Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
CAGL0L08404g3.498ON41041019500.0
KNAG0A079703.498ON3884174862e-56
Skud_16.4463.498ON4563674187e-46
TPHA0A056903.498ON4784894111e-44
YPR152C (URN1)3.498ON4653644092e-44
Suva_16.4803.498ON4524334021e-43
Smik_16.4043.498ON4603603977e-43
NCAS0F035803.498ON4134173756e-40
Kpol_480.113.498ON4634693751e-39
KAFR0G037203.498ON4094183361e-34
TDEL0D056603.498ON4424353353e-34
SAKL0F02552g3.498ON4784683031e-29
KLTH0G02398g3.498ON4624533003e-29
KLLA0E03939g3.498ON4354382826e-27
Ecym_12313.498ON3292312699e-26
ZYRO0D09768g3.498ON4602252606e-24
Kwal_47.188953.498ON4432262482e-22
AFR317C3.498ON3282272125e-18
TBLA0D029303.498ON2762162071e-17
NDAI0B059003.498ON5222632067e-17
Ecym_33972.649ON575831123e-05
TBLA0C009302.649ON65885990.001
CAGL0L05368g2.649ON59075980.002
TPHA0L020202.649ON58376970.002
ADR159C2.649ON56977960.003
SAKL0G19360g2.649ON56876930.006
YKL012W (PRP40)2.649ON58377920.010
ZYRO0E00682g2.649ON57082890.023
Kpol_1073.42.649ON53079870.034
Smik_11.2432.649ON57981840.087
Kwal_14.9392.649ON56275830.13
Skud_11.2172.649ON58326820.15
TDEL0B074402.649ON57079800.23
NCAS0C051102.649ON60477800.27
KAFR0A002302.649ON55626790.36
Suva_11.2162.649ON58579770.57
KLLA0E18239g2.649ON57176770.63
KLTH0C00924g2.649ON56426731.6
NCAS0E041305.16ON571116722.5
CAGL0M01210g5.381ON33498703.2
Ecym_83948.134ON84180713.6
KLTH0E06908g8.134ON79180695.2
Kwal_47.173028.134ON78780695.5
TPHA0D024605.546ON40697687.0
TDEL0F009908.134ON78980687.1
TDEL0D058303.515ON161960687.5
Kwal_47.190233.515ON165760687.8
KLTH0G01892g3.515ON165760688.1
SAKL0F02046g3.515ON165960688.1
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0L08404g
         (410 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0L08404g Chr12 (924898..926130) [1233 bp, 410 aa] {ON} simil...   755   0.0  
KNAG0A07970 Chr1 complement(1270860..1272026) [1167 bp, 388 aa] ...   191   2e-56
Skud_16.446 Chr16 complement(785650..787020) [1371 bp, 456 aa] {...   165   7e-46
TPHA0A05690 Chr1 complement(1289284..1290720) [1437 bp, 478 aa] ...   162   1e-44
YPR152C Chr16 complement(832061..833458) [1398 bp, 465 aa] {ON} ...   162   2e-44
Suva_16.480 Chr16 complement(828461..829819) [1359 bp, 452 aa] {...   159   1e-43
Smik_16.404 Chr16 complement(704003..705385) [1383 bp, 460 aa] {...   157   7e-43
NCAS0F03580 Chr6 complement(712074..713315) [1242 bp, 413 aa] {O...   149   6e-40
Kpol_480.11 s480 (21829..23220) [1392 bp, 463 aa] {ON} (21829..2...   149   1e-39
KAFR0G03720 Chr7 complement(765353..766582) [1230 bp, 409 aa] {O...   134   1e-34
TDEL0D05660 Chr4 complement(1018928..1020256) [1329 bp, 442 aa] ...   133   3e-34
SAKL0F02552g Chr6 (219380..220816) [1437 bp, 478 aa] {ON} simila...   121   1e-29
KLTH0G02398g Chr7 (186986..188374) [1389 bp, 462 aa] {ON} simila...   120   3e-29
KLLA0E03939g Chr5 (357695..359002) [1308 bp, 435 aa] {ON} simila...   113   6e-27
Ecym_1231 Chr1 (476386..477375) [990 bp, 329 aa] {ON} similar to...   108   9e-26
ZYRO0D09768g Chr4 (826977..828359) [1383 bp, 460 aa] {ON} simila...   104   6e-24
Kwal_47.18895 s47 complement(1018177..1019508) [1332 bp, 443 aa]...   100   2e-22
AFR317C Chr6 complement(1011817..1012803) [987 bp, 328 aa] {ON} ...    86   5e-18
TBLA0D02930 Chr4 (719542..720372) [831 bp, 276 aa] {ON} Anc_3.49...    84   1e-17
NDAI0B05900 Chr2 complement(1425195..1426763) [1569 bp, 522 aa] ...    84   7e-17
Ecym_3397 Chr3 (754713..756440) [1728 bp, 575 aa] {ON} similar t...    48   3e-05
TBLA0C00930 Chr3 complement(185527..187503) [1977 bp, 658 aa] {O...    43   0.001
CAGL0L05368g Chr12 complement(593547..595319) [1773 bp, 590 aa] ...    42   0.002
TPHA0L02020 Chr12 complement(419703..421454) [1752 bp, 583 aa] {...    42   0.002
ADR159C Chr4 complement(982821..984530) [1710 bp, 569 aa] {ON} S...    42   0.003
SAKL0G19360g Chr7 complement(1664386..1666092) [1707 bp, 568 aa]...    40   0.006
YKL012W Chr11 (418310..420061) [1752 bp, 583 aa] {ON}  PRP40U1 s...    40   0.010
ZYRO0E00682g Chr5 (49836..51548) [1713 bp, 570 aa] {ON} similar ...    39   0.023
Kpol_1073.4 s1073 (4004..5596) [1593 bp, 530 aa] {ON} (4004..559...    38   0.034
Smik_11.243 Chr11 (405300..407039) [1740 bp, 579 aa] {ON} YKL012...    37   0.087
Kwal_14.939 s14 (124224..125912) [1689 bp, 562 aa] {ON} YKL012W ...    37   0.13 
Skud_11.217 Chr11 (399225..400976) [1752 bp, 583 aa] {ON} YKL012...    36   0.15 
TDEL0B07440 Chr2 complement(1302549..1304261) [1713 bp, 570 aa] ...    35   0.23 
NCAS0C05110 Chr3 (1042307..1044121) [1815 bp, 604 aa] {ON} Anc_2...    35   0.27 
KAFR0A00230 Chr1 (46128..47798) [1671 bp, 556 aa] {ON} Anc_2.649...    35   0.36 
Suva_11.216 Chr11 (402394..404151) [1758 bp, 585 aa] {ON} YKL012...    34   0.57 
KLLA0E18239g Chr5 (1627093..1628808) [1716 bp, 571 aa] {ON} simi...    34   0.63 
KLTH0C00924g Chr3 (90830..92524) [1695 bp, 564 aa] {ON} similar ...    33   1.6  
NCAS0E04130 Chr5 (812614..814329) [1716 bp, 571 aa] {ON} Anc_5.1...    32   2.5  
CAGL0M01210g Chr13 complement(137725..138729) [1005 bp, 334 aa] ...    32   3.2  
Ecym_8394 Chr8 (808813..811338) [2526 bp, 841 aa] {ON} similar t...    32   3.6  
KLTH0E06908g Chr5 complement(634745..637120) [2376 bp, 791 aa] {...    31   5.2  
Kwal_47.17302 s47 complement(342098..344461) [2364 bp, 787 aa] {...    31   5.5  
TPHA0D02460 Chr4 (507413..508633) [1221 bp, 406 aa] {ON} Anc_5.5...    31   7.0  
TDEL0F00990 Chr6 complement(173710..176079) [2370 bp, 789 aa] {O...    31   7.1  
TDEL0D05830 Chr4 (1054309..1059168) [4860 bp, 1619 aa] {ON} Anc_...    31   7.5  
Kwal_47.19023 s47 (1064313..1069286) [4974 bp, 1657 aa] {ON} YGL...    31   7.8  
KLTH0G01892g Chr7 complement(142143..147116) [4974 bp, 1657 aa] ...    31   8.1  
SAKL0F02046g Chr6 complement(172863..177842) [4980 bp, 1659 aa] ...    31   8.1  

>CAGL0L08404g Chr12 (924898..926130) [1233 bp, 410 aa] {ON} similar
           to uniprot|Q06525 Saccharomyces cerevisiae YPR152c
          Length = 410

 Score =  755 bits (1950), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 373/410 (90%), Positives = 373/410 (90%)

Query: 1   MQRSRSKLWKEYTAPNGLKYYYNTKTQETTWTKPDTEQKDETADKEIEIKPLVAFELLAG 60
           MQRSRSKLWKEYTAPNGLKYYYNTKTQETTWTKPDTEQKDETADKEIEIKPLVAFELLAG
Sbjct: 1   MQRSRSKLWKEYTAPNGLKYYYNTKTQETTWTKPDTEQKDETADKEIEIKPLVAFELLAG 60

Query: 61  WALIIFSDGSKKYYNCNESQWSRKISHPECXXXXXXXXXXXXXXXXXXXXXYRCRTNAKD 120
           WALIIFSDGSKKYYNCNESQWSRKISHPEC                     YRCRTNAKD
Sbjct: 61  WALIIFSDGSKKYYNCNESQWSRKISHPECLKLIDLLNKDRLLLLIGIIRGYRCRTNAKD 120

Query: 121 LVNEIREDIDFIREDMNAAKTSEDMKSGSTVNNLENTKNALLGYYSSDDEEEPAKRDEQA 180
           LVNEIREDIDFIREDMNAAKTSEDMKSGSTVNNLENTKNALLGYYSSDDEEEPAKRDEQA
Sbjct: 121 LVNEIREDIDFIREDMNAAKTSEDMKSGSTVNNLENTKNALLGYYSSDDEEEPAKRDEQA 180

Query: 181 VVEEPDETNTLEVPDITQELGQDIKDSYFALFAKHELNKYSTWRIESEKVSQDPEFYKII 240
           VVEEPDETNTLEVPDITQELGQDIKDSYFALFAKHELNKYSTWRIESEKVSQDPEFYKII
Sbjct: 181 VVEEPDETNTLEVPDITQELGQDIKDSYFALFAKHELNKYSTWRIESEKVSQDPEFYKII 240

Query: 241 DDAVRENIFEEWCNAGSVESNEESGDPGDDQFEPTKYHYLSQLVANYDLKPDTIPEXXXX 300
           DDAVRENIFEEWCNAGSVESNEESGDPGDDQFEPTKYHYLSQLVANYDLKPDTIPE    
Sbjct: 241 DDAVRENIFEEWCNAGSVESNEESGDPGDDQFEPTKYHYLSQLVANYDLKPDTIPEDIIK 300

Query: 301 XXXXXXXXXXXXYTTKSEQRQFLSKMLAWYKHMSLEDRKQMFQTYIDRIPVGKYTDIDSD 360
                       YTTKSEQRQFLSKMLAWYKHMSLEDRKQMFQTYIDRIPVGKYTDIDSD
Sbjct: 301 DKKLIKKYRIKDYTTKSEQRQFLSKMLAWYKHMSLEDRKQMFQTYIDRIPVGKYTDIDSD 360

Query: 361 AQEDVESQLLELENQLGIPTSENDLEYYCIDLRSKRDILLSTIRNRVNGK 410
           AQEDVESQLLELENQLGIPTSENDLEYYCIDLRSKRDILLSTIRNRVNGK
Sbjct: 361 AQEDVESQLLELENQLGIPTSENDLEYYCIDLRSKRDILLSTIRNRVNGK 410

>KNAG0A07970 Chr1 complement(1270860..1272026) [1167 bp, 388 aa]
           {ON} Anc_3.498 YPR152C
          Length = 388

 Score =  191 bits (486), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 134/417 (32%), Positives = 197/417 (47%), Gaps = 64/417 (15%)

Query: 8   LWKEYTAPNGLKYYYNTKTQETTWTKPDTEQKDETADKEIEIKPLVAFELLAGWALIIFS 67
           +W+EY APNG KYY+NT T ETTW  P T +      +E+ IKP     LL  W L+I +
Sbjct: 4   VWREYRAPNGKKYYHNTTTGETTWDSPYTRK----PQRELSIKPQYVIPLLNAWNLVICN 59

