Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
CAGL0L08426g3.496ON1401407205e-99
KNAG0A079603.496ON1771392662e-29
TPHA0D033003.496ON1961422593e-28
Kpol_1017.43.496ON1841482558e-28
NDAI0B058903.496ON2781422401e-24
YPR151C (SUE1)3.496ON2061362332e-24
KLLA0E03983g3.496ON1911432314e-24
SAKL0F02618g3.496ON2531452354e-24
Smik_16.4033.496ON2031432308e-24
Suva_16.4793.496ON2121432291e-23
ZYRO0D09812g3.496ON1851502227e-23
NCAS0F035703.496ON2301432232e-22
Skud_16.4453.496ON2151362212e-22
Kwal_55.212483.496ON2221382063e-20
TDEL0D056403.496ON1241291995e-20
KLTH0F14938g3.496ON2291422003e-19
KAFR0G037103.496ON79671461e-12
TBLA0D029403.496ON71481339e-11
Ecym_12333.496ON87511252e-09
TPHA0D012908.682ON2181291322e-09
Kwal_26.88288.682ON2231311304e-09
KLTH0D11396g8.682ON2251251252e-08
NCAS0C013108.682ON2571341234e-08
SAKL0H06380g8.682ON2191221163e-07
Kpol_1013.98.682ON2611211155e-07
TPHA0G015708.682ON2551451121e-06
ZYRO0F07480g8.682ON2361281093e-06
KLLA0D06061g8.682ON2491301084e-06
AFR315C3.496ON7743991e-05
KNAG0J017608.682ON2581241051e-05
Suva_16.1518.682ON2531241041e-05
Kpol_1072.128.682ON2221301032e-05
TDEL0A062708.682ON2421281023e-05
YPL159C (PET20)8.682ON2531311013e-05
Skud_16.1238.682ON2551241005e-05
TBLA0B038008.682ON3241351006e-05
Smik_6.3568.682ON253124971e-04
Smik_14.363.62ON524141953e-04
TDEL0E007103.62ON476140953e-04
NDAI0K013208.682ON258125890.002
CAGL0M02101g8.682ON26725790.030
Ecym_23908.682ON227121780.047
Suva_14.443.62ON525141780.052
KLLA0A07447g3.62ON486142760.11
SAKL0C12342g3.62ON552134760.11
YNL295W3.62ON524141730.27
SAKL0H09086g8.582ON47269710.47
TBLA0B085103.62ON501153700.57
KAFR0H023808.682ON220123690.59
ZYRO0C02244g3.62ON460141690.88
KLTH0A01364g3.62ON47633681.0
TPHA0P012603.62ON494141671.6
ACR096W8.630ON50552652.7
Kwal_60.24929singletonON19976642.7
Kwal_23.52773.62ON47033643.1
Skud_14.423.62ON524147634.3
TDEL0F00160singletonON50423634.7
Smik_13.2322.616ON85080635.6
ZYRO0F11176g7.324ON46463626.1
YCL045C (EMC1)1.29ON76034626.8
TDEL0A010902.68ON105652627.7
KNAG0B017401.267ON76570619.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0L08426g
         (140 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0L08426g Chr12 (926880..927302) [423 bp, 140 aa] {ON} simila...   281   5e-99
KNAG0A07960 Chr1 complement(1270134..1270667) [534 bp, 177 aa] {...   107   2e-29
TPHA0D03300 Chr4 complement(678395..678985) [591 bp, 196 aa] {ON...   104   3e-28
Kpol_1017.4 s1017 (17411..17965) [555 bp, 184 aa] {ON} (17411..1...   102   8e-28
NDAI0B05890 Chr2 complement(1423733..1424569) [837 bp, 278 aa] {...    97   1e-24
YPR151C Chr16 complement(831055..831675) [621 bp, 206 aa] {ON}  ...    94   2e-24
KLLA0E03983g Chr5 (363400..363975) [576 bp, 191 aa] {ON} similar...    94   4e-24
SAKL0F02618g Chr6 (225795..226556) [762 bp, 253 aa] {ON} similar...    95   4e-24
Smik_16.403 Chr16 complement(702998..703609) [612 bp, 203 aa] {O...    93   8e-24
Suva_16.479 Chr16 complement(827450..828088) [639 bp, 212 aa] {O...    93   1e-23
ZYRO0D09812g Chr4 (833123..833680) [558 bp, 185 aa] {ON} similar...    90   7e-23
NCAS0F03570 Chr6 complement(711238..711930) [693 bp, 230 aa] {ON...    91   2e-22
Skud_16.445 Chr16 complement(784636..785283) [648 bp, 215 aa] {O...    90   2e-22
Kwal_55.21248 s55 complement(748370..749038) [669 bp, 222 aa] {O...    84   3e-20
TDEL0D05640 Chr4 complement(1013767..1014141) [375 bp, 124 aa] {...    81   5e-20
KLTH0F14938g Chr6 complement(1220898..1221587) [690 bp, 229 aa] ...    82   3e-19
KAFR0G03710 Chr7 complement(764660..764899) [240 bp, 79 aa] {ON}...    61   1e-12
TBLA0D02940 Chr4 (720446..720661) [216 bp, 71 aa] {ON} Anc_3.496...    56   9e-11
Ecym_1233 Chr1 (481548..481811) [264 bp, 87 aa] {ON} similar to ...    53   2e-09
TPHA0D01290 Chr4 (268062..268718) [657 bp, 218 aa] {ON} Anc_8.68...    55   2e-09
Kwal_26.8828 s26 (960466..961137) [672 bp, 223 aa] {ON} YPL159C ...    55   4e-09
KLTH0D11396g Chr4 (931339..932016) [678 bp, 225 aa] {ON} similar...    53   2e-08
NCAS0C01310 Chr3 complement(241103..241876) [774 bp, 257 aa] {ON...    52   4e-08
SAKL0H06380g Chr8 complement(563753..564412) [660 bp, 219 aa] {O...    49   3e-07
Kpol_1013.9 s1013 (15300..16085) [786 bp, 261 aa] {ON} (15300..1...    49   5e-07
TPHA0G01570 Chr7 complement(319949..320716) [768 bp, 255 aa] {ON...    48   1e-06
ZYRO0F07480g Chr6 (607194..607904) [711 bp, 236 aa] {ON} similar...    47   3e-06
KLLA0D06061g Chr4 (520082..520831) [750 bp, 249 aa] {ON} weakly ...    46   4e-06
AFR315C Chr6 complement(1006937..1007170) [234 bp, 77 aa] {ON} S...    43   1e-05
KNAG0J01760 Chr10 (320758..321534) [777 bp, 258 aa] {ON} Anc_8.6...    45   1e-05
Suva_16.151 Chr16 complement(260210..260971) [762 bp, 253 aa] {O...    45   1e-05
Kpol_1072.12 s1072 complement(24362..25030) [669 bp, 222 aa] {ON...    44   2e-05
TDEL0A06270 Chr1 (1098704..1099432) [729 bp, 242 aa] {ON} Anc_8....    44   3e-05
YPL159C Chr16 complement(250907..251668) [762 bp, 253 aa] {ON}  ...    44   3e-05
Skud_16.123 Chr16 complement(222359..223126) [768 bp, 255 aa] {O...    43   5e-05
TBLA0B03800 Chr2 complement(873861..874835) [975 bp, 324 aa] {ON...    43   6e-05
Smik_6.356 Chr6 (572523..573284) [762 bp, 253 aa] {ON} YPL159C (...    42   1e-04
Smik_14.36 Chr14 (61288..62862) [1575 bp, 524 aa] {ON} YNL295W (...    41   3e-04
TDEL0E00710 Chr5 (152143..153573) [1431 bp, 476 aa] {ON} Anc_3.6...    41   3e-04
NDAI0K01320 Chr11 complement(297117..297893) [777 bp, 258 aa] {O...    39   0.002
CAGL0M02101g Chr13 complement(254024..254827) [804 bp, 267 aa] {...    35   0.030
Ecym_2390 Chr2 complement(757433..758116) [684 bp, 227 aa] {ON} ...    35   0.047
Suva_14.44 Chr14 (73757..75334) [1578 bp, 525 aa] {ON} YNL295W (...    35   0.052
KLLA0A07447g Chr1 (669272..670732) [1461 bp, 486 aa] {ON} simila...    34   0.11 
SAKL0C12342g Chr3 complement(1099949..1101607) [1659 bp, 552 aa]...    34   0.11 
YNL295W Chr14 (76946..78520) [1575 bp, 524 aa] {ON} Putative pro...    33   0.27 
SAKL0H09086g Chr8 complement(774264..775682) [1419 bp, 472 aa] {...    32   0.47 
TBLA0B08510 Chr2 complement(2036557..2038062) [1506 bp, 501 aa] ...    32   0.57 
KAFR0H02380 Chr8 complement(455996..456658) [663 bp, 220 aa] {ON...    31   0.59 
ZYRO0C02244g Chr3 complement(174640..176022) [1383 bp, 460 aa] {...    31   0.88 
KLTH0A01364g Chr1 (126448..127878) [1431 bp, 476 aa] {ON} weakly...    31   1.0  
TPHA0P01260 Chr16 complement(252274..253758) [1485 bp, 494 aa] {...    30   1.6  
ACR096W Chr3 (527646..529163) [1518 bp, 505 aa] {ON} Syntenic ho...    30   2.7  
Kwal_60.24929 s60 complement(7427..8026) [600 bp, 199 aa] {ON} Y...    29   2.7  
Kwal_23.5277 s23 complement(1088250..1089662) [1413 bp, 470 aa] ...    29   3.1  
Skud_14.42 Chr14 (70507..72081) [1575 bp, 524 aa] {ON} YNL295W (...    29   4.3  
TDEL0F00160 Chr6 (17872..19386) [1515 bp, 504 aa] {ON}                 29   4.7  
Smik_13.232 Chr13 complement(364426..366978) [2553 bp, 850 aa] {...    29   5.6  
ZYRO0F11176g Chr6 complement(915602..916996) [1395 bp, 464 aa] {...    28   6.1  
YCL045C Chr3 complement(44623..46905) [2283 bp, 760 aa] {ON}  EM...    28   6.8  
TDEL0A01090 Chr1 complement(182565..185735) [3171 bp, 1056 aa] {...    28   7.7  
KNAG0B01740 Chr2 (318809..321106) [2298 bp, 765 aa] {ON} Anc_1.2...    28   9.3  

