Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
CAGL0L08470gsingletonON1601608581e-119
KNAG0H016701.396ON42479644.1
YPL138C (SPP1)8.650ON35325619.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0L08470g
         (160 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0L08470g Chr12 complement(930435..930917) [483 bp, 160 aa] {...   335   e-119
KNAG0H01670 Chr8 (298481..299755) [1275 bp, 424 aa] {ON} Anc_1.3...    29   4.1  
YPL138C Chr16 complement(291366..292427) [1062 bp, 353 aa] {ON} ...    28   9.7  

>CAGL0L08470g Chr12 complement(930435..930917) [483 bp, 160 aa] {ON}
           no similarity
          Length = 160

 Score =  335 bits (858), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 160/160 (100%), Positives = 160/160 (100%)

Query: 1   MYASQSCFDLFRCVASYDVETMENGLHITIHVRRKFNESFEFRLLSGIVAQQSHASGGVH 60
           MYASQSCFDLFRCVASYDVETMENGLHITIHVRRKFNESFEFRLLSGIVAQQSHASGGVH
Sbjct: 1   MYASQSCFDLFRCVASYDVETMENGLHITIHVRRKFNESFEFRLLSGIVAQQSHASGGVH 60

Query: 61  CLNHLAVDLDVSAQEDQLLPAMSVVHFSPGIVPFHHTSLHITVESKDVVLVHICMYCRYI 120
           CLNHLAVDLDVSAQEDQLLPAMSVVHFSPGIVPFHHTSLHITVESKDVVLVHICMYCRYI
Sbjct: 61  CLNHLAVDLDVSAQEDQLLPAMSVVHFSPGIVPFHHTSLHITVESKDVVLVHICMYCRYI 120

Query: 121 PFTHGNTIAMGCESSDPDITAADRDCHGKNSGDWRCGKRR 160
           PFTHGNTIAMGCESSDPDITAADRDCHGKNSGDWRCGKRR
Sbjct: 121 PFTHGNTIAMGCESSDPDITAADRDCHGKNSGDWRCGKRR 160

>KNAG0H01670 Chr8 (298481..299755) [1275 bp, 424 aa] {ON} Anc_1.396
           YLR174W
          Length = 424

 Score = 29.3 bits (64), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 25/79 (31%), Positives = 39/79 (49%), Gaps = 6/79 (7%)

Query: 31  HVRRKFNE---SFEFRLLSGIVAQQSHASGG-VHCLNHLAVDL--DVSAQEDQLLPAMSV 84
           H + KF E   +FE RL+  +VAQ   ++GG +  L +   D+  D+ AQ    L  M+ 
Sbjct: 237 HYKTKFEELGITFEHRLIDDMVAQMLKSNGGFILSLKNYDGDVQSDIVAQGFGSLGLMTS 296

Query: 85  VHFSPGIVPFHHTSLHITV 103
           +  +P    F   + H TV
Sbjct: 297 MLVTPDDSVFESEAAHGTV 315

>YPL138C Chr16 complement(291366..292427) [1062 bp, 353 aa] {ON}
           SPP1Subunit of COMPASS (Set1C), a complex which
           methylates histone H3 on lysine 4 and is required in
           telomeric transcriptional silencing; interacts with
           Orc2p; PHD finger domain protein similar to human CGBP,
           an unmethylated CpG binding protein
          Length = 353

 Score = 28.1 bits (61), Expect = 9.7,   Method: Compositional matrix adjust.
 Identities = 12/25 (48%), Positives = 15/25 (60%)

Query: 94  FHHTSLHITVESKDVVLVHICMYCR 118
           FH T LHI  + KD+V    C YC+
Sbjct: 46  FHFTCLHIPEQFKDLVFSFYCPYCQ 70

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.325    0.137    0.437 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 16,545,151
Number of extensions: 620256
Number of successful extensions: 1509
Number of sequences better than 10.0: 6
Number of HSP's gapped: 1518
Number of HSP's successfully gapped: 6
Length of query: 160
Length of database: 53,481,399
Length adjustment: 101
Effective length of query: 59
Effective length of database: 41,900,133
Effective search space: 2472107847
Effective search space used: 2472107847
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 61 (28.1 bits)