Query: 68  DGSKKYYNCNESQWSRKISHPECXXXXXXXXXXXXXXXXXXXXXYRCRTNAKDLVNEIRE 127
           +G+K Y N +       +   +                      Y C T+   + N + E
Sbjct: 60  NGAKFYLNPDGDP-VLTLDDADSSELLSLVDREKLILLIGVARGYHC-TSGDKVYNSVLE 117

Query: 128 DIDFIREDMNAAKTSEDMKSGSTVNNLENTKNALLGYYSSDDEEEPAKRDEQAVVEEPDE 187
           +I F+++D                  L N K  L               +E+ + EEP E
Sbjct: 118 EISFLKDD------------------LANDKAPL--------------AEERELQEEPLE 145

Query: 188 TNTLEVPDITQELGQDI-------------------KDSYFALFAKHELNKYSTWRIESE 228
           TN    P  +  +                       + SYF LF+++ L+KYS W IES 
Sbjct: 146 TNVQSEPVPSALVSGYGSSSDGSDDEEEVPPDTDANRISYFNLFSEYGLDKYSVWSIESL 205

Query: 229 KVSQDPEFYKIIDDAVRENIFEEWCNAGSVESNEESG-DPGDDQFEPTKYHYLSQLVANY 287
           K+S DP F+ I DD  RE IFEEWC +G V+ +E+ G   GDD   PTKYHYLSQ+VA  
Sbjct: 206 KISNDPRFHIISDDRQREEIFEEWCCSGVVDDSEDEGYSSGDDDLSPTKYHYLSQIVAKS 265

Query: 288 DLKPDTI-PEXXXXXXXXXXXXXXXXYTTKSEQRQFLSKMLAWYKHMSLEDRKQMFQTYI 346
            + P TI  +                + +K EQ QF+S++L +YK  +LE+R Q+F  +I
Sbjct: 266 TVTPTTIFQDIKQEKASLFKQYGIKQFLSKREQEQFVSQLLFYYKKFTLEERVQLFTKFI 325

Query: 347 DRIPVGKY----TDIDSDAQEDVESQLLELENQLGIPTSENDLEYYCIDLRSKRDIL 399
                G      +  DS   ED+E+ LL++E+ L  PT  ++  YY +D+++K+ +L
Sbjct: 326 AESRTGTVPSPTSPADSATPEDIETNLLQMESHLP-PTVLDNTVYYTLDIKTKQSVL 381

>Skud_16.446 Chr16 complement(785650..787020) [1371 bp, 456 aa] {ON}
           YPR152C (REAL)
          Length = 456

 Score =  165 bits (418), Expect = 7e-46,   Method: Compositional matrix adjust.
 Identities = 116/367 (31%), Positives = 181/367 (49%), Gaps = 42/367 (11%)

Query: 8   LWKEYTAPNGLKYYYNTKTQETTWTKPD----TEQKDETADKEIEIKPLVAFELLAGWAL 63
           +W+E+  P G++YYYN KT+++ W  PD    ++Q++      +E KP  + EL+  W L
Sbjct: 1   MWQEFKTPAGIRYYYNKKTKQSQWENPDFKIFSDQENVEKALRMERKPTFSLELIDAWHL 60

Query: 64  IIFSDGSKKYYNCNESQWSRKISH---PECXXXXXXXXXXXXXXXXXXXXXYRCRTNAKD 120
           +I +DG+K YYN +   +  +IS     +C                     Y  R    D
Sbjct: 61  VICNDGTKFYYNSDSKVFKNEISQESDSQCSALVESLDKEKLVLLIGVARGYDMRDEDVD 120

Query: 121 LVNE-IREDIDFIREDMN-AAKTSEDMKSGSTVNN-LENTKNALLGYYSS---------- 167
            + E + E+I+  +++ N A +  E  +    VN  L+     L+  Y S          
Sbjct: 121 KIFESLNEEINLFKKNQNEAGRVDEANEEPGDVNPPLKEHHTGLISGYGSSSEEEEEEEE 180

Query: 168 ----DDEEEPAKRDEQAVVEEPDETNTLEVPDITQELGQDIKDSYFALFAKHELNKYSTW 223
               DD E+   +D   +    D+ N ++  D       D +  +F LF ++EL+K+STW
Sbjct: 181 EEEEDDGEQDLNKDATII----DDLNQIDTGD------ADERGLFFRLFDRYELDKFSTW 230

Query: 224 RIESEKVSQDPEFYKIIDDAVRENIFEEWCNAGSVES--NEESG--DPGDDQFEPTKYHY 279
            ++S+K+  DP+FY I DDAVRE  FEEWC     +S   E SG  D G D  EPTKYHY
Sbjct: 231 SLQSKKIENDPDFYTIGDDAVREGFFEEWCGHEHSDSAAAEASGSEDVG-DVLEPTKYHY 289

Query: 280 LSQLVANYD-LKPDTIPEXXXXXXXX--XXXXXXXXYTTKSEQRQFLSKMLAWYKHMSLE 336
           L+Q++A    + PD +P+                    +K EQ +F+S++L +YK  SLE
Sbjct: 290 LAQILAKAGTIPPDAVPQDIRKQQKELYKAYRIKEYVPSKREQDKFVSQLLFYYKTFSLE 349

Query: 337 DRKQMFQ 343
            RK++FQ
Sbjct: 350 QRKEIFQ 356

>TPHA0A05690 Chr1 complement(1289284..1290720) [1437 bp, 478 aa]
           {ON} Anc_3.498 YPR152C
          Length = 478

 Score =  162 bits (411), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 135/489 (27%), Positives = 215/489 (43%), Gaps = 102/489 (20%)

Query: 5   RSKLWKEYTAPNGLKYYYNTKTQETTWTKPDT---------EQKDETADKEIEIKPLVAF 55
           + ++WKE+ APNG KYYYN KT++TTW +P++          QKDE+        P+ AF
Sbjct: 2   KIRVWKEFIAPNGQKYYYNLKTKKTTWDEPESLFEGNAVSQGQKDES--------PVFAF 53

Query: 56  ELLAGWALIIFSDGSKKYYNCNESQWSRKISHPECXXXXXXXXXXXXXXXXXXXXXYRCR 115
            L   W L+I S G K Y+N  E+    ++ H E                          
Sbjct: 54  PLFNDWYLVISSLGKKFYFNAVENISVLEL-HDELNTQLLQSIDKQKLILLVGVARGFIY 112

Query: 116 TNAKDLVNEIREDIDFIREDM---------NAAKTSEDMKSGSTVNNLENTKNALLG-YY 165
                +  EI E++DF++ ++         N A+ SE+        +L  T N ++  YY
Sbjct: 113 DEYLQVYEEIMENLDFVKNEISNEYKELQVNVAQESEESADKQDPGDLIATDNGIVNDYY 172

Query: 166 SSDDEEEPAKRDE-------------------QAVVEEPD----ETNTLEVPDITQELGQ 202
           SS DEE   + D+                   + +  E D      N++E  D       
Sbjct: 173 SSSDEEVDIREDKFNEIDLAEDNLQQNDGIRTEVIRTETDFNEENLNSVETLDFNAS--- 229

Query: 203 DIKDSYFALFAKHELNKYSTWRIESEKVSQDPEFYKIIDDAVRENIFEEWCNAGSVESNE 262
             K+ YF LF K++LN +STW  +S+ V  DP+FY I D+++RE+IFEEWC+      N 
Sbjct: 230 --KEKYFQLFEKYQLNSFSTWSNQSKVVMDDPDFYLITDNSLREDIFEEWCSRKHSHHNS 287

Query: 263 ESGDPGDDQ---------------------------FEPTKYHYLSQLVANYDLKPDTIP 295
            +    DDQ                            EPTKYHYLS +++  ++ PDTI 
Sbjct: 288 ITSVDKDDQTDSSGAHSSAEDNLDDNVADQNEEEENLEPTKYHYLSHIISKANISPDTIF 347

Query: 296 E--XXXXXXXXXXXXXXXXYTTKSEQRQFLSKMLAWYKHMSLEDRKQMFQTYI--DRIPV 351
           +                   T+K +   F SK++ +YK      R+ +F+  +  ++  +
Sbjct: 348 QDIKKDNKKLFKQFKINKFITSKRDLESFSSKLIFYYKKFDQSQRRDIFEGILEQNKTAI 407

Query: 352 GKYT---------DIDSDAQEDV--ESQLLELENQLGIPTS----ENDLEYYCIDLRSKR 396
            K+           +++   ED   E+QLL+LE+ LG+  S     ND +YY + ++ K 
Sbjct: 408 NKHVVEHSDKVLETLNTSVNEDFEKETQLLKLEDILGLSGSLEKLANDPKYYILGIKDKL 467

Query: 397 DILLSTIRN 405
           + L + +RN
Sbjct: 468 ECLKNYLRN 476

>YPR152C Chr16 complement(832061..833458) [1398 bp, 465 aa] {ON}
           URN1Putative protein of unknown function containing WW
           and FF domains; overexpression causes accumulation of
           cells in G1 phase
          Length = 465

 Score =  162 bits (409), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 113/364 (31%), Positives = 187/364 (51%), Gaps = 36/364 (9%)

Query: 9   WKEYTAPNGLKYYYNTKTQETTWTKPDTEQ----KDETADKEIEIKPLVAFELLAGWALI 64
           W+E+  P G KYYYN  T+++ W KP+ ++    +    + + E KP  + EL+ GW LI
Sbjct: 5   WQEFKTPAGKKYYYNKNTKQSRWEKPNLKKGSNLESNAKESQTERKPTFSLELVNGWHLI 64

Query: 65  IFSDGSKKYYNCNESQWSRKISHPE---CXXXXXXXXXXXXXXXXXXXXXYRCRTNAKD- 120
           I++DG+K Y+N +  ++   IS  +   C                     Y  R    D 
Sbjct: 65  IYNDGTKLYFNDDSKEFKNDISQEDDSRCRSLIESLDKEKLVLLIGVARGYTMREEDIDK 124

Query: 121 LVNEIREDIDFIREDMNAAKTSEDM--KSGSTVNNLENTKNALLGYYSSDD--------E 170
           ++    E+I   + + +  +  +++  ++G   + L+ +   L+  Y S          E
Sbjct: 125 ILESCNEEIHLFKRNQDEVERKDEISEEAGDVKSPLQESHTGLVSGYGSSSGEEDEEEDE 184

Query: 171 EEPAKRDEQAV---VEEPDETNTLEVPDITQELGQDIKDSYFALFAKHELNKYSTWRIES 227
           EE  + +EQ V   +   D+ N ++  DI      D ++ +F LF +++L+K+STW ++S
Sbjct: 185 EEDEENEEQIVNQDISIIDDLNRIDTDDI------DERNIFFELFDRYKLDKFSTWSLQS 238

Query: 228 EKVSQDPEFYKIIDDAVRENIFEEWC-----NAGSVESNEESGDPGDDQ-FEPTKYHYLS 281
           +K+  DP+FYKI DD VRE++FEEWC     NA + ES+ E     D +  EPTKYHYL+
Sbjct: 239 KKIENDPDFYKIRDDTVRESLFEEWCGERSGNATAEESDSEDNSEDDSEVLEPTKYHYLA 298

Query: 282 QLVANYD-LKPDTIPEXXXXXXXX--XXXXXXXXYTTKSEQRQFLSKMLAWYKHMSLEDR 338
           Q+VAN   + PDTIP+                    +K +Q +F+S++L +YK   LE R
Sbjct: 299 QIVANAGTIAPDTIPQDIRKQQKALYKAYKIKEYIPSKRDQDKFVSQLLFYYKTFDLEQR 358

Query: 339 KQMF 342
           K++F
Sbjct: 359 KEIF 362

>Suva_16.480 Chr16 complement(828461..829819) [1359 bp, 452 aa] {ON}
           YPR152C (REAL)
          Length = 452

 Score =  159 bits (402), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 122/433 (28%), Positives = 209/433 (48%), Gaps = 53/433 (12%)

Query: 5   RSKLWKEYTAPNGLKYYYNTKTQETTWTKPDTEQKDETADK----EIEIKPLVAFELLAG 60
           R+++W+E+  P G +Y+YN  T+E+ W KPD ++     D+    ++E KP+ A EL+  
Sbjct: 3   RNEVWQEFKTPAGKRYFYNKNTKESRWDKPDFKKASGAQDRAKVAQVERKPMFALELIDD 62