>CAGL0L08426g Chr12 (926880..927302) [423 bp, 140 aa] {ON} similar
           to uniprot|Q06524 Saccharomyces cerevisiae YPR151c
          Length = 140

 Score =  281 bits (720), Expect = 5e-99,   Method: Compositional matrix adjust.
 Identities = 140/140 (100%), Positives = 140/140 (100%)

Query: 1   MKRVNEIFRKLPKVPMTRYLENRLLSEDMLYNGYRPILYPMRENPLLCHSNVRETHYYGE 60
           MKRVNEIFRKLPKVPMTRYLENRLLSEDMLYNGYRPILYPMRENPLLCHSNVRETHYYGE
Sbjct: 1   MKRVNEIFRKLPKVPMTRYLENRLLSEDMLYNGYRPILYPMRENPLLCHSNVRETHYYGE 60

Query: 61  SSNELQKKDEEPVNELLYGPEGRGGISTMGVRRMADPSKVKLGLSYSIMGMEYYPEWEKV 120
           SSNELQKKDEEPVNELLYGPEGRGGISTMGVRRMADPSKVKLGLSYSIMGMEYYPEWEKV
Sbjct: 61  SSNELQKKDEEPVNELLYGPEGRGGISTMGVRRMADPSKVKLGLSYSIMGMEYYPEWEKV 120

Query: 121 PRDVVKRIKPYEVMKVKKNV 140
           PRDVVKRIKPYEVMKVKKNV
Sbjct: 121 PRDVVKRIKPYEVMKVKKNV 140

>KNAG0A07960 Chr1 complement(1270134..1270667) [534 bp, 177 aa] {ON}
           Anc_3.496 YPR151C
          Length = 177

 Score =  107 bits (266), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 59/139 (42%), Positives = 87/139 (62%), Gaps = 10/139 (7%)

Query: 6   EIFRKLPKVPMTRYLENRLLSEDMLYNGYRPILYPMRENPLLCHSN--VRETH-YYGESS 62
            +FR+LPKVPMT+YLE R L++D+LY+GYRP++YP+RENPL  +SN  +  +H  +    
Sbjct: 30  SMFRRLPKVPMTKYLETRELAKDILYSGYRPVMYPVRENPLFRNSNKLMAISHPEHDTEG 89

Query: 63  NELQKKDEEPVNELLYGPEGRGGISTMGVR---RMADPSKVKL----GLSYSIMGMEYYP 115
            E   +D + VN  L+G    GGI+T+G     + A     K+      S S + ME YP
Sbjct: 90  TEGTHRDSQTVNTELFGNNNCGGINTLGCNGTWKYAPKIPQKMLPFNWWSASSLAMEVYP 149

Query: 116 EWEKVPRDVVKRIKPYEVM 134
           EW  VP+ VVK +KP++++
Sbjct: 150 EWSSVPKHVVKGLKPFDLL 168

>TPHA0D03300 Chr4 complement(678395..678985) [591 bp, 196 aa] {ON}
           Anc_3.496 YPR151C
          Length = 196

 Score =  104 bits (259), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 60/142 (42%), Positives = 82/142 (57%), Gaps = 12/142 (8%)

Query: 4   VNEIFRKLPKVPMTRYLENRLLSEDMLYNGYRPILYPMRENPLLCHSN-----VRETHYY 58
            N IF+ LP+VP TRYLE+  L+ D+L++GYRPI YP++ENPL  + N        T   
Sbjct: 47  FNSIFKNLPRVPTTRYLESTKLTNDILFSGYRPITYPVKENPLFRNINKYNNDFLSTQET 106

Query: 59  GESSNELQKKDEEPVNELLYGPEGRGGISTMGVRRMA--DPSKVKLGLSY-----SIMGM 111
            E +N +  +       +L G +G GGI + GV      +P+  +  L Y     SIMGM
Sbjct: 107 QEKNNPVLPQKNHEAFSVLTGEKGTGGIMSGGVNGTWKYNPTVPENLLPYNWWSTSIMGM 166

Query: 112 EYYPEWEKVPRDVVKRIKPYEV 133
           EYYPEW  VPR  +K +KP+EV
Sbjct: 167 EYYPEWNNVPRRFLKTLKPFEV 188

>Kpol_1017.4 s1017 (17411..17965) [555 bp, 184 aa] {ON}
           (17411..17965) [555 nt, 185 aa]
          Length = 184

 Score =  102 bits (255), Expect = 8e-28,   Method: Compositional matrix adjust.
 Identities = 61/148 (41%), Positives = 86/148 (58%), Gaps = 19/148 (12%)

Query: 6   EIFRKLPKVPMTRYLENRLLSEDMLYNGYRPILYPMRENPLLCHS----NVRETHYYGES 61
            IFR LP+VP T++LE+  L+ D+L++GYRPI YP++ENPL  ++    N+         
Sbjct: 34  HIFRSLPRVPTTQFLESTTLTNDILFSGYRPITYPVKENPLFRNTGNTKNIFGQDLVNAE 93

Query: 62  SNE-----LQKKDEEPVNE---LLYGPEGRGGISTMGVRRMAD-----PSKV--KLGLSY 106
           SN      LQ+ D+   ++    L G  G GGI + GV          PSK+      S 
Sbjct: 94  SNSNDASLLQEHDKNITSQEFNTLSGDRGTGGIKSGGVNGTWRFNPRVPSKLLPYSWWST 153

Query: 107 SIMGMEYYPEWEKVPRDVVKRIKPYEVM 134
           SIMGMEYYPEW+ +PR VVK +KPY+++
Sbjct: 154 SIMGMEYYPEWKNIPRKVVKDLKPYQLV 181

>NDAI0B05890 Chr2 complement(1423733..1424569) [837 bp, 278 aa] {ON}
           Anc_3.496 YPR151C
          Length = 278

 Score = 97.1 bits (240), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 61/142 (42%), Positives = 88/142 (61%), Gaps = 17/142 (11%)

Query: 5   NEIFRKLPKVPMTRYLENRLLSEDMLYNGYRPILYPMRENPL----LCHSNVRETHYYGE 60
           N IFR +PKVPMT+YLE + LS+DMLY+GYRPI+YP++ENPL    L  ++     +   
Sbjct: 126 NNIFRTMPKVPMTKYLETKELSQDMLYSGYRPIMYPVKENPLFRLTLKKNSSSSFPFSTT 185

Query: 61  SSNELQKKDEEPVNELLYGPEGRGGISTMGVR-------RMAD---PSKVKLGLSYSIMG 110
           SS+  +KK  +      +  +  GGI T G+        R+ +   P+K+    S SIMG
Sbjct: 186 SSSSSEKKKPQQEQMKKHYDDEYGGIMTGGINGTWRYSPRIPNNLLPNKI---WSMSIMG 242

Query: 111 MEYYPEWEKVPRDVVKRIKPYE 132
           MEYYPEW+ VP ++VK +KP++
Sbjct: 243 MEYYPEWKGVPFNIVKNLKPFD 264

>YPR151C Chr16 complement(831055..831675) [621 bp, 206 aa] {ON}
           SUE1Mitochondrial protein required for degradation of
           unstable forms of cytochrome c
          Length = 206

 Score = 94.4 bits (233), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 55/136 (40%), Positives = 83/136 (61%), Gaps = 11/136 (8%)

Query: 8   FRKLPKVPMTRYLENRLLSEDMLYNGYRPILYPMRENPLL---CHSNVRETHYYGESSN- 63
           FR LPKVP T+YLE R L+ D+LY+GYRP++YP++ENPL       +++      E +N 
Sbjct: 55  FRSLPKVPTTQYLEARELTRDILYSGYRPVMYPVKENPLFRDKKRKSLQTLLTMNEKTNA 114

Query: 64  ELQKKDEEPVNELLYGPEGRGGISTMGVRRMA--DPSKVKLGL-----SYSIMGMEYYPE 116
           E +  DE+    +L+G  G GGI + GV      +P+     L     S S MGMEY+PE
Sbjct: 115 EAKTIDEKKHKNILFGERGTGGIMSGGVNGTWKYNPTVPNELLPFNWWSTSSMGMEYFPE 174

Query: 117 WEKVPRDVVKRIKPYE 132
           W+ VP  +++++KP++
Sbjct: 175 WKNVPPYMMRKLKPFD 190

>KLLA0E03983g Chr5 (363400..363975) [576 bp, 191 aa] {ON} similar to
           gnl|GLV|CAGL0L08426g Candida glabrata CAGL0L08426g and
           weakly similar to YPR151C uniprot|Q06524 Saccharomyces
           cerevisiae YPR151C SUE1 Mitochondrial protein required
           for degradation of unstable forms of cytochrome c
          Length = 191

 Score = 93.6 bits (231), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 53/143 (37%), Positives = 81/143 (56%), Gaps = 13/143 (9%)

Query: 3   RVNEIFRKLPKVPMTRYLENRLLSEDMLYNGYRPILYPMRENPLLCHSNVRETHYYGE-- 60
           +  +++R+LP+VP TR+L  + L+ D+L++GYRPI+ P+R+NPL   + V+E     E  
Sbjct: 7   KATQMYRQLPRVPTTRFLAPQELTADILFSGYRPIVSPLRDNPLF-QAKVKELEVEREKN 65

Query: 61  SSNELQKK---DEEPVNELLYGPEGRGGISTMGVR-------RMADPSKVKLGLSYSIMG 110
              +L+ K     EP +  + GP G GGI + GV        R+ +        S S MG
Sbjct: 66  GGGKLKSKAAFASEPEHPFMAGPNGTGGILSGGVNGTWRYNPRIPNKLLQSALWSSSAMG 125

Query: 111 MEYYPEWEKVPRDVVKRIKPYEV 133
           ME+YPEW  VP  V   +KPY++
Sbjct: 126 MEFYPEWNDVPNKVSASLKPYQL 148

>SAKL0F02618g Chr6 (225795..226556) [762 bp, 253 aa] {ON} similar to
           uniprot|Q06524 Saccharomyces cerevisiae YPR151C SUE1
           Mitochondrial protein required for degradation of
           unstable forms of cytochrome c
          Length = 253

