FULL
          Length = 302

 Score =  232 bits (592), Expect = 1e-74,   Method: Compositional matrix adjust.
 Identities = 125/313 (39%), Positives = 188/313 (60%), Gaps = 15/313 (4%)

Query: 2   SVQGYHDSALPTCIIHIKPTVTNNDESSPLFVWIPGNPGLLEYYQEFLAKVHDKNPTWEI 61
           S+Q   D  LP  + H    + ++   +PLFV+IPGNPGL+E+Y+ FLA++H+KNP WEI
Sbjct: 3   SIQNCVD-PLPCSLYHRNAGLNSSGGEAPLFVFIPGNPGLIEFYEPFLAQIHEKNPAWEI 61

Query: 62  LGISHAGTVIESSQLKKFRKNPLPIYDLKQQTQHXXXXXXXXXXXXXRELVIMGHSVGAY 121
           LGISHAG    S ++        P+Y L+QQ  H             + ++IMGHSVGA+
Sbjct: 62  LGISHAGMNSCSEEVS-------PVYSLEQQIDHKIEIINRYCLDG-KPIIIMGHSVGAF 113

Query: 122 IAQHVVSSPDLVGRVSKLGLITPTIRDIHKSSHGLIFTRVFNYISNVNEYLSFISSNIFN 181
           + Q + +S  L  +V ++GL+TPT+ DIHKS  G+  T +  +  + +  +S ++  +F 
Sbjct: 114 MVQKITTSRRLKSKVIRVGLLTPTVIDIHKSEKGVKLTSITRWCPSFHNVVSTLNWALFE 173

Query: 182 KLIPAYWTKLLISFAMGCSFDEYHIILG--TFLLLTQRETLRQVLGLAAHEMLEIRDDWA 239
           KL+P   TK +IS  +    D+    LG  T LL+T    ++Q LGLAA E+  IR DWA
Sbjct: 174 KLLPTKITKSIISLLV----DDPQSCLGATTELLVTNSRFVKQALGLAAEEVRVIRSDWA 229

Query: 240 FQENLLTKCKDNGTKLWLLFSDNDHWVSQHTQAELIKFLKDRYPELLLRVDVDKDIKHSF 299
           +Q+  L  C++N TK+W LFS+ DHWVS  T+ ++I F +      L ++DV   I+H+F
Sbjct: 230 YQKEFLLLCQENDTKIWWLFSEKDHWVSPTTRNDIIDFYRQHSSPALSQIDVSSTIEHAF 289

Query: 300 VVKDVDLVTRRYF 312
           V +  DLV ++YF
Sbjct: 290 VRRHADLVIKQYF 302

>KLTH0F14740g Chr6 complement(1208120..1209028) [909 bp, 302 aa]
           {ON} similar to uniprot|Q06522 Saccharomyces cerevisiae
           YPR147C Hypothetical ORF
          Length = 302

 Score =  230 bits (587), Expect = 9e-74,   Method: Compositional matrix adjust.
 Identities = 129/315 (40%), Positives = 181/315 (57%), Gaps = 16/315 (5%)

Query: 1   MSVQGYHDSALPTCIIHIKPTVTNNDESSPLFVWIPGNPGLLEYYQEFLAKVHDKNPTWE 60
           M ++       P+ I+H+K  V++    + LFV+IPGNPGL+EYY  FL +VH+KNP WE
Sbjct: 1   MKIEASFVGGEPSSILHLKSGVSSLGSDACLFVFIPGNPGLIEYYVPFLQQVHEKNPDWE 60

Query: 61  ILGISHAGTVIESSQLKKFRKNPLPIYDLKQQTQHXXXXXXXXXXXXXRELVIMGHSVGA 120
           ILGISHAG       +        P+Y L++Q  H             +++ IMGHSVGA
Sbjct: 61  ILGISHAG-------MNSCNDIACPVYTLQEQINHKVDVINSYAQGN-KKITIMGHSVGA 112

Query: 121 YIAQHVVSSPDLVGRVSKLGLITPTIRDIHKSSHGLIFTRVFNYISNVNEYLSFISSNIF 180
           +IAQ VV+S  L   V+++GL+TPT+ DIHKS  GL  T +       ++ +S +    F
Sbjct: 113 FIAQKVVTSGLLNDEVARVGLLTPTVIDIHKSEKGLKLTAITERFPRFHQLVSALDWIAF 172