Query: 61  WALIIFSDGSKKYYNCNESQWSR----KISHPECXXXXXXXXXXXXXXXXXXXXXYRCRT 116
           W LII +DG+K YYN  ES  S+    +    +C                     Y  R 
Sbjct: 63  WHLIICNDGTKFYYN-GESNISKYEIDEEGAGQCAALMNSLDKEKLILLIGVARGYNVRE 121

Query: 117 -NAKDLVNEIREDIDFIREDM------NAAKTSEDMKSGSTVNNLENTKNALLGY---YS 166
            + + +   + E+ID  +++        A + +E+     T     N+   + GY     
Sbjct: 122 EDVEKIFESLNEEIDLFKKNQVVVVEEKADEPNEEAGDAETPPQ-ANSAGLVSGYGSSSE 180

Query: 167 SDDEEEPAKRDEQAVVEEPDETNTLEVPDITQELGQDIKDSYFALFAKHELNKYSTWRIE 226
            ++EEE  + D+  ++   D+ N ++  D+ +      +  +F L  ++EL+K+STW ++
Sbjct: 181 EEEEEEEPENDDAGII---DDLNQIDSGDVNE------RGLFFQLCDRYELDKFSTWSLQ 231

Query: 227 SEKVSQDPEFYKIIDDAVRENIFEEWC--NAGSVESNEESGDPGDDQFEPTKYHYLSQLV 284
            +K+  DP+FYK+ D AVRE++FEEWC   + S   NE   +   D  EPTK+HYL+Q+V
Sbjct: 232 CKKIENDPDFYKVGDAAVRESLFEEWCASASASASGNESEDEDDADLLEPTKFHYLAQIV 291

Query: 285 ANYDLKPDTIPEXXXXXXXXXXXXXXXX--YTTKSEQRQFLSKMLAWYKHMSLEDRKQMF 342
           A  ++ PD IP+                    +K +Q +F+S++L +YK  SLE RK++F
Sbjct: 292 AKAEIAPDCIPQDIRKQQKALFKAYRIKEYVPSKRDQDRFVSQLLFYYKTFSLEQRKEIF 351

Query: 343 QTYI----------------DRIPVGKYTDIDSDAQED---VESQLLELENQLGI-PTSE 382
           Q  +                D   + ++  I      D   VE  LL +E++ G+   + 
Sbjct: 352 QECLRDHERDFACAVQSLRQDVGLISRWQAILRPTAADGASVEDALLSIEHRCGVGAIAL 411

Query: 383 NDLEYYCIDLRSK 395
            D  YY + +  K
Sbjct: 412 ADPRYYVLGILDK 424

>Smik_16.404 Chr16 complement(704003..705385) [1383 bp, 460 aa] {ON}
           YPR152C (REAL)
          Length = 460

 Score =  157 bits (397), Expect = 7e-43,   Method: Compositional matrix adjust.
 Identities = 113/360 (31%), Positives = 180/360 (50%), Gaps = 29/360 (8%)

Query: 8   LWKEYTAPNGLKYYYNTKTQETTWTKPDTEQKDETAD----KEIEIKPLVAFELLAGWAL 63
           +W+E+  P G KYYYN  T+++ W KP+ ++  +  D     +IE  P  A EL+ GW L
Sbjct: 4   VWQEFKTPTGEKYYYNKTTKQSQWEKPNLKKNSDLEDDAKVSQIERMPTFALELIDGWHL 63

Query: 64  IIFSDGSKKYYNCNESQWSRKI---SHPECXXXXXXXXXXXXXXXXXXXXXYRCRTNAKD 120
           II +DG+K Y+N +   +   I   S  +C                     Y  +    D
Sbjct: 64  IICNDGTKLYFNHDSKIFKSDICQESGGKCGALIESLDKDKLVLLIGIARGYSVQEEDID 123

Query: 121 LVNE-IREDIDFIREDMNAAKTSEDMK--SGSTVNNLENTKNALLGYYSSDDEEEPAK-- 175
            + E + E+ID  +++ +  +   + +  +G   + L  +   L+  Y S  EEE  +  
Sbjct: 124 KIFESLNEEIDLFKKNQDGFEREIETREEAGVVKSLLSESHTGLISGYGSSSEEEEEEEE 183

Query: 176 ------RDEQAV---VEEPDETNTLEVPDITQELGQDIKDSYFALFAKHELNKYSTWRIE 226
                   EQ V   V   D+ N ++  DI +  G++ +  +F L  +++L+K+STW ++
Sbjct: 184 EEEEEDHAEQGVNQNVSIIDDLNHIDADDIDE--GRE-RSLFFQLCDRYKLDKFSTWSLQ 240

Query: 227 SEKVSQDPEFYKIIDDAVRENIFEEWCNAGSVESNEESGDPGDDQFEPTKYHYLSQLVAN 286
           S+K+  DPEFYKI DD VRE +FEEWC   S  + E   +   +  EPTKYHYL+Q+VA 
Sbjct: 241 SKKIENDPEFYKIRDDTVREGLFEEWCEKHS--AKESDSEDESNVLEPTKYHYLAQIVAK 298

Query: 287 Y-DLKPDTIPEXXXXXXXX--XXXXXXXXYTTKSEQRQFLSKMLAWYKHMSLEDRKQMFQ 343
             ++ PD IP+                     K EQ +F+S++L +YK  +LE RK +FQ
Sbjct: 299 AGNIAPDAIPQDIRKRQKALYKAYRIKEYVPLKREQDRFVSQLLFYYKTFNLEQRKTIFQ 358

>NCAS0F03580 Chr6 complement(712074..713315) [1242 bp, 413 aa] {ON}
           Anc_3.498 YPR152C
          Length = 413

 Score =  149 bits (375), Expect = 6e-40,   Method: Compositional matrix adjust.
 Identities = 127/417 (30%), Positives = 199/417 (47%), Gaps = 52/417 (12%)

Query: 4   SRSKLWKEYTAPNGLKYYYNTKTQETTWTKPDTEQKDETADKEIEIKPLVAFELLAGWAL 63
           +R KLW+EY APNG KYYYN KT+ETTWTKP  E+K E  D + E+K   AFEL  GW L
Sbjct: 2   NRGKLWREYKAPNGRKYYYNVKTKETTWTKPVEEEKPEPGDNK-EVK--FAFELFDGWYL 58

Query: 64  IIFSDGSKKYYN-CNESQW----SRKISHPECXXXXXXXXXXXXXXXXXXXXXYRCRTNA 118
           +I  DG K +Y+  NE  +    ++K+                             R + 
Sbjct: 59  LIRGDGGKLFYDSVNEKSYLETRTKKMGENNEKIIELMDKEKIILLIGMTRGFRDDRYHI 118

Query: 119 KDLVNEIREDIDFIRED-MNAAKTSEDMKSGSTVNNLENTKNALLGYYSSDDEEEPAKRD 177
           K + ++I +DI+F++++ +N A   E + + +     E  +              P +  
Sbjct: 119 KGVYDDIAQDINFLKQEILNDAMELERLNAEAEEEESEKEEAL------------PQE-- 164

Query: 178 EQAVVEEPDETNTLEVPDITQELGQDIKDSYFALFAKHELNKYSTWRIESEKVSQDPEFY 237
                E+ D T  L      +E  QD+KD  F LF    L+ YSTW ++S K+S   +++
Sbjct: 165 -----EQDDHTVELLNNLEEEEEEQDVKDRLFHLFESFNLDVYSTWSLQSRKISNQADYF 219

Query: 238 KIIDDAVRENIFEEWCNAGSVESNEESGDPGDDQFEPTKYHYLSQLVANYDLKPDTIPEX 297
            + DD  RE +FE+WC     +  E+  +  DD +EPTKYHYLS+++  Y L+ +   + 
Sbjct: 220 LVHDDTQREEMFEDWCAMKVAQLPEDESEAEDDDYEPTKYHYLSEIM--YQLRDEINADT 277

Query: 298 XXXXXXXXXXXXXXXYTTKS------EQRQFLSKMLAWYKHMSLEDRKQMFQTYID-RIP 350
                          Y  K       E R  +S++L +YK  +  +R+ +F  Y+  R  
Sbjct: 278 VADDILRGHRPLFKQYHIKQFIPDRRELRAVVSRLLFYYKRFTARERRAVFHDYVSQRYG 337

Query: 351 VGKYTDIDSD-----AQEDVESQLLELE-------NQLGIPTSENDLEYYCIDLRSK 395
           +    D+D+D     + E +E+++L+ E       N    PT+   LEYY + LR K
Sbjct: 338 LLPGEDVDNDDAGSLSGEQMETRILQWERDRQTEGNSSWDPTA---LEYYVVGLREK 391

>Kpol_480.11 s480 (21829..23220) [1392 bp, 463 aa] {ON}
           (21829..23220) [1392 nt, 464 aa]
          Length = 463

 Score =  149 bits (375), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 128/469 (27%), Positives = 213/469 (45%), Gaps = 77/469 (16%)

Query: 7   KLWKEYTAPNGLKYYYNTKTQETTWTKPD----TEQKDETADKEIEIKPLVAFELLAGWA 62
           K+WKE+ AP+G KYYYN K++E+TWTKPD    TE+    +D+     PL  F LL GW 
Sbjct: 4   KIWKEFNAPDGRKYYYNIKSKESTWTKPDSLYDTEKGKVGSDRAG--APLFVFPLLNGWH 61

Query: 63  LIIFSDGSKKYYN--CNESQWSRKISHPECXXXXXXXXXXXXXXXXXXXXXYRCRTNAKD 120
           LII   G K YYN   N++  S+++S                         Y      K 
Sbjct: 62  LIICVGGEKYYYNKVLNDT-ISKELSDDSSLQLLNAVDKDKLILLIAVARGYNWPDYEK- 119

Query: 121 LVNEIREDIDFIREDMNAAKTSEDMKSGSTV---------NNLENTKNALLGYY------ 165
           L +E+ ++ + I  DM   + +E   +             N +  +   L+G Y      
Sbjct: 120 LYDELLKEFELISNDMMQTQQAEVTSTEDEDEDEDENQEGNVVAVSNTGLIGGYLSSDDE 179

Query: 166 ------------SSDDEEEPAKRDEQAVVEEPDETNTLE-----VPDITQELGQDIKDSY 208
                       +++ EE+ AKR +Q  V+E    N+++     + DI  E  + +   +
Sbjct: 180 ESSDENQVEVSENTNIEEDLAKRSDQNDVDE--NLNSIDHGLDSLDDIDLEKSKSL---F 234

Query: 209 FALFAKHELNKYSTWRIESEKVSQDPEFYKIIDDAVRENIFEEWC---------NAGSVE 259
             LF + +L+ YS+WR++ +K+   P++++I D++ RE +FE WC         N  + E
Sbjct: 235 TRLFEEFQLDPYSSWRLQLKKIQNHPDYFQITDNSTREELFESWCSSKFNGGKSNVTNFE 294

Query: 260 SNEESGDPGD--DQFEPTKYHYLSQLVANYDLKPDTI--PEXXXXXXXXXXXXXXXXYTT 315
             +E     D  D FEPTK+HYL+ +++  D+  DTI                      +
Sbjct: 295 GEDEETLTSDEEDDFEPTKFHYLAHIISKADIAADTIFLDIKENNKSLFKEFKIKDFIKS 354

Query: 316 KSEQRQFLSKMLAWYKHMSLEDRKQMFQTYIDR-----IP--------VGKYTDIDSDAQ 362
           K +Q  F SK+L +YK   L +RK +F   +       IP        V      D D  
Sbjct: 355 KKDQEAFSSKLLFFYKKFQLNERKNLFLQLLKENENLIIPNINSNIEIVRHIIKNDVDEA 414

Query: 363 EDVESQLLELENQLGIPTS----ENDLEYYCIDLRSKRDILLSTIRNRV 407
            ++E+QLL++E  +G+        ND +YY + ++ K  +L   +++++
Sbjct: 415 YEIETQLLQIEKIIGLQNMLVDLANDPKYYILGIKDKLILLKEYLKDKI 463

>KAFR0G03720 Chr7 complement(765353..766582) [1230 bp, 409 aa] {ON}
           Anc_3.498 YPR152C
          Length = 409

 Score =  134 bits (336), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 118/418 (28%), Positives = 205/418 (49%), Gaps = 51/418 (12%)