 Score = 95.1 bits (235), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 57/145 (39%), Positives = 87/145 (60%), Gaps = 14/145 (9%)

Query: 2   KRVNEIFRKLPKVPMTRYLENRLLSEDMLYNGYRPILYPMRENPLLCHSNVR-----ETH 56
           K+ ++IFR LPKVP T++LE R L+ D+L++GYRP+ YP++ENP       R     ET 
Sbjct: 17  KKNSDIFRLLPKVPTTQFLEPRELTRDILFSGYRPVTYPVKENPFFNIGTQRKGLAGETS 76

Query: 57  YYGESSNELQKKDEEPVNELLYGPEGRGGISTMGVRRMAD-----PSKV---KLGLSYSI 108
              E  NE ++++E+  + ++ GP G GGI + GV          P+K+    L  S S 
Sbjct: 77  AKKEYKNEAERENEKEEHNVMAGPRGTGGIVSGGVNGTWRYNPRIPTKLLPYNL-WSSST 135

Query: 109 MGMEYYPEWEKVPRDVVKRIKPYEV 133
           M MEYYPEW  VP+ +  ++KP+++
Sbjct: 136 MAMEYYPEWLNVPKTIANKLKPFDM 160

>Smik_16.403 Chr16 complement(702998..703609) [612 bp, 203 aa] {ON}
           YPR151C (REAL)
          Length = 203

 Score = 93.2 bits (230), Expect = 8e-24,   Method: Compositional matrix adjust.
 Identities = 55/143 (38%), Positives = 78/143 (54%), Gaps = 25/143 (17%)

Query: 8   FRKLPKVPMTRYLENRLLSEDMLYNGYRPILYPMRENPLLCHSNVRETHYYGESSNELQK 67
           FR LPKVP T+YLE R L+ D+LY+GYRP++YP++ENPL      +       S   L  
Sbjct: 53  FRSLPKVPTTQYLEARELTRDILYSGYRPVMYPVKENPLFRDKKKK-------SLQMLLT 105

Query: 68  KDEEPVNE-----------LLYGPEGRGGISTMGVRRMA--DPSKVKLGL-----SYSIM 109
            DE P+ E           +L+G  G GGI + GV      +P+     L     S S M
Sbjct: 106 ADEAPITEAKTTEKSKHKNILFGERGTGGIMSGGVNGTWKYNPTVPNELLPFNWWSTSSM 165

Query: 110 GMEYYPEWEKVPRDVVKRIKPYE 132
           GMEY+PEW  +P  + +++KP++
Sbjct: 166 GMEYFPEWRNIPSYMTRKLKPFD 188

>Suva_16.479 Chr16 complement(827450..828088) [639 bp, 212 aa] {ON}
           YPR151C (REAL)
          Length = 212

 Score = 92.8 bits (229), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 55/143 (38%), Positives = 79/143 (55%), Gaps = 25/143 (17%)

Query: 8   FRKLPKVPMTRYLENRLLSEDMLYNGYRPILYPMRENPLLCHSNVRETHYYGESSNELQK 67
           FR LPKVP T+YLE R L+ D+LY+GYRP++YP++ENPL      +       S   L  
Sbjct: 62  FRSLPKVPTTQYLEARELTRDILYSGYRPVMYPVKENPLFRDKKKK-------SLQMLLA 114

Query: 68  KDEEPVNE-----------LLYGPEGRGGISTMGVRRMA--DPSKVKLGLSY-----SIM 109
            DE+P  E           + +G  G GGI + GV      +P+     L Y     S M
Sbjct: 115 SDEKPATEAKATEKSEHKNVFFGERGTGGIMSGGVNGTWKYNPTVPNELLPYNWWSTSSM 174

Query: 110 GMEYYPEWEKVPRDVVKRIKPYE 132
           GMEY+PEW+ VP  +++++KP++
Sbjct: 175 GMEYFPEWKNVPSYMMRKLKPFD 197

>ZYRO0D09812g Chr4 (833123..833680) [558 bp, 185 aa] {ON} similar to
           gnl|GLV|CAGL0L08426g Candida glabrata CAGL0L08426g and
           weakly similar to YPR151C uniprot|Q06524 Saccharomyces
           cerevisiae YPR151C SUE1 Mitochondrial protein required
           for degradation of unstable forms of cytochrome c
          Length = 185

 Score = 90.1 bits (222), Expect = 7e-23,   Method: Compositional matrix adjust.
 Identities = 54/150 (36%), Positives = 88/150 (58%), Gaps = 27/150 (18%)

Query: 5   NEIFRKLPKVPMTRYLENRLLSEDMLYNGYRPILYPMRENPLLCHSNVRETHYYGESSNE 64
           ++IFR +P+VP T++LE+R L+ D+L++GYRP++YP++ENPL      +E    GE ++E
Sbjct: 22  SDIFRSMPRVPTTQFLESRELTRDILFSGYRPVMYPVKENPLF-----KERTRNGELTDE 76

Query: 65  LQKKDEEPVNE---------------LLYGPEG----RGGISTMGVRRMAD-PSKVK--L 102
           LQ +    + +               ++ GP G      G ++   R  A  PSK+    
Sbjct: 77  LQSRHNSGLRQGRTQEEEKESGEEYSVIAGPRGCGGIASGGASGTWRNGAKMPSKLLPYS 136

Query: 103 GLSYSIMGMEYYPEWEKVPRDVVKRIKPYE 132
             S + MGME++PEWE VPR VV+++KP++
Sbjct: 137 WWSTTSMGMEFFPEWEGVPRHVVRKLKPFD 166

>NCAS0F03570 Chr6 complement(711238..711930) [693 bp, 230 aa] {ON}
           Anc_3.496 YPR151C
          Length = 230

 Score = 90.5 bits (223), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 57/143 (39%), Positives = 80/143 (55%), Gaps = 29/143 (20%)

Query: 1   MKRVNEIFRKLPKVPMTRYLENRLLSEDMLYNGYRPILYPMRENPLLCHSNVRETHYYGE 60
            K  N IFRKLPKVPMTRYLE + LS+++L+ GY+PI+YP+RENPL              
Sbjct: 111 FKYSNNIFRKLPKVPMTRYLETKQLSKEILFAGYKPIMYPVRENPLF------------- 157

Query: 61  SSNELQKKDEEPVNELLYGPEGRGGISTMGVRRMADPSKVKLGLSYSIMGMEYYPEWEKV 120
              +L+ K E+   E   G E R   S++         K K   S SI+G++ YPEW  V
Sbjct: 158 ---KLKIKQEDAKRE--NGNEKRALGSSVS-------HKYKGIWSTSILGLQDYPEWNNV 205

Query: 121 PRDVVKRIKPYE----VMKVKKN 139
           P + +K +KP++     + +KKN
Sbjct: 206 PWNNIKNLKPFDEELASITIKKN 228

>Skud_16.445 Chr16 complement(784636..785283) [648 bp, 215 aa] {ON}
           YPR151C (REAL)
          Length = 215

 Score = 89.7 bits (221), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 54/136 (39%), Positives = 84/136 (61%), Gaps = 11/136 (8%)

Query: 8   FRKLPKVPMTRYLENRLLSEDMLYNGYRPILYPMRENPLL---CHSNVRETHYYGESSNE 64
           FR LPKVP T+YLE R L+ D+LY+GYRP++YP++ENPL       +++      E+   
Sbjct: 62  FRSLPKVPTTQYLEARELTRDILYSGYRPVMYPVKENPLFRDKKRDSLQMLLAPDEAPAA 121

Query: 65  LQKKDEEPVNE-LLYGPEGRGGISTMGVRRMA--DPSKVKLGL-----SYSIMGMEYYPE 116
             K  E+ +++ +L+G  G GGIS+ GV      +P+     L     S S MGMEY+PE
Sbjct: 122 EAKATEKDMHKNVLFGERGTGGISSGGVNGTWKYNPTVPNELLPFNWWSTSSMGMEYFPE 181

Query: 117 WEKVPRDVVKRIKPYE 132
           W+ VP  +++++KP++
Sbjct: 182 WKNVPSYMMRKLKPFD 197

>Kwal_55.21248 s55 complement(748370..749038) [669 bp, 222 aa] {ON}
           YPR151C - Hypothetical ORF [contig 130] FULL
          Length = 222

 Score = 84.0 bits (206), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 56/138 (40%), Positives = 81/138 (58%), Gaps = 8/138 (5%)

Query: 2   KRVNEIFRKLPKVPMTRYLENRLLSEDMLYNGYRPILYPMRENPLLCHSNVRETHYYGE- 60
           +R ++IFR LPKVP T+YLE   L+ D+LY+GYRP++YP++ENPL   +  +      E 
Sbjct: 17  RRSSDIFRSLPKVPTTQYLEPAELTRDILYSGYRPVIYPVKENPLFKETGWKTQRLREEP 76

Query: 61  SSNELQKKDEEPVNELLYGPEGRGGISTMGVRRMAD-----PSK-VKLGL-SYSIMGMEY 113
            S+      +E     + GP+G GGI + GV          PSK +   L S + M MEY
Sbjct: 77  GSDTALTAAKESSKNAMAGPQGTGGIGSGGVNGTWRYNPRIPSKLLPFSLWSSTSMAMEY 136

Query: 114 YPEWEKVPRDVVKRIKPY 131
           +PEW  VPR VV +++P+
Sbjct: 137 HPEWLAVPRTVVNKLRPF 154

>TDEL0D05640 Chr4 complement(1013767..1014141) [375 bp, 124 aa] {ON}
           Anc_3.496 YPR151C
          Length = 124

 Score = 81.3 bits (199), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 42/129 (32%), Positives = 68/129 (52%), Gaps = 35/129 (27%)

Query: 4   VNEIFRKLPKVPMTRYLENRLLSEDMLYNGYRPILYPMRENPLLCHSNVRETHYYGESSN 63
            +++FR LP+VP TR+LE + LS D+L++GYRP++YP+RENPL                 
Sbjct: 27  TDDLFRTLPRVPTTRFLETQRLSSDILFSGYRPVMYPVRENPLF---------------- 70

