Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
CAGL0L08492g3.491ON38538519240.0
Skud_16.4433.491ON4204387371e-93
SAKL0F02794g3.491ON3974037151e-90
Smik_16.4013.491ON4274107074e-89
Suva_16.4773.491ON4234146971e-87
Kwal_55.212273.491ON3763706887e-87
KLTH0F14806g3.491ON3584006859e-87
YPR148C3.491ON4354146911e-86
ZYRO0D10010g3.491ON3823696635e-83
AFR309C3.491ON3643736363e-79
TDEL0D055903.491ON3443936171e-76
Kpol_1017.73.491ON3783896182e-76
KLLA0E04621g3.491ON3894346132e-75
KAFR0G036803.491ON4154316046e-74
Ecym_12383.491ON3933725828e-71
TPHA0D032703.491ON3883875783e-70
TBLA0D029803.491ON4434135701e-68
KNAG0A079303.491ON4524694882e-56
NDAI0B058503.491ON4732914605e-52
NCAS0F035403.491ON4442684472e-50
TDEL0H022407.221ON3382402002e-16
KLLA0E04511g7.221ON3022441982e-16
KLTH0A03894g7.221ON3232371957e-16
NDAI0A026607.221ON3642431958e-16
ZYRO0D16522g7.221ON3582381941e-15
CAGL0L00891g7.221ON3412381861e-14
SAKL0F08162g7.221ON3302371842e-14
Kwal_47.181487.221ON3233731832e-14
Ecym_43777.221ON3332151815e-14
Kpol_1070.197.221ON3112661734e-13
ADL115W7.221ON3332461727e-13
KAFR0I019507.221ON3302391719e-13
KNAG0D017607.221ON3422041701e-12
TBLA0B015807.221ON3862191673e-12
NCAS0A133807.221ON3292441664e-12
Skud_9.1287.221ON3292431655e-12
Smik_9.1507.221ON3262431646e-12
YIL041W (GVP36)7.221ON3262431639e-12
TPHA0B027507.221ON3632231622e-11
Suva_9.1597.221ON3252431574e-11
TBLA0D042007.221ON3312351522e-10
TPHA0C012307.221ON3052511512e-10
Kpol_478.227.221ON350621292e-07
KAFR0L011207.275ON55090712.9
Smik_7.1396.233ON1264123696.1
TBLA0G03710singletonON13648656.2
CAGL0J05456g2.214ON37163678.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0L08492g
         (385 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0L08492g Chr12 (931048..932205) [1158 bp, 385 aa] {ON} simil...   745   0.0  
Skud_16.443 Chr16 complement(780561..781823) [1263 bp, 420 aa] {...   288   1e-93
SAKL0F02794g Chr6 (238272..239465) [1194 bp, 397 aa] {ON} simila...   280   1e-90
Smik_16.401 Chr16 complement(698791..700074) [1284 bp, 427 aa] {...   276   4e-89
Suva_16.477 Chr16 complement(823311..824582) [1272 bp, 423 aa] {...   273   1e-87
Kwal_55.21227 s55 complement(739317..740447) [1131 bp, 376 aa] {...   269   7e-87
KLTH0F14806g Chr6 complement(1212362..1213438) [1077 bp, 358 aa]...   268   9e-87
YPR148C Chr16 complement(826833..828140) [1308 bp, 435 aa] {ON} ...   270   1e-86
ZYRO0D10010g Chr4 (845993..847141) [1149 bp, 382 aa] {ON} simila...   259   5e-83
AFR309C Chr6 complement(1000078..1001172) [1095 bp, 364 aa] {ON}...   249   3e-79
TDEL0D05590 Chr4 complement(1008107..1009141) [1035 bp, 344 aa] ...   242   1e-76
Kpol_1017.7 s1017 (27496..28272,28322..28330,28419..28769) [1137...   242   2e-76
KLLA0E04621g Chr5 (412009..413178) [1170 bp, 389 aa] {ON} some s...   240   2e-75
KAFR0G03680 Chr7 complement(760604..761851) [1248 bp, 415 aa] {O...   237   6e-74
Ecym_1238 Chr1 (489922..491103) [1182 bp, 393 aa] {ON} similar t...   228   8e-71
TPHA0D03270 Chr4 complement(673063..674229) [1167 bp, 388 aa] {O...   227   3e-70
TBLA0D02980 Chr4 (723788..725119) [1332 bp, 443 aa] {ON} Anc_3.4...   224   1e-68
KNAG0A07930 Chr1 complement(1265981..1267339) [1359 bp, 452 aa] ...   192   2e-56
NDAI0B05850 Chr2 complement(1418191..1419612) [1422 bp, 473 aa] ...   181   5e-52
NCAS0F03540 Chr6 complement(707257..708591) [1335 bp, 444 aa] {O...   176   2e-50
TDEL0H02240 Chr8 (377524..378540) [1017 bp, 338 aa] {ON} Anc_7.2...    82   2e-16
KLLA0E04511g Chr5 complement(406764..407672) [909 bp, 302 aa] {O...    81   2e-16
KLTH0A03894g Chr1 complement(328648..329619) [972 bp, 323 aa] {O...    80   7e-16
NDAI0A02660 Chr1 (599113..600207) [1095 bp, 364 aa] {ON} Anc_7.221     80   8e-16
ZYRO0D16522g Chr4 complement(1371404..1372480) [1077 bp, 358 aa]...    79   1e-15
CAGL0L00891g Chr12 (108801..109826) [1026 bp, 341 aa] {ON} simil...    76   1e-14
SAKL0F08162g Chr6 complement(622302..623294) [993 bp, 330 aa] {O...    75   2e-14
Kwal_47.18148 s47 complement(708086..709057) [972 bp, 323 aa] {O...    75   2e-14
Ecym_4377 Chr4 complement(796971..797972) [1002 bp, 333 aa] {ON}...    74   5e-14
Kpol_1070.19 s1070 (45405..46340) [936 bp, 311 aa] {ON} (45405.....    71   4e-13
ADL115W Chr4 (483164..484165) [1002 bp, 333 aa] {ON} Syntenic ho...    71   7e-13
KAFR0I01950 Chr9 (398299..399291) [993 bp, 330 aa] {ON} Anc_7.22...    70   9e-13
KNAG0D01760 Chr4 (296169..297197) [1029 bp, 342 aa] {ON} Anc_7.2...    70   1e-12
TBLA0B01580 Chr2 (345206..346366) [1161 bp, 386 aa] {ON} Anc_7.2...    69   3e-12
NCAS0A13380 Chr1 complement(2633641..2634630) [990 bp, 329 aa] {...    69   4e-12
Skud_9.128 Chr9 (245338..246327) [990 bp, 329 aa] {ON} YIL041W (...    68   5e-12
Smik_9.150 Chr9 (250717..251697) [981 bp, 326 aa] {ON} YIL041W (...    68   6e-12
YIL041W Chr9 (276525..277505) [981 bp, 326 aa] {ON}  GVP36BAR do...    67   9e-12
TPHA0B02750 Chr2 (627808..628899) [1092 bp, 363 aa] {ON} Anc_7.2...    67   2e-11
Suva_9.159 Chr9 (265174..266151) [978 bp, 325 aa] {ON} YIL041W (...    65   4e-11
TBLA0D04200 Chr4 (1038483..1039478) [996 bp, 331 aa] {ON} Anc_7....    63   2e-10
TPHA0C01230 Chr3 (280944..281861) [918 bp, 305 aa] {ON} Anc_7.22...    63   2e-10
Kpol_478.22 s478 (67833..68885) [1053 bp, 350 aa] {ON} (67833..6...    54   2e-07
KAFR0L01120 Chr12 complement(211027..212679) [1653 bp, 550 aa] {...    32   2.9  
Smik_7.139 Chr7 (251686..255480) [3795 bp, 1264 aa] {ON} YGL133W...    31   6.1  
TBLA0G03710 Chr7 (984437..984847) [411 bp, 136 aa] {ON}                30   6.2  
CAGL0J05456g Chr10 (521362..522477) [1116 bp, 371 aa] {ON} simil...    30   8.8  

>CAGL0L08492g Chr12 (931048..932205) [1158 bp, 385 aa] {ON} similar
           to uniprot|Q06523 Saccharomyces cerevisiae YPR148c
          Length = 385

 Score =  745 bits (1924), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 369/385 (95%), Positives = 369/385 (95%)

Query: 1   MFKFNLESITQSISEGTQSLVQQFNDPKTKLSIKAKTRFLQEAIGNERDISKLPPQYVVL 60
           MFKFNLESITQSISEGTQSLVQQFNDPKTKLSIKAKTRFLQEAIGNERDISKLPPQYVVL
Sbjct: 1   MFKFNLESITQSISEGTQSLVQQFNDPKTKLSIKAKTRFLQEAIGNERDISKLPPQYVVL 60

Query: 61  EKKCDSIEKVLKRILIVTKTYEIEGYDYPPNISESLSSWWQTKEWFNISELTKNVIPKHG 120
           EKKCDSIEKVLKRILIVTKTYEIEGYDYPPNISESLSSWWQTKEWFNISELTKNVIPKHG
Sbjct: 61  EKKCDSIEKVLKRILIVTKTYEIEGYDYPPNISESLSSWWQTKEWFNISELTKNVIPKHG 120

Query: 121 NVEKAGTEASKTLTDKEVSHEGPPSFASAIARAGKDSQLIFXXXXXXXXXXXXXXXXLVK 180
           NVEKAGTEASKTLTDKEVSHEGPPSFASAIARAGKDSQLIF                LVK
Sbjct: 121 NVEKAGTEASKTLTDKEVSHEGPPSFASAIARAGKDSQLIFESIETKDEDEKEDIDELVK 180

Query: 181 IFKIWSDCFYEISDSKTEMDQMMIKEFNVKLEDYLQKNFQKIHTLRAKVEESRLNFDTMR 240
           IFKIWSDCFYEISDSKTEMDQMMIKEFNVKLEDYLQKNFQKIHTLRAKVEESRLNFDTMR
Sbjct: 181 IFKIWSDCFYEISDSKTEMDQMMIKEFNVKLEDYLQKNFQKIHTLRAKVEESRLNFDTMR 240

Query: 241 YEVAQTSKQTDSKELGNEDETKPSSMDANKTNTEEKEAANDKVETKEKTETNATIADETK 300
           YEVAQTSKQTDSKELGNEDETKPSSMDANKTNTEEKEAANDKVETKEKTETNATIADETK
Sbjct: 241 YEVAQTSKQTDSKELGNEDETKPSSMDANKTNTEEKEAANDKVETKEKTETNATIADETK 300

Query: 301 ETKDTKDSEDLKEDSKTSTDGQLLEQLEDEFVSNTTEAVEVMTEVSENSELLSLIKLFQT 360
           ETKDTKDSEDLKEDSKTSTDGQLLEQLEDEFVSNTTEAVEVMTEVSENSELLSLIKLFQT
Sbjct: 301 ETKDTKDSEDLKEDSKTSTDGQLLEQLEDEFVSNTTEAVEVMTEVSENSELLSLIKLFQT 360

Query: 361 FQLSYHQHCVKSLEQSLKDLNAIDN 385
           FQLSYHQHCVKSLEQSLKDLNAIDN
Sbjct: 361 FQLSYHQHCVKSLEQSLKDLNAIDN 385

>Skud_16.443 Chr16 complement(780561..781823) [1263 bp, 420 aa] {ON}
           YPR148C (REAL)
          Length = 420

 Score =  288 bits (737), Expect = 1e-93,   Method: Compositional matrix adjust.
 Identities = 177/438 (40%), Positives = 241/438 (55%), Gaps = 81/438 (18%)

Query: 4   FNLESITQSISEGTQ-----------SLVQQFNDPKTKLSIKAKTRFLQEAIGNERDISK 52
           F+L  IT SI+               S     NDP+T+LSIK++TRF+QE++G   DISK
Sbjct: 8   FSLNKITDSIATAAHKTQDTLNNALASANVNLNDPETRLSIKSRTRFVQESLGTVSDISK 67

Query: 53  LPPQYVVLEKKCDSIEKVLKRILIVTKTYEIEGYDYPPNISESLSSWWQTKE--WFNISE 110
           LPPQY  LEKK DS+EKV +RIL+V+KT+E+EGYDYPPN++ES+S WW   +  WF    
Sbjct: 68  LPPQYQFLEKKSDSLEKVCRRILLVSKTFEVEGYDYPPNLTESISDWWSVNKDGWF---- 123

Query: 111 LTKNVIPKHGNVEKAGTEASKTLTDKEVSHEG----PPSFASAIARAGKDSQLIFXXXXX 166
                          G+  S+    K+VS+      P SFA AI++A  D +  F     
Sbjct: 124 ---------------GSRKSENANKKKVSNHDDAFLPRSFAQAISKAAVDCECEFQSLKQ 168

Query: 167 XXXXXXXXX-------------------------XXLVKIFKIWSDCFYEISDSKTEMDQ 201
                                               L+K+F  WS C+  I + K EMD 
Sbjct: 169 DEKAGLKKKSESNETAQDAEAQEEDEEDEEDEDLSNLIKVFDSWSTCYKNIDEGKAEMDS 228

Query: 202 MMIKEFNVKLEDYLQKNFQKIHTLRAKVEESRLNFDTMRYEV-----------AQTSKQT 250
            MIKEFN KLE  + K+F+K+H LR KVE+SRL FDTMRYEV           A+TSK+ 
Sbjct: 229 TMIKEFNKKLEKLINKDFKKVHELRKKVEDSRLKFDTMRYEVKSKEAKLKAQKAETSKEV 288

Query: 251 DSKELGNEDETKPSSMDANKTNTEEKEAANDKVETKEKTETNATIADETKETKDTKDSED 310
           D K +       P S D N T  +E   + D +E   K ET+ + AD+    K+  DS+ 
Sbjct: 289 DDKAVS---ANAPISPDENPTTEDESPISKD-LEGDSKKETSGSAADDAAVVKE--DSKA 342

Query: 311 LKEDSKTSTD---GQLLEQLEDEFVSNTTEAVEVMTEVSENSELLSLIKLFQTFQLSYHQ 367
            + D  T  D    +LLE+LEDEFVSNTT AVE+M E++++S++L L+KLFQ FQL Y +
Sbjct: 343 NQGDEPTIEDLEENKLLEKLEDEFVSNTTTAVEIMEEITDSSDILGLVKLFQNFQLVYFR 402

Query: 368 HCVKSLEQSLKDLNAIDN 385
            CV+ +E +LK LN+++N
Sbjct: 403 QCVQEVEANLKVLNSLEN 420

>SAKL0F02794g Chr6 (238272..239465) [1194 bp, 397 aa] {ON} similar
           to uniprot|Q06523 Saccharomyces cerevisiae YPR148C
           Protein of unknown function green fluorescent protein
           (GFP)-fusion protein localizes to the cytoplasm in a
           punctate pattern
          Length = 397

 Score =  280 bits (715), Expect = 1e-90,   Method: Compositional matrix adjust.
 Identities = 166/403 (41%), Positives = 239/403 (59%), Gaps = 35/403 (8%)

Query: 4   FNLESITQSISEG---TQSLVQ------QFNDPKTKLSIKAKTRFLQEAIGNERDISKLP 54
           F+L+ +T SIS     TQ  +       Q +DP+ KLS+K +  +LQE +G   DISKLP
Sbjct: 8   FSLDKLTNSISSAAHKTQDKLSTAIANIQLDDPQAKLSLKVRKHYLQETLGAIDDISKLP 67

