Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
CAGL0L07634g6.20ON1130113059380.0
Skud_13.1526.20ON1090108416800.0
Smik_13.1576.20ON1090108616470.0
Suva_13.1606.20ON1090108616320.0
TDEL0G044906.20ON1093111516320.0
ZYRO0C07810g6.20ON1099109115980.0
Sklu_YGOB_Anc_6.20b6.20ON1088111314740.0
Kpol_1037.256.20ON1105109013371e-165
KNAG0M011606.20ON1131116213081e-160
ACR006C6.20ON1071111312731e-156
YML002W6.20ON73772212441e-156
Sklu_YGOB_Anc_6.20singletonOFF84988811911e-147
NCAS0H008206.20ON1146112712061e-145
TPHA0J003306.20ON1107111411961e-144
Ecym_30246.20ON1079111411871e-143
KLTH0C11242g6.20ON1097111211751e-141
Kwal_56.224246.20ON1089109711431e-137
KLLA0D01133g6.20ON1067112910391e-122
NDAI0D008006.20ON119312059741e-112
TBLA0A072606.20ON120411778414e-94
KAFR0L004006.20ON9428376992e-76
YML003WsingletonOFF2902923622e-37
TDEL0A067806.265ON20071771.1
TBLA0A040908.346ON72760772.3
Ecym_25953.565ON170116732.7
KLLA0E20285g7.388ON24972752.8
YBR098W (MMS4)3.341ON691117737.1
NCAS0B022808.520ON183478728.3
TBLA0H014008.284ON42144718.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0L07634g
         (1130 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0L07634g Chr12 complement(840409..843801) [3393 bp, 1130 aa]...  2291   0.0  
Skud_13.152 Chr13 (249372..252644) [3273 bp, 1090 aa] {ON} YML00...   651   0.0  
Smik_13.157 Chr13 (254644..257916) [3273 bp, 1090 aa] {ON} YML00...   639   0.0  
Suva_13.160 Chr13 (253437..256709) [3273 bp, 1090 aa] {ON} YML00...   633   0.0  
TDEL0G04490 Chr7 complement(814781..818062) [3282 bp, 1093 aa] {...   633   0.0  
ZYRO0C07810g Chr3 complement(591035..594334) [3300 bp, 1099 aa] ...   620   0.0  
Sklu_YGOB_Anc_6.20b Chr5 (89924..92470,92474..93193) [3267 bp, 1...   572   0.0  
Kpol_1037.25 s1037 (56141..59458) [3318 bp, 1105 aa] {ON} (56141...   519   e-165
KNAG0M01160 Chr13 (207940..211335) [3396 bp, 1131 aa] {ON} Anc_6...   508   e-160
ACR006C Chr3 complement(364436..367651) [3216 bp, 1071 aa] {ON} ...   494   e-156
YML002W Chr13 (264541..266754) [2214 bp, 737 aa] {ON} Putative p...   483   e-156
Sklu_YGOB_Anc_6.20 Chr5 (89924..92473) [2550 bp, 849 aa] {OFF} A...   463   e-147
NCAS0H00820 Chr8 (148184..151624) [3441 bp, 1146 aa] {ON} Anc_6....   469   e-145
TPHA0J00330 Chr10 (72684..76007) [3324 bp, 1107 aa] {ON} Anc_6.2...   465   e-144
Ecym_3024 Chr3 (46949..50188) [3240 bp, 1079 aa] {ON} similar to...   461   e-143
KLTH0C11242g Chr3 complement(921970..925263) [3294 bp, 1097 aa] ...   457   e-141
Kwal_56.22424 s56 (121475..124744) [3270 bp, 1089 aa] {ON} YML00...   444   e-137
KLLA0D01133g Chr4 (101580..104783) [3204 bp, 1067 aa] {ON} some ...   404   e-122
NDAI0D00800 Chr4 (177862..181443) [3582 bp, 1193 aa] {ON} Anc_6....   379   e-112
TBLA0A07260 Chr1 (1807831..1811445) [3615 bp, 1204 aa] {ON} Anc_...   328   4e-94
KAFR0L00400 Chr12 (72520..75348) [2829 bp, 942 aa] {ON} Anc_6.20...   273   2e-76
YML003W Chr13 (263483..264355) [873 bp, 290 aa] {OFF} Putative p...   144   2e-37
TDEL0A06780 Chr1 complement(1182697..1183299) [603 bp, 200 aa] {...    34   1.1  
TBLA0A04090 Chr1 complement(1014784..1016967) [2184 bp, 727 aa] ...    34   2.3  
Ecym_2595 Chr2 (1158968..1159480) [513 bp, 170 aa] {ON} similar ...    33   2.7  
KLLA0E20285g Chr5 (1803791..1804540) [750 bp, 249 aa] {ON} simil...    33   2.8  
YBR098W Chr2 (441515..443590) [2076 bp, 691 aa] {ON}  MMS4Subuni...    33   7.1  
NCAS0B02280 Chr2 complement(377630..383134) [5505 bp, 1834 aa] {...    32   8.3  
TBLA0H01400 Chr8 (312727..313992) [1266 bp, 421 aa] {ON} Anc_8.2...    32   8.8  

