Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
CAGL0L08448g3.493ON1731738981e-125
CAGL0I10494g3.493ON1721746676e-90
Smik_16.4023.493ON1731736476e-87
YPR149W (NCE102)3.493ON1731736477e-87
Skud_16.4443.493ON1731736415e-86
KNAG0B008003.493ON1821826034e-80
NCAS0E008003.493ON1741755879e-78
Suva_16.4783.493ON1661735712e-75
KNAG0A079503.493ON1821825671e-74
NDAI0G009303.493ON1761765601e-73
KAFR0C019703.493ON1791795523e-72
TDEL0D056103.493ON1751755496e-72
YGR131W (FHN1)3.493ON1741745201e-67
NDAI0B058803.493ON1821825002e-64
KAFR0G037003.493ON1861774933e-63
Kpol_1017.63.493ON1871874891e-62
KLLA0D16280g3.493ON1691734853e-62
Suva_7.4193.493ON1741744767e-61
SAKL0F02750g3.493ON1701734723e-60
Smik_6.2273.493ON1741744723e-60
TPHA0D032803.493ON1841844707e-60
ZYRO0D09966g3.493ON1781784639e-59
TBLA0D029603.493ON1891894612e-58
Skud_7.4423.493ON1741744523e-57
Kwal_55.212383.493ON1701734411e-55
NCAS0F035603.493ON1831834386e-55
TBLA0C044903.493ON1861564326e-54
KLTH0F14850g3.493ON1711744098e-51
Ecym_12363.493ON1691733231e-37
AFR312W3.493ON1681452882e-32
Smik_4.212.61ON316159760.15
Suva_4.272.61ON322159750.21
TDEL0H00180singletonON25751720.40
Kwal_23.4058singletonON216144691.1
Kpol_530.476.102ON13551671.4
SAKL0F16764gsingletonON28478681.7
YKL221W (MCH2)singletonON47347663.0
Kwal_23.46502.61ON385160663.4
KNAG0I017506.26ON32484654.1
CAGL0H10076g3.263ON32554636.0
SAKL0E01408g6.26ON307122636.8
YDL218W2.61ON317159637.4
TBLA0E02500singletonON57654638.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0L08448g
         (173 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0L08448g Chr12 complement(928396..928917) [522 bp, 173 aa] {...   350   e-125
CAGL0I10494g Chr9 complement(1037855..1038373) [519 bp, 172 aa] ...   261   6e-90
Smik_16.402 Chr16 (701857..702378) [522 bp, 173 aa] {ON} YPR149W...   253   6e-87
YPR149W Chr16 (829918..830439) [522 bp, 173 aa] {ON}  NCE102Prot...   253   7e-87
Skud_16.444 Chr16 (783546..784067) [522 bp, 173 aa] {ON} YPR149W...   251   5e-86
KNAG0B00800 Chr2 complement(147427..147975) [549 bp, 182 aa] {ON...   236   4e-80
NCAS0E00800 Chr5 complement(147211..147735) [525 bp, 174 aa] {ON...   230   9e-78
Suva_16.478 Chr16 (826406..826906) [501 bp, 166 aa] {ON} YPR149W...   224   2e-75
KNAG0A07950 Chr1 (1269265..1269813) [549 bp, 182 aa] {ON} Anc_3....   223   1e-74
NDAI0G00930 Chr7 complement(194039..194569) [531 bp, 176 aa] {ON...   220   1e-73
KAFR0C01970 Chr3 (393616..394155) [540 bp, 179 aa] {ON} Anc_3.49...   217   3e-72
TDEL0D05610 Chr4 (1011746..1012273) [528 bp, 175 aa] {ON} Anc_3....   216   6e-72
YGR131W Chr7 (754726..755250) [525 bp, 174 aa] {ON}  FHN1Protein...   204   1e-67
NDAI0B05880 Chr2 (1422880..1423428) [549 bp, 182 aa] {ON} Anc_3....   197   2e-64
KAFR0G03700 Chr7 (763909..764469) [561 bp, 186 aa] {ON} Anc_3.49...   194   3e-63
Kpol_1017.6 s1017 complement(22157..22720) [564 bp, 187 aa] {ON}...   192   1e-62
KLLA0D16280g Chr4 (1370792..1371301) [510 bp, 169 aa] {ON} simil...   191   3e-62
Suva_7.419 Chr7 (724883..725407) [525 bp, 174 aa] {ON} YGR131W (...   187   7e-61
SAKL0F02750g Chr6 complement(232715..233227) [513 bp, 170 aa] {O...   186   3e-60
Smik_6.227 Chr6 (372610..373134) [525 bp, 174 aa] {ON} YGR131W (...   186   3e-60
TPHA0D03280 Chr4 (676013..676567) [555 bp, 184 aa] {ON} Anc_3.49...   185   7e-60
ZYRO0D09966g Chr4 (841449..841985) [537 bp, 178 aa] {ON} weakly ...   182   9e-59
TBLA0D02960 Chr4 complement(721934..722503) [570 bp, 189 aa] {ON...   182   2e-58
Skud_7.442 Chr7 (733950..734474) [525 bp, 174 aa] {ON} YGR131W (...   178   3e-57
Kwal_55.21238 s55 (744992..745504) [513 bp, 170 aa] {ON} YPR149W...   174   1e-55
NCAS0F03560 Chr6 (710517..711068) [552 bp, 183 aa] {ON} Anc_3.49...   173   6e-55
TBLA0C04490 Chr3 (1088664..1089224) [561 bp, 186 aa] {ON} Anc_3....   171   6e-54
KLTH0F14850g Chr6 (1217267..1217782) [516 bp, 171 aa] {ON} simil...   162   8e-51
Ecym_1236 Chr1 complement(485252..485761) [510 bp, 169 aa] {ON} ...   129   1e-37
AFR312W Chr6 (1004068..1004574) [507 bp, 168 aa] {ON} Syntenic h...   115   2e-32
Smik_4.21 Chr4 (44522..45472) [951 bp, 316 aa] {ON} YDL218W (REAL)     34   0.15 
Suva_4.27 Chr4 (54848..55816) [969 bp, 322 aa] {ON} YDL218W (REAL)     33   0.21 
TDEL0H00180 Chr8 (19833..20606) [774 bp, 257 aa] {ON}                  32   0.40 
Kwal_23.4058 s23 complement(551392..552042) [651 bp, 216 aa] {ON...    31   1.1  
Kpol_530.47 s530 complement(108566..108973) [408 bp, 135 aa] {ON...    30   1.4  
SAKL0F16764g Chr6 (1384018..1384872) [855 bp, 284 aa] {ON} some ...    31   1.7  
YKL221W Chr11 (6107..7528) [1422 bp, 473 aa] {ON}  MCH2Protein w...    30   3.0  
Kwal_23.4650 s23 (802842..803999) [1158 bp, 385 aa] {ON} YDL218W...    30   3.4  
KNAG0I01750 Chr9 (344381..345355) [975 bp, 324 aa] {ON} Anc_6.26...    30   4.1  
CAGL0H10076g Chr8 (982652..983629) [978 bp, 325 aa] {ON} similar...    29   6.0  
SAKL0E01408g Chr5 (106229..107152) [924 bp, 307 aa] {ON} similar...    29   6.8  
YDL218W Chr4 (66493..67446) [954 bp, 317 aa] {ON} Putative prote...    29   7.4  
TBLA0E02500 Chr5 (628027..629757) [1731 bp, 576 aa] {ON}               29   8.3  

>CAGL0L08448g Chr12 complement(928396..928917) [522 bp, 173 aa] {ON}
           highly similar to uniprot|Q12207 Saccharomyces
           cerevisiae YPR149w or uniprot|P53279 Saccharomyces
           cerevisiae YGR131w
          Length = 173

 Score =  350 bits (898), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 173/173 (100%), Positives = 173/173 (100%)

Query: 1   MLAVTDNLLRIVNFVFMVICIGLISDLIATRDRHSSRVNYCMFAAAYGIATDSLYGVFAN 60
           MLAVTDNLLRIVNFVFMVICIGLISDLIATRDRHSSRVNYCMFAAAYGIATDSLYGVFAN
Sbjct: 1   MLAVTDNLLRIVNFVFMVICIGLISDLIATRDRHSSRVNYCMFAAAYGIATDSLYGVFAN 60

Query: 61  FFEILAWPLILFTLDFLNFAFMLTAGCVLAVGIRAHSCNNAHYRENNKIIQGSERRCRES 120
           FFEILAWPLILFTLDFLNFAFMLTAGCVLAVGIRAHSCNNAHYRENNKIIQGSERRCRES
Sbjct: 61  FFEILAWPLILFTLDFLNFAFMLTAGCVLAVGIRAHSCNNAHYRENNKIIQGSERRCRES 120

Query: 121 QAAVAFFFFSMAIFLAKMIMSLLNIFSNGAFGTKFIRRRRNNAEVGVPSVSQV 173
           QAAVAFFFFSMAIFLAKMIMSLLNIFSNGAFGTKFIRRRRNNAEVGVPSVSQV
Sbjct: 121 QAAVAFFFFSMAIFLAKMIMSLLNIFSNGAFGTKFIRRRRNNAEVGVPSVSQV 173