Query: 64  ELQKKDEEPVNELLYGPEGRGGISTMGVRRMADPSKVKLGLSYSIMGMEYYPEWEKVPRD 123
                             GRG  +       ++  +  L  S + MG+E +PEW  VPR+
Sbjct: 71  ------------------GRGTKTEAPASLESNLPRYDL-WSTTTMGLERFPEWSNVPRE 111

Query: 124 VVKRIKPYE 132
           VV++++P++
Sbjct: 112 VVRKLRPFD 120

>KLTH0F14938g Chr6 complement(1220898..1221587) [690 bp, 229 aa]
           {ON} weakly similar to uniprot|Q06524 Saccharomyces
           cerevisiae YPR151C SUE1 Mitochondrial protein required
           for degradation of unstable forms of cytochrome c
          Length = 229

 Score = 81.6 bits (200), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 54/142 (38%), Positives = 77/142 (54%), Gaps = 14/142 (9%)

Query: 2   KRVNEIFRKLPKVPMTRYLENRLLSEDMLYNGYRPILYPMRENPLLCHSNVRETHYYGE- 60
           ++ +EIFR LPKVP T+YLE   L+ D+LY+GYRP++YP++ENPL   +  +     GE 
Sbjct: 17  RKSSEIFRSLPKVPTTQYLEPAELTRDILYSGYRPVIYPVKENPLFKEAGWKTQRLRGER 76

Query: 61  ----SSNELQKKDEEPVNELLYGPEGRGGISTMGVRRMAD-PSKVKLGLSYSI-----MG 110
               SS   Q  +   +   L       G      R     PSK+   L Y++     M 
Sbjct: 77  GARKSSTVPQSSEMNAMAGPLGTGGIGSGGVNGTWRYNPRIPSKL---LPYNLWSCTSMA 133

Query: 111 MEYYPEWEKVPRDVVKRIKPYE 132
           MEY+PEW  VPR VV +++P+E
Sbjct: 134 MEYHPEWLAVPRTVVNKLRPFE 155

>KAFR0G03710 Chr7 complement(764660..764899) [240 bp, 79 aa] {ON}
          Anc_3.496 YPR151C
          Length = 79

 Score = 60.8 bits (146), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 32/67 (47%), Positives = 44/67 (65%), Gaps = 11/67 (16%)

Query: 7  IFRKLPKVPMTRYLENRLLSEDMLYNGYRPILYPMRENPLLCHSNVRETHYYGESSNE-- 64
          + + LP+VP T+YL+   L  D+LYNGYRP+LYPM+ENPLL   N       GE +NE  
Sbjct: 7  LCKNLPRVPTTKYLDKSKLKIDILYNGYRPVLYPMKENPLLYRQN-------GELANEQF 59

Query: 65 --LQKKD 69
            +Q++D
Sbjct: 60 TDIQQRD 66

>TBLA0D02940 Chr4 (720446..720661) [216 bp, 71 aa] {ON} Anc_3.496
          YPR151C
          Length = 71

 Score = 55.8 bits (133), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 22/48 (45%), Positives = 35/48 (72%)

Query: 7  IFRKLPKVPMTRYLENRLLSEDMLYNGYRPILYPMRENPLLCHSNVRE 54
          + R LP+VP T YLEN  L  D+ ++GYRP++YP++ENPL  +  +++
Sbjct: 15 VLRDLPRVPTTEYLENTRLYNDIFFSGYRPVMYPVKENPLFRNGELKK 62

>Ecym_1233 Chr1 (481548..481811) [264 bp, 87 aa] {ON} similar to
          Ashbya gossypii AFR315C
          Length = 87

 Score = 52.8 bits (125), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 36/51 (70%), Gaps = 1/51 (1%)

Query: 6  EIFRKLPKVPMTRYLENRLLSEDMLYNGYRPILYPMRENPLLCHS-NVRET 55
          EI R LP+VP T+YL    L  D+ ++GYRP++YP+++NPL   S N+ E+
Sbjct: 8  EILRHLPRVPTTQYLSLEELRTDIFFSGYRPMVYPVKQNPLFRSSKNILES 58

>TPHA0D01290 Chr4 (268062..268718) [657 bp, 218 aa] {ON} Anc_8.682
           YPL159C
          Length = 218

 Score = 55.5 bits (132), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 36/129 (27%), Positives = 61/129 (47%), Gaps = 28/129 (21%)

Query: 11  LPKVPMTRYLENRLLSEDMLYNGYRPILYPMRENPLLCHSNVRETHYYGESSNELQKKDE 70
           LPKVP T  + +R ++ + LY+GYRP+    ++  LL   N                   
Sbjct: 95  LPKVPQTSSITHREITTNSLYSGYRPLFIDNKKGTLLGDVN----------------STA 138

Query: 71  EPVNELLYGPEGRGGISTMGVRRMADPSKVKLGLSYSIMGMEYYPEWEKVPRDVVKRIKP 130
           +  N  +Y          M +  +++PS   +    S  G+E Y EW+ VP  V+K++KP
Sbjct: 139 QDANSSIYEF-------AMKLNELSEPSPWMM----SATGLESYSEWDYVPSKVIKKLKP 187

Query: 131 YEVMKVKKN 139
           Y+ + +K+N
Sbjct: 188 YD-LSIKEN 195

>Kwal_26.8828 s26 (960466..961137) [672 bp, 223 aa] {ON} YPL159C -
           Hypothetical ORF [contig 68] FULL
          Length = 223

 Score = 54.7 bits (130), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 36/131 (27%), Positives = 57/131 (43%), Gaps = 37/131 (28%)

Query: 2   KRVNEIFRKLPKVPMTRYLENRLLSEDMLYNGYRPILYPMRENPLLCHSNVRETHYYGES 61
           K++   F  LPK P T +L+ R +S  +LY+GYRP +                       
Sbjct: 76  KQLKTDFSWLPKAPSTDHLKQRDVSTTLLYSGYRPFV----------------------- 112

Query: 62  SNELQKKDEEPVNELLYGPEGRGGISTMGVRRMADPSKVKLGLSYSIMGMEYYPEWEKVP 121
              L   D++  +  LY          M +  + DP    L    S  G E+Y EW+ VP
Sbjct: 113 ---LAPADQKQTDSTLYE-------FAMKLESLGDP----LPWISSATGTEFYGEWDGVP 158

Query: 122 RDVVKRIKPYE 132
            DV+K+++P++
Sbjct: 159 ADVIKQLRPFQ 169

>KLTH0D11396g Chr4 (931339..932016) [678 bp, 225 aa] {ON} similar to
           uniprot|Q99373 Saccharomyces cerevisiae YPL159C PET20
           Protein required for respiratory growth and stability of
           the mitochondrial genome
          Length = 225

 Score = 52.8 bits (125), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 34/125 (27%), Positives = 55/125 (44%), Gaps = 37/125 (29%)

Query: 8   FRKLPKVPMTRYLENRLLSEDMLYNGYRPILYPMRENPLLCHSNVRETHYYGESSNELQK 67
           F  LPK P T +L++R +S  +LY+GYRP +    E                      QK
Sbjct: 82  FSWLPKAPSTDHLKHRDVSTTLLYSGYRPFVLNSSE----------------------QK 119

Query: 68  KDEEPVNELLYGPEGRGGISTMGVRRMADPSKVKLGLSYSIMGMEYYPEWEKVPRDVVKR 127
           + +  + E             M +  + DP    L    S  G E+Y EW+ +P DV+K+
Sbjct: 120 QTDSTLYEF-----------AMKLEALGDP----LPWISSATGTEFYGEWDNIPADVIKK 164

Query: 128 IKPYE 132
           ++P++
Sbjct: 165 LRPFQ 169

>NCAS0C01310 Chr3 complement(241103..241876) [774 bp, 257 aa] {ON}
           Anc_8.682
          Length = 257

 Score = 52.0 bits (123), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 39/134 (29%), Positives = 63/134 (47%), Gaps = 21/134 (15%)

Query: 8   FRKLPKV-PMTRYLENRLLSEDMLYNGYRPILYPMRENPLLCHSNVRETHYYGESSNELQ 66
           +  LPKV P+T    N + S D+LY+GYRP+    ++       N      +G S+N   
Sbjct: 87  YSTLPKVEPITNLRHNEI-STDILYSGYRPLFLNFKD-----LENSSRKAEFGNSNNSTL 140

Query: 67  KKDEEPVNELLYGPEGRGGISTMGVRRMADPSKVKLGLSYSIMGMEYYPEWEKVPRDVVK 126
            +    +++L   PE   G ++                S S  GME + EW+ VP  ++K
Sbjct: 141 YEIAMKLDDL--SPEAISGSTSSN-----------FWHSTSATGMEVFDEWDNVPNSILK 187

Query: 127 RIKPYEVMKVKKNV 140
            +KP++   VKKN+
Sbjct: 188 NLKPFQA-PVKKNL 200

>SAKL0H06380g Chr8 complement(563753..564412) [660 bp, 219 aa] {ON}
           similar to uniprot|Q99373 Saccharomyces cerevisiae
           YPL159C PET20 Protein required for respiratory growth
           and stability of the mitochondrial genome
          Length = 219

 Score = 49.3 bits (116), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 35/122 (28%), Positives = 53/122 (43%), Gaps = 37/122 (30%)

Query: 11  LPKVPMTRYLENRLLSEDMLYNGYRPILYPMRENPLLCHSNVRETHYYGESSNELQKKDE 70
           LPK P T +L+ R +S D+ Y+GYRPI      NP                     K+ E
Sbjct: 83  LPKAPSTEHLKLREISTDVFYSGYRPIFL----NPASP------------------KESE 120

Query: 71  EPVNELLYGPEGRGGISTMGVRRMADPSKVKLGLSYSIMGMEYYPEWEKVPRDVVKRIKP 130
             + E             M +  + DP    +    S  G E+Y EW+ VP +V+K++KP
Sbjct: 121 STLYEF-----------AMKLEALGDP----IPWVSSATGTEFYGEWDNVPTEVIKKLKP 165

Query: 131 YE 132
           ++
Sbjct: 166 FQ 167

>Kpol_1013.9 s1013 (15300..16085) [786 bp, 261 aa] {ON}
           (15300..16085) [786 nt, 262 aa]
          Length = 261