>CAGL0L07634g Chr12 complement(840409..843801) [3393 bp, 1130 aa] {ON}
            some similarities with uniprot|Q04257 Saccharomyces
            cerevisiae YML002w and some similarities with
            uniprot|Q04257 Saccharomyces cerevisiae YML003w
          Length = 1130

 Score = 2291 bits (5938), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1120/1130 (99%), Positives = 1120/1130 (99%)

Query: 1    MTTHSNFQXXXXXXXXXXAICNCGEPNSSPLKKLYTQLGKKDKYLILVPPTELLLYYSDK 60
            MTTHSNFQ          AICNCGEPNSSPLKKLYTQLGKKDKYLILVPPTELLLYYSDK
Sbjct: 1    MTTHSNFQLPPLLNPLLNAICNCGEPNSSPLKKLYTQLGKKDKYLILVPPTELLLYYSDK 60

Query: 61   ESNSELHDLCYTPNFASAHILLLDATDTEVNNGDEAVLIKNIEKRYDVHFIKAMDQSWKF 120
            ESNSELHDLCYTPNFASAHILLLDATDTEVNNGDEAVLIKNIEKRYDVHFIKAMDQSWKF
Sbjct: 61   ESNSELHDLCYTPNFASAHILLLDATDTEVNNGDEAVLIKNIEKRYDVHFIKAMDQSWKF 120

Query: 121  INWKNRVIYEFNKLGDQIKNRAKILDIESIPIFNNYMKTTDNTITIMYIDDVFLNGTLEC 180
            INWKNRVIYEFNKLGDQIKNRAKILDIESIPIFNNYMKTTDNTITIMYIDDVFLNGTLEC
Sbjct: 121  INWKNRVIYEFNKLGDQIKNRAKILDIESIPIFNNYMKTTDNTITIMYIDDVFLNGTLEC 180

Query: 181  NLRSDIDLLRSPSMRSIPTAKRPSLINKKSTDYENSKSKATFDSILRVNKHWSSKFEQHF 240
            NLRSDIDLLRSPSMRSIPTAKRPSLINKKSTDYENSKSKATFDSILRVNKHWSSKFEQHF
Sbjct: 181  NLRSDIDLLRSPSMRSIPTAKRPSLINKKSTDYENSKSKATFDSILRVNKHWSSKFEQHF 240

Query: 241  QKFRLLANQDDLPIDVFHNIIEEMHEEMVSDNLFKNIVDLRNIIYEYVELNLFDDIWKMI 300
            QKFRLLANQDDLPIDVFHNIIEEMHEEMVSDNLFKNIVDLRNIIYEYVELNLFDDIWKMI
Sbjct: 241  QKFRLLANQDDLPIDVFHNIIEEMHEEMVSDNLFKNIVDLRNIIYEYVELNLFDDIWKMI 300

Query: 301  LRMNKEVEIDLNPFGNISIYQVDSEFLSTEYSKFFLENVITAERNIKEASKSLQKIESAS 360
            LRMNKEVEIDLNPFGNISIYQVDSEFLSTEYSKFFLENVITAERNIKEASKSLQKIESAS
Sbjct: 301  LRMNKEVEIDLNPFGNISIYQVDSEFLSTEYSKFFLENVITAERNIKEASKSLQKIESAS 360

Query: 361  NYKSKANILILTLRTLTGNKENDGYSSKNDDGNLSFFPLAIDADRLMNLFVLVTCRAQIK 420
            NYKSKANILILTLRTLTGNKENDGYSSKNDDGNLSFFPLAIDADRLMNLFVLVTCRAQIK
Sbjct: 361  NYKSKANILILTLRTLTGNKENDGYSSKNDDGNLSFFPLAIDADRLMNLFVLVTCRAQIK 420