Query: 181 NKLIPAYWTKLLIS-FAMGCSFDEYHIILG--TFLLLTQRETLRQVLGLAAHEMLEIRDD 237
            KL P + T  +IS FA     D+    LG  T LLLT    ++Q LGLA  EM  IR D
Sbjct: 173 EKLFPDFLTSWIISHFA-----DDPKTCLGAATRLLLTNSRFVKQALGLATEEMQVIRSD 227

Query: 238 WAFQENLLTKCKDNGTKLWLLFSDNDHWVSQHTQAELIKFLKDRYPELLLRVDVDKDIKH 297
           W +Q++ L  C+  G K+W LFSDNDHWVS  T+ +LI+F +      L+ +DV   I+H
Sbjct: 228 WEYQKDFLHYCETKGAKIWWLFSDNDHWVSSETRKDLIQFYERHSSPELVSIDVSTAIEH 287

Query: 298 SFVVKDVDLVTRRYF 312
           +FV +   +V + YF
Sbjct: 288 AFVRRHAQVVVQHYF 302

>ZYRO0D10076g Chr4 (850134..851051) [918 bp, 305 aa] {ON} similar to
           uniprot|Q06522 Saccharomyces cerevisiae YPR147C
           Hypothetical ORF
          Length = 305

 Score =  228 bits (582), Expect = 5e-73,   Method: Compositional matrix adjust.
 Identities = 132/313 (42%), Positives = 184/313 (58%), Gaps = 9/313 (2%)

Query: 1   MSVQGYHDSALPTCIIHIKPTVTNNDESSPLFVWIPGNPGLLEYYQEFLAKVHDKNPTWE 60
           MS++    + LPT ++HI     +   SSPLFVWIPGNPG+++YY+EFL  +H+K  ++E
Sbjct: 1   MSIRYLAGARLPTSVLHI--KPKSPSPSSPLFVWIPGNPGIVQYYEEFLNLLHEKYDSFE 58

Query: 61  ILGISHAGTVIESSQLKKFRKNPLPIYDLKQQTQHXXXXXXXXXXXXXRELVIMGHSVGA 120
           IL ISHAG   E   L+K +     IY L  Q QH             R L++MGHSVGA
Sbjct: 59  ILAISHAGMATEDPDLQKRKAT---IYTLDDQIQHKVEIINQFSAKD-RPLIVMGHSVGA 114

Query: 121 YIAQHVVSSPDLVGRVSKLGLITPTIRDIHKSSHGLIFTRVFNYISNVNEYLSFISSNIF 180
           Y+AQHVV +  L+GRV KLGLITPT+ DIH+S  G   TR F ++  + +  +++S  +F
Sbjct: 115 YMAQHVVLAEKLLGRVVKLGLITPTVVDIHRSQKGTQLTRAFYWVKYLPDIAAWVSDMLF 174

Query: 181 NKLIPAYWTKLLISFAMGCSFDEYHIILGTFLLLTQR-ETLRQVLGLAAHEMLEIRDDWA 239
           NKL    +T  +IS  MG   D+  + + T   L Q  E +RQ LGLAA EM +IR  W 
Sbjct: 175 NKLSSIMFTDQVISLFMGV--DKESVPVATSKSLVQNPEIIRQALGLAALEMQQIRGCWP 232

Query: 240 FQENLLTKCKDNGTKLWLLFSDNDHWVSQHTQAELIKFLKDRYPELLLRVDVDKDIKHSF 299
           FQ+ L+  C  N  +   +FS ND WVS  T+  L+ F ++ Y +  L + V +D+ HSF
Sbjct: 233 FQKKLIDHCNSNEIETKFVFSANDPWVSNATREALMVFYRENYRDRNLEISVSQDLAHSF 292

Query: 300 VVKDVDLVTRRYF 312
           +VK    +   YF
Sbjct: 293 IVKHSKYIVDEYF 305

>SAKL0F02860g Chr6 (242683..243600) [918 bp, 305 aa] {ON} similar to
           uniprot|Q06522 Saccharomyces cerevisiae YPR147C
           Hypothetical ORF
          Length = 305

 Score =  217 bits (552), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 118/311 (37%), Positives = 173/311 (55%), Gaps = 7/311 (2%)