Query: 6   SKLWKEYTAPNGLKYYYNTKTQETTWTKPDTEQKDETADKEIEIKPLVAFELLAGWALII 65
           +K+WKEY APNG KYYYNT+T++TTW KP+  +++E       I+P+    L+  W L+I
Sbjct: 2   NKIWKEYRAPNGKKYYYNTETKKTTWEKPEAAKREE-------IEPVFVIRLMNDWKLVI 54

Query: 66  FSDGSKKYYNCNESQWSRKISHPECXXXXXXXXXXXXXXXXXXXXXYRCRTNAKDLVNEI 125
            ++G K YY  NE++ ++++S  E                      Y    N + +   I
Sbjct: 55  CNNGMK-YYLDNENEPTKELSDEESLRLIELFDKEKLVCLIGIARGYAIE-NVEKIYGNI 112

Query: 126 REDIDFIREDMNAAKTSEDMKSGSTVNNLENTKNALLGYYSSDDEEEP------AKRDEQ 179
            E+++F++EDM   +     ++ S V  +              + E+P           +
Sbjct: 113 VEEVEFLKEDMKNEQERLKKEAESEVREI-----------VLKEAEKPRMNLVEGYDSSE 161

Query: 180 AVVEEPDETNTLEVPDITQELGQDIKDSYFALFAKHELNKYSTWRIESEKVSQDPEFYKI 239
           +  EE +E +   + ++  E     K  +  LF ++ L+K+S W +E  KVS+DP+FY +
Sbjct: 162 SEEEEEEEDDYEFLNNVADEGLSGDKAKFMELFDRYGLDKFSEWSMEMNKVSKDPDFYLV 221

Query: 240 IDDAVRENIFEEWCNAGSVE--SNEESG------DPGDDQFEPTKYHYLSQLVANYDLKP 291
            DD  RE++FE WC+   +   S+EE+       +  +   EPTK+HYLSQ+V+  +++ 
Sbjct: 222 TDDQEREDLFERWCSGQGIHSTSDEEAKEGGEPEEHEERPLEPTKFHYLSQIVSKSEIRR 281

Query: 292 DTIPEXXXXXXXXXXXXXXXXYTTKS--EQRQFLSKMLAWYKHM-SLEDRKQMFQTYIDR 348
            TI +                   +S  EQ +F+SK+L +YK    +EDR + F  ++ R
Sbjct: 282 TTIFQDIKRQNKRLFKEYKIKDFIESSKEQEKFVSKLLFYYKTFPQVEDRTKQFNDFL-R 340

Query: 349 IPVGKYT---DIDSDAQE-------DVESQLLELENQLGIPTSE-NDLEYYCIDLRSK 395
                YT   D+++ ++         +E+ LL++E     P    +D+ YY +DL+ K
Sbjct: 341 EKNANYTSMSDMNTLSEHIKRNDTYAIETTLLQIE--CNFPQDVLSDVRYYILDLKQK 396

>TDEL0D05660 Chr4 complement(1018928..1020256) [1329 bp, 442 aa]
           {ON} Anc_3.498 YPR152C
          Length = 442

 Score =  133 bits (335), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 107/435 (24%), Positives = 195/435 (44%), Gaps = 51/435 (11%)

Query: 6   SKLWKEYTAPNGLKYYYNTKTQETTWTKPDTEQKDETADKEI---EIKPLVAFELLAGWA 62
            +LW  +TAP+G KYYYN +T+E+TW +P++  +D    +     E +P  A  L+  W 
Sbjct: 2   GRLWTTFTAPSGEKYYYNLRTKESTWKRPESFYEDGGNKRPKLTREPEPFYAIPLVNDWF 61

Query: 63  LIIFSDGSKKYYNCNESQWSRKISHPECXXXXXXXXXXXXXXXXXXXXXYRCRTNAKDLV 122
           L+I   G K Y++ +  + S  +  PE                      Y   TN  D V
Sbjct: 62  LVIDDIGGKYYFDSSTEEASWTLEDPESAELLSTIDKNKIILLVAIARGYN--TNVGDRV 119

Query: 123 -NEIREDIDFIRED-------MNAAKTSEDMKSGSTVNNLENTKNALLGYYSSDDEEEPA 174
             E+ +D+  +R+            +   +     +    +     + GY SS++EE   
Sbjct: 120 YQEVIDDLKALRKGSAVEEEGEQEGEQESESIPSESEEEEKRPSGLIAGYSSSEEEENEI 179

Query: 175 KRDEQAVVEEPDETNTLEVPDITQELGQDIKDSYFALFAKHELNKYSTWRIESEKVSQDP 234
             D    VE+ +     ++P    E    I++ +F L  +H+ + YSTW I++ K+ +DP
Sbjct: 180 DSD----VEKLNNLGDDDLPKENHEDESQIRNDFFQLLQRHQCDPYSTWSIQARKIQEDP 235

Query: 235 EFYKIIDDAVRENIFEEWCNAGSVESNEESGDPGDDQF-------------EPTKYHYLS 281
            FY+I DD++RE++FEEWC      +        +D               EP  +HYL+
Sbjct: 236 LFYRITDDSIRESMFEEWCEKAINRTTNPQDLVDEDNLDDDSREEEEEDELEPLPFHYLA 295

Query: 282 QLVANYDLKPDTIPEXXXXXXXX--XXXXXXXXYTTKSEQRQFLSKMLAWYKHMSLEDRK 339
            +V+  ++ P TI +                    +KS+Q  F+SK+L +YK  +L++RK
Sbjct: 296 HIVSKANITPSTIFQDIKDQNKADFKKYKIKQFVKSKSQQETFVSKLLFYYKKFTLDERK 355

Query: 340 QMFQTYIDRIPVGKYTDIDSDAQE---------------DVESQLLELENQLGIPTS--- 381
           ++F   ++        +++ +++                 +E++LL++EN +G+      
Sbjct: 356 EIFHDLLESHSRSIKKNLEQESESMRSTLSEEAGSNDAYAIETKLLKMENLIGLARDMEE 415

Query: 382 -ENDLEYYCIDLRSK 395
             ND +YY + ++ K
Sbjct: 416 LANDPKYYVLGIKDK 430

>SAKL0F02552g Chr6 (219380..220816) [1437 bp, 478 aa] {ON} similar
           to uniprot|Q06525 Saccharomyces cerevisiae YPR152C
           Hypothetical ORF
          Length = 478

 Score =  121 bits (303), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 119/468 (25%), Positives = 202/468 (43%), Gaps = 87/468 (18%)

Query: 9   WKEYTAPNGLKYYYNTKTQETTWTKPDT--EQKDETADKEIEIKPLVAFELLAGWALIIF 66
           W E+T P+G KYYYN +T+++T  KP    +QK     K ++ KP     L  GW+L++ 
Sbjct: 5   WNEFTTPSGDKYYYNLETKQSTLEKPAGFDDQKSRKRQK-LQHKPKYLVPLDKGWSLVLC 63

Query: 67  SDGSKKYYN--CNESQWSRKISHPECXXXXXXXXXXXXXXXXXXXXXYRC-RTNAKDLVN 123
           + G+K Y+N   NES W+  +  P                       Y C R N  D   
Sbjct: 64  NTGTKFYHNKITNESHWT--LDDPCSIELLQQLDKEKLVLLIGISRGYYCPRRNVYD--- 118

Query: 124 EIREDIDFIREDMNAAKTSEDMKSGSTVNNLENTKNA-------LLGYYSSDDEEEPAKR 176
           EI  D+ F+++     +  E   + +    +E            + GY SSDD E+    
Sbjct: 119 EIINDLKFLKDKSLEKQGVEPEMARADEEQVEYLHQGEEQGLGLVTGYGSSDDSEDENIE 178

Query: 177 DEQAVVEEP-----------------DETNTLEVPDITQELGQDIKDSYFALFAKHELNK 219
           +E+   E                   D+ +  E+ ++++    D K+ +  LF K+ L+ 
Sbjct: 179 EEEEKAEVEGEGEEEEEEKAGEQETVDQADIDELNNLSEPPQLDAKNRFTILFDKYNLDP 238

Query: 220 YSTWRIESEKVSQDPEFYKIIDDAVRENIFEEWC----------------NAGSVESNEE 263
           YS W  +S K+++DP+FY + + + R+++FE+WC                N    +  +E
Sbjct: 239 YSMWEFQSRKINKDPDFYLVTNGSSRKDLFEQWCTETIANSKDAISDANINENDADQRQE 298

Query: 264 S-----------------GDPGDDQFEPTKYHYLSQLVANYDLKPDTI-PEXXXXXXXXX 305
           S                 G+P D+  EPT++HYLS +++   ++  TI  +         
Sbjct: 299 SEATQKEEQEEKKEVEEDGEPDDENLEPTRFHYLSHIISKSSIEQTTIFLDIKKENKALF 358

Query: 306 XXXXXXXYTTKSEQRQFLSKMLAWYKHMSLEDRKQMFQ----TYIDRIP-----VGKYTD 356
                     K +Q  F SK+L +YK M LE RK +FQ    + +D I      V K  D
Sbjct: 359 KTFRIKSSLKKKDQEDFASKLLFYYKRMDLEQRKLIFQKLLLSKLDIIRSNLRNVEKLRD 418

Query: 357 IDSDAQE-----DVESQLLELENQLGIPTS----ENDLEYYCIDLRSK 395
           I ++         +E+QLL +E+ + I       + ++ YY + ++ K
Sbjct: 419 IATEQSTPADSYAIETQLLMMEDCMDIHGKLSFLQGEVHYYILGIKDK 466

>KLTH0G02398g Chr7 (186986..188374) [1389 bp, 462 aa] {ON} similar
           to uniprot|Q06525 Saccharomyces cerevisiae YPR152C
           Hypothetical ORF
          Length = 462

 Score =  120 bits (300), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 108/453 (23%), Positives = 201/453 (44%), Gaps = 61/453 (13%)

Query: 3   RSRSKLWKEYTAPNGLKYYYNTKTQETTWTKPD-TEQKDETADKEIEIKPLVAF--ELLA 59
           R   + W+EY  P+G KYYYN  T+ +T  KPD  E+      K   + P V F   L  
Sbjct: 4   RKMPRYWREYKTPDGTKYYYNVNTKRSTTDKPDDFEESQSFRSKSRRVDPGVTFVVPLSN 63

Query: 60  GWALIIFSDGSKKYYNCN--ESQWSRKISHPECXXXXXXXXXXXXXXXXXXXXXYRCRTN 117
            W L +  +G + +Y  +  ES+W   I   E                      +     
Sbjct: 64  DWVLSVCENGQRFFYKSSTEESRWD--IEDEESLRILSLVDKNKLVLLLATARGFDI--G 119

Query: 118 AKDLVNEIREDIDFIREDMNAAKTSEDMKS--------GSTVNNLENTKNALLGYYSSDD 169
            +D+  E+ EDI+ +++     + SE +++        G   N  E    A+    S+ +
Sbjct: 120 ERDVYQELLEDINNLKQSRGVPEGSEVIEAAEEPSHTAGEPSNATEEPSQAVRTLISAYE 179

Query: 170 EEEPAKRDEQAV-----VEEPDETNTLEVPDI---TQELGQDIKDSYFALFAKHELNKYS 221
             +        +     V   +E +  ++ D+   + +  +  K  + +LF +++L+ YS
Sbjct: 180 SSDEDGDSSDEINAEKEVHSDNEGSNSDIEDLNAASHQYNEATKQMFTSLFDEYDLDPYS 239

Query: 222 TWRIESEKVSQDPEFYKIIDDAVRENIFEEWCNAGSVESNEESGDPGDD----------- 270
           TW ++S+K+  +P FY++  DA R  +FE+WC A  V+  +   DP              
Sbjct: 240 TWNMQSKKICDNPLFYQVASDAERRELFEDWCVA-KVKLEDVIEDPAHQAVSSDGDGDDD 298

Query: 271 -----QFEPTKYHYLSQLVANYDLKPDTIP-EXXXXXXXXXXXXXXXXYTTKSEQRQFLS 324
                + EPT+YHYL+ +V+  ++ P T+P +                   K +Q +FLS
Sbjct: 299 DTSTDELEPTRYHYLAHIVSKAEVAPSTLPRDLRSEQKQLFKQFKIKESLGKKQQDEFLS 358

Query: 325 KMLAWYKHMSLEDRKQMFQTYID---RIPVGKYTDIDS----DAQED-------VESQLL 370
           K+L +YK+M+ E R ++   ++    ++ +  + +I+      +Q+D       +ESQLL
Sbjct: 359 KLLFYYKNMTEEQRLEVLVKFLKTRRKLIMKGFRNIEQLESVLSQQDLPTSGFAIESQLL 418