>CAGL0I10494g Chr9 complement(1037855..1038373) [519 bp, 172 aa]
           {ON} highly similar to uniprot|Q12207 Saccharomyces
           cerevisiae YPR149w NCE2 or uniprot|P53279 Saccharomyces
           cerevisiae YGR131w
          Length = 172

 Score =  261 bits (667), Expect = 6e-90,   Method: Compositional matrix adjust.
 Identities = 128/174 (73%), Positives = 147/174 (84%), Gaps = 3/174 (1%)

Query: 1   MLAVTDNLLRIVNFVFMVICIGLISDLIATRDRHSSRVNYCMFAAAYGIATDSLYGVFAN 60
           ML+V DNLLRIVN VF++ICIGL S LI TR RHSSRVN+C+FAAAYGIATDSLYG+FAN
Sbjct: 1   MLSVADNLLRIVNAVFLIICIGLASSLINTRKRHSSRVNFCLFAAAYGIATDSLYGIFAN 60

Query: 61  FFEILAWPLILFTLDFLNFAFMLTAGCVLAVGIRAHSCNNAHYRE-NNKIIQGSERRCRE 119
           FFE LAWPL+LF LDFLNF F  TAG VLAVGIRAHSCNN  Y E   KI+QGS  RCR+
Sbjct: 61  FFEPLAWPLVLFVLDFLNFVFTFTAGTVLAVGIRAHSCNNKRYLERETKIVQGSGTRCRQ 120

Query: 120 SQAAVAFFFFSMAIFLAKMIMSLLNIFSNGAFGTKFIRRRRNNAEVGVPSVSQV 173
           +QA VAFF+FSMAIFLAKMIMS++++ SNGAFG K   RR+++ EVGVPS+SQV
Sbjct: 121 AQALVAFFYFSMAIFLAKMIMSIVSVVSNGAFGAKL--RRKHHTEVGVPSISQV 172

>Smik_16.402 Chr16 (701857..702378) [522 bp, 173 aa] {ON} YPR149W
           (REAL)
          Length = 173

 Score =  253 bits (647), Expect = 6e-87,   Method: Compositional matrix adjust.
 Identities = 120/173 (69%), Positives = 143/173 (82%)

Query: 1   MLAVTDNLLRIVNFVFMVICIGLISDLIATRDRHSSRVNYCMFAAAYGIATDSLYGVFAN 60
           MLA+ DN+LRI+NF+F+VI I LIS L+ T+D+HSSRVNYCMFA AYGI TDSLYGVFAN
Sbjct: 1   MLALADNILRIINFLFLVISIALISSLLNTQDKHSSRVNYCMFACAYGIFTDSLYGVFAN 60

Query: 61  FFEILAWPLILFTLDFLNFAFMLTAGCVLAVGIRAHSCNNAHYRENNKIIQGSERRCRES 120
           F E LAWPL+LFTLDFLNF F  TAG VLAVGIRAHSCNN+ Y ++NKI QGS  RCR++
Sbjct: 61  FIEPLAWPLVLFTLDFLNFVFTFTAGTVLAVGIRAHSCNNSSYVDSNKITQGSGTRCRQA 120

Query: 121 QAAVAFFFFSMAIFLAKMIMSLLNIFSNGAFGTKFIRRRRNNAEVGVPSVSQV 173
           QAAVAF +FS AIFLAK +MS+ N+ SNGAFG+    +RR   +VGVP++SQV
Sbjct: 121 QAAVAFLYFSCAIFLAKTLMSIFNMISNGAFGSGSFSKRRRTGQVGVPTISQV 173

>YPR149W Chr16 (829918..830439) [522 bp, 173 aa] {ON}  NCE102Protein
           of unknown function; contains transmembrane domains;
           involved in secretion of proteins that lack classical
           secretory signal sequences; component of the
           detergent-insoluble glycolipid-enriched complexes (DIGs)
          Length = 173

 Score =  253 bits (647), Expect = 7e-87,   Method: Compositional matrix adjust.
 Identities = 121/173 (69%), Positives = 143/173 (82%)

Query: 1   MLAVTDNLLRIVNFVFMVICIGLISDLIATRDRHSSRVNYCMFAAAYGIATDSLYGVFAN 60
           MLA+ DN+LRI+NF+F+VI IGLIS L+ T+ RHSSRVNYCMFA AYGI TDSLYGVFAN
Sbjct: 1   MLALADNILRIINFLFLVISIGLISSLLNTQHRHSSRVNYCMFACAYGIFTDSLYGVFAN 60

Query: 61  FFEILAWPLILFTLDFLNFAFMLTAGCVLAVGIRAHSCNNAHYRENNKIIQGSERRCRES 120
           F E LAWPL+LFTLDFLNF F  TAG VLAVGIRAHSCNN+ Y ++NKI QGS  RCR++
Sbjct: 61  FIEPLAWPLVLFTLDFLNFVFTFTAGTVLAVGIRAHSCNNSSYVDSNKITQGSGTRCRQA 120

Query: 121 QAAVAFFFFSMAIFLAKMIMSLLNIFSNGAFGTKFIRRRRNNAEVGVPSVSQV 173
           QAAVAF +FS AIFLAK +MS+ N+ SNGAFG+    +RR   +VGVP++SQV
Sbjct: 121 QAAVAFLYFSCAIFLAKTLMSVFNMISNGAFGSGSFSKRRRTGQVGVPTISQV 173

>Skud_16.444 Chr16 (783546..784067) [522 bp, 173 aa] {ON} YPR149W
           (REAL)
          Length = 173

 Score =  251 bits (641), Expect = 5e-86,   Method: Compositional matrix adjust.
 Identities = 121/173 (69%), Positives = 143/173 (82%)

Query: 1   MLAVTDNLLRIVNFVFMVICIGLISDLIATRDRHSSRVNYCMFAAAYGIATDSLYGVFAN 60
           MLA  DN+LRI+NF+F+VI IGLIS L+ T+DR+SSRVN+CMFAAAYGI TDSLYGVFAN
Sbjct: 1   MLAPADNILRIINFLFLVIVIGLISSLLNTQDRNSSRVNFCMFAAAYGIFTDSLYGVFAN 60

Query: 61  FFEILAWPLILFTLDFLNFAFMLTAGCVLAVGIRAHSCNNAHYRENNKIIQGSERRCRES 120
           FFE LAWPL+LFTLDFLNF F  TAG VLAVGIRAHSCNN  Y ++N I QGS  RCR++
Sbjct: 61  FFEPLAWPLVLFTLDFLNFVFTFTAGTVLAVGIRAHSCNNRSYVDSNGITQGSGTRCRQA 120

Query: 121 QAAVAFFFFSMAIFLAKMIMSLLNIFSNGAFGTKFIRRRRNNAEVGVPSVSQV 173
           QAAVAF +FS AIFLAK +MS+ N+ SNGAFG+    +RR   +VGVP++SQV
Sbjct: 121 QAAVAFLYFSCAIFLAKTLMSVFNMISNGAFGSGSFSKRRRTGQVGVPTISQV 173

>KNAG0B00800 Chr2 complement(147427..147975) [549 bp, 182 aa] {ON}
           Anc_3.493 YPR149W
          Length = 182

 Score =  236 bits (603), Expect = 4e-80,   Method: Compositional matrix adjust.
 Identities = 129/182 (70%), Positives = 142/182 (78%), Gaps = 9/182 (4%)

Query: 1   MLAVTDNLLRIVNFVFMVICIGLISDLIATRDRHSSRVNYCMFAAAYGIATDSLYGVFAN 60
           ML V DNLLR++NF F+VIC+  IS LI T+  H SRVNYCMFAAAYGIATD LYG+ AN
Sbjct: 1   MLGVADNLLRLLNFCFLVICLAFISTLINTQKFHISRVNYCMFAAAYGIATDGLYGLLAN 60

Query: 61  FFEILAWPLILFTLDFLNFAFMLTAGCVLAVGIRAHSCNNAHYRENNKIIQGSERRCRES 120
           F+E LAWPLILFTLDFLNFAF LTAG VLAVGIRAHSC N  YRE N IIQGSE RCR S
Sbjct: 61  FWEPLAWPLILFTLDFLNFAFTLTAGIVLAVGIRAHSCKNVRYRERNHIIQGSENRCRIS 120

Query: 121 QAAVAFFFFSMAIFLAKMIMSLLNIFSNGAFGT---KFIRRRRNNAEV------GVPSVS 171
           QAA AFFFFSM IF+AKM+MS +N+ SNGAF T   KF RRRR+   V      GVPS+S
Sbjct: 121 QAATAFFFFSMGIFIAKMVMSGINLASNGAFTTASSKFGRRRRHGGGVGVPETSGVPSIS 180

Query: 172 QV 173
           QV
Sbjct: 181 QV 182

>NCAS0E00800 Chr5 complement(147211..147735) [525 bp, 174 aa] {ON}
           Anc_3.493 YGR131W
          Length = 174

 Score =  230 bits (587), Expect = 9e-78,   Method: Compositional matrix adjust.
 Identities = 116/175 (66%), Positives = 138/175 (78%), Gaps = 3/175 (1%)