 Score = 48.9 bits (115), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 37/121 (30%), Positives = 50/121 (41%), Gaps = 30/121 (24%)

Query: 11  LPKVPMTRYLENRLLSEDMLYNGYRPILYPMRENPLLCHSNVRETHYYGESSNELQKKDE 70
           LPKVP T  L +R +    LY+GYRPI    +                G   N+L    +
Sbjct: 112 LPKVPSTENLNHREIRTSALYSGYRPIYINSK----------------GSGKNKLSGTMK 155

Query: 71  EPVNELLYGPEGRGGISTMGVRRMADPSKVKLGLSYSIMGMEYYPEWEKVPRDVVKRIKP 130
             VN   Y              ++ +PS        S  GME Y EW+ VP DV+K +KP
Sbjct: 156 NGVNSTFYEI----------AMKLENPSP----WMSSATGMELYSEWDHVPLDVLKDLKP 201

Query: 131 Y 131
           +
Sbjct: 202 F 202

>TPHA0G01570 Chr7 complement(319949..320716) [768 bp, 255 aa] {ON}
           Anc_8.682 YPL159C
          Length = 255

 Score = 47.8 bits (112), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 35/145 (24%), Positives = 58/145 (40%), Gaps = 42/145 (28%)

Query: 2   KRVNEIFRKLPKVPMTRYLENRLLSEDMLYNGYRPI------LYPMRENPLLCHSNVRET 55
           K++   +  LPK P T +L +   + D+ Y+GYRP+      L   +ENP  C       
Sbjct: 97  KQIKFDYSSLPKAPTTHHLHSSEFNTDLFYSGYRPLSIDVNQLASEQENPCTC------- 149

Query: 56  HYYGESSNELQKKDEEPVNELLYGPEGRGGISTMGVRRMADPSKVKLGLSYSIMGMEYYP 115
            Y    S ++ KK+                             KV     +S  G E Y 
Sbjct: 150 -YEISLSMDIVKKNL----------------------------KVSTPWLFSATGSELYK 180

Query: 116 EWEKVPRDVVKRIKPYEVMKVKKNV 140
           EW+ +P+ V+  +K +   ++K+ V
Sbjct: 181 EWDNIPKSVLDNLKCFHPPQIKQTV 205

>ZYRO0F07480g Chr6 (607194..607904) [711 bp, 236 aa] {ON} similar to
           uniprot|Q99373 Saccharomyces cerevisiae YPL159C PET20
           Protein required for respiratory growth and stability of
           the mitochondrial genome
          Length = 236

 Score = 46.6 bits (109), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 38/128 (29%), Positives = 56/128 (43%), Gaps = 39/128 (30%)

Query: 11  LPKVPMTRYLENRLLSEDMLYNGYRPILYPMRENPLLCHSNVRETHYYGESSNELQKKDE 70
           LP+VP T YL  R +S  +LY+GYRP+      NP                 +EL+   +
Sbjct: 88  LPRVPSTNYLRPRDMSSKILYSGYRPLFL----NP-----------------DELKTSQD 126

Query: 71  EPVNELLYGPEGRGGISTMGVRRMADPSKV-KLG----LSYSIMGMEYYPEWEKVPRDVV 125
                        GG +  G R      K+ +LG     + S  G E YPEW+ VP +V 
Sbjct: 127 -------------GGNANNGARLYEFAMKLEELGEQSLWTSSATGQEIYPEWDYVPMEVQ 173

Query: 126 KRIKPYEV 133
           +++KP+  
Sbjct: 174 RKLKPFNA 181

>KLLA0D06061g Chr4 (520082..520831) [750 bp, 249 aa] {ON} weakly
           similar to uniprot|Q99373 Saccharomyces cerevisiae
           YPL159C PET20 Protein required for respiratory growth
           and stability of the mitochondrial genome
          Length = 249

 Score = 46.2 bits (108), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 31/130 (23%), Positives = 59/130 (45%), Gaps = 39/130 (30%)

Query: 2   KRVNEIFRKLPKVPMTRYLENRLLSEDMLYNGYRPILYPMRENPLLCHSNVRETHYYGES 61
           K+++  +  LP+VP T ++     + DMLY+GYRPI        ++   N +E       
Sbjct: 103 KKLSRDYSWLPRVPTTEHILREEFNSDMLYSGYRPI--------VVGDKNAKE------- 147

Query: 62  SNELQKKDEEPVNELLYGPEGRGGISTMGVRRMADPSKVKLGLSYSIMGMEYYPEWEKVP 121
                       N+L+           M + ++++P    +    S  G E++ EW+ VP
Sbjct: 148 ------------NKLMQF--------AMKLEKLSEP----VPWVSSATGQEFFSEWDNVP 183

Query: 122 RDVVKRIKPY 131
            +++K +KP+
Sbjct: 184 SEIIKDLKPF 193

>AFR315C Chr6 complement(1006937..1007170) [234 bp, 77 aa] {ON}
          Syntenic homolog of Saccharomyces cerevisiae YPR151C
          (SUE1)
          Length = 77

 Score = 42.7 bits (99), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 17/43 (39%), Positives = 30/43 (69%)

Query: 5  NEIFRKLPKVPMTRYLENRLLSEDMLYNGYRPILYPMRENPLL 47
           + FR LP+VP T++L    +  D+L++ +RP+ YP+ +NPL+
Sbjct: 4  QQFFRMLPRVPSTQHLPADKVRLDILFSRHRPLTYPVSQNPLI 46

>KNAG0J01760 Chr10 (320758..321534) [777 bp, 258 aa] {ON} Anc_8.682
           YPL159C
          Length = 258

 Score = 45.1 bits (105), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 29/124 (23%), Positives = 48/124 (38%), Gaps = 22/124 (17%)

Query: 8   FRKLPKVPMTRYLENRLLSEDMLYNGYRPILYPMRENPLLCHSNVRETHYYGESSNELQK 67
           +  LP VP T+++E   +  ++LY+GYRP         L   S   E             
Sbjct: 93  YHPLPSVPSTQHIEANDMCTELLYSGYRP---------LFLDSTALERGLLAAKEQASFT 143

Query: 68  KDEEPVNELLYGPEGRGGISTMGVRRMADPSKVKLGLSYSIMGMEYYPEWEKVPRDVVKR 127
           +   P     Y              ++ DP+ +    + S  G+E Y EW+ +P  V   
Sbjct: 144 QSASPTGSTFYEI----------AMKLEDPACI---WANSATGLEKYTEWDNIPYSVANS 190

Query: 128 IKPY 131
           +KP+
Sbjct: 191 LKPF 194

>Suva_16.151 Chr16 complement(260210..260971) [762 bp, 253 aa] {ON}
           YPL159C (REAL)
          Length = 253

 Score = 44.7 bits (104), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 31/124 (25%), Positives = 54/124 (43%), Gaps = 33/124 (26%)

Query: 8   FRKLPKVPMTRYLENRLLSEDMLYNGYRPILYPMRENPLLCHSNVRETHYYGESSNELQK 67
           F  LP+VP T +L++  ++ ++LY+GYRPI                         N    
Sbjct: 100 FSWLPRVPSTSHLKHSDMTTNVLYSGYRPIFI-----------------------NPNDP 136

Query: 68  KDEEPVNELLYGPEGRGGISTMGVRRMADPSKVKLGLSYSIMGMEYYPEWEKVPRDVVKR 127
           K +E     LY          M +  + +P    +    S  G+E++ EWE +P +++K 
Sbjct: 137 KLKEDTGSTLYE-------FAMKLDDLNEPLSPWIS---SATGLEFFSEWENIPSELLKN 186

Query: 128 IKPY 131
           +KP+
Sbjct: 187 LKPF 190

>Kpol_1072.12 s1072 complement(24362..25030) [669 bp, 222 aa] {ON}
           complement(24362..25030) [669 nt, 223 aa]
          Length = 222

 Score = 44.3 bits (103), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 34/130 (26%), Positives = 55/130 (42%), Gaps = 30/130 (23%)

Query: 11  LPKVPMTRYLENRLLSEDMLYNGYRPILYPMRENPLLCHSNVRETHYYGESSNELQKKDE 70
           LPKVP  + L ++ ++ D+ Y+G+RP+     E   L + +   + +Y     E+    +
Sbjct: 97  LPKVPSNKRLTHQDITTDIFYSGFRPLSIDPTE---LENKDEDSSTWY-----EVSLTLD 148

Query: 71  EPVNELLYGPEGRGGISTMGVRRMADPSKVKLGLSYSIMGMEYYPEWEKVPRDVVKRIKP 130
            PV      P G   I T                  S  GME Y EW  VP +V+  + P
Sbjct: 149 SPV-----PPSGHNSIWTS-----------------SATGMERYREWHSVPEEVINSLTP 186

Query: 131 YEVMKVKKNV 140
           ++   +  NV
Sbjct: 187 FQPPDIDGNV 196

>TDEL0A06270 Chr1 (1098704..1099432) [729 bp, 242 aa] {ON} Anc_8.682
           YPL159C
          Length = 242

 Score = 43.9 bits (102), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 35/128 (27%), Positives = 53/128 (41%), Gaps = 41/128 (32%)

Query: 11  LPKVPMTRYLENRLLSEDMLYNGYRPILYPMRENPLLCHSNVRETHYYGESSNELQKKDE 70
           LP+VP T  L+ R +S  +LY+GYRP+      NP                         
Sbjct: 96  LPRVPSTGNLKPRDMSMKVLYSGYRPLFI----NP------------------------- 126

Query: 71  EPVNELLYGPEGRGGIST-----MGVRRMADPSKVKLGLSYSIMGMEYYPEWEKVPRDVV 125
              +E+    EG G   T     M +  + D S        S  G+EYY EW+ +P ++ 
Sbjct: 127 ---DEIKTSSEGSGTGGTLYEFAMKLEELGDQSP----WVTSATGLEYYREWDSIPGELQ 179

Query: 126 KRIKPYEV 133
           K++KP+  
Sbjct: 180 KKLKPFTA 187

>YPL159C Chr16 complement(250907..251668) [762 bp, 253 aa] {ON}
           PET20Mitochondrial protein, required for respiratory
           growth under some conditions and for stability of the
           mitochondrial genome
          Length = 253