Query: 371 ELENQLGI----PTSENDLEYYCIDLRSKRDIL 399
            LE+ + I       +++++YY + ++ K   L
Sbjct: 419 RLEDCIDIHGVSKALQDEVQYYVLGIKQKTTAL 451

>KLLA0E03939g Chr5 (357695..359002) [1308 bp, 435 aa] {ON} similar
           to uniprot|Q06525 Saccharomyces cerevisiae YPR152C
           Hypothetical ORF
          Length = 435

 Score =  113 bits (282), Expect = 6e-27,   Method: Compositional matrix adjust.
 Identities = 108/438 (24%), Positives = 202/438 (46%), Gaps = 49/438 (11%)

Query: 9   WKEYTAPNGLKYYYNTKTQETTWTKPDTEQKDETADKEIEIKPLVAFELLAGWALIIFSD 68
           WK +  P+G  YY+NT+++ +T  KP      +   KE+ + P+    L   W L+I  D
Sbjct: 4   WKRFKDPSGNFYYFNTRSKVSTKEKPKEFGSQQAGMKELRV-PVFCLPLRNYWNLVICKD 62

Query: 69  GSKKYYN--CNESQWSRKISHPECXXXXXXXXXXXXXXXXXXXXXYRCRTNAKDLVNEIR 126
           GSK ++N   N SQ+  K++  E                      +  R N +D+  EIR
Sbjct: 63  GSKFFHNDESNVSQF--KLADDESKALLDKVDTSLLALLIGVARGFNLR-NDRDVYGEIR 119

Query: 127 E----DIDFIREDMNAAKTSEDMKSGSTVNNLENTKNALLGYYSSDDEEEPAKRDEQAVV 182
           +     +D   ++ N         + S V+  + ++++      S          E++ V
Sbjct: 120 DVLQAKLDSNDKEQNDITEERPQVTNSNVDTEDKSESS--NILVSGYSSSSDDSGEESEV 177

Query: 183 EEPDETNTLEVP--DITQELGQ-DIKDSYFALFAKHELNKYSTWRIESEKVSQDPEFYKI 239
           EE ++ ++++V   D    L   +I+  +  L  + +L+ YSTW I+++++  DP +Y I
Sbjct: 178 EEKNDPSSIDVKEEDTLPSLNNTEIESKFIQLLNEIQLDPYSTWSIQAKRIMHDPRYYLI 237

Query: 240 IDDAVRENIFEEWCN--------------AGSVESNEESGDPGDDQFEPTKYHYLSQLVA 285
             +  R+ +F+ WC+                S E+++E  +  D   EPTKYHYL+ +++
Sbjct: 238 TSNDKRDELFQTWCSQQLNNSNNDNENNAQDSAENSDE--EDSDVTLEPTKYHYLAHIIS 295

Query: 286 NYDLKPDTIPEXXXXXXXXXXXXXXXXYT-TKSEQRQFLSKMLAWYKHMSLEDRKQMFQT 344
             ++ P+T+                   T TK EQ QF SK++A+YK M    R ++F+ 
Sbjct: 296 KANITPETLFSNIKKENKSLFKELEINKTLTKKEQEQFASKVIAYYKRMDNLQRTELFKK 355

Query: 345 YI----------DRIPVGKYTDIDSDAQEDVESQLLELENQLGIPTS------ENDLEYY 388
            +          +++      +  SD+ + +E+QLL+LEN L I  +      +N++ YY
Sbjct: 356 MMKNKLRFPPISEKLSQLMLEETPSDSFK-LETQLLQLENALLILDNLQNSYMQNEIMYY 414

Query: 389 CIDLRSKRDILLSTIRNR 406
            + ++ K   L   +R++
Sbjct: 415 ILGIKDKLAALKEILRDQ 432

>Ecym_1231 Chr1 (476386..477375) [990 bp, 329 aa] {ON} similar to
           Ashbya gossypii AFR317C
          Length = 329

 Score =  108 bits (269), Expect = 9e-26,   Method: Compositional matrix adjust.
 Identities = 74/231 (32%), Positives = 117/231 (50%), Gaps = 32/231 (13%)

Query: 208 YFALFAKHELNKYSTWRIESEKVSQDPEFYKIIDDAVRENIFEEWCN-----AGSVESNE 262
           + ALF ++ELN YS+W ++S KV  DPEFY ++DD  R  +FE+WC      AG   S  
Sbjct: 90  FIALFDRYELNPYSSWSLQSRKVQSDPEFYTLLDDETRRELFEDWCTMKLAKAGGDSSAS 149

Query: 263 ESG---------DPGDDQFEPTKYHYLSQLVANYDLKPDTIPEXXXXXXXXXXXXXXXXY 313
            +G         D  D+  EP K+HYLS +V+   +KP T+                   
Sbjct: 150 LTGEEEEEEDDDDDEDESLEPVKFHYLSHIVSKSTIKPQTVFSDVKTENKLLFKNFNIDE 209

Query: 314 TT-KSEQRQFLSKMLAWYKHMSLEDRKQMFQTYIDRIPVGKYTDID------------SD 360
           T  K EQRQF+S +L +YK  S ++R ++F+  +D     +  + D            +D
Sbjct: 210 THPKQEQRQFVSSLLFYYKKKSSKERVEIFKNLLDTKVKHEINNEDQLQQILDQENLPND 269

Query: 361 AQEDVESQLLELENQLGIPTS----ENDLEYYCIDLRSKRDILLSTIRNRV 407
           A E +ESQL+ +E  +G+  S    + D++YY + +R K  ++   +R+ V
Sbjct: 270 AYE-IESQLITMEKYIGMHDSLRQLQEDIKYYVVGVRDKTILIKEFLRHMV 319

>ZYRO0D09768g Chr4 (826977..828359) [1383 bp, 460 aa] {ON} similar
           to uniprot|Q06525 Saccharomyces cerevisiae YPR152C
          Length = 460

 Score =  104 bits (260), Expect = 6e-24,   Method: Compositional matrix adjust.
 Identities = 70/225 (31%), Positives = 116/225 (51%), Gaps = 40/225 (17%)

Query: 205 KDSYFALFAKHELNKYSTWRIESEKVSQDPEFYKIIDDAVRENIFEEWCNAGSVESNEES 264
           K + + LF +++LN YS W  E +K+  DP+F +++DD+VRE++FEEWC      ++  S
Sbjct: 230 KKALWDLFTRYDLNPYSAWPFEMKKIRDDPDFLRVLDDSVREDVFEEWC------AHAIS 283

Query: 265 GD---PGDD----------QFEPTKYHYLSQLVANYDLKPDTIPEXXXXXXXXXXXXXXX 311
           GD   P D+            EPTKYHYL+ +V+  ++ P TI                 
Sbjct: 284 GDQVEPVDEIKSEDFDEEEDLEPTKYHYLAHIVSKSNITPTTIFMDIKNDNKSSFKKYNI 343

Query: 312 X--YTTKSEQRQFLSKMLAWYKHMSLEDRKQMFQTYI---------------DRIPVGKY 354
               T+K +Q  F+SK+L +YK M LE+RK++F   +               D++     
Sbjct: 344 KDFLTSKKDQESFVSKLLFYYKRMKLEERKEVFVQLLKQNGKTIEENLSNDMDKVRHCLA 403

Query: 355 TDIDSDAQEDVESQLLELENQLGIPTSENDL----EYYCIDLRSK 395
            +IDS+    VE++L ++E  +G+  + +DL    +YY + +R K
Sbjct: 404 QEIDSNDPYAVETKLFKMEKFMGLWGNLSDLVEEPKYYILGIRDK 448

 Score = 79.0 bits (193), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 39/84 (46%), Positives = 53/84 (63%), Gaps = 7/84 (8%)

Query: 6  SKLWKEYTAPNGLKYYYNTKTQETTWTKPDT-----EQKDETADKEIEIKPLVAFELLAG 60
          +++W+EY AP+G KYYYN  T+++TW KP++     E +     K+IE KP VA EL  G
Sbjct: 2  ARIWREYVAPDGRKYYYNAVTKQSTWHKPESLDEMDENRGVKRFKKIESKPHVALELYHG 61

Query: 61 WALIIFSDGSKKYYNC--NESQWS 82
          W L+I   G K YYN   NES W+
Sbjct: 62 WHLVICDTGKKFYYNVETNESAWN 85

>Kwal_47.18895 s47 complement(1018177..1019508) [1332 bp, 443 aa]
           {ON} YPR152C - Hypothetical ORF [contig 189] FULL
          Length = 443

 Score =  100 bits (248), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 69/226 (30%), Positives = 112/226 (49%), Gaps = 34/226 (15%)

Query: 208 YFALFAKHELNKYSTWRIESEKVSQDPEFYKIIDDAVRENIFEEWC-----NAGSVESNE 262
           + +LF+K+ ++ YSTW ++S K+  DP FYKI +DA R+ +FE WC     N   V + +
Sbjct: 214 FISLFSKYAVDPYSTWNMQSRKIRDDPLFYKITNDADRKELFENWCMNECSNQSEVPAID 273

Query: 263 ES------GDPGDDQFEPTKYHYLSQLVANYDLKPDTIP-EXXXXXXXXXXXXXXXXYTT 315
           E        DP  D  EP++YHYL+ +V+   +   T+P +                  +
Sbjct: 274 EQIISSDDEDPAIDSLEPSRYHYLAHIVSKSKITSSTLPKDIRTDQKELFKQFRIKDSLS 333

Query: 316 KSEQRQFLSKMLAWYKHMSLEDRKQMFQTYIDRIP------------VGKYTDIDSDAQE 363
           K EQ  FLSK+L +YK M+ E R  +F+ +++               +       S  QE
Sbjct: 334 KREQDAFLSKLLFYYKRMTPEQRIAIFKRFLEGKKKALKKGLKNQERLSTILSTPSLPQE 393

Query: 364 D--VESQLLELENQLGIPTS----ENDLEYYCIDLRSK----RDIL 399
           +  +E+QLL LE+ +    S    + D++YY + ++ K    RDIL
Sbjct: 394 NYAIETQLLILEDCIDTHGSNAFLQEDVQYYVLGIKDKTVALRDIL 439

 Score = 63.9 bits (154), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 32/81 (39%), Positives = 51/81 (62%), Gaps = 4/81 (4%)

Query: 6  SKLWKEYTAPNGLKYYYNTKTQETTWTKPDTEQKDETA---DKEIEIKPLVAFELLAGWA 62
          ++ W+EY  P+G KYYYN  T+++T+  PD   +D+ +    ++++ KPL A  L   WA
Sbjct: 2  ARQWREYKTPDGSKYYYNLNTKKSTYEIPDDFDEDQNSGRKSRKLDAKPLFALSLFNDWA 61

Query: 63 LIIFSDGSKKYYNCNESQWSR 83
          LII + G + +YN +ES  SR
Sbjct: 62 LIICNTGLRFFYN-SESHTSR 81

>AFR317C Chr6 complement(1011817..1012803) [987 bp, 328 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPR152C
          Length = 328

 Score = 86.3 bits (212), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 55/227 (24%), Positives = 109/227 (48%), Gaps = 23/227 (10%)

Query: 205 KDSYFALFAKHELNKYSTWRIESEKVSQDPEFYKIIDDAVRENIFEEWCNAGSVESN--- 261
           K   +ALF + EL+ YS W  ES K+S D  FY + DD  R+ +FE+WC     +     
Sbjct: 97  KAELWALFERAELDPYSAWVFESAKISGDAAFYAVGDDEARQELFEQWCARKIADEGNAV 156

Query: 262 -EESGDPGDDQFEPTKYHYLSQLVANYDLKPDTIPEXXXXXXXXXXXXXXXXYTTKSEQR 320
            E+  +  + +  PT++HYL+ +V+   ++PDT+                     K EQR
Sbjct: 157 LEDGEEAEEVELVPTRFHYLAHIVSKSTVRPDTVYSDVRREHKELFDQLEVDILDKKEQR 216

Query: 321 QFLSKMLAWYKHMSLEDRKQMFQTYI--DRIPV-GKYTDIDSDAQE------------DV 365
           +F++ +L +YK M    R ++F+  +   R  +   + + D+  +E             +
Sbjct: 217 RFVAGLLFYYKKMDAALRGEVFRKLLHAHRAAITAAFLENDAQLRELLEYDELPQDSYSI 276