Query: 1   MSVQGYHDSALPTCIIHIKPTVTNNDESSPLFVWIPGNPGLLEYYQEFLAKVHDKNPTWE 60
           M +Q Y  +   + + H+KP     +  +PLFV+IPGNPGL+E+Y+ FL ++  K+  WE
Sbjct: 1   MHIQPYSKNGFFSSLYHLKPLNQEVNSQTPLFVFIPGNPGLIEFYKSFLDQIQKKHGNWE 60

Query: 61  ILGISHAGTVIESSQLKKFRKNPLPIYDLKQQTQHXXXXXXXXXXXXXRELVIMGHSVGA 120
           ILGISHAG + +   LKK    P  +Y LK Q QH             R L+I GHS+GA
Sbjct: 61  ILGISHAGMITKCKGLKK----PTKVYSLKDQVQHKIYVINDFCSSN-RPLIIAGHSIGA 115

Query: 121 YIAQHVVSSPDLVGRVSKLGLITPTIRDIHKSSHGLIFTRVFNYISNVNEYLSFISSNIF 180
           YI Q +     L+G V K+ L+TPT+ DIH S  G     +  +  N + Y++  S  +F
Sbjct: 116 YIVQKIALDVSLMGTVKKIMLLTPTVIDIHLSEKGRKLNWINEWCPNFHSYVATASWLVF 175

Query: 181 NKLIPAYWTKLLISFAMGCSFDEYHIILGTFLLLTQRETLRQVLGLAAHEMLEIRDDWAF 240
            K++P   T+ ++S  +G   ++  +     LL+T  E ++Q LGLA  EM ++RDDW F
Sbjct: 176 EKMLPQTITEKILSLFVGS--EQTCVREAAKLLVTNYEFVQQSLGLAREEMQKVRDDWNF 233

Query: 241 QENLLTKCKDNGTKLWLLFSDNDHWVSQHTQAELIKFLKDRYPELLLRVDVDKDIKHSFV 300
           Q + L  CK    +L  LF+  DHWV+  T+ +L +F    Y +  L +D D+ I HSFV
Sbjct: 234 QLSFLQFCKSQEVELQFLFAFKDHWVNSQTRFDLAEFYNSNYYKDFLTIDEDEKISHSFV 293

Query: 301 VKDVDLVTRRY 311
           + D   V  RY
Sbjct: 294 LNDTKSVVDRY 304

>NDAI0B05830 Chr2 complement(1415309..1416298) [990 bp, 329 aa] {ON}
           Anc_3.488 YPR147C
          Length = 329

 Score =  215 bits (548), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 129/334 (38%), Positives = 185/334 (55%), Gaps = 27/334 (8%)

Query: 1   MSVQGYHDSALPTCIIHIKPT--VTNNDESSPLFVWIPGNPGLLEYYQEFLAKVHDKNPT 58
           M V+ Y +S  PT IIHI+    + N+   +PLF+WIPGNPG+L+YYQ+FL  +H K+P 
Sbjct: 1   MLVKSYSESKYPTSIIHIEAEKLIENDPSLNPLFIWIPGNPGILQYYQQFLCSLHKKHPH 60

Query: 59  WEILGISHAGTVIESSQLKKFRKNPLPIYDLKQQTQHXXXXXXXXXXXX--------XRE 110
           WEIL I HAG     + L  +R     IY L +Q +H                     R 
Sbjct: 61  WEILAIPHAGM---DTSLPVYRHPNDRIYHLNEQIEHKIEVITTFLTKANSSDGIMKKRP 117

Query: 111 LVIMGHSVGAYIAQHVVSSPDLVGRV-------SKLGLITPTIRDIHKSSHGLIFTRVFN 163
           LVIMGHSVG Y+ Q +V + +    +        K+G ITPTI DI+ SS G++ +    
Sbjct: 118 LVIMGHSVGTYMIQRMVLTKEFQDTILHNSFYLKKIGFITPTIIDINLSSKGILISHGLQ 177

Query: 164 YISNVNEY-LSFISSNIFNKLIPAYWTKL---LISFAMGCSFDEYHIILGTFLLLTQRET 219
                  Y LS++S  +F+ LI  Y+  +   LI++ MGC   ++  I GT +LLT    
Sbjct: 178 LTHGYLPYILSYLSYFVFS-LILKYFDNIRRRLIAYIMGCQMTDFAAI-GTEILLTNSVL 235