Query: 55  PQYVVLEKKCDSIEKVLKRILIVTKTYEIEGYDYPPNISESLSSWWQTKEWFNISELTKN 114
           PQY  LEKKCDS+EK+ +R+L+VTKT+E+EGYDYPPN+SES+S WW      N S L   
Sbjct: 68  PQYQFLEKKCDSLEKICRRMLVVTKTFEVEGYDYPPNLSESISDWWGA----NRSGLLSF 123

Query: 115 VIPKHGNVEKAGTEASKTLTDKEVSHEG--PPSFASAIARAGKDSQLIFXXXXXXXXXXX 172
           +  K G       E S+   +++  +EG  P SFA A+++A KDS  +            
Sbjct: 124 MDGKKG-------EGSRAKAEEKDENEGFLPRSFAQALSKAAKDSGDVLRTLKDEQKEPP 176

Query: 173 XXXX--------XLVKIFKIWSDCFYEISDSKTEMDQMMIKEFNVKLEDYLQKNFQKIHT 224
                        L+ +F+ WS C  +I   K EMD +M KEFN KL+  + ++F+K+H+
Sbjct: 177 QDEDEDEDEDINSLITMFEAWSKCEQKIDQEKAEMDSLMAKEFNKKLDKLINEDFKKVHS 236

Query: 225 LRAKVEESRLNFDTMRYEVAQTSKQTDSKELGNEDETKPSSMDANKTNTEEKEAANDKVE 284
           LR KVEESRL FDT+RYE+    K+    +   E+  K   +D  + N  E++A  +  E
Sbjct: 237 LRKKVEESRLKFDTLRYELNLKEKEQQKAKAKEEENEK---VDVVEQNAPEEKAKTEGQE 293

Query: 285 TKEKTETNATIADETKETKDTKDSEDLKEDSKTSTDGQ--LLEQLEDEFVSNTTEAVEVM 342
           T E  E +    ++  E   +K  E ++ +   + D +  LLE+LEDEFVS+TTEAVE+M
Sbjct: 294 TSEGKEHDLKADEKLSEDTASKIPESVENEEVDNEDPEHKLLEKLEDEFVSSTTEAVEIM 353

Query: 343 TEVSENSELLSLIKLFQTFQLSYHQHCVKSLEQSLKDLNAIDN 385
            E++++SE+LSL+KLF  FQL YH+ CV+ LE S K L+ +DN
Sbjct: 354 GEITDSSEILSLVKLFHKFQLIYHRQCVQELEASTKILDGLDN 396

>Smik_16.401 Chr16 complement(698791..700074) [1284 bp, 427 aa] {ON}
           YPR148C (REAL)
          Length = 427

 Score =  276 bits (707), Expect = 4e-89,   Method: Compositional matrix adjust.
 Identities = 166/410 (40%), Positives = 228/410 (55%), Gaps = 73/410 (17%)

Query: 26  DPKTKLSIKAKTRFLQEAIGNERDISKLPPQYVVLEKKCDSIEKVLKRILIVTKTYEIEG 85
           DP+T+LSIK++TRF+QE++G   DISKLPPQY  LEKK DS+EKV KRIL+V+KT+E+EG
Sbjct: 41  DPQTRLSIKSRTRFVQESLGTISDISKLPPQYQFLEKKSDSLEKVCKRILLVSKTFEVEG 100

Query: 86  YDYPPNISESLSSWWQTKE--WFNISELTKNVIPKHGNVEKAGTEASKTLTDKEVSHEG- 142
           YDYPPN++ES+S WW   +  WF                   G++ S+    K+ S+   
Sbjct: 101 YDYPPNLTESISDWWSLNKDGWF-------------------GSKKSEITNKKKGSNHDD 141

Query: 143 ---PPSFASAIARAGKDSQLIFXXXXXXXXXXXXXX------------------------ 175
              P SFA AI++A  D +  F                                      
Sbjct: 142 AFLPRSFAQAISKAAVDCEFEFQNLENDEKAELKKKRESTKNAQTTGAQDEENEEDEDEE 201

Query: 176 -------XXLVKIFKIWSDCFYEISDSKTEMDQMMIKEFNVKLEDYLQKNFQKIHTLRAK 228
                    L+K+F  WS C+  I + KTEMD MM+KEFN KLE  + ++F+++H LR K
Sbjct: 202 EEEDEDLSNLIKVFDSWSTCYKNIDEGKTEMDSMMVKEFNKKLEKLINQDFKRVHELRKK 261

Query: 229 VEESRLNFDTMRYEVAQTSKQTDSKELGNEDETKPSSMDAN--------KTNTEEKEAAN 280
           VE SRL FDTMRYEV     Q D+++ G  +E     + AN         +  +EK+ +N
Sbjct: 262 VEISRLKFDTMRYEVKAKEAQLDAQKPGVTEEAHTKDVSANTATSLNEIPSTVDEKQKSN 321

Query: 281 DKVETKEKTETNATIADET-----KETKDTKDSEDLKEDSKTSTDGQLLEQLEDEFVSNT 335
              E + K E N  +AD+          D KD   L+E    S + +LLE+LEDEFVSNT
Sbjct: 322 VNTEAESKKEANEQVADDAVVMKEDPKDDKKDDTPLEE----SEENKLLEKLEDEFVSNT 377

Query: 336 TEAVEVMTEVSENSELLSLIKLFQTFQLSYHQHCVKSLEQSLKDLNAIDN 385
           T AVE M E++++SE+L LIKLFQ FQL Y + CV+ +E +LK LN ++N
Sbjct: 378 TAAVETMEEIADSSEILGLIKLFQNFQLVYFRQCVQEVEANLKVLNGLEN 427

>Suva_16.477 Chr16 complement(823311..824582) [1272 bp, 423 aa] {ON}
           YPR148C (REAL)
          Length = 423

 Score =  273 bits (697), Expect = 1e-87,   Method: Compositional matrix adjust.
 Identities = 170/414 (41%), Positives = 227/414 (54%), Gaps = 76/414 (18%)

Query: 24  FNDPKTKLSIKAKTRFLQEAIGNERDISKLPPQYVVLEKKCDSIEKVLKRILIVTKTYEI 83
            NDP+T+LSIK++TRF+QE++G   DISKLPPQY  LEKK DS+EKV KRIL+V+KT+E+
Sbjct: 34  LNDPQTRLSIKSRTRFVQESLGTVSDISKLPPQYQFLEKKSDSLEKVCKRILLVSKTFEV 93

Query: 84  EGYDYPPNISESLSSWWQTKE--WFNISELTKNVIPKHGNVEKAGTEASKTLTDKEVSHE 141
           EGYDYPPN++ES+S WW   +  WF                 K    ASK    K+ +H+
Sbjct: 94  EGYDYPPNLTESISDWWSLNKDGWFG---------------SKKTEHASKK---KDSNHD 135

Query: 142 G---PPSFASAIARAGKDSQLIFXXXXXXXXXXXXXX----------------------- 175
               P SFA AI++A  D +  F                                     
Sbjct: 136 DTFLPRSFAQAISKAAVDCESEFKNLEQNEKEDLKQKKEAKKTTQETAEQEEEEEEEEEE 195

Query: 176 ------XXLVKIFKIWSDCFYEISDSKTEMDQMMIKEFNVKLEDYLQKNFQKIHTLRAKV 229
                   L+K+F  WS C+  I + K EMD MM+KEFN KLE  + ++F+K+H LR KV
Sbjct: 196 EDDEDLSNLIKVFDSWSTCYKNIDEGKAEMDSMMVKEFNKKLEKLINEDFKKVHELRRKV 255

Query: 230 EESRLNFDTMRYEVA----QTSKQTD--SKELGNEDETKPSSMDANKTNTEEKEAANDKV 283
           EESRL FDTMRYE      Q   Q D  SKE  N D +      AN T+ EE   A  K 
Sbjct: 256 EESRLKFDTMRYEGKSKEEQLRAQKDETSKEADNNDNS------ANSTSLEEALTAEKKA 309

Query: 284 ETKE----------KTETNATIADETKETKDTKDSEDLKEDSKT--STDGQLLEQLEDEF 331
           E ++          K ET+ T A++  +T +    +          S + +LLE+LEDEF
Sbjct: 310 EKEDDAKVPEEEPKKVETDVTTANDDIDTNENPKQQPTNNQPPVEDSEENKLLEKLEDEF 369

Query: 332 VSNTTEAVEVMTEVSENSELLSLIKLFQTFQLSYHQHCVKSLEQSLKDLNAIDN 385
           VSNTT AVE M E++++SE+LSL+KLFQ FQL Y + C + +E +LK LN ++N
Sbjct: 370 VSNTTAAVETMEEITDSSEILSLVKLFQNFQLVYFRQCAQEVEANLKVLNGMEN 423

>Kwal_55.21227 s55 complement(739317..740447) [1131 bp, 376 aa] {ON}
           YPR148C - Hypothetical ORF [contig 130] FULL
          Length = 376

 Score =  269 bits (688), Expect = 7e-87,   Method: Compositional matrix adjust.
 Identities = 155/370 (41%), Positives = 209/370 (56%), Gaps = 39/370 (10%)

Query: 23  QFNDPKTKLSIKAKTRFLQEAIGNERDISKLPPQYVVLEKKCDSIEKVLKRILIVTKTYE 82
           Q +DP+  LS+KA+  +LQE +G   DISKLPPQY +LEKKCDS+EK  +R+L+VTKT+E
Sbjct: 36  QLDDPQAILSLKARKHYLQETLGTIEDISKLPPQYQLLEKKCDSLEKACRRMLVVTKTFE 95

Query: 83  IEGYDYPPNISESLSSWWQTKEWFNISELTKNVIPKHGNVEKAGTEASKTLTDKEVSHEG 142
           +EGYDYPPN+SESLS WW           + N     G +  +  +          S   
Sbjct: 96  VEGYDYPPNLSESLSDWW-----------SSNKEGLFGLMSSSKKDKGAESAAAAKSALM 144

Query: 143 PPSFASAIARAGKDSQLIFXXXXXXXXXXXXXXXX-------LVKIFKIWSDCFYEISDS 195
           P SFA AIA+A KDS  +                        L+K+F  WS+C Y+I   
Sbjct: 145 PRSFAQAIAKAAKDSGDVLAALKDQEQQASADEEDEDEDITPLIKMFSAWSECQYKIDQG 204

Query: 196 KTEMDQMMIKEFNVKLEDYLQKNFQKIHTLRAKVEESRLNFDTMRYEVAQTSKQTDSKEL 255
           K EMD +M KEFN KL   +++ F+    LR KVE+SRL FDTMRYEV  T +Q+     
Sbjct: 205 KAEMDALMAKEFNQKLNALIEEKFKNASVLRRKVEDSRLKFDTMRYEVKLTEQQSKQAME 264

Query: 256 GNEDETKPSSMDANKTNTEEKEAANDKVETKEKTETNATIADETKETKDTKDSEDLKEDS 315
             + + K S + +       KE   D  ET  +   + T   +TKE + T D+       
Sbjct: 265 NEKAQFKESDLSS-------KEEGADANETSNEVGKSVT---KTKEEQATNDAAQ----- 309

Query: 316 KTSTDGQLLEQLEDEFVSNTTEAVEVMTEVSENSELLSLIKLFQTFQLSYHQHCVKSLEQ 375
                 +LLE+LEDEFVSNTTEAVE M E+++++ELL+L+KLF  FQL YH+ CV+ LE 
Sbjct: 310 ------ELLEKLEDEFVSNTTEAVETMGEITDSAELLNLVKLFHNFQLVYHRQCVQDLEA 363

Query: 376 SLKDLNAIDN 385
           SL  LN ++ 
Sbjct: 364 SLSTLNELEG 373

>KLTH0F14806g Chr6 complement(1212362..1213438) [1077 bp, 358 aa]
           {ON} similar to uniprot|P40531 Saccharomyces cerevisiae
           YIL041W GVP36 Golgi-vesicle protein of unknown function
           green fluorescent protein (GFP)-fusion protein localizes
           to the cytoplasm
          Length = 358

 Score =  268 bits (685), Expect = 9e-87,   Method: Compositional matrix adjust.
 Identities = 159/400 (39%), Positives = 224/400 (56%), Gaps = 70/400 (17%)

Query: 4   FNLESITQSI---SEGTQSLVQ------QFNDPKTKLSIKAKTRFLQEAIGNERDISKLP 54
           F+L  +T SI   +  TQ  +       Q +DP+ KLS+KA+  +LQE +G   DISKLP
Sbjct: 8   FSLNKLTNSITNVAHKTQDTLSTAIANIQLDDPQAKLSLKARKHYLQETLGTIEDISKLP 67

Query: 55  PQYVVLEKKCDSIEKVLKRILIVTKTYEIEGYDYPPNISESLSSWWQTKEWFNISELTKN 114
           PQY  LEKKCDS+EKV +R+L+VTKTYE+EGYDYPPN+SESLS WW +           N
Sbjct: 68  PQYQFLEKKCDSLEKVCRRMLVVTKTYEVEGYDYPPNLSESLSDWWSS-----------N 116

Query: 115 VIPKHGNVEKAGTEASKTLTDKEVSHEG--PPSFASAIARAGKDSQLIFXXXXXXXXXXX 172
                G V  +  E  K L   E S E   P SFA AI++A KDS  +            
Sbjct: 117 KEGLFGFVSSSKKE--KKLEPAEDSKEALMPRSFAQAISKAAKDSGEVMTALKTEEQKAS 174

Query: 173 XXX-------XXLVKIFKIWSDCFYEISDSKTEMDQMMIKEFNVKLEDYLQKNFQKIHTL 225
                       L+K+F+ WS C + +  SK EMD +M+KEFN KL  ++++ F+   TL
Sbjct: 175 AEEDEEDEDITSLIKMFEAWSACQHNMDQSKAEMDALMVKEFNHKLTAFVEEKFKNARTL 234

Query: 226 RAKVEESRLNFDTMRYEVAQTSKQTDSKELGNEDETKPSSMDANKTNTEEKEAANDKVET 285
           R KVE+SRL FDTMRYE+    +Q  ++E                               
Sbjct: 235 RKKVEDSRLKFDTMRYELKMAEEQGKTEEAA----------------------------- 265

Query: 286 KEKTETNATIADETKETKDTKDSEDLKEDSKTSTDGQLLEQLEDEFVSNTTEAVEVMTEV 345
            ++TE+     DE + +KD+  S++ +         +LLE+LEDEFVSNTTEAVE M E+
Sbjct: 266 -QQTESQKPQEDEAEASKDSDSSDEAQ---------KLLEKLEDEFVSNTTEAVETMGEI 315

Query: 346 SENSELLSLIKLFQTFQLSYHQHCVKSLEQSLKDLNAIDN 385
           ++++E+++L+KLF  FQL Y++ CV++LE S+  LN ++ 
Sbjct: 316 TDSAEIINLVKLFHNFQLIYYKQCVQNLETSINSLNELEG 355

>YPR148C Chr16 complement(826833..828140) [1308 bp, 435 aa] {ON}
           Protein of unknown function that may interact with
           ribosomes, based on co-purification experiments; green
           fluorescent protein (GFP)-fusion protein localizes to
           the cytoplasm in a punctate pattern
          Length = 435

 Score =  270 bits (691), Expect = 1e-86,   Method: Compositional matrix adjust.
 Identities = 163/414 (39%), Positives = 230/414 (55%), Gaps = 75/414 (18%)

Query: 26  DPKTKLSIKAKTRFLQEAIGNERDISKLPPQYVVLEKKCDSIEKVLKRILIVTKTYEIEG 85
           DP+T+LSIK++TRF+QE++G   DISKLPPQY  LEKK DS+EKV KRIL+V+KT+E+EG
Sbjct: 41  DPQTRLSIKSRTRFVQESLGTVSDISKLPPQYQFLEKKSDSLEKVCKRILLVSKTFEVEG 100