Query: 366 ESQLLELENQLGIPTS----ENDLEYYCIDLRSKRDILLSTIRNRVN 408
           E+ L  +E  +G+  +    +++++YY + ++ K  ++   +R  ++
Sbjct: 277 ETDLFIVEKCIGLHGALSKLQSEIKYYVLGVKDKLVVMKEVLREMLS 323

 Score = 40.4 bits (93), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 16/29 (55%), Positives = 20/29 (68%)

Query: 8  LWKEYTAPNGLKYYYNTKTQETTWTKPDT 36
          +WK   + +G  YYYNT+T ETTW KPD 
Sbjct: 2  VWKRAKSEDGKAYYYNTETNETTWDKPDA 30

>TBLA0D02930 Chr4 (719542..720372) [831 bp, 276 aa] {ON} Anc_3.498
           YPR152C
          Length = 276

 Score = 84.3 bits (207), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 60/216 (27%), Positives = 107/216 (49%), Gaps = 21/216 (9%)

Query: 195 DITQELGQDIKDS----------YFALFAKHELNKYSTWRIESEKVSQDPEFYKIIDDAV 244
           D+ +EL +DI  S          +F L  +  ++ YS WR+E++K+S DP FY I  D  
Sbjct: 52  DVLKELLEDIDASEDEIGNKETQFFELLDRSNIDCYSCWRLEAKKISDDPIFYNIPTDVE 111

Query: 245 RENIFEEWCNAGSVESNEESGDPGDDQFEPTKYHYLSQLVANYDLKPDTIPEXXXXXXXX 304
           RE +FE+WC        EE+  P      P  YH L++++  +D++ +TI +        
Sbjct: 112 REKLFEQWCYGKLHSREEETTQPQLALALP--YHDLAEMICCFDIQSNTIYKDIRKANKK 169

Query: 305 XXXXXXXXYTTKSEQRQFLSKMLAWYKHMSLEDRKQMFQTYIDRIPVGKYTDIDSDAQED 364
                     +K+EQ +F +K+L   K+      + +F+  ++   V +   +D +   +
Sbjct: 170 MVRQIDEK-ISKNEQEKFGTKLLGILKYHDDASCQGLFEQVLEENGVDR---VDVNTSFE 225

Query: 365 VESQLLELENQLGIPTSEN----DLEYYCIDLRSKR 396
             + L++LE ++GI T+EN    D  Y+C+   S+R
Sbjct: 226 TLADLVDLERRMGI-TTENSVSRDARYFCLRNASRR 260

>NDAI0B05900 Chr2 complement(1425195..1426763) [1569 bp, 522 aa]
           {ON} Anc_3.498 YPR152C
          Length = 522

 Score = 84.0 bits (206), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 72/263 (27%), Positives = 117/263 (44%), Gaps = 63/263 (23%)

Query: 202 QDIKDSYFALFAKHELNKYSTWRIESEKVSQDPE-FYKIIDDAVRENIFEEWC-----NA 255
           Q +K ++F L  K++L+ YSTW ++S ++ + P  FY I +D+ RE IFE+WC     + 
Sbjct: 253 QKVKQAFFELLDKNKLDMYSTWSVQSRRIIERPTIFYSISNDSEREEIFEDWCRNRVHST 312

Query: 256 GSVESNEESGDPGD---------------------DQFEPTKYHYLSQLVANYDLKPDTI 294
           G   SN +  + GD                     D  EPTKYHYLS+L+  + L+ D+I
Sbjct: 313 GLYSSNVKENNDGDTLVRGSYYEEEDKDDDDDDDDDDLEPTKYHYLSELI--FKLR-DSI 369

Query: 295 PEXXXXXXXXXXXXXXXX-------YTTKSEQRQFLSKMLAWYKHMSLEDRKQMFQTYID 347
            E                          K E  + +S +L +YK +S ++R   FQ Y+ 
Sbjct: 370 NERSIFQDIKRQGKSLFKDYRIKDWIPDKKELEKTVSLLLFYYKKLSEQERCDKFQEYVT 429

Query: 348 R----------------IPVGKYTDIDSDAQEDVESQLLELENQL------GIPTSEN-- 383
           +                +      D +++A  D+E ++L++EN +       +P +    
Sbjct: 430 KHYGEKIKLHHEELNKILEPSSSADAEAEADVDIEKEILQIENVILRSGDDHVPVTAAVD 489

Query: 384 --DLEYYCIDLRSKRDILLSTIR 404
              LEYY I LR+K   L + I 
Sbjct: 490 TPGLEYYIIGLRAKHSALATLIH 512

 Score = 68.6 bits (166), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 36/82 (43%), Positives = 50/82 (60%), Gaps = 8/82 (9%)

Query: 3  RSRSKLWKEYTAPNGLKYYYNTKTQETTWTKPDT---EQKDETADKEI-----EIKPLVA 54
          +   ++WKEY  PNG KYYYN +T+++TW KP +     K+ +  K +     EI+   A
Sbjct: 6  KHHKRIWKEYKTPNGKKYYYNIETKQSTWEKPFSFYKTNKNNSNTKALGQTHHEIENKFA 65

Query: 55 FELLAGWALIIFSDGSKKYYNC 76
          F+LL  W LI+ SDGSK YYN 
Sbjct: 66 FKLLNEWYLILRSDGSKFYYNA 87

>Ecym_3397 Chr3 (754713..756440) [1728 bp, 575 aa] {ON} similar to
          Ashbya gossypii ADR159C
          Length = 575

 Score = 47.8 bits (112), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 34/83 (40%), Positives = 39/83 (46%), Gaps = 14/83 (16%)

Query: 9  WKEYTAPNGLKYYYNTKTQETTWTKPDTEQKDETADKEIEIKPLVAFELLAGWALIIFSD 68
          WKE   P G  YYYN+K  ETTW KP          KE+E+  L A  L  GW +    D
Sbjct: 4  WKETIDPEGRVYYYNSKG-ETTWHKP----------KEMEV-VLDAILLKQGWKVASTED 51

Query: 69 GSKKYY--NCNESQWSRKISHPE 89
          G   YY  N NES W   +   E
Sbjct: 52 GKVYYYNKNTNESTWELPVVREE 74

 Score = 32.7 bits (73), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 17/39 (43%), Positives = 22/39 (56%), Gaps = 2/39 (5%)

Query: 9  WKEYTAPNGLKYYYNTKTQETTWTKPDT--EQKDETADK 45
          WK  +  +G  YYYN  T E+TW  P    E+KDE  +K
Sbjct: 44 WKVASTEDGKVYYYNKNTNESTWELPVVREEKKDEGGEK 82

>TBLA0C00930 Chr3 complement(185527..187503) [1977 bp, 658 aa]
          {ON} Anc_2.649 YKL012W
          Length = 658

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 28/85 (32%), Positives = 39/85 (45%), Gaps = 12/85 (14%)

Query: 9  WKEYTAPNGLKYYYNTKTQETTWTKP----------DTEQKDETADKEIEIKPLVAFELL 58
          WK+   P G  YYYN KT+E+ W  P           TE++      E++ K  + F  L
Sbjct: 5  WKQAKDPKGRVYYYNLKTKESRWDLPKSSTGTNKSISTEKQVSVKKNELKNKIDLEFLKL 64

Query: 59 AGWALIIFSDGSKKYYNCN--ESQW 81
           GW      +G   YYN +  ES+W
Sbjct: 65 HGWRTAQTKEGRIYYYNVDTKESRW 89

>CAGL0L05368g Chr12 complement(593547..595319) [1773 bp, 590 aa]
          {ON} similar to uniprot|P33203 Saccharomyces cerevisiae
          YKL012w PRP40 splicing factor
          Length = 590

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 27/75 (36%), Positives = 39/75 (52%), Gaps = 13/75 (17%)

Query: 9  WKEYTAPNGLKYYYNTKTQETTWTKPDTEQKDETADKEIEIKPLVAFELLAGWALIIFSD 68
          WK+ T  NG  YYYNT T+E+ W KP     ++T D + +++        AGW +    +
Sbjct: 5  WKKATDSNGKVYYYNTVTKESRWDKP----VEDTTDLKQKLRD-------AGWNVAKTKE 53

Query: 69 GSKKYYNC--NESQW 81
          G   YYN    ES+W
Sbjct: 54 GKVYYYNVKTKESRW 68

 Score = 33.5 bits (75), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 18/49 (36%), Positives = 23/49 (46%)

Query: 2  QRSRSKLWKEYTAPNGLKYYYNTKTQETTWTKPDTEQKDETADKEIEIK 50
          Q+ R   W       G  YYYN KT+E+ W  P  E+  E   K  +IK
Sbjct: 39 QKLRDAGWNVAKTKEGKVYYYNVKTKESRWDNPLAEKATEKKTKTGQIK 87

>TPHA0L02020 Chr12 complement(419703..421454) [1752 bp, 583 aa]
          {ON} Anc_2.649 YKL012W
          Length = 583

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 26/76 (34%), Positives = 32/76 (42%), Gaps = 15/76 (19%)

Query: 8  LWKEYTAPNGLKYYYNTKTQETTWTKPDTEQKDETADKEIEIKPLVAFELLAGWALIIFS 67
          LW+     NG  YYYNTKT  + W KP      ET  +              GW +    
Sbjct: 6  LWRTAKDSNGKVYYYNTKTGVSQWEKPGVSADIETLKQH-------------GWGVARTK 52

Query: 68 DGSKKYYNCN--ESQW 81
          DG   YYN +  ES+W
Sbjct: 53 DGKLYYYNSSTGESRW 68

>ADR159C Chr4 complement(982821..984530) [1710 bp, 569 aa] {ON}
          Syntenic homolog of Saccharomyces cerevisiae YKL012W
          (PRP40)
          Length = 569

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 27/77 (35%), Positives = 38/77 (49%), Gaps = 14/77 (18%)

Query: 9  WKEYTAPNGLKYYYNTKTQETTWTKPDTEQKDETADKEIEIKPLVAFELLAGWALIIFSD 68
          WKE     G  YYYN+K  ET+W KP+        D  +E++P +      GW +    D
Sbjct: 4  WKEAQDSTGRVYYYNSKG-ETSWNKPN--------DTPVELEPRLE---ECGWKVATTED 51

Query: 69 GSKKYYN--CNESQWSR 83
          G+  YYN    ES+W +
Sbjct: 52 GNVYYYNRETGESRWEK 68

 Score = 33.1 bits (74), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 15/34 (44%), Positives = 20/34 (58%)

Query: 9  WKEYTAPNGLKYYYNTKTQETTWTKPDTEQKDET 42
          WK  T  +G  YYYN +T E+ W KP+ E  +E 
Sbjct: 44 WKVATTEDGNVYYYNRETGESRWEKPELEPAEEV 77

>SAKL0G19360g Chr7 complement(1664386..1666092) [1707 bp, 568 aa]
          {ON} similar to uniprot|P33203 Saccharomyces cerevisiae
          YKL012W PRP40 U1 snRNP protein involved in splicing
          interacts with the branchpoint-binding protein during
          the formation of the second commitment complex
          Length = 568

 Score = 40.4 bits (93), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 29/76 (38%), Positives = 34/76 (44%), Gaps = 15/76 (19%)

Query: 9  WKEYTAPNGLKYYYNTKTQETTWTKPDTEQKDETADKEIEIKPLVAFELLA-GWALIIFS 67
          WKE     G  YYYNT T ETTWTKP             E+   +   LLA GW +   +
Sbjct: 6  WKEAKDLQGRIYYYNTATSETTWTKPQ------------ELYSELERRLLAHGWKVGSTA 53

Query: 68 DGSKKYYN--CNESQW 81
               YYN    ES+W
Sbjct: 54 GKQTYYYNEASGESRW 69

>YKL012W Chr11 (418310..420061) [1752 bp, 583 aa] {ON}  PRP40U1
          snRNP protein involved in splicing, interacts with the
          branchpoint-binding protein during the formation of the
          second commitment complex
          Length = 583

 Score = 40.0 bits (92), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 25/77 (32%), Positives = 39/77 (50%), Gaps = 13/77 (16%)