Query: 220 LRQVLGLAAHEMLEIRDDWAFQENLLTKCKDNGTKLWLLFSDNDHWVSQHTQAELIKFLK 279
           ++Q LGLA+ EM EIR +W  Q+  +  C  N  +LWLLF + DHWV+  T+ +LIKF +
Sbjct: 236 VKQSLGLASIEMQEIRKNWDVQKQFVENCNHNDIQLWLLFCETDHWVNNVTRTDLIKFYQ 295

Query: 280 DRYPEL-LLRVDVDKDIKHSFVVKDVDLVTRRYF 312
             Y ++  L+++V  +  HSFVV   D V  R+F
Sbjct: 296 SNYKDISRLQIEVSSEFPHSFVVNHSDWVVERFF 329

>AFR306C Chr6 complement(996001..996960) [960 bp, 319 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPR147C
          Length = 319

 Score =  200 bits (509), Expect = 7e-62,   Method: Compositional matrix adjust.
 Identities = 110/288 (38%), Positives = 164/288 (56%), Gaps = 15/288 (5%)

Query: 31  LFVWIPGNPGLLEYYQEFLAKVHDKNPTWEILGISHAGTVIESS--QLKKFRKNPLPIYD 88
           + +++PGNPGL+ +Y+EFL  +H+KNPTWEI+GISH G   ++    LK+       +Y 
Sbjct: 41  ILIFLPGNPGLINFYREFLRSIHEKNPTWEIVGISHTGMSAKTGPEDLKR-------VYT 93

Query: 89  LKQQTQHXXXXXXXXXXXXXRELV-IMGHSVGAYIAQHVVSSPDLVGRVSKLGLITPTIR 147
           L +Q +H                V ++GHS+GAY+AQ VV  P L   V  +GL+TPTI 
Sbjct: 94  LVEQVEHKVKAINDFVENRGNLAVKLVGHSIGAYMAQKVVVHPALRVNVEMVGLLTPTII 153

Query: 148 DIHKSSHGLIFTRVFNYISNVNEYLSFISSNIFNKLIPAYWTKLLISFAMGCSFDEYHII 207
           DIH+S  G+  TR+  +     EY+S +   +   L+PA W   L    +G S DE  ++
Sbjct: 154 DIHRSPKGVQLTRISEWFPRFYEYVSIVDRVLLEWLLPATWISWLARKIIGGS-DEC-VL 211

Query: 208 LGTFLLLTQRETLRQVLGLAAHEMLEIRDDWAFQENLLTKCKDNGTKLWLLFSDNDHWVS 267
                L+     +RQ LG+A  EM ++R+ W FQE  +  C++  + LWLLFS +DHWV 
Sbjct: 212 QSAEKLVKNPSYVRQALGMAQLEMHQVRNQWDFQEEFIKTCQERRSSLWLLFSGHDHWVH 271

Query: 268 QHTQAELIKFLKDRY---PELLLRVDVDKDIKHSFVVKDVDLVTRRYF 312
             T  ++++F + +Y    + LLR+ +D+ I HSFVVKD   V   YF
Sbjct: 272 SDTMKDIVEFYEAKYGTNADSLLRITIDEHISHSFVVKDTTKVVNIYF 319

>Ecym_1241 Chr1 (494505..495422) [918 bp, 305 aa] {ON} similar to
           Ashbya gossypii AFR306C
          Length = 305

 Score =  179 bits (454), Expect = 8e-54,   Method: Compositional matrix adjust.
 Identities = 99/288 (34%), Positives = 160/288 (55%), Gaps = 10/288 (3%)

Query: 29  SPLFVWIPGNPGLLEYYQEFLAKVHDKNPTWEILGISHAGTVIESSQLKKFRKNPLPIYD 88
            PL ++IPGNPGL+ +Y+EFL  +H++NPTWE++GI H G     S L++       ++ 
Sbjct: 24  GPLLLFIPGNPGLINFYEEFLKCIHERNPTWEVVGIGHTGM----SSLRENNSLSGRVHT 79