Query: 86  YDYPPNISESLSSWWQTKE--WFNISELTKNVIPKHGNVEKAGTEASKTLTDKEVSHEGP 143
           YDYPPN++ES+S WW   +  WF   +   +   K  N + A                 P
Sbjct: 101 YDYPPNLTESISDWWSLNKDGWFGSKKSESSTKKKGSNHDDAFL---------------P 145

Query: 144 PSFASAIARAGKDSQLIFXXXXXXXXXXXXXX---------------------------- 175
            SFA AI++A  D +  F                                          
Sbjct: 146 RSFAQAISKAAVDCECEFQNLEHNEKAELKKKKESIKTAQTTEAQGADHNEEDEEDEEDE 205

Query: 176 ------XXLVKIFKIWSDCFYEISDSKTEMDQMMIKEFNVKLEDYLQKNFQKIHTLRAKV 229
                   L+K+F  WS C+  I + K EMD MM+KEFN KLE  + ++F+K+H LR KV
Sbjct: 206 EDDEDLSNLIKVFDSWSTCYKNIDEGKAEMDSMMVKEFNKKLETLINQDFKKVHDLRKKV 265

Query: 230 EESRLNFDTMRYEV-----------AQTSKQTDSKELGNEDETKPSSMDANKT-NTEEKE 277
           EESRL FDTMRYEV           A+ + +  SK++  +D +  ++   ++T +TE+++
Sbjct: 266 EESRLKFDTMRYEVKAKEAELEAKKAEATGEAHSKDVSAKDISANTTTSFDETPSTEDEK 325

Query: 278 AANDKVETKEKTETNATIADETKETKDTKDSEDLKEDS-------KTSTDGQLLEQLEDE 330
             ++  E + K E N    D+  + K     EDLK +        + S D +LLE+LEDE
Sbjct: 326 PKSEGAEEESKKEANEPTVDDVADRK-----EDLKSNKVNDEPPIEESEDNKLLEKLEDE 380

Query: 331 FVSNTTEAVEVMTEVSENSELLSLIKLFQTFQLSYHQHCVKSLEQSLKDLNAID 384
           FVSNTT AVE M E++++SE+L LIKLFQ FQL Y + CV+ +E +LK LN ++
Sbjct: 381 FVSNTTAAVETMEEITDSSEILGLIKLFQNFQLVYFRQCVQEVEANLKVLNGLE 434

>ZYRO0D10010g Chr4 (845993..847141) [1149 bp, 382 aa] {ON} similar
           to uniprot|Q06523 Saccharomyces cerevisiae YPR148C
           Protein of unknown function green fluorescent protein
           (GFP)-fusion protein localizes to the cytoplasm in a
           punctate pattern
          Length = 382

 Score =  259 bits (663), Expect = 5e-83,   Method: Compositional matrix adjust.
 Identities = 156/369 (42%), Positives = 217/369 (58%), Gaps = 30/369 (8%)

Query: 24  FNDPKTKLSIKAKTRFLQEAIGNERDISKLPPQYVVLEKKCDSIEKVLKRILIVTKTYEI 83
            NDP+T+LSIK +TR+L+E +G   +ISKLPPQYV+LE+K D++EK  KR+L+VT+T+E+
Sbjct: 37  LNDPQTRLSIKTRTRYLKETLGAVDEISKLPPQYVLLERKSDALEKACKRMLLVTQTFEV 96

Query: 84  EGYDYPPNISESLSSWWQ-TKE-WFNISELTKNVIPKHGNVEKAGTEASKTLTDKEVSHE 141
           EGYDYPPN+ ES S WW  +KE WF             G+ ++     SK  TD      
Sbjct: 97  EGYDYPPNLPESFSDWWSGSKEGWF-------------GSTKQDEDGESKIQTDGSSKDP 143

Query: 142 -GPPSFASAIARAGKDSQLIFXXXXXXXXXX---XXXXXXLVKIFKIWSDCFYEISDSKT 197
             P SFA AIA+A  +    +                   LV++F   S C+  I + K 
Sbjct: 144 LMPRSFAQAIAKASHECGEAYQNSQKSEKKQIDEDEDDVNLVEMFNTLSICYRNIDEGKD 203

Query: 198 EMDQMMIKEFNVKLEDYLQKNFQKIHTLRAKVEESRLNFDTMRYEVAQTSKQTDSKELGN 257
           EMD+ + +EFN KLE  L ++F+KIH LR KVE SRL FDTMRYE+    K+   +    
Sbjct: 204 EMDKSIAREFNDKLEQLLNRDFKKIHVLRNKVENSRLKFDTMRYEMRLKEKEEKEE---- 259

Query: 258 EDETKPSSMDANKTNTEEKEAANDKVETKEKTETNATIADETKETK-DTKDSEDLKEDSK 316
                 ++ D   +N  ++E  N+  + +EK  T A  A+    TK +  + E + E  +
Sbjct: 260 --NENTANADEGPSNKNQQEPTNEPAKEEEKP-TPAEPAEAQHTTKTENSNKEPMVEKPE 316

Query: 317 TSTDGQLLEQLEDEFVSNTTEAVEVMTEVSENSELLSLIKLFQTFQLSYHQHCVKSLEQS 376
              D +LLEQLEDEFVSNT+EAVE MT + E SE+L L+KLFQ  QL Y++ CV+ +E S
Sbjct: 317 ---DNKLLEQLEDEFVSNTSEAVETMTSIVEGSEILRLMKLFQNLQLVYYRQCVQEMEAS 373

Query: 377 LKDLNAIDN 385
           LK LN ++N
Sbjct: 374 LKGLNDLEN 382

>AFR309C Chr6 complement(1000078..1001172) [1095 bp, 364 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPR148C
          Length = 364

 Score =  249 bits (636), Expect = 3e-79,   Method: Compositional matrix adjust.
 Identities = 153/373 (41%), Positives = 207/373 (55%), Gaps = 65/373 (17%)

Query: 23  QFNDPKTKLSIKAKTRFLQEAIGNERDISKLPPQYVVLEKKCDSIEKVLKRILIVTKTYE 82
           + +DPKT LS+K + R LQE +G+ +DIS+LPPQY  LE+KCD+IE+V K+IL+V+KT+E
Sbjct: 43  KIDDPKTILSLKTRKRQLQETLGSAKDISQLPPQYGFLERKCDAIEQVCKKILVVSKTFE 102

Query: 83  IEGYDYPPNISESLSSWWQTKEWFNISELTKNV-IPKHGNVEKAGTEASKTLTDKEVSHE 141
           +EGYDYPPN +ES+S WW T         TK     K G   K GT+  K   DK+    
Sbjct: 103 VEGYDYPPNPTESISDWWNTS--------TKETRFLKFG---KGGTDKQK--EDKQKQAA 149

Query: 142 G---PPSFASAIARAGKDSQLIFXXXXXXXXXXXXXXX-------XLVKIFKIWSDCFYE 191
           G   PPSFA A+ RA K SQ I                        L+K+F  W+D  Y 
Sbjct: 150 GSSDPPSFAHALHRAAKGSQGIIQELKEQAEEEQEQEVEIDEDVESLIKMFGTWADAQYN 209

Query: 192 ISDSKTEMDQMMIKEFNVKLEDYLQKNFQKIHTLRAKVEESRLNFDTMRYEVAQTSKQTD 251
           +  +K EMDQ M+KEFN KL+  L+  F+K HTLR KVEESRL FDT++YE         
Sbjct: 210 MDIAKREMDQFMVKEFNEKLKHLLEVEFKKGHTLRRKVEESRLTFDTLKYE--------- 260

Query: 252 SKELGNEDETKPSSMDANKTNTEEKEAANDKVETKEKTETNATIADETKETKDTKDSEDL 311
                                  E++AA  K + + K    AT +    ++     + DL
Sbjct: 261 ---------------------QHERDAALAKKQDEAKQAEGATPSTGVTQS----STADL 295

Query: 312 KEDSKTSTDGQLLEQLEDEFVSNTTEAVEVMTEVSENSELLSLIKLFQTFQLSYHQHCVK 371
              ++       LE  EDEFVSNT EAVE MT +++ ++L+SL+KLFQ FQL YH+ CV+
Sbjct: 296 AFYAQ-------LEDAEDEFVSNTAEAVEFMTSIADATKLISLVKLFQNFQLVYHRKCVQ 348

Query: 372 SLEQSLKDLNAID 384
            LE SL  L +++
Sbjct: 349 ELEVSLNSLTSLE 361

>TDEL0D05590 Chr4 complement(1008107..1009141) [1035 bp, 344 aa]
           {ON} Anc_3.491 YPR148C
          Length = 344

 Score =  242 bits (617), Expect = 1e-76,   Method: Compositional matrix adjust.
 Identities = 155/393 (39%), Positives = 215/393 (54%), Gaps = 70/393 (17%)

Query: 4   FNLESITQSISEGTQ-------SLVQQFNDPKTKLSIKAKTRFLQEAIGNERDISKLPPQ 56
           F+L  IT +++           S +   +DP+ KLS+KA+TR+LQE +G   D SKLPPQ
Sbjct: 8   FSLNKITDTLANAAHKTQDTLNSAIANVSDPQAKLSLKARTRYLQETLGTIDDKSKLPPQ 67

Query: 57  YVVLEKKCDSIEKVLKRILIVTKTYEIEGYDYPPNISESLSSWWQTKE--WFNISELTKN 114
           Y  LEKK D++EK  KRIL+VT+T+E+EGYDYPPN++ES+S WW   +  WF   +  K 
Sbjct: 68  YQSLEKKSDALEKCCKRILLVTRTFEVEGYDYPPNLTESISDWWSLNKDGWFGTKKPEKT 127

Query: 115 VIPKHGNVEKAGTEASKTLTDKEVSHEGPPSFASAIARAGKDSQLIFX--XXXXXXXXXX 172
                 N    G++A             P SF+ AI++A  D   +F             
Sbjct: 128 -----KNDSSDGSDAFL-----------PRSFSQAISKAANDCNSVFTNLQEHGDEDEED 171

Query: 173 XXXXXLVKIFKIWSDCFYEISDSKTEMDQMMIKEFNVKLEDYLQKNFQKIHTLRAKVEES 232
                + K+F  WS C+  I + K EMD M+ KEFN KLE  + ++F+K+H  R KVEES
Sbjct: 172 EDVSNVAKMFDSWSKCYKNIDEGKHEMDSMIRKEFNTKLEKIINEDFKKVHASRKKVEES 231

Query: 233 RLNFDTMRYEVAQTSKQTDSKELGNEDETKPSSMDANKTNTEEKEAANDKVETKEKTETN 292
           RL FDT+RYE+                  K    +  K +TE  EA+ D+ +T+E     
Sbjct: 232 RLKFDTVRYEI------------------KLKETENAKKSTETDEASKDETKTEE----- 268

Query: 293 ATIADETKETKDTKDSEDLKEDSKTSTDGQLLEQLEDEFVSNTTEAVEVMTEVSENSELL 352
                               E  KTS + +LLE+LEDEFVSNTT AVE+M EV+E++E+L
Sbjct: 269 --------------------EPPKTSEEDKLLEELEDEFVSNTTAAVEIMGEVTESAEIL 308

Query: 353 SLIKLFQTFQLSYHQHCVKSLEQSLKDLNAIDN 385
            L KLFQ FQL Y + CV+ +E SLK L A+++
Sbjct: 309 GLAKLFQNFQLVYFRQCVQEVEASLKILGALES 341

>Kpol_1017.7 s1017 (27496..28272,28322..28330,28419..28769) [1137
           bp, 378 aa] {ON}
           (27496..28272,28322..28330,28419..28769) [1137 nt, 379
           aa]
          Length = 378

 Score =  242 bits (618), Expect = 2e-76,   Method: Compositional matrix adjust.
 Identities = 152/389 (39%), Positives = 218/389 (56%), Gaps = 45/389 (11%)

Query: 7   ESITQSISEGTQSLVQQFNDPKTKLSIKAKTRFLQEAIGNERD-ISKLPPQYVVLEKKCD 65
           E++T ++S   ++L    NDP TKLSIK+K RF+QE +G   D  SKLPP Y  LE K D
Sbjct: 23  ENLTNALSNVNENLENYLNDPNTKLSIKSKARFIQEKLGTINDQPSKLPPTYTDLELKTD 82

Query: 66  SIEKVLKRILIVTKTYEIEGYDYPPNISESLSSWWQTKEWFNISELTKNVIPKHGNVEKA 125
           +IEK LKR+L VTKTYE EGYDYPPN++ESLS WW   +         NV     N E  
Sbjct: 83  AIEKALKRLLTVTKTYETEGYDYPPNLTESLSDWWTNDD---------NVTNTDENDE-- 131

Query: 126 GTEASKTLTDKEVSHEGPPSFASAIARAGKDSQLIFXXXXXXXXXXXXXX---------- 175
             +++K+          P SFA AI+ A  D+                            
Sbjct: 132 NIQSNKSFL--------PRSFAQAISNASFDAASNVNSVTNTIKLNHKDDEEEEEDDEEW 183

Query: 176 XXLVKIFKIWSDCFYEISDSKTEMDQMMIKEFNVKLEDYLQKNFQKIHTLRAKVEESRLN 235
             L KIF+   +C+  I + KTEMD++++ EFN KL+D +   F+ +H LR  VE SRL 
Sbjct: 184 SDLHKIFESLGNCYRNIDNGKTEMDKLIVNEFNNKLKDLINTEFKNVHQLRKSVENSRLK 243

Query: 236 FDTMRYEVAQTSKQTDSKELGNEDETKPSSMDANKTNTEEKEAANDKVETKEKTETNATI 295
           FDTMRYE+     +     +  ED++  S    +K  T +KEA+  K ET +K       
Sbjct: 244 FDTMRYELKIKEWKRTXXXMEAEDKSDVSKKGTSKKETPKKEAS--KKETPKK------- 294

Query: 296 ADETKETKDTKDSEDLKEDSKTSTDGQLLEQLEDEFVSNTTEAVEVMTEVSENSELLSLI 355
             E  + +D  +  + + D+    D +LLE+LEDEFVSNT  AVE M E+++NS++++L+
Sbjct: 295 --EINKKEDITNEGNTENDN----DNKLLEKLEDEFVSNTQNAVEKMEELTDNSKIINLV 348

Query: 356 KLFQTFQLSYHQHCVKSLEQSLKDLNAID 384
           KL+Q FQL Y++ C++ +E +LK LN ++
Sbjct: 349 KLYQNFQLVYYKQCIQEIESNLKILNGLE 377

>KLLA0E04621g Chr5 (412009..413178) [1170 bp, 389 aa] {ON} some
           similarites with uniprot|Q06523 Saccharomyces cerevisiae
           YPR148C Protein of unknown function green fluorescent
           protein (GFP)-fusion protein localizes to the cytoplasm
           in a punctate pattern
          Length = 389

 Score =  240 bits (613), Expect = 2e-75,   Method: Compositional matrix adjust.
 Identities = 155/434 (35%), Positives = 227/434 (52%), Gaps = 97/434 (22%)

Query: 1   MF-KFNLESITQSISEGTQSLVQQF---------NDPKTKLSIKAKTRFLQEAIGNERDI 50
           MF K +L +IT SIS   Q   +QF         +DP+T+LSI  +   LQE +G   DI
Sbjct: 1   MFSKLSLNNITDSISNAAQRTQEQFSSAIEKIHLDDPETRLSILKRRHQLQETLGTVHDI 60