Query: 1   MLAVTDNLLRIVNFVFMVICIGLISDLIATRDRHSSRVNYCMFAAAYGIATDSLYGVFAN 60
           ML V DNLLRI+N VF+VICIGL S L+ T+  ++SR+NYCMF  AY + TDS+YG+FAN
Sbjct: 1   MLGVADNLLRILNAVFLVICIGLNSALLNTKTHNNSRINYCMFTCAYCLTTDSIYGIFAN 60

Query: 61  FFEILAWPLILFTLDFLNFAFMLTAGCVLAVGIRAHSCNNAHYRENNKIIQGSERRCRES 120
           FF+ILA P + F LDFLNFAF   AG VLA GIRAHSC + HY  +NKI QG + RCRES
Sbjct: 61  FFDILALPALCFCLDFLNFAFTFVAGTVLATGIRAHSCKSEHYVNSNKITQGFKNRCRES 120

Query: 121 QAAVAFFFFSMAIFLAKMIMSLLNIFSNGAFGTKFI--RRRRNNAEVGVPSVSQV 173
           QA VAFF+FSMAIFLAK+IMS +N+  NGAF T+ I  RRRRN AE+GVPS+SQV
Sbjct: 121 QALVAFFYFSMAIFLAKLIMSTINMIQNGAF-TQHIGRRRRRNAAEIGVPSISQV 174

>Suva_16.478 Chr16 (826406..826906) [501 bp, 166 aa] {ON} YPR149W
           (REAL)
          Length = 166

 Score =  224 bits (571), Expect = 2e-75,   Method: Compositional matrix adjust.
 Identities = 111/173 (64%), Positives = 131/173 (75%), Gaps = 7/173 (4%)

Query: 1   MLAVTDNLLRIVNFVFMVICIGLISDLIATRDRHSSRVNYCMFAAAYGIATDSLYGVFAN 60
           MLA  DN+LRI+NF+F+VI IGLIS L+ T+  +SSR+NYCMFA AY I TDSLYGVFAN
Sbjct: 1   MLAPVDNILRIINFLFLVISIGLISSLLNTQSGNSSRINYCMFAVAYAIVTDSLYGVFAN 60

Query: 61  FFEILAWPLILFTLDFLNFAFMLTAGCVLAVGIRAHSCNNAHYRENNKIIQGSERRCRES 120
           FFE LAWPLILF+LDFLNF F  TA       IRAHSC N  Y  +N I QGS  RCRE+
Sbjct: 61  FFEPLAWPLILFSLDFLNFVFTFTA-------IRAHSCRNQTYLASNSITQGSGNRCREA 113

Query: 121 QAAVAFFFFSMAIFLAKMIMSLLNIFSNGAFGTKFIRRRRNNAEVGVPSVSQV 173
           QAAVAF +FS AIFLAK +MS+ N+ SNGAFG+    +RR   +VGVP++SQV
Sbjct: 114 QAAVAFLYFSCAIFLAKTLMSVFNMISNGAFGSGSFSKRRRTGQVGVPTISQV 166

>KNAG0A07950 Chr1 (1269265..1269813) [549 bp, 182 aa] {ON} Anc_3.493
           YPR149W
          Length = 182

 Score =  223 bits (567), Expect = 1e-74,   Method: Compositional matrix adjust.
 Identities = 121/182 (66%), Positives = 142/182 (78%), Gaps = 9/182 (4%)

Query: 1   MLAVTDNLLRIVNFVFMVICIGLISDLIATRDRHSSRVNYCMFAAAYGIATDSLYGVFAN 60
           MLA+ D  LR+VNFVF+VIC+GLIS L+ T+  HSSR+NYCMF AAYGI TDS YGV AN
Sbjct: 1   MLALADIFLRLVNFVFLVICMGLISALLNTQHGHSSRINYCMFTAAYGITTDSFYGVVAN 60

Query: 61  FFEILAWPLILFTLDFLNFAFMLTAGCVLAVGIRAHSCNNAHYRENNKIIQGSERRCRES 120
           F+E L+WPL+L  LDFLNF F LTAGCVLAVGIRAHSC N  YR  NKI+QGSE RCR++
Sbjct: 61  FWEPLSWPLLLGALDFLNFVFTLTAGCVLAVGIRAHSCKNVAYRNKNKIVQGSENRCRQA 120

Query: 121 QAAVAFFFFSMAIFLAKMIMSLLNIFSNGAF--------GTKFIRRRRNNA-EVGVPSVS 171
           QAAVAFFFFSMAIFLAK IMSL+NIF+NG F        G++F +R+R      GVP++S
Sbjct: 121 QAAVAFFFFSMAIFLAKFIMSLVNIFTNGPFGSAGSSPMGSRFSKRKRTQGVPQGVPNIS 180

Query: 172 QV 173
            V
Sbjct: 181 TV 182

>NDAI0G00930 Chr7 complement(194039..194569) [531 bp, 176 aa] {ON}
           Anc_3.493 YGR131W
          Length = 176

 Score =  220 bits (560), Expect = 1e-73,   Method: Compositional matrix adjust.
 Identities = 110/176 (62%), Positives = 133/176 (75%), Gaps = 3/176 (1%)

Query: 1   MLAVTDNLLRIVNFVFMVICIGLISDLIATRDRHSSRVNYCMFAAAYGIATDSLYGVFAN 60
           ML+V DNLLR++N +F+VICIGL S L+ T+  H+SR+NYCMF   Y + TDS +G+ AN
Sbjct: 1   MLSVADNLLRLLNAMFLVICIGLNSALLNTQQGHNSRINYCMFTCVYCLLTDSFFGILAN 60

Query: 61  FFEILAWPLILFTLDFLNFAFMLTAGCVLAVGIRAHSCNNAHYRENNKIIQGSERRCRES 120
           FFE L++P ILFTLDFLNF+F   AG VLA GIR+HSCNN  Y + NKI QGS  RCRES
Sbjct: 61  FFEFLSFPFILFTLDFLNFSFTFVAGTVLATGIRSHSCNNQSYLDRNKITQGSGNRCRES 120

Query: 121 QAAVAFFFFSMAIFLAKMIMSLLNIFSNGAFGTKFI--RRRRNN-AEVGVPSVSQV 173
           QA VAFF+FSM IFL K+ MS +++  NGAF   F   RRRRN  AEVGVPS+SQV
Sbjct: 121 QALVAFFYFSMFIFLIKLAMSTISMIQNGAFSNTFTSRRRRRNGAAEVGVPSISQV 176

>KAFR0C01970 Chr3 (393616..394155) [540 bp, 179 aa] {ON} Anc_3.493
           YPR149W
          Length = 179

 Score =  217 bits (552), Expect = 3e-72,   Method: Compositional matrix adjust.
 Identities = 108/179 (60%), Positives = 140/179 (78%), Gaps = 6/179 (3%)

Query: 1   MLAVTDNLLRIVNFVFMVICIGLISDLIATRD-RHSSRVNYCMFAAAYGIATDSLYGVFA 59
           ML V DN+LR++N VF++I I L S LI T++  H+SRVNYCMFA A+G+  DS+YG+ A
Sbjct: 1   MLGVADNILRLINAVFLIIAIALTSALINTQNGHHNSRVNYCMFACAFGLFFDSIYGICA 60

Query: 60  NFFEILAWPLILFTLDFLNFAFMLTAGCVLAVGIRAHSCNNAHYRENNKIIQGSERRCRE 119
           NFF++LAWPL+LFTLDFLNFAF  +A   LAVGIRAHSC N  Y ++NKI++GS +RCRE
Sbjct: 61  NFFQVLAWPLLLFTLDFLNFAFTFSAATALAVGIRAHSCGNQSYLDSNKIVRGSGQRCRE 120

Query: 120 SQAAVAFFFFSMAIFLAKMIMSLLNIFSNGAF---GTKFIRRRRNNAE--VGVPSVSQV 173
           +QA VAF +FS AIF+AKMIMS +N+F NGAF    ++FI RR+ +A    GVP++SQV
Sbjct: 121 AQALVAFLYFSTAIFIAKMIMSCINLFQNGAFSSGSSRFISRRKKHATDVGGVPNISQV 179

>TDEL0D05610 Chr4 (1011746..1012273) [528 bp, 175 aa] {ON} Anc_3.493
           YPR149W
          Length = 175

 Score =  216 bits (549), Expect = 6e-72,   Method: Compositional matrix adjust.
 Identities = 108/175 (61%), Positives = 135/175 (77%), Gaps = 2/175 (1%)

Query: 1   MLAVTDNLLRIVNFVFMVICIGLISDLIATRDRHSSRVNYCMFAAAYGIATDSLYGVFAN 60
           MLA+ DN LR+VNF F+VI +GL+ +LI++ D HSSRVN+CMFAAA+GI TDS YG+ AN
Sbjct: 1   MLAIVDNALRLVNFAFLVILLGLVGELISSEDGHSSRVNFCMFAAAFGIVTDSFYGILAN 60