Query: 89  LKQQTQHXXXXXXX-XXXXXXRELVIMGHSVGAYIAQHVVSSPDLVGRVSKLGLITPTIR 147
           L +Q +               R + ++GHS+GAY+ Q +     L G++  + L+TPTI 
Sbjct: 80  LDEQIEDKVKVINEFVDAGGDRCIKLIGHSIGAYMVQKIALHKGLRGKIDMVMLLTPTII 139

Query: 148 DIHKSSHGLIFTRVFNYISNVNEYLSFISSNIFNKLIPAYWTKLLISFAMGCSFDEYHII 207
           DIH+SS G+  TR+ ++     EY   +   +F  ++P  W + +    +G S DE  ++
Sbjct: 140 DIHRSSKGVQLTRISDWFPKFYEYAYVVDRVLFKWILPTSWIEWIARKLIGGS-DEC-VL 197

Query: 208 LGTFLLLTQRETLRQVLGLAAHEMLEIRDDWAFQENLLTKCKDNGTKLWLLFSDNDHWVS 267
                L++  E ++Q LGLA  EM ++R+ W FQ+  ++ C+ N  K+  LFS +DHWV 
Sbjct: 198 QSAQKLVSTPEFVKQALGLAQIEMYQVRNQWDFQDEFISFCQANKIKVRFLFSGHDHWVH 257

Query: 268 QHTQAELIKFLKDRYP---ELLLRVDVDKDIKHSFVVKDVDLVTRRYF 312
             T  ++I+  + +Y    + LL + +D  I HSFVVKD   V   YF
Sbjct: 258 PDTMKDIIELYEAKYSSDEKDLLNITIDGHINHSFVVKDTTKVVNIYF 305

>TDEL0G04830 Chr7 complement(891989..893620) [1632 bp, 543 aa] {ON} 
          Length = 543

 Score = 38.5 bits (88), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 41/128 (32%), Positives = 59/128 (46%), Gaps = 24/128 (18%)

Query: 136 VSKLGLITPTIRD---IHKSSHGLIFTRVFNYISNVNEYLSFI-SSNIFNKLIPAYWTKL 191
           V+K+  I+PTIR     H  SH   F  V   I        F+ SS  FN +I A  + L
Sbjct: 399 VAKIASISPTIRIPVYAHLLSH--FFVAVIGCI--------FMGSSTAFNAIITACISIL 448

Query: 192 LISFAMGCSFDEYHIILGTFLLLTQRETLRQVLGLAAHEMLEIRDDWAFQENLLTKCKDN 251
           L+S+A+ C    +  ++G         + +Q LGL +H++ E R  W    N+LT C   
Sbjct: 449 LLSYAVPCIIMVF--VVGKKNFYRNIASEQQALGL-SHQVEESRASWYLVPNILTIC--- 502

Query: 252 GTKLWLLF 259
               W LF
Sbjct: 503 ----WALF 506

>Ecym_3254 Chr3 (484386..486407) [2022 bp, 673 aa] {ON} similar to
           Ashbya gossypii AER070C
          Length = 673

 Score = 34.7 bits (78), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 22/77 (28%), Positives = 35/77 (45%), Gaps = 3/77 (3%)

Query: 164 YISNVNEYLSFISSNIFN---KLIPAYWTKLLISFAMGCSFDEYHIILGTFLLLTQRETL 220
           YI +V EYLS  +  I     K+ P + +         C F   H  +   +L+ + +  
Sbjct: 134 YIHDVREYLSLKAEEIVCEQFKVCPVFESLGYCPMGFKCRFLSTHCDMDALVLVEKPDEE 193

Query: 221 RQVLGLAAHEMLEIRDD 237
           R+VL  A HE+ +I  D
Sbjct: 194 RKVLWDANHEINQIAGD 210

>TBLA0A05350 Chr1 (1311836..1312903) [1068 bp, 355 aa] {ON} Anc_1.72
           YCR044C
          Length = 355

 Score = 32.7 bits (73), Expect = 0.97,   Method: Compositional matrix adjust.
 Identities = 25/88 (28%), Positives = 44/88 (50%), Gaps = 6/88 (6%)

Query: 163 NYIS-NVNEYLSFISSNIFNKLIPAYWTKLLISFAMGCSFDEYHIILGTFLLLTQRETLR 221
           NYI+  +   L++ISS+IF+     +  KL   FA G     +H I+G    L  + T+R
Sbjct: 157 NYIAVAIAGMLAWISSSIFHFRDLLFTEKLDYFFAGGTVLMGFHAIIGRMFRLDHKPTIR 216