Query: 8  LWKEYTAPNGLKYYYNTKTQETTWTKPDTEQKDETADKEIEIKPLVAFELLAGWALIIFS 67
          +WKE    +G  YYYNT T+++TW KP    K+  + +E+ ++         GW     +
Sbjct: 3  IWKEAKDASGRIYYYNTLTKKSTWEKP----KELISQEELLLRE-------NGWKAAKTA 51

Query: 68 DGSKKYYN--CNESQWS 82
          DG   YYN    E+ W+
Sbjct: 52 DGKVYYYNPTTRETSWT 68

 Score = 34.7 bits (78), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 17/37 (45%), Positives = 21/37 (56%)

Query: 5  RSKLWKEYTAPNGLKYYYNTKTQETTWTKPDTEQKDE 41
          R   WK     +G  YYYN  T+ET+WT P  E+K E
Sbjct: 41 RENGWKAAKTADGKVYYYNPTTRETSWTIPAFEKKVE 77

>ZYRO0E00682g Chr5 (49836..51548) [1713 bp, 570 aa] {ON} similar
          to uniprot|P33203 Saccharomyces cerevisiae YKL012W
          PRP40 U1 snRNP protein involved in splicing interacts
          with the branchpoint-binding protein during the
          formation of the second commitment complex
          Length = 570

 Score = 38.9 bits (89), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 29/82 (35%), Positives = 39/82 (47%), Gaps = 17/82 (20%)

Query: 4  SRSKLWKEYTAPNGLKYYYNTKTQETTWTKPDTEQKDETADKEIEIKPLVAFELLA--GW 61
          S   LWKE    +G  YYYN KT E+ W KP    ++  +++E+         +LA  GW
Sbjct: 2  SSESLWKEAKDTSGRIYYYNAKTGESKWEKP----RELLSEQEL---------ILAKHGW 48

Query: 62 ALIIFSDGSKKYYNCN--ESQW 81
               SDG   YYN     S+W
Sbjct: 49 KSSKTSDGKLYYYNAQTKTSRW 70

>Kpol_1073.4 s1073 (4004..5596) [1593 bp, 530 aa] {ON}
          (4004..5596) [1593 nt, 531 aa]
          Length = 530

 Score = 38.1 bits (87), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 28/79 (35%), Positives = 35/79 (44%), Gaps = 15/79 (18%)

Query: 6  SKLWKEYTAPNGLKYYYNTKTQETTWTKP-DTEQKDETADKEIEIKPLVAFELLAGWALI 64
          S +WKE    NG  YYYN+KT E+ W KP +   K E   K+             GW++ 
Sbjct: 2  SDIWKEAKDNNGRVYYYNSKTGESRWEKPVEAPSKQEQLLKK------------NGWSIG 49

Query: 65 IFSDGSKKYYN--CNESQW 81
              G   YYN    ES W
Sbjct: 50 KSKAGKIYYYNTKTGESSW 68

>Smik_11.243 Chr11 (405300..407039) [1740 bp, 579 aa] {ON} YKL012W
          (REAL)
          Length = 579

 Score = 37.0 bits (84), Expect = 0.087,   Method: Compositional matrix adjust.
 Identities = 28/81 (34%), Positives = 37/81 (45%), Gaps = 21/81 (25%)

Query: 8  LWKEYTAPNGLKYYYNTKTQETTWTKPDTEQKDETADKEIEIKPLVAFE--LLA--GWAL 63
          +WKE    NG  YYYN+ T+++TW KP               K LV+ E  LL   GW  
Sbjct: 3  IWKEAKDANGRVYYYNSLTKKSTWEKP---------------KELVSEEEQLLRENGWRA 47

Query: 64 IIFSDGSKKYYN--CNESQWS 82
              +G   YYN    E+ W+
Sbjct: 48 AKTKEGKVYYYNPATRETSWT 68

 Score = 34.7 bits (78), Expect = 0.51,   Method: Compositional matrix adjust.
 Identities = 18/45 (40%), Positives = 24/45 (53%)

Query: 2  QRSRSKLWKEYTAPNGLKYYYNTKTQETTWTKPDTEQKDETADKE 46
          Q  R   W+      G  YYYN  T+ET+WT P  E+K +T  K+
Sbjct: 38 QLLRENGWRAAKTKEGKVYYYNPATRETSWTIPVFEKKVQTTAKK 82

>Kwal_14.939 s14 (124224..125912) [1689 bp, 562 aa] {ON} YKL012W
          (PRP40) - U1 snRNP protein [contig 244] FULL
          Length = 562

 Score = 36.6 bits (83), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 24/75 (32%), Positives = 36/75 (48%), Gaps = 13/75 (17%)

Query: 9  WKEYTAPNGLKYYYNTKTQETTWTKPDTEQKDETADKEIEIKPLVAFELLAGWALIIFSD 68
          W E   P G  YYYN+++ ETTW KP    ++  ++ E++++         GW       
Sbjct: 4  WNEAHDPEGRVYYYNSESGETTWDKP----RELYSELELQLEK-------HGWKTGETEG 52

Query: 69 GSKKYYN--CNESQW 81
          G   YYN    ES+W
Sbjct: 53 GKLYYYNESSGESRW 67

>Skud_11.217 Chr11 (399225..400976) [1752 bp, 583 aa] {ON} YKL012W
          (REAL)
          Length = 583

 Score = 36.2 bits (82), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 15/26 (57%), Positives = 18/26 (69%)

Query: 9  WKEYTAPNGLKYYYNTKTQETTWTKP 34
          WKE    NG  YYYNT T+++TW KP
Sbjct: 4  WKEAKDANGRVYYYNTLTKKSTWEKP 29

 Score = 32.7 bits (73), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 26/78 (33%), Positives = 36/78 (46%), Gaps = 7/78 (8%)

Query: 9   WKEYTAPNGLKYYYNTKTQETTWTKPDTEQKDETADKEIEIKPLVAFELLAGWALIIFSD 68
           W+      G  YYYNT T++T+W  P  E+K E   K+   +P V     A     + +D
Sbjct: 45  WRAAKTAEGKVYYYNTTTRKTSWAIPIFEKKTEDIAKK---EPDVILSAQASKYRTVSTD 101

Query: 69  GSKKYYNCN----ESQWS 82
             KK    N    ESQ+S
Sbjct: 102 EEKKELRQNIKEEESQYS 119

>TDEL0B07440 Chr2 complement(1302549..1304261) [1713 bp, 570 aa]
          {ON} Anc_2.649 YKL012W
          Length = 570

 Score = 35.4 bits (80), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 26/79 (32%), Positives = 36/79 (45%), Gaps = 13/79 (16%)

Query: 9  WKEYTAPNGLKYYYNTKTQETTWTKPDTEQKDETADKEIEIKPLVAFELLAGWALIIFSD 68
          WKE     G  YYYN K  E+ W KP   Q+  T ++ + +K         GW     ++
Sbjct: 7  WKEALDDKGRTYYYNAKNGESRWEKP---QELFTEEELVLLK--------HGWKSSRTAE 55

Query: 69 GSKKYYN--CNESQWSRKI 85
          G   YYN    ES+W + I
Sbjct: 56 GKIYYYNSITKESRWEKPI 74

>NCAS0C05110 Chr3 (1042307..1044121) [1815 bp, 604 aa] {ON}
          Anc_2.649
          Length = 604

 Score = 35.4 bits (80), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 23/77 (29%), Positives = 35/77 (45%), Gaps = 11/77 (14%)

Query: 9  WKEYTAPNGLKYYYNTKTQETTWTKPDTEQKDETADKEIEIKPLVAFELL--AGWALIIF 66
          W+     NG  YYYN  T+E+ W +P + +     D   ++       LL   GW   + 
Sbjct: 11 WRSAKDANGRTYYYNINTKESRWDRPASMEGSTNNDDSDKM-------LLEQIGWKSNVT 63

Query: 67 SDGSKKYYNC--NESQW 81
          ++G   YYN    ES+W
Sbjct: 64 NEGKVYYYNLKTGESRW 80

>KAFR0A00230 Chr1 (46128..47798) [1671 bp, 556 aa] {ON} Anc_2.649
          YKL012W
          Length = 556

 Score = 35.0 bits (79), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 14/26 (53%), Positives = 17/26 (65%)

Query: 9  WKEYTAPNGLKYYYNTKTQETTWTKP 34
          WK    P G  YYYNT T+++TW KP
Sbjct: 4  WKAAKDPKGRIYYYNTVTKKSTWEKP 29

 Score = 32.7 bits (73), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 14/33 (42%), Positives = 20/33 (60%)

Query: 9  WKEYTAPNGLKYYYNTKTQETTWTKPDTEQKDE 41
          WK     +G  YYYN KT+E+ WT P   +++E
Sbjct: 43 WKTGKTKDGKTYYYNVKTRESRWTLPPEMKQEE 75

>Suva_11.216 Chr11 (402394..404151) [1758 bp, 585 aa] {ON} YKL012W
          (REAL)
          Length = 585

 Score = 34.3 bits (77), Expect = 0.57,   Method: Compositional matrix adjust.
 Identities = 24/79 (30%), Positives = 35/79 (44%), Gaps = 15/79 (18%)

Query: 9  WKEYTAPNGLKYYYNTKTQETTWTKPD--TEQKDETADKEIEIKPLVAFELLAGWALIIF 66
          WKE    NG  YYYNT T+++ W KP+    Q+++   +              GW     
Sbjct: 4  WKEAKDANGRVYYYNTLTKKSIWEKPEELVSQQEQLLQEN-------------GWKAAKT 50

Query: 67 SDGSKKYYNCNESQWSRKI 85
          ++G   YYN +  Q S  I
Sbjct: 51 AEGKIYYYNPSTRQTSWTI 69

 Score = 32.7 bits (73), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 51/217 (23%), Positives = 99/217 (45%), Gaps = 45/217 (20%)

Query: 172 EPAKRDEQAVVEEPDE-TNTLEVPDITQELGQDIKDSYFALFAKHELNKYSTW---RIES 227
           E  K  EQA  EE  E  N  ++ ++T+   ++ +  +  +   ++++  STW   RI S
Sbjct: 102 EKKKALEQAAKEEESEYANNSKLLNVTRRTKEEAEKEFITMLENNQVD--STWSFSRIIS 159

Query: 228 EKVSQDPEFYKIIDDAV-RENIFEEWCNAGSVESNEESGDPGDDQFEPTKYH--YLSQLV 284
           E  ++DP ++ + DD + ++ +FE++       SN  +     +  E +K+   +L  L 
Sbjct: 160 ELGTKDPRYWMVDDDPLWKKEMFEKYL------SNRSADQLLKEHNETSKFKDAFLKMLQ 213

Query: 285 ANYDLKPDTIPEXXXXXXXXXXXXXXXXYTTKSEQRQFLSKMLAWYKHMSLED--RKQMF 342
            N  +K                      YT  S  ++ ++     YKH  + +  ++Q F
Sbjct: 214 NNSHIK---------------------YYTRWSTAKRLIADE-PIYKHSVVNEKTKRQTF 251

Query: 343 QTYIDRIPVGKYTDIDSDAQEDVESQ-LLELENQLGI 378
           Q YID +     T+ + +++E ++ Q L+EL   L I
Sbjct: 252 QEYIDTL-----TNTERESKEKLKEQALVELREYLNI 283

 Score = 31.6 bits (70), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 17/42 (40%), Positives = 23/42 (54%), Gaps = 1/42 (2%)

Query: 9  WKEYTAPNGLKYYYNTKTQETTWTKPDTEQK-DETADKEIEI 49
          WK      G  YYYN  T++T+WT P  ++K    A KE E+
Sbjct: 45 WKAAKTAEGKIYYYNPSTRQTSWTIPAFDKKTGPIAKKEPEV 86

>KLLA0E18239g Chr5 (1627093..1628808) [1716 bp, 571 aa] {ON}
          similar to uniprot|P33203 Saccharomyces cerevisiae
          YKL012W PRP40 U1 snRNP protein involved in splicing
          interacts with the branchpoint-binding protein during
          the formation of the second commitment complex
          Length = 571

 Score = 34.3 bits (77), Expect = 0.63,   Method: Compositional matrix adjust.
 Identities = 27/76 (35%), Positives = 33/76 (43%), Gaps = 14/76 (18%)

Query: 9  WKEYTAPNGLKYYYNTKTQETTWTKPDTEQKDETADKEIEIKPLVAFELLAGWALIIFSD 68
          W+E   P G  YYYN  T +TTW KP      E    E E K L       GW   +  D
Sbjct: 3  WQETKDPQGRVYYYND-TGQTTWEKP------EELFTEFERKLLK-----YGWKTALAED 50