Query: 61  FFEILAWPLILFTLDFLNFAFMLTAGCVLAVGIRAHSCNNAHYRENNKIIQGSERRCRES 120
            +E+ AWP+ILF LDFLNFAF  +A   LAVGIR HSC N  Y ++N I QGS +RCR +
Sbjct: 61  IWEVFAWPVILFALDFLNFAFTFSAATALAVGIRTHSCKNQDYLDSNNITQGSTQRCRLA 120

Query: 121 QAAVAFFFFSMAIFLAKMIMSLLNIFSNGAFG--TKFIRRRRNNAEVGVPSVSQV 173
           QA+VAFF+FS  IFLAKMIMSL+ I +NG F   T    RRR +A+VGVP++SQV
Sbjct: 121 QASVAFFYFSFFIFLAKMIMSLIGIITNGPFSSRTTLTSRRRKSAQVGVPTISQV 175

>YGR131W Chr7 (754726..755250) [525 bp, 174 aa] {ON}  FHN1Protein of
           unknown function; induced by ketoconazole; promoter
           region contains sterol regulatory element motif, which
           has been identified as a Upc2p-binding site;
           overexpression complements function of Nce102p in NCE102
           deletion strain
          Length = 174

 Score =  204 bits (520), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 99/174 (56%), Positives = 124/174 (71%), Gaps = 1/174 (0%)

Query: 1   MLAVTDNLLRIVNFVFMVICIGLISDLIATRDRHSSRVNYCMFAAAYGIATDSLYGVFAN 60
           ML+  DNL+RI+N VF++I IGLIS LI T+ +HSSRVN+CMFAA YG+ TDSLYG  AN
Sbjct: 1   MLSAADNLVRIINAVFLIISIGLISGLIGTQTKHSSRVNFCMFAAVYGLVTDSLYGFLAN 60

Query: 61  FFEILAWPLILFTLDFLNFAFMLTAGCVLAVGIRAHSCNNAHYRENNKIIQGSERRCRES 120
           F+  L +P IL  LDFLNF F   A   LAVGIR HSC N  Y E NKIIQGS  RC +S
Sbjct: 61  FWTSLTYPAILLVLDFLNFIFTFVAATALAVGIRCHSCKNKTYLEQNKIIQGSSSRCHQS 120

Query: 121 QAAVAFFFFSMAIFLAKMIMSLLNIFSNGAFGTKF-IRRRRNNAEVGVPSVSQV 173
           QAAVAFF+FS  +FL K+ ++ + +  NG FG+     RRR   ++G+P++SQV
Sbjct: 121 QAAVAFFYFSCFLFLIKVTVATMGMMQNGGFGSNTGFSRRRARRQMGIPTISQV 174

>NDAI0B05880 Chr2 (1422880..1423428) [549 bp, 182 aa] {ON} Anc_3.493
           YGR131W
          Length = 182

 Score =  197 bits (500), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 103/182 (56%), Positives = 131/182 (71%), Gaps = 9/182 (4%)

Query: 1   MLAVTDNLLRIVNFVFMVICIGLISDLIATRDRHSSRVNYCMFAAAYGIATDSLYGVFAN 60
           ML+  DN+LR++N +F+V+ +  IS L+ T+  +SSR+N+CMFAAA+G+ TDS +GV  N
Sbjct: 1   MLSKVDNILRVINAIFLVLTMAFISALLNTQRNNSSRINFCMFAAAFGLLTDSFFGVAFN 60

Query: 61  FFEILA-WPLILFTLDFLNFAFMLTAGCVLAVGIRAHSCNNAHYRENNKIIQGSERRCRE 119
            F+ LA WP++LF  DFLNF F  TAG VLAV IRAHSC N  Y  +N I QGSE RCR 
Sbjct: 61  MFDALASWPILLFIFDFLNFVFTFTAGTVLAVAIRAHSCKNERYVNSNSITQGSENRCRM 120

Query: 120 SQAAVAFFFFSMAIFLAKMIMSLLNIFSNGAFGTKFI-----RRRRNNA---EVGVPSVS 171
           SQAAVAFF+FS  IFLAKMIMS +N+ SNG FG+        +RR N +   EVGVP++S
Sbjct: 121 SQAAVAFFYFSCFIFLAKMIMSGINMASNGLFGSGTWAGSRSKRRTNRSGANEVGVPTIS 180

Query: 172 QV 173
           QV
Sbjct: 181 QV 182

>KAFR0G03700 Chr7 (763909..764469) [561 bp, 186 aa] {ON} Anc_3.493
           YPR149W
          Length = 186

 Score =  194 bits (493), Expect = 3e-63,   Method: Compositional matrix adjust.
 Identities = 107/177 (60%), Positives = 129/177 (72%), Gaps = 6/177 (3%)

Query: 1   MLAVTDNLLRIVNFVFMVICIGLISDLIATRDRH-SSRVNYCMFAAAYGIATDSLYGVFA 59
           MLA+ DN LR+VNF FMVI +  I+ L+ TR  H S+RVNYCMFA A+GI TDS+YG+FA
Sbjct: 1   MLAIADNSLRLVNFCFMVITMAFIAQLLNTRQGHNSARVNYCMFAVAFGILTDSIYGLFA 60

Query: 60  NFFEILAWPLILFTLDFLNFAFMLTAGCVLAVGIRAHSCNNAHYRENNKIIQGSERRCRE 119
           NFFE LAWP+ILF  DFLNF F  TAG VLAVGIRAH+CNN  YR +NKI++GSE RCR 
Sbjct: 61  NFFEQLAWPIILFVFDFLNFVFFFTAGTVLAVGIRAHNCNNEAYRNSNKIVRGSETRCRV 120

Query: 120 SQAAVAFFFFSMAIFLAKMIMSLLNIFSNGA-----FGTKFIRRRRNNAEVGVPSVS 171
           +QAAVAFF+FSMAIFL K + S++   S G            RR+R +A  GVP+ S
Sbjct: 121 AQAAVAFFYFSMAIFLVKGVFSIMKAISEGPFGSGSSFGFGSRRKRRSAGTGVPTTS 177

>Kpol_1017.6 s1017 complement(22157..22720) [564 bp, 187 aa] {ON}
           complement(22157..22720) [564 nt, 188 aa]
          Length = 187

 Score =  192 bits (489), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 102/187 (54%), Positives = 131/187 (70%), Gaps = 14/187 (7%)

Query: 1   MLAVTDNLLRIVNFVFMVICIGLISDLIATRDRHSSRVNYCMFAAAYGIATDSLYGVFAN 60
           ML++ DN++R +NF F VIC+GLI  L+AT   HSSRVNYCMF   + + TDS YG+ AN
Sbjct: 1   MLSLADNIMRAINFCFFVICMGLIGSLLATEKGHSSRVNYCMFVPPFAVVTDSFYGILAN 60

Query: 61  FFEI-LAWPLILFTLDFLNFAFMLTAGCVLAVGIRAHSCNNAHYRENNKIIQGSERRCRE 119
            +    AWP+ILF  DFLNFAF  TAG VL+VGIR HSC N +Y +NNKIIQGS  RCR+
Sbjct: 61  IWTTPFAWPIILFAFDFLNFAFTFTAGTVLSVGIRTHSCKNRNYIDNNKIIQGSTDRCRK 120

Query: 120 SQAAVAFFFFSMAIFLAKMIMSLLNIFSNGAFG--TKFIRRRRNN-----------AEVG 166
           +QA++AFF+FS  IF  K++MS +N+ SNGA G  T  I RRR++            +VG
Sbjct: 121 AQASIAFFYFSFFIFFVKVVMSAINLLSNGAMGFSTPSIGRRRHHTANIGVPGASSPQVG 180

Query: 167 VPSVSQV 173
           VP++SQV
Sbjct: 181 VPNISQV 187

>KLLA0D16280g Chr4 (1370792..1371301) [510 bp, 169 aa] {ON} similar
           to uniprot|Q12207 Saccharomyces cerevisiae YPR149W
           NCE102 and to uniprot|P53279 Saccharomyces cerevisiae
           YGR131W
          Length = 169

 Score =  191 bits (485), Expect = 3e-62,   Method: Compositional matrix adjust.
 Identities = 92/173 (53%), Positives = 124/173 (71%), Gaps = 4/173 (2%)

Query: 1   MLAVTDNLLRIVNFVFMVICIGLISDLIATRDRHSSRVNYCMFAAAYGIATDSLYGVFAN 60
           ML++ DN LR VNFVF++I +GL+ +LIAT+D  SSRVN+ +FAA +GI  DSLY + AN
Sbjct: 1   MLSILDNSLRGVNFVFLIIVLGLVGNLIATQDHSSSRVNFAIFAAVFGIVFDSLYALIAN 60

Query: 61  FFEILAWPLILFTLDFLNFAFMLTAGCVLAVGIRAHSCNNAHYRENNKIIQGSERRCRES 120
           F   LAWP+IL +LDFLN+ F  +A   LAVGIR  SC N  +   NKI +GS+ RCR++
Sbjct: 61  FISALAWPIILVSLDFLNWVFTFSAATALAVGIRGGSCTNDSFTSGNKIAEGSKDRCRKA 120