Query: 51  SKLPPQYVVLEKKCDSIEKVLKRILIVTKTYEIEGYDYPPNISESLSSWWQTKE--WFNI 108
           S+LP QY  LE+K D++EK+ KR+L+VTKT+E+EGYDYPPN++ES + WW   +   F+ 
Sbjct: 61  SQLPIQYKFLEQKSDALEKICKRLLLVTKTFEVEGYDYPPNLTESFNDWWSGNKDSIFSF 120

Query: 109 SELTKNVIPKHGNVEKAGTEASKTLTDKEVSHEG--PPSFASAIARAGKDSQLIFXXXXX 166
           S+    V P+                 KE +  G  P SFA A+++A  DS LI      
Sbjct: 121 SKKKAEVSPEV----------------KETAENGLLPRSFAQALSKAATDSALILKQLKA 164

Query: 167 XXXXXXXXXXX---------------------------------LVKIFKIWSDCFYEIS 193
                                                       L+K F+ W+ C   I 
Sbjct: 165 EETRTNQEESQEGADQKPAEETKAEPELEAEADEDEDEDEDVDNLIKAFESWTKCQLSID 224

Query: 194 DSKTEMDQMMIKEFNVKLEDYLQKNFQKIHTLRAKVEESRLNFDTMRYEVAQTSKQTDSK 253
            SK EMD +M+KEFN KL   ++ +F+K H LRAKV+++RLNFDT+R+E+          
Sbjct: 225 QSKAEMDSLMVKEFNAKLSKLIETDFKKGHELRAKVQDARLNFDTLRHEI---------- 274

Query: 254 ELGNEDETKPSSMDANKTNTEEKEAANDKVETKEKTETNATIADETKETKDTKDSEDLKE 313
                           K   +EKE      E ++K      +A ET ET + K +E+  +
Sbjct: 275 ----------------KLKLQEKEVVASSEEAEKK------VATETPETPEKKTNEEPVD 312

Query: 314 DSKT--STDGQLLEQLEDEFVSNTTEAVEVMTEVSENSELLSLIKLFQTFQLSYHQHCVK 371
            +KT    D +L E+LED+FVS T+E VE + E++++SE++SL+KLF  FQL +++ CVK
Sbjct: 313 MAKTEEDPDSKLFERLEDQFVSATSETVEFLGELTDSSEIISLVKLFHNFQLIHYKQCVK 372

Query: 372 SLEQSLKDLNAIDN 385
           SLE+ L+ LN++D+
Sbjct: 373 SLEEDLEVLNSLDS 386

>KAFR0G03680 Chr7 complement(760604..761851) [1248 bp, 415 aa] {ON}
           Anc_3.491 YPR148C
          Length = 415

 Score =  237 bits (604), Expect = 6e-74,   Method: Compositional matrix adjust.
 Identities = 162/431 (37%), Positives = 237/431 (54%), Gaps = 63/431 (14%)

Query: 1   MF-KFNLESITQSISEGTQSLVQQFNDP------KTKLSIKAKTRFLQEAIGN--ERDIS 51
           MF  FN + IT SIS   QS  Q+ ND       +TKL  K   RF QE +G   +++IS
Sbjct: 1   MFSNFNFDKITNSISTAAQSAQQKINDTILTPDVQTKLHFKKTARFWQEKVGQIPDKEIS 60

Query: 52  KLPPQYVVLEKKCDSIEKVLKRILIVTKTYEIEGYDYPPNISESLSSWW-----QTKEWF 106
           KLP  Y+ LE K D++EK+LKR+LIVTKTYEIEGYDYPPN+SESL+ WW     ++K+  
Sbjct: 61  KLPEGYLNLENKVDALEKILKRLLIVTKTYEIEGYDYPPNLSESLNDWWWSDLKKSKKHQ 120

Query: 107 NISELTKNVIPKHGNVEKAGTEASKTLTD-KEVSHEGPPSFASAIARAGKDSQLIFXXXX 165
             S    N  P    + KA  ++   L D KE   + P           ++    F    
Sbjct: 121 EKSSFMNNSFP--MAISKAAFDSKSILDDLKEKQQDLPKEGEEPEEEVEEEDDDEF---- 174

Query: 166 XXXXXXXXXXXXLVKIFKIWSDCFYEISDSKTEMDQMMIKEFNVKLEDYLQKNFQKIHTL 225
                       L+++F   S+C+  I  SK EMD M++KEFN KLE  +  +F+K+  L
Sbjct: 175 ----------LNLLEVFNSLSNCYKNIDKSKAEMDAMIVKEFNFKLEHLINNDFKKVSKL 224

Query: 226 RAKVEESRLNFDTMRYEV-----AQTS-KQTDSK--ELGNEDETKPSSMDANKTNTEEKE 277
           R KV++SRL FDT+R+E+     AQ S +Q +S+  ++  ED TK        T  E+  
Sbjct: 225 RTKVQDSRLEFDTLRHEIKLKELAQESIRQENSQKTDVFKEDSTKEVPPKEESTKEEQVN 284

Query: 278 AANDKVETKEKTETNATIADETKETKDTKDSEDLKEDSKTSTDG---------------- 321
             ++K ET++K  T    A++  E K  ++  + KE  K + +G                
Sbjct: 285 EESNKEETEKKKITEDKPAEDVVEKKTVEEQAEAKETEKPAKEGSSKEEAPKEDVKHNGS 344

Query: 322 --------QLLEQLEDEFVSNTTEAVEVMTEVSENSELLSLIKLFQTFQLSYHQHCVKSL 373
                   +LLE+LEDEFVSNT  AVE+MTE++E SE+++L+KLFQ FQL +++ CV+ +
Sbjct: 345 SEEETEEYKLLEKLEDEFVSNTGAAVELMTELTETSEVINLVKLFQNFQLIHYKQCVQEI 404

Query: 374 EQSLKDLNAID 384
           E ++K L+ ++
Sbjct: 405 ENNMKFLDQLE 415

>Ecym_1238 Chr1 (489922..491103) [1182 bp, 393 aa] {ON} similar to
           Ashbya gossypii AFR309C
          Length = 393

 Score =  228 bits (582), Expect = 8e-71,   Method: Compositional matrix adjust.
 Identities = 140/372 (37%), Positives = 208/372 (55%), Gaps = 42/372 (11%)

Query: 24  FNDPKTKLSIKAKTRFLQEAIGNERDISKLPPQYVVLEKKCDSIEKVLKRILIVTKTYEI 83
            +DP+T LS++ +   LQE +G  +DISKLPP+Y  LE+KCD+ EKV  RIL+V+KT+E+
Sbjct: 44  LDDPQTMLSLRTRKHQLQETLGTIKDISKLPPRYQFLERKCDAFEKVCSRILVVSKTFEV 103

Query: 84  EGYDYPPNISESLSSWWQTKEWFNISELTKNVIPKHGNVEKAG-TEASKTLTDKEVSHEG 142
           +GYDYPPN++ES+S WW +      S     V    G   K    +A +  + ++ S+EG
Sbjct: 104 DGYDYPPNLAESISDWWGS------SSKKDGVFWGFGKKSKNDKNKAEQKSSAEKKSNEG 157

Query: 143 --PPSFASAIARAGKDSQLIFXXXXXXXXXXXXXXX--------XLVKIFKIWSDCFYEI 192
             PPSFA AI++A  DS  I                         L+ I + W++    I
Sbjct: 158 YIPPSFAQAISKAADDSITILKELNEEQLVNPSNGAETEDEDVDSLMPILEAWAEAQSNI 217

Query: 193 SDSKTEMDQMMIKEFNVKLEDYLQKNFQKIHTLRAKVEESRLNFDTMRYEV-AQTSKQTD 251
            ++K +MDQ MI EFN KL+  +  +F K+  LR KVEESRL FDT+RYE+  + S  + 
Sbjct: 218 DEAKQQMDQFMINEFNKKLDSLVNNDFLKVRALRKKVEESRLKFDTLRYELEMRKSGASQ 277

Query: 252 SKELGNEDETKPSSMDANKTNTEEKEAANDKVETKEKTETNATIADETKETKDTKDSEDL 311
           +KE         +++++ + N ++KE  ++    K     N  I   + E          
Sbjct: 278 TKETF-------TTIESQQVNDKDKENEDN---LKPTIHNNTGIGSSSDE---------- 317

Query: 312 KEDSKTSTDGQLLEQLEDEFVSNTTEAVEVMTEVSENSELLSLIKLFQTFQLSYHQHCVK 371
            ED K      LLE+ EDEFVSNTT+AV  MT+++++  L +L+KLF  FQL YH+ CV+
Sbjct: 318 -EDQKFRL---LLEKAEDEFVSNTTDAVAYMTQITDSVNLSTLVKLFHNFQLIYHKKCVQ 373

Query: 372 SLEQSLKDLNAI 383
            L+ SL  +N +
Sbjct: 374 ELQASLNVINTL 385

>TPHA0D03270 Chr4 complement(673063..674229) [1167 bp, 388 aa] {ON}
           Anc_3.491 YPR148C
          Length = 388

 Score =  227 bits (578), Expect = 3e-70,   Method: Compositional matrix adjust.
 Identities = 159/387 (41%), Positives = 227/387 (58%), Gaps = 33/387 (8%)

Query: 7   ESITQSISEGTQSLVQQFNDPKTKLSIKAKTRFLQEAIGNERD-ISKLPPQYVVLEKKCD 65
           E+ T +I++   ++    NDP TKLSI+A++R++QE +G   D ISKLP QYV LE K D
Sbjct: 23  ENFTNAITDLNNNIETILNDPNTKLSIRARSRYIQEQLGTLDDEISKLPQQYVELEIKTD 82

Query: 66  SIEKVLKRILIVTKTYEIEGYDYPPNISESLSSWWQTKEWFNISELTKNVIPKH--GNVE 123
           S+EK+LKR+L+VT T+  EGYDYPPN++ES+S WW   E    +   KN +P+     + 
Sbjct: 83  SVEKILKRLLLVTNTFATEGYDYPPNLTESISDWWAEDE----TTENKNFLPRSFAQALA 138

Query: 124 KAGTEASKTLTDKEVSHEGPPSFASAIARAG-KDSQLIFXXXXXXXXXXXXXXXXLV--- 179
           KA ++ SK +TDK    E      ++    G KD                     LV   
Sbjct: 139 KAYSD-SKLITDK---AERNIKLQTSPKNTGTKDENPEAGAEEEVEADDDEEDEDLVTLG 194

Query: 180 KIFKIWSDCFYEISDSKTEMDQMMIKEFNVKLEDYLQKNFQKIHTLRAKVEESRLNFDTM 239
           K FK  S+ F  I + K EMD M++ EFN KLE  L+  F+++  LR  VE SRL FDTM
Sbjct: 195 KAFKALSNSFTNIDNGKNEMDTMIVNEFNKKLEHLLEVEFKEVAQLRRNVENSRLKFDTM 254

Query: 240 RYEVAQTSKQTDSKELGNEDETKPSSMDANKTNTEEKEAANDKVETKEKTETNATIADET 299
           RY+V    K  ++K    ++E K  S D        KE    + ETKE  ET  T   E 
Sbjct: 255 RYDV----KLKEAK--AEQEEAKEVSTD--------KEIEKKESETKE-PETKGTEEKEP 299

Query: 300 KETKDTKDSEDLKEDSKTSTDG--QLLEQLEDEFVSNTTEAVEVMTEVSENSELLSLIKL 357
            ETKDT++ + +KE+   + D   +LLEQLEDEFVSNT+ AVE M E+++++++L L+KL
Sbjct: 300 -ETKDTEEKDPVKENEGENEDEDYKLLEQLEDEFVSNTSSAVEKMEELTDSAKILDLVKL 358

Query: 358 FQTFQLSYHQHCVKSLEQSLKDLNAID 384
           FQ FQL Y++ CV+ +E +LK ++ ++
Sbjct: 359 FQNFQLVYYRQCVQEIENNLKTISDLE 385

>TBLA0D02980 Chr4 (723788..725119) [1332 bp, 443 aa] {ON} Anc_3.491
           YPR148C
          Length = 443

 Score =  224 bits (570), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 150/413 (36%), Positives = 217/413 (52%), Gaps = 71/413 (17%)

Query: 12  SISEGTQSLVQQFNDPKTKLSIKAKTRFLQEAIGNERDISKLPPQYVVLEKKCDSIEKVL 71
           ++S   Q++   +NDP+T+L++ +K  +LQE+IG   +ISKLP QY  LE+K D++EK++
Sbjct: 52  TLSNAIQNVNIDWNDPQTRLTLLSKQHYLQESIGQINEISKLPSQYNALERKTDALEKII 111

Query: 72  KRILIVTKTYEIEGYDYPPNISESLSSWWQTKEWFNISELTKNVIPKHGNVEKAGTEASK 131
           KRILIVT T+EIEGYDYPPN+SES+S WW                    N   A    + 
Sbjct: 112 KRILIVTNTFEIEGYDYPPNLSESISEWW-------------------LNDPLAFLRDND 152

Query: 132 TLTDKEVSHEGPP-----------------SFASAIARAGKDSQLIFXX----------- 163
              DK  S+  PP                 SF  AI++A  DS  I              
Sbjct: 153 NTNDKNKSNSNPPDTKSKSDSDSESSFLPRSFPHAISKASSDSSAILTNLNNNEKLEFAK 212

Query: 164 --XXXXXXXXXXXXXXLVKIFKIWSDCFYEISDSKTEMDQMMIKEFNVKLEDYLQKNFQK 221
                           L+K+F  WS C   I  SK + DQ++IK+FN KL   L   F+ 
Sbjct: 213 TKTEDEEYEDDEDIQLLIKVFDSWSLCNKNIDKSKFQRDQLIIKQFNKKLTSLLDVEFKN 272

Query: 222 IHTLRAKVEESRLNFDTMRYEVAQTSKQTDSKELGNEDETKPSSMDANKTNTEEKEAAND 281
           +  LR KV+++RL FDTMRYE+A+ ++     ++  E+  KP  M+  +   E +     
Sbjct: 273 VKALRLKVQDARLKFDTMRYEIAKAAE----AKVRAEENDKPVEMEKGEGEDEGEGEGKG 328

Query: 282 KVETKEKT--------------ETNATIADETKETKDTKDSEDLKEDSKTSTDGQLLEQL 327
           K + K +T              +  ATI     + KD+ + E  K DS+   D +LLE L
Sbjct: 329 KGKGKGETASTSTETASTSTTKDAAATIE---SQKKDSPNPEFEKNDSQNE-DEKLLEHL 384

Query: 328 EDEFVSNTTEAVEVMTEVSENSELLSLIKLFQTFQLSYHQHCVKSLEQSLKDL 380
           EDEFVS+T+ AVE M E++E+S++L LIKLFQ FQL ++Q C+K +E ++K L
Sbjct: 385 EDEFVSHTSAAVETMEEITESSKILDLIKLFQNFQLLHYQQCIKEVETNMKLL 437

>KNAG0A07930 Chr1 complement(1265981..1267339) [1359 bp, 452 aa]
           {ON} Anc_3.491 YPR148C
          Length = 452

 Score =  192 bits (488), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 148/469 (31%), Positives = 226/469 (48%), Gaps = 108/469 (23%)

Query: 1   MF-KFNLESITQSISEGTQSLVQQFN------DPKTKLSIKAKTRFLQEAIG--NERDIS 51
           MF  F+L+ +T +I+   QS     +      D +TKL     TR+ QE +G  +E +I+
Sbjct: 1   MFSNFSLDKLTSTITNAAQSAQDTIHNTILSPDAQTKLQFLKTTRYFQEKVGTISEDEIA 60

Query: 52  KLPPQYVVLEKKCDSIEKVLKRILIVTKTYEIEGYDYPPNISESLSSWWQTKEWFNISEL 111
           KLP  Y  L++K +++EKVLKR+L+VTKT+E+EGYDYPPN++ESL+ WW           
Sbjct: 61  KLPEGYQRLQEKSEAMEKVLKRLLVVTKTFELEGYDYPPNVTESLNHWW----------- 109