 Score = 43.5 bits (101), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 31/131 (23%), Positives = 56/131 (42%), Gaps = 33/131 (25%)

Query: 1   MKRVNEIFRKLPKVPMTRYLENRLLSEDMLYNGYRPILYPMRENPLLCHSNVRETHYYGE 60
           +K+    F  LP+VP T +L+   ++ ++LY+GYRP+                       
Sbjct: 93  LKKKRSDFSWLPRVPSTSHLKQSDMTTNVLYSGYRPLFI--------------------- 131

Query: 61  SSNELQKKDEEPVNELLYGPEGRGGISTMGVRRMADPSKVKLGLSYSIMGMEYYPEWEKV 120
             N    K +E     LY          M +  + +P    +    S  G+E++ EWE +
Sbjct: 132 --NPNDPKLKEDTGSTLYE-------FAMKLEDLNEPLSPWIS---SATGLEFFSEWENI 179

Query: 121 PRDVVKRIKPY 131
           P +++K +KP+
Sbjct: 180 PSELLKNLKPF 190

>Skud_16.123 Chr16 complement(222359..223126) [768 bp, 255 aa] {ON}
           YPL159C (REAL)
          Length = 255

 Score = 43.1 bits (100), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 30/124 (24%), Positives = 54/124 (43%), Gaps = 33/124 (26%)

Query: 8   FRKLPKVPMTRYLENRLLSEDMLYNGYRPILYPMRENPLLCHSNVRETHYYGESSNELQK 67
           F  LP+VP T +L++  ++ ++LY+GYRP+                         N    
Sbjct: 100 FSWLPRVPSTSHLKHTDMTTNVLYSGYRPLFI-----------------------NPNDP 136

Query: 68  KDEEPVNELLYGPEGRGGISTMGVRRMADPSKVKLGLSYSIMGMEYYPEWEKVPRDVVKR 127
           K +E     LY          M +  + +P    +    S  G+E++ EWE +P +++K 
Sbjct: 137 KLKEDTGSTLYE-------FAMKLEDLNEPLSPWIS---SATGLEFFSEWENIPSELLKN 186

Query: 128 IKPY 131
           +KP+
Sbjct: 187 LKPF 190

>TBLA0B03800 Chr2 complement(873861..874835) [975 bp, 324 aa] {ON}
           Anc_8.682 YPL159C
          Length = 324

 Score = 43.1 bits (100), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 37/135 (27%), Positives = 63/135 (46%), Gaps = 34/135 (25%)

Query: 11  LPKVPMTRYLENRLLSEDMLYNGYRPILYPMRENPLLCHSNVRETHYYGESSNELQKKDE 70
           LPKVP  + L+ R +  ++LY+GYRP+                             K   
Sbjct: 167 LPKVPTLKNLKQRDVMTNVLYSGYRPLSIDF-------------------------KALN 201

Query: 71  EPVNELLYGP-EGRGGISTM--GVRRMADPSKVKLGLSYSIMGMEYYPEWEKVPRDVVKR 127
           +P N  +Y P     G ST+     ++   S++   +S S  G+E Y EW+ +P +V+K+
Sbjct: 202 DPTN--IYDPYSSPNGSSTLYEFAMQLQSLSEIFPWMS-SAAGLEVYSEWDSIPIEVLKK 258

Query: 128 IKPY---EVMKVKKN 139
           +KP    +++K+ KN
Sbjct: 259 LKPLQSPQMIKLSKN 273

>Smik_6.356 Chr6 (572523..573284) [762 bp, 253 aa] {ON} YPL159C
           (REAL)
          Length = 253

 Score = 42.0 bits (97), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 29/124 (23%), Positives = 53/124 (42%), Gaps = 33/124 (26%)

Query: 8   FRKLPKVPMTRYLENRLLSEDMLYNGYRPILYPMRENPLLCHSNVRETHYYGESSNELQK 67
           F  LPKVP T +L+   ++ ++LY+GYRP+                         N    
Sbjct: 100 FSWLPKVPSTSHLKQSDMTTNVLYSGYRPLFI-----------------------NPNDP 136

Query: 68  KDEEPVNELLYGPEGRGGISTMGVRRMADPSKVKLGLSYSIMGMEYYPEWEKVPRDVVKR 127
           K +E     LY          M +  + +P    +    S  G+E++ EW+ +P ++++ 
Sbjct: 137 KLKEDTGSTLYE-------FAMKLEDLNEPLSPWIS---SATGLEFFSEWDNIPSELLRN 186

Query: 128 IKPY 131
           +KP+
Sbjct: 187 LKPF 190

>Smik_14.36 Chr14 (61288..62862) [1575 bp, 524 aa] {ON} YNL295W
           (REAL)
          Length = 524

 Score = 41.2 bits (95), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 35/141 (24%), Positives = 66/141 (46%), Gaps = 17/141 (12%)

Query: 11  LPKVPMTRYLENRLLSEDMLYNGYRPILYPMRENPLLCHSNVRETHYYGE---------- 60
           +PKV  T +++N+ +  + L+ GYRP+       P    S+ R+   + E          
Sbjct: 111 VPKVASTDHIQNKEVHTEGLFAGYRPLFLGNSSFP----SDARKGKNFHELGDVLPNIQV 166

Query: 61  --SSNELQKKDEEPVNELLYGPEGRGGISTMGVRRMADPSKVKLGLSYSIMGMEYYP-EW 117
             +S +  K + + + E L+    R  I  M     +   K  +    SI GM Y    +
Sbjct: 167 IDASEKDGKLNMQEIIEDLHKSSLRDSIHNMEQHSSSHKRKPVIPWDASISGMVYNDMPF 226

Query: 118 EKVPRDVVKRIKPYEVMKVKK 138
           + VP+ VV R+KP+++M++++
Sbjct: 227 KHVPKSVVLRMKPFKLMRIER 247

>TDEL0E00710 Chr5 (152143..153573) [1431 bp, 476 aa] {ON} Anc_3.62
           YNL295W
          Length = 476

 Score = 41.2 bits (95), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 36/140 (25%), Positives = 68/140 (48%), Gaps = 20/140 (14%)

Query: 11  LPKVPMTRYLENRLLSEDMLYNGYRPILY---PMR--------ENPLLCHSNVRETHYYG 59
           LP+VP T Y+ N  +  + L+ GYRP+      +R        +N     +N++ T    
Sbjct: 75  LPRVPSTDYIPNTEVQTEGLFAGYRPLFLGNSSLRPETRTNALDNFFTSFANLKVT---S 131

Query: 60  ESSNELQKKDEEPVNELLYGPEGRGGISTMGVRRMADPSKVKLGLSYSIMGMEYYPE-WE 118
           ES N  +++ ++ + EL          ++ G  R     K  +    SI GM Y    ++
Sbjct: 132 ESKNSAEEEVQDVIEELKRDSAQLNLKNSKGKNR-----KPIIPWDASISGMVYNDHSFK 186

Query: 119 KVPRDVVKRIKPYEVMKVKK 138
            VP+ VV ++KP++++K+++
Sbjct: 187 DVPKSVVSKLKPFKMVKLER 206

>NDAI0K01320 Chr11 complement(297117..297893) [777 bp, 258 aa] {ON}
           Anc_8.682 YPL159C
          Length = 258

 Score = 38.9 bits (89), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 29/125 (23%), Positives = 52/125 (41%), Gaps = 30/125 (24%)

Query: 8   FRKLPKVPMTRYLENRLLSEDMLYNGYRPILYPMRENPLLCHSNVRETHYYGESSNELQK 67
           F +LPK+     L ++ +S  +LY+GYRP+  P         +N    + +    +E  K
Sbjct: 91  FSRLPKITPPSNLRHQDISMKLLYSGYRPLFIPNGSFQQGQKNNGSTLYEFAMKLDEF-K 149

Query: 68  KDEEPVNELLYGPEGRGGISTMGVRRMADPSKVKLGLSYSIMGMEYYPEWEKVPRDVVKR 127
           KD+   N  ++                            S  G+E + EW+ VP  V++ 
Sbjct: 150 KDK---NSTIWDT--------------------------SATGVETFTEWDNVPESVIRN 180

Query: 128 IKPYE 132
           +KP++
Sbjct: 181 LKPFQ 185

>CAGL0M02101g Chr13 complement(254024..254827) [804 bp, 267 aa] {ON}
           some similarities with uniprot|Q99373 Saccharomyces
           cerevisiae YPL159c
          Length = 267

 Score = 35.0 bits (79), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 13/25 (52%), Positives = 17/25 (68%)

Query: 107 SIMGMEYYPEWEKVPRDVVKRIKPY 131
           S  G E Y EW+ VP DV+K +KP+
Sbjct: 177 SATGSEMYAEWDNVPGDVIKDLKPF 201

>Ecym_2390 Chr2 complement(757433..758116) [684 bp, 227 aa] {ON}
           similar to Ashbya gossypii AAL087C
          Length = 227

 Score = 34.7 bits (78), Expect = 0.047,   Method: Compositional matrix adjust.
 Identities = 29/121 (23%), Positives = 46/121 (38%), Gaps = 37/121 (30%)

Query: 11  LPKVPMTRYLENRLLSEDMLYNGYRPILYPMRENPLLCHSNVRETHYYGESSNELQKKDE 70
            P  P T +L+   ++ D+LY+GYRP L   R +P    S + E                
Sbjct: 89  FPVAPKTEHLKEGDIAVDLLYSGYRP-LSLRRADPKEAQSKIYEL--------------- 132

Query: 71  EPVNELLYGPEGRGGISTMGVRRMADPSKVKLGLSYSIMGMEYYPEWEKVPRDVVKRIKP 130
                             M +  + DP    L    +  G   Y EW+ VP+ V++ ++P
Sbjct: 133 -----------------AMRLEAVEDP----LPWVKNATGRVLYDEWDNVPQSVIRNLRP 171

Query: 131 Y 131
           Y
Sbjct: 172 Y 172

>Suva_14.44 Chr14 (73757..75334) [1578 bp, 525 aa] {ON} YNL295W
           (REAL)
          Length = 525

 Score = 34.7 bits (78), Expect = 0.052,   Method: Compositional matrix adjust.
 Identities = 32/141 (22%), Positives = 67/141 (47%), Gaps = 17/141 (12%)