Query: 121 QAAVAFFFFSMAIFLAKMIMSLLNIFSNGAFGTKFIRRRRNNAEVGVPSVSQV 173
           QA+  F +FS AIFL K I+S++N  ++GAFGT   R+     +VGVP++SQV
Sbjct: 121 QASTVFLYFSFAIFLVKFILSIVNAITSGAFGTSSNRK----TQVGVPTISQV 169

>Suva_7.419 Chr7 (724883..725407) [525 bp, 174 aa] {ON} YGR131W
           (REAL)
          Length = 174

 Score =  187 bits (476), Expect = 7e-61,   Method: Compositional matrix adjust.
 Identities = 90/174 (51%), Positives = 125/174 (71%), Gaps = 1/174 (0%)

Query: 1   MLAVTDNLLRIVNFVFMVICIGLISDLIATRDRHSSRVNYCMFAAAYGIATDSLYGVFAN 60
           ML+V DN++RI+N +F++I IGL+S LI+++ +HSSRVN+CMFAAAYG+ TDS YG  AN
Sbjct: 1   MLSVADNIVRIINAIFLIISIGLVSGLISSQTKHSSRVNFCMFAAAYGLLTDSFYGCLAN 60

Query: 61  FFEILAWPLILFTLDFLNFAFMLTAGCVLAVGIRAHSCNNAHYRENNKIIQGSERRCRES 120
            +  L +P+I+F LDFLNF F   AG  LAVGIR HSC+N  Y +NNKI QGS  RC ++
Sbjct: 61  LWSSLTYPVIMFVLDFLNFLFTFIAGTALAVGIRCHSCSNKTYLDNNKITQGSGSRCHQA 120

Query: 121 QAAVAFFFFSMAIFLAKMIMSLLNIFS-NGAFGTKFIRRRRNNAEVGVPSVSQV 173
           +AAV FF+FS  +FL K+++S+  +    G        RRR   ++G+P++SQV
Sbjct: 121 KAAVVFFYFSCILFLIKVVVSIAAMVQNGGFGFGNSFGRRRARRQMGIPTISQV 174

>SAKL0F02750g Chr6 complement(232715..233227) [513 bp, 170 aa] {ON}
           similar to uniprot|Q12207 Saccharomyces cerevisiae
           YPR149W NCE102 and to uniprot|P53279 Saccharomyces
           cerevisiae YGR131W
          Length = 170

 Score =  186 bits (472), Expect = 3e-60,   Method: Compositional matrix adjust.
 Identities = 96/173 (55%), Positives = 123/173 (71%), Gaps = 3/173 (1%)

Query: 1   MLAVTDNLLRIVNFVFMVICIGLISDLIATRDRHSSRVNYCMFAAAYGIATDSLYGVFAN 60
           ML++ DN LR+VNF F+VI +GL   LIAT+D HS RVN+ +F AA+ + TDS Y VFAN
Sbjct: 1   MLSILDNSLRLVNFAFLVIILGLTGSLIATQDEHSPRVNFAIFTAAFALVTDSFYAVFAN 60

Query: 61  FFEILAWPLILFTLDFLNFAFMLTAGCVLAVGIRAHSCNNAHYRENNKIIQGSERRCRES 120
            F   AWP++L T DFLNF F  +A   LAVGIR HSC N  Y  +N I QGS  RCR++
Sbjct: 61  LFSAFAWPILLVTWDFLNFVFTFSAATALAVGIRTHSCTNESYLFSNNITQGSTDRCRKA 120

Query: 121 QAAVAFFFFSMAIFLAKMIMSLLNIFSNGAFGTKFIRRRRNNAEVGVPSVSQV 173
           QA VAF +FS  IFL K+++S++N+FS+GAFG+    RR N   VGVP++SQV
Sbjct: 121 QATVAFLYFSFFIFLTKLVLSVINVFSSGAFGSGSGSRRAN---VGVPTISQV 170

>Smik_6.227 Chr6 (372610..373134) [525 bp, 174 aa] {ON} YGR131W
           (REAL)
          Length = 174

 Score =  186 bits (472), Expect = 3e-60,   Method: Compositional matrix adjust.
 Identities = 95/174 (54%), Positives = 118/174 (67%), Gaps = 1/174 (0%)

Query: 1   MLAVTDNLLRIVNFVFMVICIGLISDLIATRDRHSSRVNYCMFAAAYGIATDSLYGVFAN 60
           ML+  DNL+RI+N VF++I IGLIS LI+T+ +HSSRVN+CMF AAYG+ TDSLYG  AN
Sbjct: 1   MLSAADNLIRIINAVFLIISIGLISGLISTQAKHSSRVNFCMFTAAYGLVTDSLYGFLAN 60

Query: 61  FFEILAWPLILFTLDFLNFAFMLTAGCVLAVGIRAHSCNNAHYRENNKIIQGSERRCRES 120
           F+  L +P IL  LD LNF F   A   LAVGIR HSC N  Y E NKI Q S  RC +S
Sbjct: 61  FWSSLTYPAILLALDILNFIFTFVAATALAVGIRCHSCKNKTYLEQNKITQASSSRCHQS 120

Query: 121 QAAVAFFFFSMAIFLAKMIMSLL-NIFSNGAFGTKFIRRRRNNAEVGVPSVSQV 173
           QAAVAFF+FS  +FL K+ ++    I + G        RRR   ++GVP++SQV
Sbjct: 121 QAAVAFFYFSCFLFLIKVTVTAAGTIQNGGFGFNSGFGRRRARRQLGVPTISQV 174

>TPHA0D03280 Chr4 (676013..676567) [555 bp, 184 aa] {ON} Anc_3.493
           YPR149W
          Length = 184

 Score =  185 bits (470), Expect = 7e-60,   Method: Compositional matrix adjust.
 Identities = 97/184 (52%), Positives = 126/184 (68%), Gaps = 11/184 (5%)

Query: 1   MLAVTDNLLRIVNFVFMVICIGLISDLIATRDRHSSRVNYCMFAAAYGIATDSLYGVFAN 60
           ML + DN+LR VNF F VIC+GL+  L+AT+++HSSRVNYC+F   + + TD+ YG  AN
Sbjct: 1   MLGLADNILRGVNFCFFVICLGLVGSLLATQNQHSSRVNYCIFVPPFALVTDTFYGALAN 60

Query: 61  FFEI-LAWPLILFTLDFLNFAFMLTAGCVLAVGIRAHSCNNAHYRENNKIIQGSERRCRE 119
            +   LAWP+ILF  DFLNFAF  TAG VLAVG R HSC N  Y ++N I QGS  RCR+
Sbjct: 61  IWSTPLAWPIILFCFDFLNFAFTFTAGTVLAVGTRTHSCTNQSYLDSNNITQGSTDRCRK 120

Query: 120 SQAAVAFFFFSMAIFLAKMIMSLLNIFSNGAFGT----------KFIRRRRNNAEVGVPS 169
           +QAA AFF+FS  IFLAK+IMS +N+F+NGA G+                  + ++GVP+
Sbjct: 121 AQAATAFFYFSFFIFLAKLIMSSINLFTNGALGSMSFGRRRGGAGVGVPGAASPQIGVPN 180

Query: 170 VSQV 173
           +SQV
Sbjct: 181 ISQV 184

>ZYRO0D09966g Chr4 (841449..841985) [537 bp, 178 aa] {ON} weakly
           similar to uniprot|Q12207 Saccharomyces cerevisiae
           YPR149W NCE102 and to uniprot|P53279 Saccharomyces
           cerevisiae YGR131W
          Length = 178

 Score =  182 bits (463), Expect = 9e-59,   Method: Compositional matrix adjust.
 Identities = 105/178 (58%), Positives = 126/178 (70%), Gaps = 5/178 (2%)

Query: 1   MLAVTDNLLRIVNFVFMVICIGLISDLIATRDR-HSSRVNYCMFAAAYGIATDSLYGVFA 59
           MLA+TDN+LR VNF F VI +GL+  LI +    H+SRVN+CMFAAA+GI  DS YG+ A
Sbjct: 1   MLALTDNILRAVNFCFFVILLGLVGKLIQSEKHGHNSRVNFCMFAAAFGIVADSFYGILA 60

Query: 60  NFFEILAWPLILFTLDFLNFAFMLTAGCVLAVGIRAHSCNNAHYRENNKIIQGSERRCRE 119
           N F   A+P+ILF LDFLNF F  TA   LAVGIR HSC N HY ++NKI QGS  RCRE
Sbjct: 61  NIFVPFAFPVILFILDFLNFVFTFTAATALAVGIRTHSCTNRHYLDSNKITQGSTSRCRE 120

Query: 120 SQAAVAFFFFSMAIFLAKMIMSLLNIFSNGA----FGTKFIRRRRNNAEVGVPSVSQV 173
           +QA VAFF+F+  IFL KM+MS L++ SNGA     G    RRR   A VGVP++SQV
Sbjct: 121 AQAVVAFFYFAFFIFLFKMVMSFLSLLSNGAFGSSSGFSSRRRRTQQANVGVPTISQV 178