Query: 112 TKNVIPKHGNVEKAGTEASKTLTDKEVSHEGPPSFASAIARAGKDSQLIFXXXXXXXXXX 171
                    N ++   + ++   D  + +    SFA AI +A  DSQ I           
Sbjct: 110 ---------NEDENKKKKTQDFGDSSILNR---SFAIAIGKAVLDSQYILSDLKEQQKTR 157

Query: 172 XXX-------------------------------------XXXLVKIFKIWSDCFYEISD 194
                                                      ++  F +WS+C+  I  
Sbjct: 158 GTEEKKVKREEEAEAAEEEDEADDGEQEAEDEEEEEEDIDMNNMISAFGLWSNCYKNIDQ 217

Query: 195 SKTEMDQMMIKEFNVKLEDYLQKNFQKIHTLRAKVEESRLNFDTMRY------------- 241
           SK EMD M++KEFN KL D L+ +F+ +H L  +V++SRL FDT+R+             
Sbjct: 218 SKAEMDSMIVKEFNQKLTDMLEIDFKTVHKLCTRVQDSRLEFDTLRHKLKLKELEKEARR 277

Query: 242 ----EVAQTSKQTDSKELGNEDETKPSSMDANKTNTEEKE----AANDKV---------- 283
               EVA+   +   + +         +    K+ TEE E    + ND            
Sbjct: 278 QVMEEVAEQQAEASGEPVRKRKSRAHGAQGGRKSTTEEAEKTSASENDSSKKSGKASGKS 337

Query: 284 ----ETKEKTETN---ATIADETKETKDTKD-SEDLKEDSKTSTDGQLLEQLEDEFVSNT 335
               ET E+ +T    A  A E KE    K+ +   + +     + +LLE+LEDEFVSN 
Sbjct: 338 KKGKETAEEPQTEPKEAPPAAEAKEEPPAKETAPAKESNEAEEEENKLLERLEDEFVSNI 397

Query: 336 TEAVEVMTEVSENSELLSLIKLFQTFQLSYHQHCVKSLEQSLKDLNAID 384
           T AVE MTE++++SEL+SL+KLFQ  QL +++ CV+ LE S+K L+ ++
Sbjct: 398 TAAVEKMTELTDSSELISLVKLFQNIQLVHYRQCVQELEASMKSLDELE 446

>NDAI0B05850 Chr2 complement(1418191..1419612) [1422 bp, 473 aa]
           {ON} Anc_3.491 YPR148C
          Length = 473

 Score =  181 bits (460), Expect = 5e-52,   Method: Compositional matrix adjust.
 Identities = 109/291 (37%), Positives = 147/291 (50%), Gaps = 54/291 (18%)

Query: 1   MFK-FNLESITQSISEGTQSLVQQFN-------DPKTKLSIKAKTRFLQEAIGNERDISK 52
           MF  F+L+ IT SI    Q      N       DP+TKLSIK++TR  QE +G   DISK
Sbjct: 1   MFSSFSLDKITNSIGNAAQKATNTLNNAINTATDPQTKLSIKSQTRLFQEQLGTIHDISK 60

Query: 53  LPPQYVVLEKKCDSIEKVLKRILIVTKTYEIEGYDYPPNISESLSSWWQTKEWFNISELT 112
           LP QY  LE K DS+EK +KRIL+V+KT+E+EGYDYPPN++ES S WW      NI++ +
Sbjct: 61  LPDQYKSLELKTDSLEKSIKRILLVSKTFEMEGYDYPPNLTESFSDWW------NITKKS 114

Query: 113 KNVIPKHGNVEKAGTEASKTLTDKEVSHEG-----------PPSFASAIARAGKDSQLIF 161
            +   K  +V       +    D   + E            P SFA AI+++  D   I+
Sbjct: 115 SSHRKKQISVNNKKKNNTDNDHDNATNVEPIENDITSSSFLPRSFAQAISKSAMDCTDIY 174

Query: 162 XXXXXXXXXXXXXX-----------------------------XXLVKIFKIWSDCFYEI 192
                                                        L+K F+ WS+C+  I
Sbjct: 175 QQLSIQETATKETTIKDENEAQEEDDEDAGEEEEEDDDDDEDIQNLIKAFESWSNCYKNI 234

Query: 193 SDSKTEMDQMMIKEFNVKLEDYLQKNFQKIHTLRAKVEESRLNFDTMRYEV 243
              K+EMD MM KEFN KLED +   F+K++TLR KV +SRL FDT+R+E+
Sbjct: 235 DQGKSEMDSMMTKEFNNKLEDLINNEFKKVNTLRKKVADSRLKFDTVRHEI 285

 Score = 89.4 bits (220), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 46/102 (45%), Positives = 71/102 (69%)

Query: 284 ETKEKTETNATIADETKETKDTKDSEDLKEDSKTSTDGQLLEQLEDEFVSNTTEAVEVMT 343
           E + K E  A + D +K+    +D  + +++   S + +LLEQLEDEFVS+T  AVE+MT
Sbjct: 371 EAEPKAEVEAKVNDTSKDQLKKEDDAEKQDEQDDSEEHKLLEQLEDEFVSSTASAVEMMT 430

Query: 344 EVSENSELLSLIKLFQTFQLSYHQHCVKSLEQSLKDLNAIDN 385
           E++E+S ++ LIKLFQ FQL Y++ CV+ +E +LK LN +D+
Sbjct: 431 EITESSSIIGLIKLFQNFQLVYYRQCVQEIEANLKTLNELDH 472

>NCAS0F03540 Chr6 complement(707257..708591) [1335 bp, 444 aa] {ON}
           Anc_3.491 YPR148C
          Length = 444

 Score =  176 bits (447), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 101/268 (37%), Positives = 139/268 (51%), Gaps = 48/268 (17%)

Query: 1   MFK-FNLESITQSISEGTQ-------SLVQQFNDPKTKLSIKAKTRFLQEAIGNERDISK 52
           MF  F+L+ IT S++   Q       + +    DP TKLS++++ R  QE+IG   DIS 
Sbjct: 1   MFSNFSLDKITNSLATAAQKTSDTLSNAITTATDPATKLSLRSQKRLFQESIGTVHDIST 60

Query: 53  LPPQYVVLEKKCDSIEKVLKRILIVTKTYEIEGYDYPPNISESLSSWWQTKEWFNISELT 112
           LP QY  LE + D++EK L+RILIV+KT+E+EGYDYPPN+SES S WW          L+
Sbjct: 61  LPEQYTTLEARTDALEKCLRRILIVSKTFEMEGYDYPPNLSESFSDWWS---------LS 111

Query: 113 KNVIPKHGNVEKAGTEASKTLTDKEVSHEGPPSFASAIARAGKDSQLIFXXX-------- 164
                +    +K G                P SFA AI+ + +D   I+           
Sbjct: 112 SKKKKEQEKEDKKGF--------------LPRSFAQAISNSAEDCVEIYQHVNDGDDEDK 157

Query: 165 ---------XXXXXXXXXXXXXLVKIFKIWSDCFYEISDSKTEMDQMMIKEFNVKLEDYL 215
                                 L+K F  W+ C+  I   K EMD MM+KEFN KLE  L
Sbjct: 158 EENANNEEENEEEDEEDEDVKNLIKTFDSWAKCYKNIDQGKAEMDSMMMKEFNAKLEKLL 217

Query: 216 QKNFQKIHTLRAKVEESRLNFDTMRYEV 243
            + F+K+HTLR +V++SRL FDT+RYE+
Sbjct: 218 NEEFKKVHTLRKRVKDSRLKFDTVRYEL 245

 Score = 84.0 bits (206), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 43/93 (46%), Positives = 69/93 (74%), Gaps = 3/93 (3%)

Query: 292 NATIADETKETKDTKDSEDLKEDSKTSTDGQLLEQLEDEFVSNTTEAVEVMTEVSENSEL 351
           +AT  DE K ++D K  + +++DS+   + +LLEQLED FVS+T  AVE+M E++++SE+
Sbjct: 354 SATKVDEEKASEDKKTDKAIEDDSE---EHKLLEQLEDTFVSSTASAVEMMEEITDSSEI 410

Query: 352 LSLIKLFQTFQLSYHQHCVKSLEQSLKDLNAID 384
           + L+KLFQ FQL Y++ CV+ +E +LK LN ++
Sbjct: 411 IGLVKLFQNFQLVYYRQCVQEIEANLKTLNELE 443

>TDEL0H02240 Chr8 (377524..378540) [1017 bp, 338 aa] {ON} Anc_7.221
           YIL041W
          Length = 338

 Score = 81.6 bits (200), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 63/240 (26%), Positives = 113/240 (47%), Gaps = 19/240 (7%)

Query: 8   SITQSISEGTQSLVQQFNDPKTKLS--IKAKTRFLQEAIGNERDISKLPPQYVVLEKKCD 65
           S+ Q   E + ++ Q+  +  T L    ++  R +QE +G   DIS+LP +Y+ LE+K D
Sbjct: 10  SLNQKFQELSTAVSQRTQEISTNLPSLTQSTQRLVQERLGQVTDISQLPREYLELERKVD 69

Query: 66  SIEKVLKRILIVTKTYEIEGYDYPPNISESLSSWWQTKEWFNISELTKNVIPKHGNVEKA 125
           +I+ + +  L VT  YE E YDYP  ++ES++ + +      + EL+      H +   +
Sbjct: 70  TIKLIYENFLHVTSIYENESYDYPKYVTESVNDFSKIV-AHKVQELS------HAS---S 119

Query: 126 GTEASKTLTDKEVSHEGPPSFASAIARAGKDSQLIFXXXXXXXXXXXXXXXXLVKIFKIW 185
            +EA   L     + E P +   A+++                         +  +   +
Sbjct: 120 ASEAQNILITPTPAKE-PRTLNYALSKVS------LISSEYLNHIGDHDEAQVASVLLKY 172

Query: 186 SDCFYEISDSKTEMDQMMIKEFNVKLEDYLQKNFQKIHTLRAKVEESRLNFDTMRYEVAQ 245
           SD   +++ ++ + D M+   FN +L+D L+ NF+K    R  VE  RL +D  R  +AQ
Sbjct: 173 SDLQAKVAQARLQQDTMIQTRFNKQLKDNLEHNFKKAQKARKDVEYKRLQYDVARSNLAQ 232

 Score = 34.7 bits (78), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 19/52 (36%), Positives = 28/52 (53%)

Query: 324 LEQLEDEFVSNTTEAVEVMTEVSENSELLSLIKLFQTFQLSYHQHCVKSLEQ 375
           +E LED+F   T +A  +M EV  N++    IK     QL+YHQ     +E+
Sbjct: 245 METLEDQFAQATEDATIIMQEVLSNAKFTEEIKEMANAQLTYHQTSASLIEE 296

>KLLA0E04511g Chr5 complement(406764..407672) [909 bp, 302 aa] {ON}
           similar to uniprot|P40531 Saccharomyces cerevisiae
           YIL041W GVP36 Golgi-vesicle protein of unknown function
           green fluorescent protein (GFP)-fusion protein localizes
           to the cytoplasm
          Length = 302

 Score = 80.9 bits (198), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 66/244 (27%), Positives = 114/244 (46%), Gaps = 29/244 (11%)

Query: 2   FKFNLESITQSISEGTQ--SLVQQFNDPKTKLSIKAKT--RFLQEAIGNERDISKLPPQY 57
           F   ++ ++ S+S+  Q   L Q+F D KT L + A +  R LQE +G   DIS+LP +Y
Sbjct: 8   FSKKVQELSTSVSQKAQEAQLDQKFKDLKTNLPLLANSTQRMLQEKLGQVTDISQLPDEY 67

Query: 58  VVLEKKCDSIEKVLKRILIVTKTYEIEGYDYPPNISESLSSWWQTKEWFNISELTKNVIP 117
           V LE + ++I+ + +  L VTK YE E YDYP N+ ES            + E +K V  
Sbjct: 68  VQLEHRVETIKLIYENFLKVTKIYENESYDYPSNVKES------------VDEFSKLVGG 115

Query: 118 KHGNVEKA-GTEASKTLTDKEVSHEGPPSFASAIARAGKDSQLIFXXXXXXXXXXXXXXX 176
           K  ++ K    E ++ +       + P +   A+++    S                   
Sbjct: 116 KLHDLSKVTNREQAQNVLLSSPQMKEPKTLNYALSKVALTS------------SEHVEDE 163

Query: 177 XLVKIFKIWSDCFYEISDSKTEMDQMMIKEFNVKLEDYLQKNFQKIHTLRAKVEESRLNF 236
            L      +SD   +I+  + + D M+  +FN  +++ L+++ +     R  VE+ RL +
Sbjct: 164 SLANFLAKYSDSQTKIAQLRLQQDTMIQTKFNKAIKEKLEQDIETSTKARKLVEQKRLQY 223

Query: 237 DTMR 240
           D +R
Sbjct: 224 DVVR 227

>KLTH0A03894g Chr1 complement(328648..329619) [972 bp, 323 aa] {ON}
           similar to uniprot|P40531 Saccharomyces cerevisiae
           YIL041W GVP36 Golgi-vesicle protein of unknown function
           green fluorescent protein (GFP)-fusion protein localizes
           to the cytoplasm
          Length = 323

 Score = 79.7 bits (195), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 63/237 (26%), Positives = 107/237 (45%), Gaps = 24/237 (10%)

Query: 9   ITQSISEGTQSLVQQFNDPKTKLSIKAKTRFLQEAIGNERDISKLPPQYVVLEKKCDSIE 68
           ++ ++S+ TQ L  Q   P    S +   R +QE +G   DIS+LP +YV LE K D + 
Sbjct: 37  LSSAVSQRTQDLTTQL--PSFAQSTQ---RLVQEKLGQVTDISQLPQEYVELENKIDRVR 91

Query: 69  KVLKRILIVTKTYEIEGYDYPPNISESLSSWWQTKEWFNISELTKNVIPKHGNVEKA-GT 127
            V +  L VT+ YE E YDYP N+ +S            ++E +  V  K  ++ +A  T
Sbjct: 92  LVYENFLKVTQVYENESYDYPNNVRDS------------VNEFSSVVAGKLHDLSRATST 139

Query: 128 EASKTLTDKEVSHEGPPSFASAIARAGKDSQLIFXXXXXXXXXXXXXXXXLVKIFKIWSD 187
             ++++      H+ P +   A+++    S                    L+K    +SD
Sbjct: 140 NEAQSVLIAPGPHKDPKTLNYALSKVALTSSEYLNKSVGGDDSEVSNA--LLK----YSD 193

Query: 188 CFYEISDSKTEMDQMMIKEFNVKLEDYLQKNFQKIHTLRAKVEESRLNFDTMRYEVA 244
              +++ ++ + D ++   FN KL D L  +  +    R  VE  RL +D  R  +A
Sbjct: 194 VQAKVAQARLQQDTLIQTRFNKKLRDILANDLNEAQKARKNVEHKRLQYDIARSNLA 250

 Score = 38.1 bits (87), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 22/57 (38%), Positives = 32/57 (56%)

Query: 324 LEQLEDEFVSNTTEAVEVMTEVSENSELLSLIKLFQTFQLSYHQHCVKSLEQSLKDL 380
           +E LEDEF   T +AV VM +V+ +SELL  ++     Q  YH+   + L + L  L
Sbjct: 264 MESLEDEFAQATDDAVVVMQKVAGSSELLKELRELVAAQADYHKQSYELLSEFLPQL 320