Query: 69 GSKKYY--NCNESQWS 82
          G   YY  +  E+ W+
Sbjct: 51 GRVYYYKSDTGETTWN 66

 Score = 33.5 bits (75), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 17/42 (40%), Positives = 21/42 (50%)

Query: 9  WKEYTAPNGLKYYYNTKTQETTWTKPDTEQKDETADKEIEIK 50
          WK   A +G  YYY + T ETTW  P  E  D   ++ I  K
Sbjct: 43 WKTALAEDGRVYYYKSDTGETTWNVPVFENDDNRDERSIPTK 84

>KLTH0C00924g Chr3 (90830..92524) [1695 bp, 564 aa] {ON} similar
          to uniprot|P33203 Saccharomyces cerevisiae YKL012W
          PRP40 U1 snRNP protein involved in splicing interacts
          with the branchpoint-binding protein during the
          formation of the second commitment complex
          Length = 564

 Score = 32.7 bits (73), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 14/26 (53%), Positives = 15/26 (57%)

Query: 9  WKEYTAPNGLKYYYNTKTQETTWTKP 34
          WKE     G  YYYN  + ETTW KP
Sbjct: 4  WKEANDAEGRVYYYNADSGETTWDKP 29

>NCAS0E04130 Chr5 (812614..814329) [1716 bp, 571 aa] {ON} Anc_5.16
           YGR278W
          Length = 571

 Score = 32.3 bits (72), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 26/116 (22%), Positives = 51/116 (43%), Gaps = 1/116 (0%)

Query: 114 CRTNAKDLVNEIREDIDFIREDMNAAKTSEDMKSGSTVNNLENTKNALLGYYSSDDEEEP 173
           C  N KD +  + ++ +  + D+       DMK  +  ++LE  K   L   SS   +E 
Sbjct: 254 CYQNVKDRITLLNKEAEKEKADITQKNVLSDMKDMTATDDLEFKKKIYLLLKSSLSGDEA 313

Query: 174 AKRDEQAVVEEPDETNTLEVPDITQELGQDIKDSYFALFAKHELNKYSTWRIESEK 229
           A +  +  + + D+   ++V  I   L +     ++ L ++  L  + +WR   EK
Sbjct: 314 AHKILKLRIPDDDKWKIVDVI-IKSSLQESTYSKFYGLLSERLLTSHKSWRGSFEK 368

>CAGL0M01210g Chr13 complement(137725..138729) [1005 bp, 334 aa]
           {ON} similar to uniprot|P38803 Saccharomyces cerevisiae
           YHR085w
          Length = 334

 Score = 31.6 bits (70), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 27/98 (27%), Positives = 44/98 (44%), Gaps = 12/98 (12%)

Query: 323 LSKMLAWYKHMSLEDRKQMFQTYIDRIP-----------VGKYTDIDSDAQEDVESQLLE 371
           L K L   KH + + RK+    YI  IP           + + + +  D  +DV  QLLE
Sbjct: 55  LRKRLPLLKHHNDKVRKETLGIYIKAIPKIISTQLMTPLISQTSQLICDDSKDVREQLLE 114

Query: 372 LENQLGIPTSENDLEYYCIDLRSKRDILLSTIRNRVNG 409
           L +++G    E  L+ +C  L    ++ ++ I  RV  
Sbjct: 115 LFDEVG-KHDEQVLKLHCRSLVLYINMGMTHILPRVQA 151

>Ecym_8394 Chr8 (808813..811338) [2526 bp, 841 aa] {ON} similar to
           Ashbya gossypii ADL055C
          Length = 841

 Score = 32.0 bits (71), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 20/80 (25%), Positives = 39/80 (48%), Gaps = 8/80 (10%)

Query: 9   WKEYTAPNGLKYYYNTKTQETTWTKPDTEQKDET---ADKEIEIKPLVAF-ELLAGWALI 64
           W++   P G  Y+ +  T+ TTW  P  +Q   T   A+  I+ +P+     L +GW + 
Sbjct: 369 WEQRFTPEGRAYFVDHNTRTTTWVDPRRQQYIRTYGPANNTIQQQPVSQLGPLPSGWEMR 428

Query: 65  IFSDGSKKYY---NCNESQW 81
           + ++ ++ Y+   N   + W
Sbjct: 429 L-TNTARVYFVDHNTKTTTW 447

>KLTH0E06908g Chr5 complement(634745..637120) [2376 bp, 791 aa] {ON}
           highly similar to uniprot|P39940 Saccharomyces
           cerevisiae YER125W RSP5 Ubiquitin-protein ligase
           involved in ubiquitin-mediated protein degradation plays
           a role in heat shock element (HSE)-mediated gene
           expression and multivesicular body sorting contains a
           hect (homologous to E6-AP carboxyl terminus) domain
          Length = 791

 Score = 31.2 bits (69), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 20/80 (25%), Positives = 39/80 (48%), Gaps = 8/80 (10%)

Query: 9   WKEYTAPNGLKYYYNTKTQETTWTKPDTEQKDET---ADKEIEIKPLVAF-ELLAGWALI 64
           W++   P G  Y+ +  T+ TTW  P  +Q   T   A+  I+ +P+     L +GW + 
Sbjct: 319 WEQRFTPEGRAYFVDHNTRTTTWVDPRRQQYIRTYGPANTTIQQQPVSQLGPLPSGWEMR 378

Query: 65  IFSDGSKKYY---NCNESQW 81
           + ++ ++ Y+   N   + W
Sbjct: 379 L-TNTARVYFVDHNTKTTTW 397

>Kwal_47.17302 s47 complement(342098..344461) [2364 bp, 787 aa] {ON}
           YER125W (RSP5) - Rsp5p encodes a hect (homologous to
           E6-AP C terminus) and encodes a ubiquitin-protein ligase
           (E3 enzyme) [contig 210] FULL
          Length = 787

 Score = 31.2 bits (69), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 20/80 (25%), Positives = 39/80 (48%), Gaps = 8/80 (10%)

Query: 9   WKEYTAPNGLKYYYNTKTQETTWTKPDTEQKDET---ADKEIEIKPLVAF-ELLAGWALI 64
           W++   P G  Y+ +  T+ TTW  P  +Q   T   A+  I+ +P+     L +GW + 
Sbjct: 315 WEQRFTPEGRAYFVDHNTRTTTWVDPRRQQYIRTYGPANTTIQQQPVSQLGPLPSGWEMR 374

Query: 65  IFSDGSKKYY---NCNESQW 81
           + ++ ++ Y+   N   + W
Sbjct: 375 L-TNTARVYFVDHNTKTTTW 393

>TPHA0D02460 Chr4 (507413..508633) [1221 bp, 406 aa] {ON} Anc_5.546
           YML015C
          Length = 406

 Score = 30.8 bits (68), Expect = 7.0,   Method: Compositional matrix adjust.
 Identities = 28/97 (28%), Positives = 49/97 (50%), Gaps = 9/97 (9%)

Query: 144 DMKSGSTVNNLENTKNALLGYYSSDDE-EEPAKRDEQAV-----VEEPDETNTLEVPDIT 197
           +M++G T+N+   T N  L Y ++D+E  EP K+  + +      +EPDE    EVP   
Sbjct: 53  EMRTGGTLNSFFATGNYKLNYKNNDEENSEPEKKRRKIIYNNGKAQEPDEL-INEVPG-N 110

Query: 198 QELGQDIKDSYFA-LFAKHELNKYSTWRIESEKVSQD 233
            +  +DI+D     L   H L++   +R+    + +D
Sbjct: 111 IKFAKDIRDEKAKELVFSHVLDQNEQFRLLVNNLDED 147

>TDEL0F00990 Chr6 complement(173710..176079) [2370 bp, 789 aa] {ON}
           Anc_8.134 YER125W
          Length = 789

 Score = 30.8 bits (68), Expect = 7.1,   Method: Compositional matrix adjust.
 Identities = 20/80 (25%), Positives = 38/80 (47%), Gaps = 8/80 (10%)

Query: 9   WKEYTAPNGLKYYYNTKTQETTWTKPDTEQKDET---ADKEIEIKPLVAF-ELLAGWALI 64
           W++   P G  Y+ +  T+ TTW  P  +Q   T   A   I+ +P+     L +GW + 
Sbjct: 317 WEQRFTPEGRAYFVDHNTRTTTWVDPRRQQYIRTYGPASTTIQQQPVSQLGPLPSGWEMR 376

Query: 65  IFSDGSKKYY---NCNESQW 81
           + ++ ++ Y+   N   + W
Sbjct: 377 L-TNTARVYFVDHNTKTTTW 395

>TDEL0D05830 Chr4 (1054309..1059168) [4860 bp, 1619 aa] {ON}
           Anc_3.515 YGL206C
          Length = 1619

 Score = 30.8 bits (68), Expect = 7.5,   Method: Compositional matrix adjust.
 Identities = 20/60 (33%), Positives = 29/60 (48%), Gaps = 12/60 (20%)

Query: 208 YFA-LFAKHELNKYSTWRIESEKVSQDPEFYKIIDDAVRENIFEEWCNAGSVESNEESGD 266
           YF+ L  K +LNKY T  +    + QD           R+ +FE+W     +E +EE GD
Sbjct: 420 YFSTLLDKGKLNKYETIELAKPVLQQD-----------RKQLFEKWLKEDKLECSEELGD 468

>Kwal_47.19023 s47 (1064313..1069286) [4974 bp, 1657 aa] {ON}
           YGL206C (CHC1) - presumed vesicle coat protein [contig
           188] FULL
          Length = 1657

 Score = 30.8 bits (68), Expect = 7.8,   Method: Compositional matrix adjust.
 Identities = 20/60 (33%), Positives = 29/60 (48%), Gaps = 12/60 (20%)

Query: 208 YFA-LFAKHELNKYSTWRIESEKVSQDPEFYKIIDDAVRENIFEEWCNAGSVESNEESGD 266
           YF+ L  K +LNKY T  +    + QD           R+ +FE+W     +E +EE GD
Sbjct: 419 YFSTLLDKGKLNKYETIELAKPVLQQD-----------RKQLFEKWLKEDKLECSEELGD 467

>KLTH0G01892g Chr7 complement(142143..147116) [4974 bp, 1657 aa]
           {ON} highly similar to uniprot|P22137 Saccharomyces
           cerevisiae YGL206C CHC1 vesicle coat protein presumed
           vesicle coat protein
          Length = 1657

 Score = 30.8 bits (68), Expect = 8.1,   Method: Compositional matrix adjust.
 Identities = 20/60 (33%), Positives = 29/60 (48%), Gaps = 12/60 (20%)

Query: 208 YFA-LFAKHELNKYSTWRIESEKVSQDPEFYKIIDDAVRENIFEEWCNAGSVESNEESGD 266
           YF+ L  K +LNKY T  +    + QD           R+ +FE+W     +E +EE GD
Sbjct: 419 YFSTLLDKGKLNKYETIELARPVLQQD-----------RKQLFEKWLKEDKLECSEELGD 467

>SAKL0F02046g Chr6 complement(172863..177842) [4980 bp, 1659 aa]
           {ON} highly similar to uniprot|P22137 Saccharomyces
           cerevisiae YGL206C CHC1 vesicle coat protein presumed
           vesicle coat protein
          Length = 1659

 Score = 30.8 bits (68), Expect = 8.1,   Method: Compositional matrix adjust.
 Identities = 20/60 (33%), Positives = 29/60 (48%), Gaps = 12/60 (20%)

Query: 208 YFA-LFAKHELNKYSTWRIESEKVSQDPEFYKIIDDAVRENIFEEWCNAGSVESNEESGD 266
           YF+ L  K +LNKY T  +    + QD           R+ +FE+W     +E +EE GD
Sbjct: 421 YFSTLLDKGKLNKYETVELARPVLQQD-----------RKQLFEKWLKEDKLECSEELGD 469

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.311    0.130    0.376 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 44,680,712
Number of extensions: 2008654
Number of successful extensions: 8533
Number of sequences better than 10.0: 136
Number of HSP's gapped: 8781
Number of HSP's successfully gapped: 167
Length of query: 410
Length of database: 53,481,399
Length adjustment: 112
Effective length of query: 298
Effective length of database: 40,638,807
Effective search space: 12110364486
Effective search space used: 12110364486
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.8 bits)
S2: 67 (30.4 bits)