>TBLA0D02960 Chr4 complement(721934..722503) [570 bp, 189 aa] {ON}
           Anc_3.493 YPR149W
          Length = 189

 Score =  182 bits (461), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 98/189 (51%), Positives = 119/189 (62%), Gaps = 16/189 (8%)

Query: 1   MLAVTDNLLRIVNFVFMVICIGLISDLIATRD-RHSSRVNYCMFAAAYGIATDSLYGVFA 59
           ML + DN+ RI NF F VI  G+I +L+ T    HSSRVNYCMF  A+G+ +DS YG+ A
Sbjct: 1   MLELYDNVFRIFNFCFFVITAGMIGNLLNTEHGHHSSRVNYCMFPPAWGLVSDSFYGILA 60

Query: 60  NFF-EILAWPLILFTLDFLNFAFMLTAGCVLAVGIRAHSCNNAHYRENNKIIQGSERRCR 118
           N   E  A+P ILF  DFLNF F  TAG VLAVGIR HSC N  YR  N IIQGSERRCR
Sbjct: 61  NLVPEPFAFPPILFAFDFLNFVFTFTAGTVLAVGIRTHSCTNKEYRRENYIIQGSERRCR 120

Query: 119 ESQAAVAFFFFSMAIFLAKMIMSLLNIFSNGAFGT----------KFIRRRRNNAEV--- 165
           E+QA +AFF+FSM +FL K++++L+  F+ G  G            F RR R  A     
Sbjct: 121 EAQACIAFFYFSMFLFLVKVLITLVTYFTGGELGQTGYGGGYGGRSFGRRPRTRAPPQMN 180

Query: 166 -GVPSVSQV 173
            G  S+SQV
Sbjct: 181 KGGISISQV 189

>Skud_7.442 Chr7 (733950..734474) [525 bp, 174 aa] {ON} YGR131W
           (REAL)
          Length = 174

 Score =  178 bits (452), Expect = 3e-57,   Method: Compositional matrix adjust.
 Identities = 96/174 (55%), Positives = 118/174 (67%), Gaps = 1/174 (0%)

Query: 1   MLAVTDNLLRIVNFVFMVICIGLISDLIATRDRHSSRVNYCMFAAAYGIATDSLYGVFAN 60
           ML+  DNL+RIV+ VF++I IGLI  L+ T+   SSRVN+CMFAAAYG+ TDS YG  AN
Sbjct: 1   MLSAADNLIRIVSAVFLIISIGLIGGLMGTQTNGSSRVNFCMFAAAYGLITDSFYGFLAN 60

Query: 61  FFEILAWPLILFTLDFLNFAFMLTAGCVLAVGIRAHSCNNAHYRENNKIIQGSERRCRES 120
           F+  L +P IL  LDFLNF F   A   LAVGIR HSC N  Y E N I QGS  RC +S
Sbjct: 61  FWSSLTYPAILLVLDFLNFLFTFAAATALAVGIRCHSCKNKTYLEQNNITQGSSSRCHQS 120

Query: 121 QAAVAFFFFSMAIFLAKMIMSLLNIFSNGAFG-TKFIRRRRNNAEVGVPSVSQV 173
           QAAVAFF+FS  +FL K+ +S+  +  NG FG      RRR   ++GVP++SQV
Sbjct: 121 QAAVAFFYFSCFLFLIKVTVSVAGMMQNGGFGFNTGYGRRRARRQMGVPTISQV 174

>Kwal_55.21238 s55 (744992..745504) [513 bp, 170 aa] {ON} YPR149W
           (NCE102) - Involved in secretion of proteins that lack
           classical secretory signal sequences [contig 130] FULL
          Length = 170

 Score =  174 bits (441), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 89/173 (51%), Positives = 121/173 (69%), Gaps = 3/173 (1%)

Query: 1   MLAVTDNLLRIVNFVFMVICIGLISDLIATRDRHSSRVNYCMFAAAYGIATDSLYGVFAN 60
           ML++ DN LR  NFVF++I +GL   L ATRD ++ +VN+ +FAAA+G+  D+LY + AN
Sbjct: 1   MLSILDNSLRAANFVFLLIVLGLTGSLAATRDNNNPQVNFAVFAAAFGLLFDTLYAIPAN 60

Query: 61  FFEILAWPLILFTLDFLNFAFMLTAGCVLAVGIRAHSCNNAHYRENNKIIQGSERRCRES 120
           F   LAWPL++   DFLNF F   A   LAV IR HSC N+ Y +NNK+ QGS  RCR++
Sbjct: 61  FISALAWPLLIAVFDFLNFVFTFAAATALAVAIRVHSCTNSDYVDNNKVTQGSSDRCRKA 120

Query: 121 QAAVAFFFFSMAIFLAKMIMSLLNIFSNGAFGTKFIRRRRNNAEVGVPSVSQV 173
           QA+VAF +F+  +FL K+ +SL+N+FS GAF T      R +A VGVP++SQV
Sbjct: 121 QASVAFLYFAFFVFLVKLALSLVNVFSVGAFSTS---SGRKSANVGVPTISQV 170

>NCAS0F03560 Chr6 (710517..711068) [552 bp, 183 aa] {ON} Anc_3.493
           YGR131W
          Length = 183

 Score =  173 bits (438), Expect = 6e-55,   Method: Compositional matrix adjust.
 Identities = 103/183 (56%), Positives = 132/183 (72%), Gaps = 10/183 (5%)

Query: 1   MLAVTDNLLRIVNFVFMVICIGLISDLIATRDRHSSRVNYCMFAAAYGIATDSLYGVFAN 60
           ML+  DN LR  N +F+V+ I  IS L++T++  SSRVNYCMFAAA+G+ TDS +G+ AN
Sbjct: 1   MLSKVDNTLRFFNGIFLVLAIAFISTLLSTQNHGSSRVNYCMFAAAFGLLTDSFFGMAAN 60

Query: 61  FFEILA-WPLILFTLDFLNFAFMLTAGCVLAVGIRAHSCNNAHYRENNKIIQGSERRCRE 119
             + L+ WP+ILF  DFLNF F  TAG VLAVGIR HSCNN  Y E+NKIIQGS  RCR 
Sbjct: 61  LIDFLSSWPIILFVFDFLNFVFTFTAGTVLAVGIRCHSCNNRRYLESNKIIQGSGIRCRV 120

Query: 120 SQAAVAFFFFSMAIFLAKMIMSLLNIFSNGAFGT-KFIRRRRNNA--------EVGVPSV 170
           SQAAVAFF+F+  +FLAKMIMS +++ SNGAFG+  F+ RR+  +          GVP++
Sbjct: 121 SQAAVAFFYFAAFVFLAKMIMSAISMASNGAFGSGSFMSRRKRRSGAGVGGTTGGGVPTI 180

Query: 171 SQV 173
           S+V
Sbjct: 181 SEV 183

>TBLA0C04490 Chr3 (1088664..1089224) [561 bp, 186 aa] {ON} Anc_3.493
           YPR149W
          Length = 186

 Score =  171 bits (432), Expect = 6e-54,   Method: Compositional matrix adjust.
 Identities = 82/156 (52%), Positives = 110/156 (70%), Gaps = 2/156 (1%)

Query: 1   MLAVTDNLLRIVNFVFMVICIGLISDLIATRDR-HSSRVNYCMFAAAYGIATDSLYGVFA 59
           ML+ T N+LRI+NF F+VI  G+I  LI +  R HS RVNYCMFAA + + TDS Y + A
Sbjct: 1   MLSRTANVLRIINFCFLVIITGMIGKLIESEKRPHSPRVNYCMFAAPFALVTDSFYAIPA 60

Query: 60  NFFE-ILAWPLILFTLDFLNFAFMLTAGCVLAVGIRAHSCNNAHYRENNKIIQGSERRCR 118
           NF+    AWP++L++ DFLNF F  TAG VL+VGIR HSC N HY  +NKI QGS  RCR
Sbjct: 61  NFWPSPFAWPILLWSFDFLNFTFTFTAGTVLSVGIRTHSCLNKHYLFSNKITQGSTERCR 120

Query: 119 ESQAAVAFFFFSMAIFLAKMIMSLLNIFSNGAFGTK 154
            +QA++AF++FS  I+L +++ S L ++ NG F  +
Sbjct: 121 LAQASIAFYYFSFFIYLVQLVKSSLLMWENGLFKPE 156

>KLTH0F14850g Chr6 (1217267..1217782) [516 bp, 171 aa] {ON} similar
           to uniprot|Q12207 Saccharomyces cerevisiae YPR149W
           NCE102 and to uniprot|P53279 Saccharomyces cerevisiae
           YGR131W
          Length = 171

 Score =  162 bits (409), Expect = 8e-51,   Method: Compositional matrix adjust.
 Identities = 89/174 (51%), Positives = 117/174 (67%), Gaps = 4/174 (2%)

Query: 1   MLAVTDNLLRIVNFVFMVICIGLISDLIATRDRHSS-RVNYCMFAAAYGIATDSLYGVFA 59
           ML++ DN LR +NF F+VI +GL   L AT   H++ +VN+ +F AA+G+  DSLY + A
Sbjct: 1   MLSILDNSLRALNFAFLVIILGLTGSLAATHKTHNNPQVNFAIFTAAFGLLFDSLYAIPA 60