>NDAI0A02660 Chr1 (599113..600207) [1095 bp, 364 aa] {ON} Anc_7.221
          Length = 364

 Score = 79.7 bits (195), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 64/243 (26%), Positives = 113/243 (46%), Gaps = 18/243 (7%)

Query: 2   FKFNLESITQSISEGTQSLVQQFNDPKTKLSIKAKTRFLQEAIGNERDISKLPPQYVVLE 61
           F   L+ ++ ++S+ TQ      N P      ++  R +QE +G   DIS+LP +Y+ LE
Sbjct: 11  FNKRLQELSTTVSQKTQEFST--NMPDINSLAQSTQRMVQERLGQVTDISQLPEEYLQLE 68

Query: 62  KKCDSIEKVLKRILIVTKTYEIEGYDYPPNISESLSSWWQTKEWFNISELTKNVIPKHGN 121
           +K D+I+ V    L VT T+E + YDYP    ES            + E +K+ + K   
Sbjct: 69  RKIDTIKSVYDNFLSVTNTFEHQSYDYPNVARES------------VIEFSKSAVSKVEE 116

Query: 122 VEKA--GTEASKTLTDKEVSHEGPPSFASAIARAGKDS--QLIFXXXXXXXXXXXXXXXX 177
           +  A   +EA + LT+     + P +   A+++A   S  QL                  
Sbjct: 117 LSHATSASEAQQILTNNSNQIKEPKTLNYALSKASLISSEQLNKQFSTDDDNNSNSDFKL 176

Query: 178 LVKIFKIWSDCFYEISDSKTEMDQMMIKEFNVKLEDYLQKNFQKIHTLRAKVEESRLNFD 237
           +  I   +SD   +I+ ++ + D ++ ++FN  L + L  +F++   +R  V+  RL +D
Sbjct: 177 VSSILLKFSDIQAKIAQARLQQDLLIKQKFNNNLRNDLNTSFERAQKVRKDVQNKRLQYD 236

Query: 238 TMR 240
             R
Sbjct: 237 VAR 239

 Score = 34.3 bits (77), Expect = 0.53,   Method: Compositional matrix adjust.
 Identities = 17/44 (38%), Positives = 24/44 (54%)

Query: 324 LEQLEDEFVSNTTEAVEVMTEVSENSELLSLIKLFQTFQLSYHQ 367
           +E LED+F   T  A  VM E+ ENS  +  +      QL+Y+Q
Sbjct: 257 MELLEDQFAQATEHATLVMNEIIENSNFMEYLNELARAQLAYYQ 300

>ZYRO0D16522g Chr4 complement(1371404..1372480) [1077 bp, 358 aa]
           {ON} similar to uniprot|P40531 Saccharomyces cerevisiae
           YIL041W GVP36 Golgi-vesicle protein of unknown function
           green fluorescent protein (GFP)-fusion protein localizes
           to the cytoplasm
          Length = 358

 Score = 79.3 bits (194), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 63/238 (26%), Positives = 108/238 (45%), Gaps = 26/238 (10%)

Query: 12  SISEGTQSLVQQFNDPKTKLSIKAK---------TRFLQEAIGNERDISKLPPQYVVLEK 62
           S S+ T+ L ++F    T +S KA+          R++QE +G+  DIS++P +Y+ L  
Sbjct: 2   SFSKFTEGLNEKFQQLSTTVSGKAQEFSQGIPVTHRYMQEKLGHATDISEMPQEYIDLTT 61

Query: 63  KCDSIEKVLKRILIVTKTYEIEGYDYPPNISESLSSWWQTKEWFNISELTKNVIPKHGNV 122
           K D+I+ +    L VT+ Y+ E YDYP  I+ES++ + +T     I EL+      H + 
Sbjct: 62  KVDAIKLIYNHFLQVTQVYDNESYDYPKYINESINEFSRTV-GSKIQELS------HAS- 113

Query: 123 EKAGTEASKTLTDKEVSHEGPPSFASAIARAGKDSQLIFXXXXXXXXXXXXXXXXLVKIF 182
             +  EA   L+    S + P +   A++R                         L    
Sbjct: 114 --SAHEAHSILSAPGPSKD-PKTLNYALSRVS------LVSSECMEHLSTHDDALLASYL 164

Query: 183 KIWSDCFYEISDSKTEMDQMMIKEFNVKLEDYLQKNFQKIHTLRAKVEESRLNFDTMR 240
             +SD    ++ ++   D ++   FN KL + +  N ++ H +R  VE  RL +D  R
Sbjct: 165 MKYSDIQSRVAQARLHQDSLVQTHFNAKLREEIDGNLKRAHRVRRDVENKRLTYDASR 222

 Score = 36.2 bits (82), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 21/71 (29%), Positives = 34/71 (47%), Gaps = 3/71 (4%)

Query: 313 EDSKTSTDGQL---LEQLEDEFVSNTTEAVEVMTEVSENSELLSLIKLFQTFQLSYHQHC 369
           E +K   + QL   +E  E+EF   T  A+ VM EV   +  + L++     Q SYH+  
Sbjct: 226 EKAKPEKEAQLRVQMETAEEEFAQATENAIVVMQEVIAGANFMPLLRELAAAQWSYHETA 285

Query: 370 VKSLEQSLKDL 380
            + ++  L D 
Sbjct: 286 AQRMQAFLSDF 296

>CAGL0L00891g Chr12 (108801..109826) [1026 bp, 341 aa] {ON} similar
           to uniprot|P40531 Saccharomyces cerevisiae YIL041w
          Length = 341

 Score = 76.3 bits (186), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 65/238 (27%), Positives = 109/238 (45%), Gaps = 25/238 (10%)

Query: 5   NLESITQSISEGTQSLVQQFNDPKTKLSIKAKTRFLQEAIGNERDISKLPPQYVVLEKKC 64
           NL+S + ++S+ T  L    N P    S +   R +QE +G   DIS+LP +Y+ LE K 
Sbjct: 14  NLQSFSNTVSQKTHEL--STNIPTLAQSTQ---RMVQEKLGQVTDISQLPQEYLELENKV 68

Query: 65  DSIEKVLKRILIVTKTYEIEGYDYPPNISESLSSWWQTKEWFNISELTKNVIPKHGNVEK 124
           D+I+ V +  L VT  YE E YDYP  +SES            ++E +KN+  K   + K
Sbjct: 69  DTIKIVYEHFLQVTAVYENESYDYPKYVSES------------VNEFSKNMAAKVQELSK 116

Query: 125 A--GTEASKTLTDKEVSHEGPPSFASAIARAGKDSQLIFXXXXXXXXXXXXXXXXLVKIF 182
           A   TEA   L       E P +   A+++   ++                    L K+ 
Sbjct: 117 ATSATEAQNILVAPGPVKE-PKTLNYAMSKVALNA-----SEYLNHSFDDPMDAKLSKVL 170

Query: 183 KIWSDCFYEISDSKTEMDQMMIKEFNVKLEDYLQKNFQKIHTLRAKVEESRLNFDTMR 240
             +SD   +++ ++ + D  +  +FN  + + L ++  + +  R  V+  RL +D  R
Sbjct: 171 LNYSDVQTKVAQARLQQDTQIQTKFNKVIRENLAESIARANKARKDVQSKRLQYDVAR 228

 Score = 33.9 bits (76), Expect = 0.55,   Method: Compositional matrix adjust.
 Identities = 18/48 (37%), Positives = 26/48 (54%)

Query: 324 LEQLEDEFVSNTTEAVEVMTEVSENSELLSLIKLFQTFQLSYHQHCVK 371
           +E LED+F   T +A  VM EV  ++  L  +K   T QL Y++   K
Sbjct: 246 METLEDQFAQATEDATVVMQEVIASANFLPSLKELATAQLEYYEQSAK 293

>SAKL0F08162g Chr6 complement(622302..623294) [993 bp, 330 aa] {ON}
           highly similar to uniprot|Q75AN7 Ashbya gossypii ADL115W
           ADL115Wp and similar to YIL041W uniprot|P40531
           Saccharomyces cerevisiae YIL041W GVP36 Golgi-vesicle
           protein of unknown function green fluorescent protein
           (GFP)-fusion protein localizes to the cytoplasm
          Length = 330

 Score = 75.5 bits (184), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 63/237 (26%), Positives = 107/237 (45%), Gaps = 25/237 (10%)

Query: 9   ITQSISEGTQSLVQQFNDPKTKLSIKAKTRFLQEAIGNERDISKLPPQYVVLEKKCDSIE 68
           ++Q++S+ TQ L      P    S +   R +QE +G   DIS+LP +Y+ LE + D I 
Sbjct: 37  LSQAVSQRTQDLTTSL--PSLAQSTQ---RLVQERLGQVTDISQLPQEYLELENRIDRIR 91

Query: 69  KVLKRILIVTKTYEIEGYDYPPNISESLSSWWQTKEWFNISELTKNVIPK-HGNVEKAGT 127
            V +  L VT+ YE E YDYP N+ +S            ++E +K V  K H     + T
Sbjct: 92  LVYENFLKVTQVYEHESYDYPNNVRDS------------VNEFSKTVSSKLHELSHASST 139

Query: 128 EASKTLTDKEVSHEGPPSFASAIARAGKDSQLIFXXXXXXXXXXXXXXXXLVKIFKIWSD 187
           + ++ +       + P +   A+++    S                    L+K    +SD
Sbjct: 140 DEAQNILISPGPAKDPKTLNYALSKVALTSS---EYLSKSGHEDETIATALLK----YSD 192

Query: 188 CFYEISDSKTEMDQMMIKEFNVKLEDYLQKNFQKIHTLRAKVEESRLNFDTMRYEVA 244
              +I+ ++ + D ++  +FN KL + L  +  K    R +VE  RL +D  R  +A
Sbjct: 193 VQAKIAQARLQQDTLIQTKFNKKLRETLASDLNKAVKARKEVENKRLQYDIARANLA 249

>Kwal_47.18148 s47 complement(708086..709057) [972 bp, 323 aa] {ON}
           YIL041W - Hypothetical ORF [contig 197] FULL
          Length = 323

 Score = 75.1 bits (183), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 87/373 (23%), Positives = 148/373 (39%), Gaps = 90/373 (24%)

Query: 9   ITQSISEGTQSLVQQFNDPKTKLSIKAKTRFLQEAIGNERDISKLPPQYVVLEKKCDSIE 68
           ++ ++S+ TQ    Q   P    S +   R +QE +G   DIS+LP  YV LE K D ++
Sbjct: 37  LSTAVSQKTQDFTTQL--PSLAQSTQ---RLMQEKLGQVTDISQLPQDYVELENKIDRMK 91

Query: 69  KVLKRILIVTKTYEIEGYDYPPNISESLSSWWQTKEWFNISELTKNVIPKHGNVEKA-GT 127
            V +  L VT+ YE E YDYP N+ +S            ++E +  V  K   + +A  T
Sbjct: 92  LVYENFLKVTQVYENESYDYPNNVRDS------------VNEFSSIVGTKLHELSRATST 139

Query: 128 EASKTLTDKEVSHEGPPSFASAIARAGKDSQLIFXXXXXXXXXXXXXXXXLVKIFKIWSD 187
             ++++      H+ P +   A+++    S                    L+K    +SD
Sbjct: 140 NEAQSVLISPGPHKDPKTLNYALSKVALTSSEYLNKSPGAEDSEVSSS--LLK----YSD 193

Query: 188 CFYEISDSKTEMDQMMIKEFNVKLEDYLQKNFQKIHTLRAKVEESRLNFDTMRYEVAQTS 247
              +I+ ++   D ++  +FN KL   L  +  +    R  VE  RL     +Y++A+  
Sbjct: 194 VQAKIAQARLHQDTLIQTKFNKKLRAALADDLNRAQKARKNVENKRL-----QYDIAR-- 246

Query: 248 KQTDSKELGNEDETKPSSMDANKTNTEEKEAANDKVETKEKTETNATIADETKETKDTKD 307
                               AN  N   ++ A+ +V+                       
Sbjct: 247 --------------------ANLANARPEKEASLRVQ----------------------- 263

Query: 308 SEDLKEDSKTSTDGQLLEQLEDEFVSNTTEAVEVMTEVSENSELLSLIKLFQTFQLSYHQ 367
                           +E LEDEF   T +AV +M +V+E+SELL  ++     Q  Y++
Sbjct: 264 ----------------MESLEDEFAQATDDAVVIMQKVAESSELLKDLRELVAAQAEYYK 307

Query: 368 HCVKSLEQSLKDL 380
              + L + L  L
Sbjct: 308 QSAELLSEFLPQL 320

>Ecym_4377 Chr4 complement(796971..797972) [1002 bp, 333 aa] {ON}
           similar to Ashbya gossypii ADL115W
          Length = 333

 Score = 74.3 bits (181), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 57/215 (26%), Positives = 98/215 (45%), Gaps = 22/215 (10%)

Query: 38  RFLQEAIGNERDISKLPPQYVVLEKKCDSIEKVLKRILIVTKTYEIEGYDYPPNISESLS 97
           R +QE +G   DIS++P +YV +EK+ D I  + +  L VT+ YE E YDYP ++SES  
Sbjct: 61  RMVQEKLGQITDISQMPEEYVHMEKRVDKIRLIYENFLKVTQIYESETYDYPQHVSES-- 118

Query: 98  SWWQTKEWFNISELTKNVIPKHGNVEKA-GTEASKTLTDKEVSHEGPPSFASAIARAGKD 156
                     ++E++K V  K   + KA  TE ++ +       + P +   A+++    
Sbjct: 119 ----------VNEISKTVTGKIQELTKATSTEEAQNILISPGPAKDPKTLNYALSKVSLT 168

Query: 157 SQLIFXXXXXXXXXXXXXXXXLVKIFKIWSDCFYEISDSKTEMDQMMIKEFNVKLEDYLQ 216
           S                       I   +SD   +I+ ++ + D ++   FN +L++ L 
Sbjct: 169 S-------SEYLSKSGSDSNVTADILLKYSDIQAQIAQARLQQDMLIRTRFNKQLKEKLN 221

Query: 217 KNFQKIHTLRAKVEESRLNFDTMR--YEVAQTSKQ 249
             F      R +V+  RL +D  R  +  A+  KQ
Sbjct: 222 NEFAAAARARKEVDNKRLQYDIARANFSAAKPEKQ 256

>Kpol_1070.19 s1070 (45405..46340) [936 bp, 311 aa] {ON}
           (45405..46340) [936 nt, 312 aa]
          Length = 311

 Score = 71.2 bits (173), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 69/266 (25%), Positives = 122/266 (45%), Gaps = 68/266 (25%)

Query: 12  SISEGTQSLVQQFNDPKTKLSIKAK-------------TRFLQEAIGNERDISKLPPQYV 58
           S +  T SL Q+F +  T +S K +              R +QE +GN  DIS+LP +Y+
Sbjct: 2   SFNSFTNSLSQKFQELSTAVSEKTQEFSTSIPTLAESTQRLVQEKLGNVTDISQLPQEYI 61

Query: 59  VLEKKCDSIEKVLKRILIVTKTYEIEGYDYPPNISESLSSWWQTKEWFN-ISELT----- 112
            LE++ D+I+ V +  L +T  YE E YDYP  +S+S++ +  +K + N ++EL+     
Sbjct: 62  ELERQVDTIKLVYEHFLQITAIYENESYDYPKYVSDSVNDF--SKVFANKVTELSHATSA 119

Query: 113 ---KNVI--------PKHGN--VEKAGTEASKTLTDKEVSHEGPPSFASAIARAGKDSQL 159
              +N++        P+  N  + K    +S++L      +EGP      +A A      
Sbjct: 120 QEAQNILVTPGPAKEPRTLNYALSKVALNSSESLAQLADPNEGP------VADA------ 167