Query: 222 Q-----VLGLAAHEMLEIRDDWAFQENL 244
           +     V+ +    +L +  DW++  N+
Sbjct: 217 KTFSIFVITIFCAHLLRLYLDWSYTYNM 244

>Ecym_8323 Chr8 complement(657183..659753) [2571 bp, 856 aa] {ON}
           similar to Ashbya gossypii ACR103C
          Length = 856

 Score = 32.3 bits (72), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 21/77 (27%), Positives = 43/77 (55%), Gaps = 8/77 (10%)

Query: 214 LTQRETLRQVLGLAAHEMLEIRDDWAFQENLLTKCKD---NGTKLWLLFSD-NDHWVSQH 269
           L Q +++R++    AH++   + DW ++E +L   K    + ++  L+F+  ND  V+ +
Sbjct: 257 LYQPDSVRRITSDGAHDIYNGKPDWVYEEEVLASHKAVWWSPSESVLVFAKFNDSTVANY 316

Query: 270 TQAELIKFLKDR-YPEL 285
           T   ++KF+ D  YP +
Sbjct: 317 T---MLKFISDEHYPNI 330

>Skud_2.331 Chr2 complement(599967..601097) [1131 bp, 376 aa] {ON}
           YBR204C (REAL)
          Length = 376

 Score = 32.0 bits (71), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 28/131 (21%), Positives = 56/131 (42%), Gaps = 7/131 (5%)

Query: 31  LFVWIPGNPGLLEYYQEFLAKVHDKNPTW---EILGISHAGTVIESSQLKKFRKNPLPIY 87
           +F+++PG  G LE ++  L  +      +   ++ G  H+    +   LK      + + 
Sbjct: 89  VFLFVPGLAGNLEQFEPLLKLIDSDQKAFLALDLPGFGHSSEWADYPMLKVVELIFVLVC 148

Query: 88  DLKQQTQHXXXXXXXXXXXXXRELVIMGHSVGAYIAQHVVSSP-DLVGRVSKLGLITPT- 145
           D+ ++                R++V+ GHS+G ++A H+       +  V K+ L+TP  
Sbjct: 149 DVLKKWPAAVPKDREVNPFDNRKIVLTGHSMGCFLACHLYEQHLAALKVVEKMVLLTPPK 208

Query: 146 --IRDIHKSSH 154
             I  + K  H
Sbjct: 209 AHIEQLSKDRH 219

>NCAS0B02260 Chr2 complement(374788..375879) [1092 bp, 363 aa] {ON}
           Anc_8.524 YBR204C
          Length = 363

 Score = 32.0 bits (71), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 27/121 (22%), Positives = 49/121 (40%), Gaps = 8/121 (6%)

Query: 26  DESSPLFVWIPGNPGLLEYYQEFLAKVHDKNPTWEILGISHAGTV--IESSQLKKFRKNP 83
           ++  PL ++I G  G L  ++  L   H K   +  L +   G    +ES  +K   +  
Sbjct: 78  NDGHPLHLFIHGLGGSLGQFEPLLRLTHLKGKKFLTLDLPGFGQSDELESYSMKSVIETI 137

Query: 84  LPIYDLKQQTQHXXXXXXXXXXXXXRELVIMGHSVGAYIAQHVVSSPDLVGRVSKLGLIT 143
             + DL    Q               +L++ GHS+G Y+  H   +      + K+ L++
Sbjct: 138 RSVVDLATGNQKSLGENTQL------KLILTGHSMGCYLCLHFFETYSKNYDIRKIALLS 191

Query: 144 P 144
           P
Sbjct: 192 P 192

>Smik_2.345 Chr2 complement(618817..619944) [1128 bp, 375 aa] {ON}
           YBR204C (REAL)
          Length = 375

 Score = 32.0 bits (71), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 34/142 (23%), Positives = 60/142 (42%), Gaps = 7/142 (4%)

Query: 28  SSPLFVWIPGNPGLLEYYQEFLAKVHDKNPTWEILGISHAGTVIESSQ---LKKFRKNPL 84
           S  +FV++PG  G LE ++  L  V      +  L +   G   E S    LK      +
Sbjct: 85  SDTVFVFVPGLAGNLEQFEPLLKLVDSDRKAFLALDLPGFGDSSEWSDYPMLKVVELIFI 144