Query: 60  NFFEILAWPLILFTLDFLNFAFMLTAGCVLAVGIRAHSCNNAHYRENNKIIQGSERRCRE 119
           NF   LAWPL++   DFLNF F   A   LAV IR HSC N  Y ++N + QGS  RCR+
Sbjct: 61  NFVSALAWPLLIAVFDFLNFVFTFAAATALAVAIRTHSCTNQDYLDSNTVTQGSTDRCRK 120

Query: 120 SQAAVAFFFFSMAIFLAKMIMSLLNIFSNGAFGTKFIRRRRNNAEVGVPSVSQV 173
           +QA+VAF +FS  IFLAK+ +SL+N+ S GAFG    RR  N   VGVP++SQV
Sbjct: 121 AQASVAFLYFSFFIFLAKLGLSLVNLISVGAFGAGSSRRTGN---VGVPTISQV 171

>Ecym_1236 Chr1 complement(485252..485761) [510 bp, 169 aa] {ON}
           similar to Ashbya gossypii AFR312W
          Length = 169

 Score =  129 bits (323), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 78/173 (45%), Positives = 104/173 (60%), Gaps = 4/173 (2%)

Query: 1   MLAVTDNLLRIVNFVFMVICIGLISDLIATRDRHSSRVNYCMFAAAYGIATDSLYGVFAN 60
           ML++ DN LR  NF+F++I + L   LI  ++R  SRVN+ +F A + +  DSLY V AN
Sbjct: 1   MLSILDNSLRAANFLFLIIVLALTGSLINGQNRSHSRVNFGLFTAIFALLFDSLYSVLAN 60

Query: 61  FFEILAWPLILFTLDFLNFAFMLTAGCVLAVGIRAHSCNNAHYRENNKIIQGSERRCRES 120
           F   LAWP++L T D LN  F   A   L   I  HSC+N+ +   N I +G E RCR+ 
Sbjct: 61  FISALAWPILLITTDVLNLIFTFAAATALGAAIGPHSCSNSGFLRGNDISEGREGRCRKV 120

Query: 121 QAAVAFFFFSMAIFLAKMIMSLLNIFSNGAFGTKFIRRRRNNAEVGVPSVSQV 173
           QA+  F FFS  IFLAK ++S LNI S GAF +   R+       GVP++SQV
Sbjct: 121 QASSVFLFFSFFIFLAKAVLSGLNIVSTGAFSSGSGRKTGG----GVPTISQV 169

>AFR312W Chr6 (1004068..1004574) [507 bp, 168 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPR149W (NCE102) and
           YGR131W
          Length = 168

 Score =  115 bits (288), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 67/145 (46%), Positives = 86/145 (59%)

Query: 1   MLAVTDNLLRIVNFVFMVICIGLISDLIATRDRHSSRVNYCMFAAAYGIATDSLYGVFAN 60
           ML++ DN LR VNFVF++I +GL   LI  +    SRVN+ +F A + + TDS Y + AN
Sbjct: 1   MLSILDNSLRAVNFVFLIIVLGLTGSLIHGQRNSHSRVNFGLFTAVFALVTDSFYSIVAN 60

Query: 61  FFEILAWPLILFTLDFLNFAFMLTAGCVLAVGIRAHSCNNAHYRENNKIIQGSERRCRES 120
           F    AWP+I   LD LN  F   A   L   I AHSC+N  + + N I + S  RCR+ 
Sbjct: 61  FISAFAWPIITIALDVLNLIFTFAAATALGQSIGAHSCSNRGFLDGNTISEQSTDRCRKV 120

Query: 121 QAAVAFFFFSMAIFLAKMIMSLLNI 145
           QA+  F FFS  IFLAK + S LNI
Sbjct: 121 QASSTFLFFSFFIFLAKAVFSGLNI 145

>Smik_4.21 Chr4 (44522..45472) [951 bp, 316 aa] {ON} YDL218W (REAL)
          Length = 316

 Score = 33.9 bits (76), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 43/159 (27%), Positives = 67/159 (42%), Gaps = 30/159 (18%)

Query: 8   LLRIVNFVFMVICIGLISDLI-ATRDRHSSRVNYCMFAAAYGIATDSLYGVFANFFEI-- 64
           LLR   F   V+ + L++  I A  DR + + N+ +             GV + F+ I  
Sbjct: 11  LLRFSQFASSVLVMSLLAYAIHAYGDRGNKKTNFTLAT-----------GVISVFYLIAL 59

Query: 65  ----LAWPLIL-----FTLDFLNFAFMLTAGCVLAVGIRAHSC-----NNAHYRE-NNKI 109
               LA P ++     F  + +     L A  VLA     HSC     N  +Y   + + 
Sbjct: 60  GILCLALPTLIYIGMYFCAELIVCMLWLAAFVVLAKAQGEHSCGSTNANGLYYNPYSGQY 119

Query: 110 IQGSERR-CRESQAAVAFFFFSMAIFLAKMIMSLLNIFS 147
              S RR C  SQAA+AF      +FL  +I+  +N+ +
Sbjct: 120 TANSHRRACNSSQAAIAFSGLCFLLFLTSVILLGINVLT 158

>Suva_4.27 Chr4 (54848..55816) [969 bp, 322 aa] {ON} YDL218W (REAL)
          Length = 322

 Score = 33.5 bits (75), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 42/159 (26%), Positives = 69/159 (43%), Gaps = 30/159 (18%)

Query: 8   LLRIVNFVFMVICIGLISDLI-ATRDRHSSRVNYCMFAAAYGIATDSLYGVFANFFEI-- 64
           LLR   FV  V+ + L++  I A  DR + + N+ +             GV + F+ I  
Sbjct: 11  LLRFSQFVSSVLVMSLLAYAIHAYSDRGNKKTNFTLAT-----------GVISVFYLIAL 59

Query: 65  ----LAWPLIL-----FTLDFLNFAFMLTAGCVLAVGIRAHSC----NNAHYRE--NNKI 109
               LA P ++     F  + +     L A  VLA     HSC    ++  Y +  + + 
Sbjct: 60  GILCLALPTLIYIGMYFCAELIMCMLWLAAFVVLAKAQGQHSCKSRNSSGEYYDPYSGQY 119

Query: 110 IQGSERR-CRESQAAVAFFFFSMAIFLAKMIMSLLNIFS 147
              + RR C  SQAA+AF      +FL  +++  +NI +
Sbjct: 120 TTTNHRRACNSSQAAIAFAGLCFLLFLTSVVLLGVNILT 158

>TDEL0H00180 Chr8 (19833..20606) [774 bp, 257 aa] {ON} 
          Length = 257

 Score = 32.3 bits (72), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 16/51 (31%), Positives = 31/51 (60%), Gaps = 2/51 (3%)

Query: 116 RCRESQAAVAFFFFSMAIFLAKMIMSLLN--IFSNGAFGTKFIRRRRNNAE 164
           RCRE++AA+A   F+M ++ A + + +LN  I    + G  ++ R  ++A+
Sbjct: 123 RCREAKAAIAMCAFNMVLYAASLTLLVLNCVIPLISSHGAPYLWRYASDAD 173

>Kwal_23.4058 s23 complement(551392..552042) [651 bp, 216 aa] {ON}
           YDL218W - Hypothetical ORF [contig 255] FULL
          Length = 216

 Score = 31.2 bits (69), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 35/144 (24%), Positives = 61/144 (42%), Gaps = 20/144 (13%)

Query: 9   LRIVNFVFMVICIGLISDLIATRDRHSSRVNYCMFAAAYGIATDSLYGVFANFFEILAWP 68
           +R   F+F +I +GL S ++    R S        AAAYG+A   +  ++     I+A P
Sbjct: 32  VRAGQFIFSIITLGLTSRVVDFGYRDS--------AAAYGVAVSVISTLY--LILIVAIP 81

Query: 69  LIL-------FTLDFLNFAFMLTAGCVLAVGIRAHSCNNAHYRENNKIIQGSERRCRESQ 121
           L L       F  + +       A   LA     H   +    ++  I +     CR ++
Sbjct: 82  LKLNDCVVAVFISELVMMILWFAAFVALAA---QHGGIDCSTYKSYYITEDWSEPCRAAE 138

Query: 122 AAVAFFFFSMAIFLAKMIMSLLNI 145
           AA+A  FF+  ++    ++  LN+
Sbjct: 139 AAIAMSFFAFLLYDFSSVLFWLNV 162

>Kpol_530.47 s530 complement(108566..108973) [408 bp, 135 aa] {ON}
           complement(108566..108973) [408 nt, 136 aa]
          Length = 135

 Score = 30.4 bits (67), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 16/51 (31%), Positives = 27/51 (52%), Gaps = 6/51 (11%)

Query: 99  NNAHYRENNKIIQGSE------RRCRESQAAVAFFFFSMAIFLAKMIMSLL 143
           N   + E N+++  +E      +  RES   +AF+     ++L KMIMSL+
Sbjct: 82  NIKKFYEKNQLLDATEIFRTLSKHKRESFLKLAFYLLMFFVYLYKMIMSLI 132