Query: 160 IFXXXXXXXXXXXXXXXXLVKIFKIWSDCFYEISDSKTEMDQMMIKEFNVKLEDYLQKNF 219
                             L+K    +SD   +I+ ++   D ++  +FN +L + L+ + 
Sbjct: 168 ------------------LLK----FSDVQAKIAQTRLHQDTLIQTKFNKQLREKLELDI 205

Query: 220 QKIHTLRAKVEESRLNFDTMRYEVAQ 245
            K    R  V+  RL +D  R ++ Q
Sbjct: 206 GKASKARKDVQYKRLQYDVARSKLTQ 231

 Score = 32.3 bits (72), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 19/59 (32%), Positives = 35/59 (59%)

Query: 324 LEQLEDEFVSNTTEAVEVMTEVSENSELLSLIKLFQTFQLSYHQHCVKSLEQSLKDLNA 382
           +E LE++F  +T +A  +M EV  +S+ LS +K     QLSY +   + L++ +  L++
Sbjct: 244 MESLEEQFAQSTEDATIIMQEVIADSKFLSSLKELAEAQLSYFETSAQLLKEFMPVLDS 302

>ADL115W Chr4 (483164..484165) [1002 bp, 333 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YIL041W
          Length = 333

 Score = 70.9 bits (172), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 62/246 (25%), Positives = 112/246 (45%), Gaps = 25/246 (10%)

Query: 6   LESITQSISEGTQSLVQQFNDPKTKLSIKAKTRFLQEAIGNERDISKLPPQYVVLEKKCD 65
           L+ ++ S+S+ TQ L    N P    + +   R +QE +G   DIS++P +YV LE++ D
Sbjct: 34  LKDLSLSVSQRTQDLTS--NLPSLAQTTQ---RRVQERLGQVTDISQMPEEYVELEQRVD 88

Query: 66  SIEKVLKRILIVTKTYEIEGYDYPPNISESLSSWWQTKEWFNISELTKNVIPKHGNVEKA 125
             + +    L V++ YE E YDYP +IS+S++ + +T     + ELTK            
Sbjct: 89  RTKLIYDNFLKVSQIYESESYDYPQHISDSVNDFSKTVTG-KVQELTKATT--------- 138

Query: 126 GTEASKTLTDKEVSHEGPPSFASAIARAGKDSQLIFXXXXXXXXXXXXXXXXLVKIFKIW 185
            TE ++++         P +   A+++    S                       I   +
Sbjct: 139 -TEEAQSILISPGPARNPKTLNYALSKVALTS-------SEYLSKSGSDDVVTADILLKY 190

Query: 186 SDCFYEISDSKTEMDQMMIKEFNVKLEDYLQKNFQKIHTLRAKVEESRLNFDTMR--YEV 243
           SD   +I+ ++ + D ++   FN +L + L   F +    R +V++ RL +D  R  +  
Sbjct: 191 SDVQAKIAQARLQQDTLIQTRFNRRLREKLNTQFAEAMQSRKQVDQKRLQYDIARANFTA 250

Query: 244 AQTSKQ 249
           A+  KQ
Sbjct: 251 ARPEKQ 256

>KAFR0I01950 Chr9 (398299..399291) [993 bp, 330 aa] {ON} Anc_7.221
           YIL041W
          Length = 330

 Score = 70.5 bits (171), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 63/239 (26%), Positives = 110/239 (46%), Gaps = 21/239 (8%)

Query: 2   FKFNLESITQSISEGTQSLVQQFNDPKTKLSIKAKTRFLQEAIGNERDISKLPPQYVVLE 61
           F    + ++ S+S+ TQ L    N P    S +   R +QE +G   DIS+LP +Y+ LE
Sbjct: 11  FTKRFQELSTSVSQRTQELSN--NLPTLAQSTQ---RLVQEKLGQVTDISQLPQEYLELE 65

Query: 62  KKCDSIEKVLKRILIVTKTYEIEGYDYPPNISESLSSWWQTKEWFNISELTKNVIPKHGN 121
           KK DSI+ + +  L VT  YE E YDYP  I +S++ + +T     I++L+      H +
Sbjct: 66  KKVDSIKLIHEHFLQVTSIYENESYDYPKVIKDSVNDFSKTMAA-KITDLS------HAS 118

Query: 122 VEKAGTEASKTLTDKEVSHEGPPSFASAIARAGKDSQLIFXXXXXXXXXXXXXXXXLVKI 181
              + +EA   L       + P +   A+++    +  +                 L   
Sbjct: 119 ---SASEAQNILISPGPIRD-PKTLNYALSKVSLTASEVINQVGSTPNESALSSKLLE-- 172

Query: 182 FKIWSDCFYEISDSKTEMDQMMIKEFNVKLEDYLQKNFQKIHTLRAKVEESRLNFDTMR 240
              +S+   +I+ ++ + D ++  +FN  L D L  +  K +  R +V+  RL +D  R
Sbjct: 173 ---FSNVQSKIAQARLQQDTLIQTKFNKALRDDLSTSLAKANKFRKEVQNKRLQYDVAR 228

 Score = 32.0 bits (71), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 19/52 (36%), Positives = 26/52 (50%)

Query: 324 LEQLEDEFVSNTTEAVEVMTEVSENSELLSLIKLFQTFQLSYHQHCVKSLEQ 375
           +E LEDEF   T  A  VM EV   S+ L+ +      QL Y Q   + L++
Sbjct: 246 MESLEDEFAQATENATLVMQEVIAGSDFLTSLNQMVAAQLEYFQTSAQLLQE 297

>KNAG0D01760 Chr4 (296169..297197) [1029 bp, 342 aa] {ON} Anc_7.221
           YIL041W
          Length = 342

 Score = 70.1 bits (170), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 57/204 (27%), Positives = 95/204 (46%), Gaps = 16/204 (7%)

Query: 38  RFLQEAIGNERDISKLPPQYVVLEKKCDSIEKVLKRILIVTKTYEIEGYDYPPNISESLS 97
           R +QE +G   DIS+LP +Y+ LEK+ D+++ V +  L VT  YE E YDYP  + +S++
Sbjct: 42  RLVQEKLGQVTDISQLPQEYLELEKRVDALKLVHEHFLQVTAIYENESYDYPKYVRDSVN 101

Query: 98  SWWQTKEWFNISELTKNVIPKHGNVEKAGTEASKTLTDKEVSHEGPPSFASAIAR-AGKD 156
            W +T     +SEL      +H +   +  EA   +       E P +   A+++ A   
Sbjct: 102 EWSRTVAT-RVSEL------RHVS---SAAEAQHVIAAPTQETE-PKTLHYALSKVALNG 150

Query: 157 SQLIFXXXXXXXXXXXXXXXXLVKIFKIWSDCFYEISDSKTEMDQMMIKEFNVKLEDYLQ 216
           SQL+                 L++    +S    E++ ++ E D  +  +FN KL   L 
Sbjct: 151 SQLVDNLDAPRTPRETQLSSGLLE----FSGVEAELAQARLEQDAAVKAQFNEKLRGQLS 206

Query: 217 KNFQKIHTLRAKVEESRLNFDTMR 240
               +    R +V + RL +D  R
Sbjct: 207 GEIARAAAARKEVFQKRLQYDVAR 230

 Score = 37.0 bits (84), Expect = 0.064,   Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 26/51 (50%)

Query: 324 LEQLEDEFVSNTTEAVEVMTEVSENSELLSLIKLFQTFQLSYHQHCVKSLE 374
           +E LEDEF   T  A  VM EV   ++LL  ++     Q +YH+     LE
Sbjct: 248 METLEDEFAQCTEHATIVMQEVLSQADLLGAVRRLAAAQHAYHERSAAILE 298

>TBLA0B01580 Chr2 (345206..346366) [1161 bp, 386 aa] {ON} Anc_7.221
           YIL041W
          Length = 386

 Score = 68.9 bits (167), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 56/219 (25%), Positives = 99/219 (45%), Gaps = 18/219 (8%)

Query: 40  LQEAIGNERDISKLPPQYVVLEKKCDSIEKVLKRILIVTKTYEIEGYDYPPNISESLSSW 99
           +QE  G   DIS LP +Y+ LE++ DSI+ V    L +T  YE E YDYP ++ +S++ +
Sbjct: 1   MQEKFGQVTDISPLPQEYLDLEQQVDSIKLVYDHFLRITTVYENESYDYPKDVRDSITEF 60

Query: 100 WQTKEWFNISELTKNV------IPKHGNVEKAGTEASKTLTDKEVSHEGPPSFASAIARA 153
            +T     + EL   +          G+VE   T  S   +    +   P +  +A+++A
Sbjct: 61  QKTASS-RVQELQTKISNSSDNSHSSGSVEPMRTSVSSVGSINNYNQNSPRTLNNALSKA 119

Query: 154 GKDSQLIFXXXXXXXXXXXXXXXXLVKIFKIWSDCFYEISDSKTEMDQMMIKEFNVKLED 213
                 +F                   +F  +S+    ISD + + D+++ K FN +L++
Sbjct: 120 A-----LFAAEQLKMDKDSST------VFHSFSEAESIISDERIKQDKIIQKSFNTELKN 168

Query: 214 YLQKNFQKIHTLRAKVEESRLNFDTMRYEVAQTSKQTDS 252
            L       +  R  V+  RL +D  R ++   S+  +S
Sbjct: 169 VLTNRIDVANKHRKDVQNKRLQYDISRTKLDHASEDKES 207

>NCAS0A13380 Chr1 complement(2633641..2634630) [990 bp, 329 aa] {ON}
           Anc_7.221
          Length = 329

 Score = 68.6 bits (166), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 64/244 (26%), Positives = 111/244 (45%), Gaps = 19/244 (7%)

Query: 1   MFKFN--LESITQSISEGTQSLVQQFNDPKTKLSIKAKT--RFLQEAIGNERDISKLPPQ 56
           M  FN    S ++++SE + ++ Q+  +  T L   A++  R +QE +G   DIS+LP +
Sbjct: 1   MSSFNSFTNSFSKTLSELSSTVSQKTQELSTNLPNLAQSTQRMVQERLGQVTDISQLPEE 60

Query: 57  YVVLEKKCDSIEKVLKRILIVTKTYEIEGYDYPPNISESLSSWWQTKEWFNISELTKNVI 116
           Y+ LE K DSI+++    L V+  YE + YDYP    ESL  + +T     + EL+    
Sbjct: 61  YLELEMKLDSIKQIYDNFLAVSSVYEQQSYDYPYVAKESLIEFSKTAAS-KVEELS---- 115

Query: 117 PKHGNVEKAGTEASKTLTDKEVSHEGPPSFASAIARAGKDSQLIFXXXXXXXXXXXXXXX 176
             H +   +  EA   LT      + P +   A+++    S                   
Sbjct: 116 --HAS---SAHEAQNILTTSSTQIKEPKTLNFALSKVALKSSEHLNQFNDNEAFKSSASA 170

Query: 177 XLVKIFKIWSDCFYEISDSKTEMDQMMIKEFNVKLEDYLQKNFQKIHTLRAKVEESRLNF 236
            L      +S+   +I+ ++ + D ++ ++FN  L   L  N  K   +R +V+  RL +
Sbjct: 171 LLN-----FSNIQAKIAQARLQQDLLIKQKFNDALRHDLATNIAKATKVRKEVQSKRLQY 225

Query: 237 DTMR 240
           D  R
Sbjct: 226 DIAR 229

 Score = 31.2 bits (69), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 16/42 (38%), Positives = 25/42 (59%)

Query: 324 LEQLEDEFVSNTTEAVEVMTEVSENSELLSLIKLFQTFQLSY 365
           +E LED+F   T  A  VM +V +NS+++S +      QL+Y
Sbjct: 247 METLEDDFAQATEHATIVMQDVIDNSDIVSRVNELARAQLAY 288

>Skud_9.128 Chr9 (245338..246327) [990 bp, 329 aa] {ON} YIL041W
           (REAL)
          Length = 329

 Score = 68.2 bits (165), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 67/243 (27%), Positives = 105/243 (43%), Gaps = 26/243 (10%)

Query: 6   LESITQSISEGTQSLVQQFNDPKTKLSIKAKTRFLQEAIGNERDISKLPPQYVVLEKKCD 65
           L+ I+ S+SE TQ L      P    S +   R +QE +G   DIS+LP +Y  LE K D
Sbjct: 14  LQEISTSVSERTQEL------PNFAQSTQ---RMVQERLGQVTDISQLPREYTELEDKVD 64

Query: 66  SIEKVLKRILIVTKTYEIEGYDYPPNISESLSSWWQTKEWFNISELTKNVIPKHGNVEKA 125
           +I+ +    L VT  YE   YDYP  I+ES++ + ++     ++ELT      H     +
Sbjct: 65  TIKLIYNHFLGVTAIYENGSYDYPKYINESVNEFSRSVAS-KLTELT------HAT---S 114

Query: 126 GTEASKTLTDKEVSHEGPPSFASAIARAGKDSQLIFXXXXXXXXXXXXXXXXLVKIFKIW 185
            +EA   L       E P +   A+++   +S                    L      +
Sbjct: 115 ASEAQNILVAPGPIKE-PKTLNYALSKVSLNSSECLNKMFPAEEQP------LASALLQF 167

Query: 186 SDCFYEISDSKTEMDQMMIKEFNVKLEDYLQKNFQKIHTLRAKVEESRLNFDTMRYEVAQ 245
           SD   +I+ ++ + D ++  +FN KL + L     K    R  V   RL +D  R  +A 
Sbjct: 168 SDVQAKIAQTRIQQDTLIQTKFNKKLRERLSFEIGKADKCRKDVHSMRLRYDVARTNLAN 227

Query: 246 TSK 248
             K
Sbjct: 228 NKK 230

>Smik_9.150 Chr9 (250717..251697) [981 bp, 326 aa] {ON} YIL041W
           (REAL)
          Length = 326

 Score = 67.8 bits (164), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 66/243 (27%), Positives = 105/243 (43%), Gaps = 26/243 (10%)

Query: 6   LESITQSISEGTQSLVQQFNDPKTKLSIKAKTRFLQEAIGNERDISKLPPQYVVLEKKCD 65
           L+ I+ S+SE TQ L      P    S +   R +QE +G   DIS+LP +Y  LE+K D
Sbjct: 14  LQEISTSVSEKTQEL------PSLAQSTQ---RMVQERLGQVTDISQLPREYTELEEKVD 64

Query: 66  SIEKVLKRILIVTKTYEIEGYDYPPNISESLSSWWQTKEWFNISELTKNVIPKHGNVEKA 125
           +I+ +    L VT  YE   YDYP  I+ES++ + ++     ++ELT      H     +
Sbjct: 65  TIKLIYNHFLGVTAIYENGSYDYPKYINESVNEFSRSVAS-KLTELT------HAT---S 114

Query: 126 GTEASKTLTDKEVSHEGPPSFASAIARAGKDSQLIFXXXXXXXXXXXXXXXXLVKIFKIW 185
            +EA   L       E P +   A+++   +S                    L      +
Sbjct: 115 ASEAQNILVAPGPIKE-PKTLNYALSKVALNSSECLNKMLPTEEQP------LASALLQF 167

Query: 186 SDCFYEISDSKTEMDQMMIKEFNVKLEDYLQKNFQKIHTLRAKVEESRLNFDTMRYEVAQ 245
           SD   +I+ ++ + D ++  +FN  L + L     K    R  V   RL +D  R  +A 
Sbjct: 168 SDVQAKIAQARIQQDTLIQTKFNKNLRERLSFEIGKADKTRKDVHSMRLRYDVARTNLAN 227