Query: 85  PIYDLKQQTQHXXXXXXXXXXXXXRELVIMGHSVGAYIAQHVVSSPDLVGRVSK-LGLIT 143
            + D+ +                  +LV++GHS+G ++A H+     +  +V K L L+T
Sbjct: 145 LLCDVLKGRPAVLSKDDNLNFFNGHKLVLVGHSMGCFLACHLYEQHLVDAKVVKTLVLLT 204

Query: 144 PTIRDIHKSSHGLIFTRVFNYI 165
           P    I + S      R++ ++
Sbjct: 205 PPKAHIEQLSKD---KRIYQWV 223

>Kpol_274.3 s274 (2546..4291) [1746 bp, 581 aa] {ON} (2546..4291)
           [1746 nt, 582 aa]
          Length = 581

 Score = 32.0 bits (71), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 17/78 (21%), Positives = 40/78 (51%), Gaps = 5/78 (6%)

Query: 160 RVFNY-ISNVNEYLSFISSNIFNKLIPAYWTKLLISFAMGCSFDEYHIILGTFLLLTQRE 218
           ++F Y I N+ +Y S+   ++FN    +Y T L   ++M    DE  I++    +  + +
Sbjct: 380 QIFGYNIQNIEQYDSYYEKDVFN----SYKTSLFTKYSMAADEDENKILIPKTEVQEKLK 435

Query: 219 TLRQVLGLAAHEMLEIRD 236
            +++ L L +  + + ++
Sbjct: 436 NIKEGLNLYSKNIFKTKN 453

>SAKL0F06402g Chr6 (487543..489708) [2166 bp, 721 aa] {ON} similar
          to uniprot|P53038 Saccharomyces cerevisiae YGR099W TEL2
          Essential DNA-binding protein specific to
          single-stranded yeast telomeric DNA repeats required
          for telomere length regulation and telomere position
          effect
          Length = 721

 Score = 31.6 bits (70), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 16/50 (32%), Positives = 30/50 (60%), Gaps = 2/50 (4%)

Query: 34 WIPGNPGLLEYYQEFLAKVHDKNPTWEILGISHAGTVIESSQLKKFRKNP 83
          +IPG+ G LE ++E L  +H+   TW +  I++    I ++ L+  ++NP
Sbjct: 15 FIPGH-GNLELFEEVLFHIHEFKKTWSVNSINYTMGKI-TANLEALKRNP 62

>TDEL0B03250 Chr2 complement(575015..576061) [1047 bp, 348 aa] {ON}
           Anc_8.524 YBR204C
          Length = 348

 Score = 30.8 bits (68), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 33/159 (20%), Positives = 63/159 (39%), Gaps = 18/159 (11%)

Query: 3   VQGYHDSALPTCIIHIKPTVTNNDESSPLFVWIPGNPGLLEYYQEFLAKVHDKNPTWEIL 62
           + G H S++ TC       +  +     LF++I G  G LE ++  L ++  +N ++   
Sbjct: 57  LHGTHTSSIRTC-----HNLRQSKGGGELFLFIHGLGGTLEQFEPVLRELDQRNKSFLAF 111

Query: 63  GISHAGTVIESSQLKKFRKNPLPIYDLKQQTQHXXXXXXXXXXXXXRELVIMGHSVGAYI 122
            +   G   E  Q         P+ D+ +                  +L ++GHS+G Y+
Sbjct: 112 DLPGFGKSDEWDQY--------PMLDVVKSID--WLIHQLTNNLKFEKLNLIGHSMGCYL 161

Query: 123 AQH---VVSSPDLVGRVSKLGLITPTIRDIHKSSHGLIF 158
           A H   +      + R+  L    P +  + KS + + F
Sbjct: 162 AVHFYLLFHESWCISRLVLLAPPKPNVDQLSKSKYLIQF 200

>SAKL0H10450g Chr8 complement(897598..898776) [1179 bp, 392 aa] {ON}
           similar to uniprot|P38139 Saccharomyces cerevisiae
           YBR204C Hypothetical ORF
          Length = 392

 Score = 30.4 bits (67), Expect = 6.2,   Method: Compositional matrix adjust.
 Identities = 15/41 (36%), Positives = 23/41 (56%)