Query: 11  LPKVPMTRYLENRLLSEDMLYNGYRPILYPMRENPLLCHSNVRETHYYGE---------- 60
           +PKV  T ++  + ++ + L+ GYRP+       P    S+VR+   + +          
Sbjct: 112 VPKVASTDHIPKKEVNTEGLFAGYRPLFLGNSSFP----SDVRKGKNFHDLDEVLPNIQL 167

Query: 61  --SSNELQKKDEEPVNELLYGPEGRGGISTMGVRRMADPSKVKLGLSYSIMGMEYYP-EW 117
             +S +  K + + + E L     R  IS M     +   +  +    SI GM Y    +
Sbjct: 168 VDASEKDGKLNVQEIIEDLQRTSLRESISNMEQSSSSHKRRPVIPWDASISGMVYNDMPF 227

Query: 118 EKVPRDVVKRIKPYEVMKVKK 138
           + +P++VV ++KP+++++V++
Sbjct: 228 KHIPKNVVSKLKPFKLVRVER 248

>KLLA0A07447g Chr1 (669272..670732) [1461 bp, 486 aa] {ON} similar
           to uniprot|P48564 Saccharomyces cerevisiae YNL295W
          Length = 486

 Score = 33.9 bits (76), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 38/142 (26%), Positives = 64/142 (45%), Gaps = 26/142 (18%)

Query: 11  LPKVPMTRYLENRLLSEDMLYNGYRPILYPMRENPLLCHSNVRETHYYGESSNELQKKDE 70
           +P+VP T YL    L  + L+ GY+P+   +  +PL   SN  +    G  S+ ++K   
Sbjct: 90  VPQVPSTDYLPREDLETEGLFAGYKPLF--LGNSPL--ESNNNDVLLDGLFSS-IRKLKN 144

Query: 71  EPVNELLYGPEGRGGISTMGVRRMADPSKV-------------KLGLSYSIMGMEYYPE- 116
             +N              + V  M D  K              K+    SI G+ Y  E 
Sbjct: 145 AQIN-------SENNTVEIDVSDMLDDLKKDNQEYQRLHEKAPKIPWDASISGLVYNDEP 197

Query: 117 WEKVPRDVVKRIKPYEVMKVKK 138
           ++ VPR VV ++KP+++++V+K
Sbjct: 198 FKGVPRSVVSKLKPFKLVRVEK 219

>SAKL0C12342g Chr3 complement(1099949..1101607) [1659 bp, 552 aa]
           {ON} similar to uniprot|P48564 Saccharomyces cerevisiae
           YNL295W Hypothetical ORF
          Length = 552

 Score = 33.9 bits (76), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 31/134 (23%), Positives = 61/134 (45%), Gaps = 12/134 (8%)

Query: 11  LPKVPMTRYLENRLLSEDMLYNGYRPILYPMRENPLLCHSNVRETHYYGESSNELQKKDE 70
           +P VP T Y+ +  +  + L+ GY+P+      N  L             S  +++K   
Sbjct: 161 VPHVPNTDYIPHSEIQTEGLFAGYKPLFL---GNSSLDEKRADVLDGLFTSLTKIKKGTS 217

Query: 71  EP-----VNELLYGPEGRGGISTMGVRRMADPSKVKLGLSYSIMGMEYYP-EWEKVPRDV 124
            P     V E+L   +    + T+  +    P    +    SI GM Y    ++ VPR+V
Sbjct: 218 APNGEINVQEILDDLQKDDTMETLKEKSHKKPV---IPWDASISGMVYNDLPFKDVPRNV 274

Query: 125 VKRIKPYEVMKVKK 138
           V ++KP++++++++
Sbjct: 275 VGKLKPFKLLRIER 288

>YNL295W Chr14 (76946..78520) [1575 bp, 524 aa] {ON} Putative
           protein of unknown function
          Length = 524

 Score = 32.7 bits (73), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 31/141 (21%), Positives = 66/141 (46%), Gaps = 17/141 (12%)

Query: 11  LPKVPMTRYLENRLLSEDMLYNGYRPILYPMRENPLLCHSNVRETHYYGE---------- 60
           +P+V  T Y+ N+ +  + L+ GYRP+       P    S+ R+   + E          
Sbjct: 111 VPRVASTDYISNKEVHTEGLFAGYRPLFLGNSGFP----SDARKGKNFHELDDVLPNIQV 166

Query: 61  --SSNELQKKDEEPVNELLYGPEGRGGISTMGVRRMADPSKVKLGLSYSIMGMEYYP-EW 117
             +S +  K + + + E L     R  I +M     +   K  +    SI GM Y    +
Sbjct: 167 VDASEKDGKLNVQEIIEDLQRTSLRESIHSMEQLPSSHKRKPVIPWDASISGMVYNDMPF 226

Query: 118 EKVPRDVVKRIKPYEVMKVKK 138
           + VP++++ ++KP++++++++
Sbjct: 227 KYVPKNIILKMKPFKLLRIER 247

>SAKL0H09086g Chr8 complement(774264..775682) [1419 bp, 472 aa] {ON}
           similar to uniprot|Q02883 Saccharomyces cerevisiae
           YPL103C
          Length = 472

 Score = 32.0 bits (71), Expect = 0.47,   Method: Compositional matrix adjust.
 Identities = 24/69 (34%), Positives = 36/69 (52%), Gaps = 9/69 (13%)

Query: 74  NELLYGPEGRGGISTMGVRRMAD--PSKVKLGLSYSIMGMEYYPEWEKVPRDVVKRIKPY 131
           N+ ++   G  G  T   RR+A+   S VKL L   +   +Y PEW + PR     I P 
Sbjct: 359 NKPIFFHGGDTGYVTDLFRRIANRYGSGVKLAL---LPCGQYCPEWHQRPR----HINPS 411

Query: 132 EVMKVKKNV 140
           EV+K+ K++
Sbjct: 412 EVLKIMKDL 420

>TBLA0B08510 Chr2 complement(2036557..2038062) [1506 bp, 501 aa]
           {ON} Anc_3.62 YNL295W
          Length = 501

 Score = 31.6 bits (70), Expect = 0.57,   Method: Compositional matrix adjust.
 Identities = 33/153 (21%), Positives = 63/153 (41%), Gaps = 50/153 (32%)

Query: 11  LPKVPMTRYLENRLLSEDMLYNGYRPILYPMRENPLLCHSNVRETHYYGESSNELQKKDE 70
           +P+V  T  + +  +  D L+ GYRP+                   + GESS + ++K  
Sbjct: 90  VPRVASTEDIPSHEVQVDGLFAGYRPL-------------------FLGESSIKRRRK-A 129

Query: 71  EPVNELLYGPEGR-----GGISTMGVRRMAD------------------------PSKVK 101
            P+++  +  E        G ST+G++ + D                        P K  
Sbjct: 130 SPLDKFFHSVETHTRNRESGKSTLGIQDIIDNLRKDHEEENLEIEEHSDKNTKVEPRKPV 189

Query: 102 LGLSYSIMGMEYYPE-WEKVPRDVVKRIKPYEV 133
           +    S+ G+ Y  + ++ VP+ V+ ++KPY+V
Sbjct: 190 IPWDASVSGIFYKDQSFKNVPKHVMNKLKPYKV 222

>KAFR0H02380 Chr8 complement(455996..456658) [663 bp, 220 aa] {ON}
           Anc_8.682 YPL159C
          Length = 220

 Score = 31.2 bits (69), Expect = 0.59,   Method: Compositional matrix adjust.
 Identities = 25/123 (20%), Positives = 44/123 (35%), Gaps = 44/123 (35%)

Query: 11  LPKVPMTRYLENRLLSEDMLYNGYRPILYPMRENPLLCHSNVRETHYYGESSNELQKKDE 70
           LP+VP T  ++ + L+ ++L++ YRP+   +                         K D 
Sbjct: 91  LPRVPSTSNMDRKQLNTELLFSAYRPLSMDL-------------------------KSDS 125

Query: 71  EPVNELLYGPEGRGGISTMG--VRRMADPSKVKLGLSYSIMGMEYYPEWEKVPRDVVKRI 128
             + E L  P+     S  G    R+ D                 +  W  VP   V+++
Sbjct: 126 STMYEFLMAPDQSTTSSPWGRPFSRLHD-----------------HRAWRNVPSHTVRKL 168

Query: 129 KPY 131
           KP+
Sbjct: 169 KPF 171

>ZYRO0C02244g Chr3 complement(174640..176022) [1383 bp, 460 aa] {ON}
           similar to gnl|GLV|KLLA0A07447g Kluyveromyces lactis
           KLLA0A07447g and weakly similar to YNL295W
           uniprot|P48564 Saccharomyces cerevisiae YNL295W
           Hypothetical ORF
          Length = 460

 Score = 31.2 bits (69), Expect = 0.88,   Method: Compositional matrix adjust.
 Identities = 35/141 (24%), Positives = 66/141 (46%), Gaps = 22/141 (15%)

Query: 11  LPKVPMTRYLENRLLSEDMLYNGYRPILY---PMR--------ENPLLCHSNVRETHYYG 59
           +P+VP T Y+    +  + L+ GYRP+     P+         +N     +N++      
Sbjct: 58  VPRVPPTDYISAPEIQTEGLFAGYRPLFLGNSPINDKNGSTPLDNFFTSFANLKVV---E 114

Query: 60  ESSNELQKKDEEPVNELLYG-PEGRGGISTMGVRRMADPSKVKLGLSYSIMGMEYYPE-W 117
           ES    +   +E + +L  G P G+   S    R+   P         SI GM Y  + +
Sbjct: 115 ESEVVGEVNVQEVIEDLRRGIPSGQMSNSKGKNRKPIIP------WDASISGMVYNDDPF 168

Query: 118 EKVPRDVVKRIKPYEVMKVKK 138
           + VP +VV ++KP+++++++K
Sbjct: 169 KHVPNNVVSKLKPFKMVRLEK 189

>KLTH0A01364g Chr1 (126448..127878) [1431 bp, 476 aa] {ON} weakly
           similar to uniprot|P48564 Saccharomyces cerevisiae
           YNL295W Hypothetical ORF
          Length = 476