>SAKL0F16764g Chr6 (1384018..1384872) [855 bp, 284 aa] {ON} some
           similarities with uniprot|Q7LGR3 Saccharomyces
           cerevisiae YDL218W Putative protein of unknown function
          Length = 284

 Score = 30.8 bits (68), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 23/78 (29%), Positives = 35/78 (44%), Gaps = 5/78 (6%)

Query: 83  LTAGCVLAVGIRAHSCNNAHYRENNKIIQGS---ERRCRESQAAVAFFFFSMAIFLAKMI 139
           LTA  VL V     +C  AHY  +++    S      CR  QA++    F+  +F    +
Sbjct: 124 LTALIVLGVDTGRANCKWAHYTYSSEYFYWSYDWRSPCRAGQASIGMAGFAFVLFACSSV 183

Query: 140 MSLLNIFSN--GAFGTKF 155
           +  LN+ S    AFG+  
Sbjct: 184 VCGLNVISPIRAAFGSTL 201

>YKL221W Chr11 (6107..7528) [1422 bp, 473 aa] {ON}  MCH2Protein with
           similarity to mammalian monocarboxylate permeases, which
           are involved in transport of monocarboxylic acids across
           the plasma membrane; mutant is not deficient in
           monocarboxylate transport
          Length = 473

 Score = 30.0 bits (66), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 18/47 (38%), Positives = 24/47 (51%), Gaps = 4/47 (8%)

Query: 101 AHYRENNKIIQGSERRCRESQAAVAFFFFSMAIFLAKMIMSLLNIFS 147
           AHY ENN    GS    +   A++    FS  +F A +I  L +IFS
Sbjct: 67  AHYLENNTFAGGS----KLDYASIGGLAFSCGLFFAPVITWLYHIFS 109

>Kwal_23.4650 s23 (802842..803999) [1158 bp, 385 aa] {ON} YDL218W -
           1:1 [contig 5] FULL
          Length = 385

 Score = 30.0 bits (66), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 36/160 (22%), Positives = 62/160 (38%), Gaps = 23/160 (14%)

Query: 9   LRIVNFVFMVICIGLISDLIATRD-RHSSRVNYCMFAAAYGIATDSLYGVFANFFEILAW 67
           LR++ F+  VI +GL++ ++   D R S + NY +  A   +    L  V          
Sbjct: 78  LRMLQFICSVIVLGLLAYVLKGYDYRGSHKTNYGLAVAVISVVYLLLLSVLGAVLSKFLL 137

Query: 68  PLILFTLDFLNFAFMLTAGCVLAV-------GIRAHSCNNAHYRE--------------- 105
           P +    + + +A  L+A  VLA        G+R  S  N  Y                 
Sbjct: 138 PGLYLLFEMIMWALWLSAFVVLAKEHGSRSCGLRNTSSYNPKYGSTSSYQSSGGDYDPFT 197

Query: 106 NNKIIQGSERRCRESQAAVAFFFFSMAIFLAKMIMSLLNI 145
           N        R C   +AA+AF   +  +F+   ++  +N+
Sbjct: 198 NRYTTNSYSRPCHSGKAAIAFAGLATLLFMITPVLIGINV 237

>KNAG0I01750 Chr9 (344381..345355) [975 bp, 324 aa] {ON} Anc_6.26
           YOL001W
          Length = 324

 Score = 29.6 bits (65), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 25/84 (29%), Positives = 39/84 (46%), Gaps = 2/84 (2%)

Query: 39  NYCMFAAAYGIATDSLYGVFANFFEILAWPLILFTLDFLN-FAFMLTAGCVLAVGIRAHS 97
           NY +    Y     S+      + ++L+     FT++ L    F+LTA  V + G+    
Sbjct: 100 NYLIRLTKYSALEPSVLLTSIYYIDLLSSVYPAFTINSLTVHRFLLTATTVASKGLCDSF 159

Query: 98  CNNAHYRENNKIIQGSERRCRESQ 121
           C NAHY +    +QGSE    ES+
Sbjct: 160 CTNAHYAKVGG-VQGSELNILESE 182

>CAGL0H10076g Chr8 (982652..983629) [978 bp, 325 aa] {ON} similar to
           uniprot|P38079 Saccharomyces cerevisiae YBR054w YRO2
          Length = 325

 Score = 28.9 bits (63), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 17/54 (31%), Positives = 25/54 (46%), Gaps = 4/54 (7%)

Query: 55  YGVFANFFEILAWPL----ILFTLDFLNFAFMLTAGCVLAVGIRAHSCNNAHYR 104
           Y  +  +F  L WPL    IL      + AF  T GCV +V     +C ++ Y+
Sbjct: 114 YARYVGWFMALPWPLIQASILGKTPVWHVAFNCTMGCVFSVCFLIAACVHSTYK 167

>SAKL0E01408g Chr5 (106229..107152) [924 bp, 307 aa] {ON} similar to
           uniprot|P20052 Saccharomyces cerevisiae YOL001W PHO80
           Cyclin negatively regulates phosphate metabolism
           Pho80p-Pho85p (cyclin-CDK complex) phosphorylates Pho4p
           and Swi5p deletion of PHO80 leads to aminoglycoside
           supersensitivity truncated form of PHO80 affects vacuole
           inheritance
          Length = 307

 Score = 28.9 bits (63), Expect = 6.8,   Method: Compositional matrix adjust.
 Identities = 30/122 (24%), Positives = 48/122 (39%), Gaps = 19/122 (15%)

Query: 1   MLAVTDNLLRIVNFVFMVICIGLISDLIATRD-----------RHSSRV-------NYCM 42
            + + D  L+      +V+   ++S LI   D           R  SRV       NY +
Sbjct: 46  QIMLPDEFLKCSRTALVVLISRMLSSLIQMNDSMCKDKNLKLTRFHSRVPPGISVYNYLI 105

Query: 43  FAAAYGIATDSLYGVFANFFEILAWPLILFTLDFLN-FAFMLTAGCVLAVGIRAHSCNNA 101
             A Y     ++      + ++L+     FTL+ L    F+LTA  V + G+    C N 
Sbjct: 106 RLAKYSSLEPAVLIAAVYYIDLLSSVYPSFTLNSLTVHRFLLTATTVASKGLSDSFCTNV 165

Query: 102 HY 103
           HY
Sbjct: 166 HY 167

>YDL218W Chr4 (66493..67446) [954 bp, 317 aa] {ON} Putative protein
           of unknown function; YDL218W transcription is regulated
           by Azf1p and induced by starvation and aerobic
           conditions; expression also induced in cells treated
           with the mycotoxin patulin
          Length = 317

 Score = 28.9 bits (63), Expect = 7.4,   Method: Compositional matrix adjust.
 Identities = 41/159 (25%), Positives = 67/159 (42%), Gaps = 30/159 (18%)

Query: 8   LLRIVNFVFMVICIGLISDLI-ATRDRHSSRVNYCMFAAAYGIATDSLYGVFANFFEI-- 64
           LLR   F   V+ + L++  I A  +R + + N+ +             GV + F+ I  
Sbjct: 11  LLRFSQFASSVLVMSLLAYAIHAYGNRGNKKTNFTLAT-----------GVISVFYLIAL 59

Query: 65  ----LAWPLIL-----FTLDFLNFAFMLTAGCVLAVGIRAHSCNNA-----HYRE-NNKI 109
               LA P ++     F  + +     L A  VLA      SC+N      +Y   + + 
Sbjct: 60  GILCLALPTLIYIGMYFCAELIVCMLWLAAFVVLAKAQGERSCSNTNADGLYYNPYSGQY 119

Query: 110 IQGSERR-CRESQAAVAFFFFSMAIFLAKMIMSLLNIFS 147
              S RR C  SQAA+AF      +FL  +I+  +N+ +
Sbjct: 120 TADSHRRACNSSQAAIAFSGLCFVLFLISVILLGINVLT 158

>TBLA0E02500 Chr5 (628027..629757) [1731 bp, 576 aa] {ON} 
          Length = 576

 Score = 28.9 bits (63), Expect = 8.3,   Method: Composition-based stats.
 Identities = 20/54 (37%), Positives = 28/54 (51%), Gaps = 8/54 (14%)

Query: 46  AYGIATDSLYGVFANFFEILAWPLIL-----FTLDFLNFAFM-LTAGCVLAVGI 93
           A+ + T   YG+F  FFE  A+P++      FT+  L  AF+    GCV A  I
Sbjct: 371 AFDLYTAVAYGIFYLFFE--AFPIVFVGIYNFTVIELGLAFLGFCVGCVFAYAI 422

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.334    0.142    0.427 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 15,735,324
Number of extensions: 549015
Number of successful extensions: 2143
Number of sequences better than 10.0: 53
Number of HSP's gapped: 2155
Number of HSP's successfully gapped: 53
Length of query: 173
Length of database: 53,481,399
Length adjustment: 102
Effective length of query: 71
Effective length of database: 41,785,467
Effective search space: 2966768157
Effective search space used: 2966768157
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 39 (21.6 bits)
S2: 62 (28.5 bits)