Query: 109 RELVIMGHSVGAYIAQHVVSSPDLVGRVSKLGLITPTIRDI 149
           R LV++GHS+G Y+A H  S+        +L L+ P   D+
Sbjct: 196 RNLVLIGHSMGCYLAIHFCSAFQEQYSFQELVLLAPPSLDL 236

>KAFR0E03120 Chr5 (623464..624504) [1041 bp, 346 aa] {ON} Anc_8.524
           YBR204C
          Length = 346

 Score = 30.4 bits (67), Expect = 6.3,   Method: Compositional matrix adjust.
 Identities = 16/39 (41%), Positives = 23/39 (58%)

Query: 110 ELVIMGHSVGAYIAQHVVSSPDLVGRVSKLGLITPTIRD 148
           +L I+GHS+G YI+ H     +    V KL L+TP + D
Sbjct: 152 KLNIVGHSLGTYISIHFYHLFNYKYNVEKLILLTPPMSD 190

>YBR204C Chr2 complement(632254..633381) [1128 bp, 375 aa] {ON}
           LDH1Serine hydrolase; exhibits active esterase plus weak
           triacylglycerol lipase activities; proposed role in
           lipid homeostasis, regulating phospholipid and non-polar
           lipid levels and required for mobilization of LD-stored
           lipids; localizes to the lipid droplet (LD) surface;
           contains a classical serine containing catalytic triad
           (GxSxG motif)
          Length = 375

 Score = 30.0 bits (66), Expect = 7.2,   Method: Compositional matrix adjust.
 Identities = 30/131 (22%), Positives = 55/131 (41%), Gaps = 7/131 (5%)

Query: 31  LFVWIPGNPGLLEYYQEFLAKVHDKNP---TWEILGISHAGTVIESSQLKKFRKNPLPIY 87
           +FV++PG  G LE ++  L  V        T ++ G  H+    +   LK      + + 
Sbjct: 88  VFVFVPGLAGNLEQFEPLLELVDSDQKAFLTLDLPGFGHSSEWSDYPMLKVVELIFVLVC 147

Query: 88  DLKQQTQHXXXXXXXXXXXXXRELVIMGHSVGAYIAQHVVSSPDLVGR-VSKLGLITPT- 145
           D+ ++                 ++V++GHS+G ++A H+        + V  L L+TP  
Sbjct: 148 DVLRKWSTAVPNNDNVNPFNGHKIVLVGHSMGCFLACHLYEQHMADTKAVQTLVLLTPPK 207

Query: 146 --IRDIHKSSH 154
             I  + K  H
Sbjct: 208 AHIEQLSKDKH 218

>SAKL0D06886g Chr4 complement(571478..572821) [1344 bp, 447 aa] {ON}
           highly similar to uniprot|P47039 Saccharomyces
           cerevisiae YJL060W BNA3 Arylformamidase involved in
           biosynthesis of nicotinic acid from tryptophan via
           kynurenine pathway potential Cdc28p substrate
          Length = 447

 Score = 30.0 bits (66), Expect = 7.4,   Method: Compositional matrix adjust.
 Identities = 25/74 (33%), Positives = 35/74 (47%), Gaps = 5/74 (6%)

Query: 232 LEIRDDWAFQENLLTKCKDNGTKLWLLFSDNDHWVSQHTQAELIKFLKDRYPELLLRVDV 291
           ++I +D+ F E LL+K KD     WL+   N+  V      E      +   E LLR  V
Sbjct: 370 VKIPEDYPFPEELLSKAKDFRISYWLI---NELGVVAIPPTEFYIQEHESAAENLLRFAV 426

Query: 292 DKDIKHSFVVKDVD 305
            KD   S++ K VD
Sbjct: 427 CKD--DSYLEKAVD 438

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.323    0.139    0.424 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 33,720,132
Number of extensions: 1446077
Number of successful extensions: 4046
Number of sequences better than 10.0: 36
Number of HSP's gapped: 4113
Number of HSP's successfully gapped: 36
Length of query: 312
Length of database: 53,481,399
Length adjustment: 109
Effective length of query: 203
Effective length of database: 40,982,805
Effective search space: 8319509415
Effective search space used: 8319509415
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.5 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 65 (29.6 bits)