Query: 246 TSK 248
             K
Sbjct: 228 NKK 230

>YIL041W Chr9 (276525..277505) [981 bp, 326 aa] {ON}  GVP36BAR
           domain-containing protein that localizes to both early
           and late Golgi vesicles; required for adaptation to
           varying nutrient concentrations, fluid-phase
           endocytosis, polarization of the actin cytoskeleton, and
           vacuole biogenesis
          Length = 326

 Score = 67.4 bits (163), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 66/243 (27%), Positives = 104/243 (42%), Gaps = 26/243 (10%)

Query: 6   LESITQSISEGTQSLVQQFNDPKTKLSIKAKTRFLQEAIGNERDISKLPPQYVVLEKKCD 65
           L+ I+ S+SE TQ L      P    S +   R +QE +G   DIS+LP +Y  LE K D
Sbjct: 14  LQEISTSVSEKTQEL------PSLAQSTQ---RMVQERLGQVTDISQLPREYTELEDKVD 64

Query: 66  SIEKVLKRILIVTKTYEIEGYDYPPNISESLSSWWQTKEWFNISELTKNVIPKHGNVEKA 125
           +I+ +    L VT  YE   YDYP  I+ES++ + ++     ++ELT      H     +
Sbjct: 65  TIKLIYNHFLGVTAIYENGSYDYPKYINESVNEFSRSVAS-KLTELT------HAT---S 114

Query: 126 GTEASKTLTDKEVSHEGPPSFASAIARAGKDSQLIFXXXXXXXXXXXXXXXXLVKIFKIW 185
            +EA   L       E P +   A+++   +S                    L      +
Sbjct: 115 ASEAQNILVAPGPIKE-PKTLNYALSKVALNSSECLNKMFPTEEQP------LASALLQF 167

Query: 186 SDCFYEISDSKTEMDQMMIKEFNVKLEDYLQKNFQKIHTLRAKVEESRLNFDTMRYEVAQ 245
           SD   +I+ ++ + D ++  +FN  L + L     K    R  V   RL +D  R  +A 
Sbjct: 168 SDVQAKIAQARIQQDTLIQTKFNKNLRERLSFEIGKADKCRKDVHSMRLRYDVARTNLAN 227

Query: 246 TSK 248
             K
Sbjct: 228 NKK 230

>TPHA0B02750 Chr2 (627808..628899) [1092 bp, 363 aa] {ON} Anc_7.221
           YIL041W
          Length = 363

 Score = 67.0 bits (162), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 58/223 (26%), Positives = 95/223 (42%), Gaps = 45/223 (20%)

Query: 38  RFLQEAIGNERDISKLPPQYVVLEKKCDSIEKVLKRILIVTKTYEIEGYDYPPNISESLS 97
           R ++E +G  +DIS LP +YV LE K D+++++ +  L VT  YE E YDYP    E   
Sbjct: 37  RLMKEKLGQAKDISTLPQEYVELETKIDTMKEIYEHFLKVTMVYEKESYDYPKEFGE--- 93

Query: 98  SWWQ----TKEWF---NISELTKNV-IPKHGNVEKAGTEASKTLTDKEVSHEGPPSFASA 149
           S+W+      E F   NISE    V IPK  N                       +  + 
Sbjct: 94  SFWEFTDSVGEKFSALNISEHNNKVKIPKTLNY----------------------ALHNV 131

Query: 150 IARAGKDSQLIFXXXXXXXXXXXXXXXXLVKIFKIWSDCFYEISDSKTEMDQMMIKEFNV 209
              A +  +L+                 L +     S+   +I++++   D ++    N 
Sbjct: 132 FLTANEKVKLLH----------EPLDNSLSETLASLSETEADIAEARLHQDSLVKSRINY 181

Query: 210 KLEDYLQKNFQKIHTLRAKVEESRLNFDTMR--YEVAQTSKQT 250
           +L++ L +NF++    R  V   R N+D  +  +E A+  KQ 
Sbjct: 182 QLKEELSQNFERAAKYRKAVHHKRFNYDVAKTNFEHAKPEKQA 224

 Score = 33.5 bits (75), Expect = 0.84,   Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 26/51 (50%)

Query: 327 LEDEFVSNTTEAVEVMTEVSENSELLSLIKLFQTFQLSYHQHCVKSLEQSL 377
           L+DEF   T +A  VM E+  NS L  ++K     QL YHQ     L + L
Sbjct: 233 LKDEFEQATKDATIVMQEIISNSRLEHILKELAVSQLVYHQRSTDLLNKFL 283

>Suva_9.159 Chr9 (265174..266151) [978 bp, 325 aa] {ON} YIL041W
           (REAL)
          Length = 325

 Score = 65.1 bits (157), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 64/243 (26%), Positives = 105/243 (43%), Gaps = 26/243 (10%)

Query: 6   LESITQSISEGTQSLVQQFNDPKTKLSIKAKTRFLQEAIGNERDISKLPPQYVVLEKKCD 65
           L+ ++ S+SE TQ L      P    S +   R +QE +G   DIS+LP +Y  LE K D
Sbjct: 14  LQELSTSVSERTQDL------PNLAQSTQ---RMVQERLGQVTDISQLPREYTELEDKVD 64

Query: 66  SIEKVLKRILIVTKTYEIEGYDYPPNISESLSSWWQTKEWFNISELTKNVIPKHGNVEKA 125
           +I+ +    L VT  YE   YDYP  I+ES++ +  +     ++ELT      H     +
Sbjct: 65  TIKLIYNHFLGVTAIYENGSYDYPKYINESVNEFSSSLAS-KLTELT------HAT---S 114

Query: 126 GTEASKTLTDKEVSHEGPPSFASAIARAGKDSQLIFXXXXXXXXXXXXXXXXLVKIFKIW 185
            ++A   L       E P +   A+++   +S                    L      +
Sbjct: 115 ASQAQNILVAPGPIKE-PKTLNYALSKVALNSSECL------NKMFPTEEQPLASSLLQF 167

Query: 186 SDCFYEISDSKTEMDQMMIKEFNVKLEDYLQKNFQKIHTLRAKVEESRLNFDTMRYEVAQ 245
           SD   +I+ ++ + D ++  +FN KL + +     K    R +V   RL +D  R  +A 
Sbjct: 168 SDVQAKIAQARIQQDTLIQTKFNKKLRERVSFEIGKADKCRKEVHSMRLRYDVARTNLAN 227

Query: 246 TSK 248
             K
Sbjct: 228 NKK 230

>TBLA0D04200 Chr4 (1038483..1039478) [996 bp, 331 aa] {ON} Anc_7.221
           YIL041W
          Length = 331

 Score = 63.2 bits (152), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 51/235 (21%), Positives = 101/235 (42%), Gaps = 20/235 (8%)

Query: 6   LESITQSISEGTQSLVQQFNDPKTKLSIKAKTRFLQEAIGNERDISKLPPQYVVLEKKCD 65
           L+ +++S+S+ TQ +   +         + + R  QE +G   DIS++P +Y+ LE + D
Sbjct: 14  LQGLSESVSQKTQEMASTW-----PAYAQVQQRLAQEKLGQITDISQMPREYIDLEDRID 68

Query: 66  SIEKVLKRILIVTKTYEIEGYDYPPNISESLSSWWQTKEWFNISELTKNVIPKHGNVEKA 125
           +++  ++ +L VT+ YE   YD+P +  ES+  W +      + EL++           +
Sbjct: 69  NLQNSIQVLLHVTRVYEEPAYDWPYSTQESVQDWSRAI-GSRVQELSR---------ASS 118

Query: 126 GTEASKTLTDKEVSHEGPPSFASAIARAGKDSQLIFXXXXXXXXXXXXXXXXLVKIFKIW 185
            +EA   L        GP +   A+++A      +                 L      +
Sbjct: 119 ASEAGNLLKSPVGPENGPRTLNYALSQAS-----LAVSTLTSSNMPGPNGEGLSSGLIAY 173

Query: 186 SDCFYEISDSKTEMDQMMIKEFNVKLEDYLQKNFQKIHTLRAKVEESRLNFDTMR 240
           SD   +++  +   D  +  +FN +L + L     K +  R  V+  R+ +D  R
Sbjct: 174 SDTQAKLAQIRIAQDTQVQTKFNKQLREILNNPIAKANKYRKDVQYKRVLYDIAR 228

>TPHA0C01230 Chr3 (280944..281861) [918 bp, 305 aa] {ON} Anc_7.221
           YIL041W
          Length = 305

 Score = 62.8 bits (151), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 67/251 (26%), Positives = 118/251 (47%), Gaps = 41/251 (16%)

Query: 8   SITQSISEGTQSLVQQFNDPKTKL-SIKAKT-RFLQEAIGNERDISKLPPQYVVLEKKCD 65
           S+TQ   E +  + ++  D  T + SI + T R +QE +GN  DIS+LP +Y+ LEK+ D
Sbjct: 9   SLTQKFQELSTVVSERTQDLGTSIPSIASSTQRLVQEKLGNVTDISQLPQEYLELEKEID 68

Query: 66  SIEKVLKRILIVTKTYEIEGYDYPPNISESLSSW---WQTK----EWFNISELTKNVIPK 118
           +I+ V +  L +T  Y+ E YDYP  +S+S++ +   +Q+K         +E  +N++  
Sbjct: 69  TIKLVYEHFLKITSIYDNESYDYPKYVSDSVNDYSKLFQSKIEDLSRATSAEEAQNILVT 128

Query: 119 HGNVEKAGT---EASKT-LTDKEVSHEGPPSFASAIARAGKDSQLIFXXXXXXXXXXXXX 174
            G + +  T     SK  LT  E  ++      SA+A                       
Sbjct: 129 PGPITEPRTLNYALSKVALTSSESLNQLQDPNVSAVA----------------------- 165

Query: 175 XXXLVKIFKIWSDCFYEISDSKTEMDQMMIKEFNVKLEDYLQKNFQKIHTLRAKVEESRL 234
              L+K    +SD   +I+  + + D ++  + N  +++ L    +K    R  V+  RL
Sbjct: 166 -STLLK----FSDMQTKIAQQRLQQDTLIQTKVNKVIKEKLSSLIEKATKSRRDVQYKRL 220

Query: 235 NFDTMRYEVAQ 245
            +D  R ++AQ
Sbjct: 221 QYDVARSKLAQ 231

>Kpol_478.22 s478 (67833..68885) [1053 bp, 350 aa] {ON}
          (67833..68885) [1053 nt, 351 aa]
          Length = 350

 Score = 54.3 bits (129), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 26/62 (41%), Positives = 38/62 (61%)

Query: 38 RFLQEAIGNERDISKLPPQYVVLEKKCDSIEKVLKRILIVTKTYEIEGYDYPPNISESLS 97
          R ++E +G   DIS LP +Y+ LE K D+ + V +  L +T  YE E YDYP   SES++
Sbjct: 37 RMVKEKLGQVDDISPLPQEYLDLELKIDTYKSVYEHFLKITSIYERESYDYPKEFSESVN 96

Query: 98 SW 99
           +
Sbjct: 97 EF 98

 Score = 38.1 bits (87), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 23/62 (37%), Positives = 33/62 (53%), Gaps = 6/62 (9%)

Query: 324 LEQLEDEFVSNTTEAVEVMTEVSENSELLSLIKLFQTFQLSYHQHCVKSLEQSLKDLNAI 383
           LE LEDEF   T +A+ VM E+  N+     +K F   +L+YH+  V +L       N +
Sbjct: 230 LEILEDEFNHATKDAIMVMQEIISNNRFEQNLKDFAAAKLAYHEKSVDALR------NLL 283

Query: 384 DN 385
           DN
Sbjct: 284 DN 285

>KAFR0L01120 Chr12 complement(211027..212679) [1653 bp, 550 aa] {ON}
           Anc_7.275 YER082C
          Length = 550

 Score = 32.0 bits (71), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 24/90 (26%), Positives = 43/90 (47%), Gaps = 6/90 (6%)

Query: 235 NFDTMR---YEVAQTSKQTDSKELGNEDETKPSSMDANKTNTEEKEAANDKVETKEKTET 291
           N+D +    YE A+  ++ + + L N+      ++D N   + +K A+N ++  K+  E 
Sbjct: 405 NYDALEINPYETAKQRQEQEVRSLLNKLPADTITLDPNVLGSIDKSASNTRLTAKDLAEL 464

Query: 292 NATIADETKETKDTKDSEDLKEDSKTSTDG 321
                D++KE KD     D+K D K    G
Sbjct: 465 TVEKRDQSKENKDI---PDVKPDVKGKNSG 491

>Smik_7.139 Chr7 (251686..255480) [3795 bp, 1264 aa] {ON} YGL133W
           (REAL)
          Length = 1264

 Score = 31.2 bits (69), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 37/123 (30%), Positives = 54/123 (43%), Gaps = 10/123 (8%)

Query: 189 FYEISDSKTEMDQMMIKEFNVKLEDYLQK--NFQKIHTLRAKVEE--SRLNFDTMRYEVA 244
           F++  DS+    + +   F +KL + + +  +F  I  L A VE+  +R   D    EV 
Sbjct: 65  FFQALDSEETQFKYVEDRFPLKLREPVARFLHFNGIRRLDALVEKVYARFKNDFFPGEVV 124

Query: 245 QTSKQTD-SKELGNEDETKPSSMDANKTNTEEKEAA-----NDKVETKEKTETNATIADE 298
              KQ D S    N  +  P   D  + N+    AA       +   KEK + NATI  E
Sbjct: 125 YLRKQKDASTTSSNSQQGTPQPDDMAEKNSISNPAAPQYQYQKRYIIKEKVQFNATINPE 184

Query: 299 TKE 301
           TKE
Sbjct: 185 TKE 187

>TBLA0G03710 Chr7 (984437..984847) [411 bp, 136 aa] {ON}
          Length = 136

 Score = 29.6 bits (65), Expect = 6.2,   Method: Compositional matrix adjust.
 Identities = 18/48 (37%), Positives = 28/48 (58%), Gaps = 6/48 (12%)

Query: 294 TIADETKETKDTKDSEDLKEDSKTSTDGQLLEQLEDEFVSNTTEAVEV 341
           T+A+E  ET  T  + ++ EDSKT+   ++ EQ      +NTT A E+
Sbjct: 32  TVANEINETSKTTVAREITEDSKTTVANEIKEQ------TNTTVATEI 73

>CAGL0J05456g Chr10 (521362..522477) [1116 bp, 371 aa] {ON} similar
           to uniprot|P53938 Saccharomyces cerevisiae YNL080c
          Length = 371

 Score = 30.4 bits (67), Expect = 8.8,   Method: Compositional matrix adjust.
 Identities = 21/63 (33%), Positives = 32/63 (50%), Gaps = 9/63 (14%)

Query: 48  RDISKLPPQYVVLEKKCDSIEKVLKRILIVTKTYEIEGYDYPPNISESLSSWWQTKEWFN 107
           RD+S LPP Y             LK+   ++    I+ Y+ P ++ ESL ++WQT    N
Sbjct: 42  RDVSMLPPVYYTFMS--------LKKAWQISIQTTIKLYE-PQSLRESLIAFWQTYMVAN 92

Query: 108 ISE 110
           IS+
Sbjct: 93  ISD 95

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.308    0.124    0.335 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 39,109,927
Number of extensions: 1732714
Number of successful extensions: 23777
Number of sequences better than 10.0: 1915
Number of HSP's gapped: 21725
Number of HSP's successfully gapped: 2876
Length of query: 385
Length of database: 53,481,399
Length adjustment: 111
Effective length of query: 274
Effective length of database: 40,753,473
Effective search space: 11166451602
Effective search space used: 11166451602
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.7 bits)
S2: 67 (30.4 bits)