 Score = 30.8 bits (68), Expect = 1.0,   Method: Composition-based stats.
 Identities = 13/33 (39%), Positives = 26/33 (78%), Gaps = 1/33 (3%)

Query: 107 SIMGMEYYPE-WEKVPRDVVKRIKPYEVMKVKK 138
           SI GM Y  + +++VPR VV ++KP++++K+++
Sbjct: 184 SISGMVYNDQPFKQVPRGVVNKLKPFKLLKIER 216

>TPHA0P01260 Chr16 complement(252274..253758) [1485 bp, 494 aa] {ON}
           Anc_3.62 YNL295W
          Length = 494

 Score = 30.4 bits (67), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 29/141 (20%), Positives = 67/141 (47%), Gaps = 16/141 (11%)

Query: 11  LPKVPMTRYLENRLLSEDMLYNGYRPIL-----------YPMRENPLLCHSNVRETHYYG 59
           +PKV  T  L +  +  + L+ GYRP+              + +N     +N++ +    
Sbjct: 89  VPKVASTDNLSSAEIQTEGLFAGYRPLFLGNSSLETNSKLDVLDNFFTSFANLKVSAPES 148

Query: 60  ESSNELQKKDEEPVNELLYGPEGRGGISTMGVRRMADPSKVKLGLSYSIMGMEYYPE-WE 118
           E+ +    + ++ +++L  G E     S++  R    P    +    SI GM Y  + ++
Sbjct: 149 ETDSYNSGQIKDVIDDLQNGLESEQEQSSL-TRENRKPI---IPWDASIGGMVYSDKAFK 204

Query: 119 KVPRDVVKRIKPYEVMKVKKN 139
            +P+ VV ++ P++++K++++
Sbjct: 205 DLPKSVVSKLSPFKLVKLERS 225

>ACR096W Chr3 (527646..529163) [1518 bp, 505 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPL128C (TBF1)
          Length = 505

 Score = 29.6 bits (65), Expect = 2.7,   Method: Composition-based stats.
 Identities = 16/52 (30%), Positives = 25/52 (48%)

Query: 42  RENPLLCHSNVRETHYYGESSNELQKKDEEPVNELLYGPEGRGGISTMGVRR 93
           +E+PLL    + +T +  + +  LQ K  EP NE    P  +  I+    RR
Sbjct: 226 QEDPLLNRKQILDTLFPADMATYLQLKSGEPANEFQLTPSEKDFITRCQRRR 277

>Kwal_60.24929 s60 complement(7427..8026) [600 bp, 199 aa] {ON}
           YHL050C - Hypothetical ORF [contig 455] FULL
          Length = 199

 Score = 29.3 bits (64), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 18/76 (23%), Positives = 35/76 (46%)

Query: 5   NEIFRKLPKVPMTRYLENRLLSEDMLYNGYRPILYPMRENPLLCHSNVRETHYYGESSNE 64
           +E F+ +P VP T++ +  LL+      G +  L  +  NP     ++ +T        E
Sbjct: 103 SESFKSIPNVPFTKFWKVLLLTATAGTGGLKKPLRFLNLNPETHIWDLVQTEPLLHVDKE 162

Query: 65  LQKKDEEPVNELLYGP 80
            ++ DE  +  + +GP
Sbjct: 163 FREVDEADMTVVAHGP 178

>Kwal_23.5277 s23 complement(1088250..1089662) [1413 bp, 470 aa]
           {ON} YNL295W - Hypothetical ORF [contig 8] FULL
          Length = 470

 Score = 29.3 bits (64), Expect = 3.1,   Method: Composition-based stats.
 Identities = 13/33 (39%), Positives = 24/33 (72%), Gaps = 1/33 (3%)

Query: 107 SIMGMEYYPE-WEKVPRDVVKRIKPYEVMKVKK 138
           SI GM Y  E ++ VPR VV ++KP+++ ++++
Sbjct: 178 SISGMVYNDEPFKHVPRAVVSKLKPFKLFRIER 210

>Skud_14.42 Chr14 (70507..72081) [1575 bp, 524 aa] {ON} YNL295W
           (REAL)
          Length = 524

 Score = 28.9 bits (63), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 31/147 (21%), Positives = 66/147 (44%), Gaps = 29/147 (19%)

Query: 11  LPKVPMTRYLENRLLSEDMLYNGYRPILYPMRENPLLCHSNVRETHYYGESSNELQKKDE 70
           +PKV  T Y+  + +  + L+ GYRP+         L +S+       G++ + L   D 
Sbjct: 111 VPKVASTEYIPIKEVHTEGLFAGYRPLF--------LGNSSFSSDMRKGKNFHALD--DG 160

Query: 71  EPVNELLYGPEGRGGIS----------TMGVRRMADPSKVK--------LGLSYSIMGME 112
            P  +++   E  G +           T  +  ++D  +          +    SI GM 
Sbjct: 161 LPNIQVIDASEKDGKLDVQEIIEDLQKTSLIENVSDKEQFSSSHKRKPVIPWDASISGMV 220

Query: 113 YYPE-WEKVPRDVVKRIKPYEVMKVKK 138
           Y    ++ VP++V+ ++KP+++M++++
Sbjct: 221 YNDMPFKYVPKNVISKMKPFKLMRIER 247

>TDEL0F00160 Chr6 (17872..19386) [1515 bp, 504 aa] {ON} 
          Length = 504

 Score = 28.9 bits (63), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 11/23 (47%), Positives = 16/23 (69%)

Query: 115 PEWEKVPRDVVKRIKPYEVMKVK 137
           P+W KV   VV  + PYE+MK++
Sbjct: 284 PDWGKVGVQVVADVGPYELMKLR 306

>Smik_13.232 Chr13 complement(364426..366978) [2553 bp, 850 aa] {ON}
           YMR053C (REAL)
          Length = 850

 Score = 28.9 bits (63), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 22/80 (27%), Positives = 33/80 (41%), Gaps = 7/80 (8%)

Query: 10  KLPKVPMTRYLENRLLSEDMLYNGYRPILYPMRENPLLCHSNVRETHYYGESSNELQKKD 69
           K P V M   ++  L   + LY  Y+        + LLC    R    + ES  +L    
Sbjct: 295 KSPVVEMVTLIQISLSYFNYLYKNYQT-------DGLLCDDTKRAIDEWWESYGKLYLGT 347

Query: 70  EEPVNELLYGPEGRGGISTM 89
           E+P NE   GP    G+ ++
Sbjct: 348 EKPKNECTLGPTTVAGLISL 367

>ZYRO0F11176g Chr6 complement(915602..916996) [1395 bp, 464 aa] {ON}
           similar to uniprot|Q12342 Saccharomyces cerevisiae
           YDL146W Protein of unknown function green fluorescent
           protein (GFP)-fusion protein localizes to the cell
           periphery cytoplasm bud and bud neck
          Length = 464

 Score = 28.5 bits (62), Expect = 6.1,   Method: Composition-based stats.
 Identities = 22/63 (34%), Positives = 33/63 (52%), Gaps = 16/63 (25%)

Query: 16  MTRYLENRLLSEDMLYNGYRPILYPMRENPLLCHSNVRETHYYGESSNELQKKDEEPVNE 75
           M R L+N   ++++L N Y  +L P+ +N  LC+     THY         KKDE  +N 
Sbjct: 314 MIRELQNISDNDELLRNYYLRVLTPLLKNTELCN-----THY---------KKDE--INN 357

Query: 76  LLY 78
           LL+
Sbjct: 358 LLH 360

>YCL045C Chr3 complement(44623..46905) [2283 bp, 760 aa] {ON}
           EMC1Member of a transmembrane complex required for
           efficient folding of proteins in the ER; null mutant
           displays induction of the unfolded protein response;
           interacts with Gal80p
          Length = 760

 Score = 28.5 bits (62), Expect = 6.8,   Method: Composition-based stats.
 Identities = 14/34 (41%), Positives = 19/34 (55%)

Query: 30  LYNGYRPILYPMRENPLLCHSNVRETHYYGESSN 63
           L  G+  + Y  RE+PL    NV +T Y G S+N
Sbjct: 169 LPQGFNKVEYFHREDPLALVLNVNDTQYMGFSAN 202

>TDEL0A01090 Chr1 complement(182565..185735) [3171 bp, 1056 aa] {ON}
           Anc_2.68 YDL215C
          Length = 1056

 Score = 28.5 bits (62), Expect = 7.7,   Method: Composition-based stats.
 Identities = 16/52 (30%), Positives = 27/52 (51%), Gaps = 4/52 (7%)

Query: 16  MTRYLENRLLSEDMLYNGYRPILYPMRENPLLCHSNVRETHYYGESSNELQK 67
           + R L N   +++M+ +      YPM  + L  + N  E HYY +SS  ++K
Sbjct: 395 LKRKLRNETFTQEMIADTLHK--YPMIVSKL--YKNFAELHYYHDSSKNMEK 442

>KNAG0B01740 Chr2 (318809..321106) [2298 bp, 765 aa] {ON} Anc_1.267
           YJL099W
          Length = 765

 Score = 28.1 bits (61), Expect = 9.3,   Method: Composition-based stats.
 Identities = 18/70 (25%), Positives = 36/70 (51%), Gaps = 7/70 (10%)

Query: 11  LPKVPMTRYLENRLLSEDMLYNGY-RPILYPMRENPLLCHSNVRETHYYGESSNELQKKD 69
           +P +P+T  ++ R   E  LY+ Y RP+      N  L      +++ +   SN ++ K 
Sbjct: 406 MPNLPVTDKIKKRYYCERALYDYYQRPLGNKDNRNVSL------DSNEFNLVSNTMEGKK 459

Query: 70  EEPVNELLYG 79
           +E V ++++G
Sbjct: 460 DEDVKKIIFG 469

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.316    0.137    0.404 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 16,396,606
Number of extensions: 705925
Number of successful extensions: 2057
Number of sequences better than 10.0: 75
Number of HSP's gapped: 2023
Number of HSP's successfully gapped: 89
Length of query: 140
Length of database: 53,481,399
Length adjustment: 98
Effective length of query: 42
Effective length of database: 42,244,131
Effective search space: 1774253502
Effective search space used: 1774253502
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 60 (27.7 bits)