Query: 421  NLKCHLSYLQNFYNNDSDTKFGILGYALSTLEAVVCYFEQLKEKENYRKLIDFCNSNERL 480
            NLKCHLSYLQNFYNNDSDTKFGILGYALSTLEAVVCYFEQLKEKENYRKLIDFCNSNERL
Sbjct: 421  NLKCHLSYLQNFYNNDSDTKFGILGYALSTLEAVVCYFEQLKEKENYRKLIDFCNSNERL 480

Query: 481  VKVLSSTKKYETNAALYFLRKYEGSLRYRDSLGQSLLALCIIHGRNDFLYHILNEYETLF 540
            VKVLSSTKKYETNAALYFLRKYEGSLRYRDSLGQSLLALCIIHGRNDFLYHILNEYETLF
Sbjct: 481  VKVLSSTKKYETNAALYFLRKYEGSLRYRDSLGQSLLALCIIHGRNDFLYHILNEYETLF 540

Query: 541  PIEDLLADESIDGSTLLIQAVKHDNQYSASLLLNILKDNCTEIELIAYINRHDINKRTAG 600
            PIEDLLADESIDGSTLLIQAVKHDNQYSASLLLNILKDNCTEIELIAYINRHDINKRTAG
Sbjct: 541  PIEDLLADESIDGSTLLIQAVKHDNQYSASLLLNILKDNCTEIELIAYINRHDINKRTAG 600

Query: 601  HFLTNELEVLKLMGKYINWVQKDNAGQTPLFTIFRSYDQDNYDEMVSQSMEYATNWYGLN 660
            HFLTNELEVLKLMGKYINWVQKDNAGQTPLFTIFRSYDQDNYDEMVSQSMEYATNWYGLN
Sbjct: 601  HFLTNELEVLKLMGKYINWVQKDNAGQTPLFTIFRSYDQDNYDEMVSQSMEYATNWYGLN 660

Query: 661  GKNFNYLDHVDKKGNTLLHILKCNLPILLADKHINVNATNRSGQTPLMTSIRYKRTENIR 720
            GKNFNYLDHVDKKGNTLLHILKCNLPILLADKHINVNATNRSGQTPLMTSIRYKRTENIR
Sbjct: 661  GKNFNYLDHVDKKGNTLLHILKCNLPILLADKHINVNATNRSGQTPLMTSIRYKRTENIR 720

Query: 721  DLLCDPRLRVDITQKNNALTAFDFSKDDEITHLLGEHELLNSPWLAVYAHTLKYTNSRWN 780
            DLLCDPRLRVDITQKNNALTAFDFSKDDEITHLLGEHELLNSPWLAVYAHTLKYTNSRWN
Sbjct: 721  DLLCDPRLRVDITQKNNALTAFDFSKDDEITHLLGEHELLNSPWLAVYAHTLKYTNSRWN 780

Query: 781  LSLTVKLKDAPKTTNFTLKTLRGILRVVIKNNMTVFLPVQELVEDLISFNRIRFSELMRI 840
            LSLTVKLKDAPKTTNFTLKTLRGILRVVIKNNMTVFLPVQELVEDLISFNRIRFSELMRI
Sbjct: 781  LSLTVKLKDAPKTTNFTLKTLRGILRVVIKNNMTVFLPVQELVEDLISFNRIRFSELMRI 840

Query: 841  KVLEMLPFISFCLSALVHIKVLDLNVFQTEENAIKWVKMNGSVDKKTNQTSDITPEDISM 900
            KVLEMLPFISFCLSALVHIKVLDLNVFQTEENAIKWVKMNGSVDKKTNQTSDITPEDISM
Sbjct: 841  KVLEMLPFISFCLSALVHIKVLDLNVFQTEENAIKWVKMNGSVDKKTNQTSDITPEDISM 900

Query: 901  IQNFLKFNITEIERTKNKLEIAEKLSLFSRLKSKDLLNSNENYVTIVSQLSSKRFRSTLK 960
            IQNFLKFNITEIERTKNKLEIAEKLSLFSRLKSKDLLNSNENYVTIVSQLSSKRFRSTLK
Sbjct: 901  IQNFLKFNITEIERTKNKLEIAEKLSLFSRLKSKDLLNSNENYVTIVSQLSSKRFRSTLK 960

Query: 961  YSAEDTKLLSVRAEKALLSKITYLKICAQKLHNHILSITTTMISNWWHIYGELLNAHKHY 1020
            YSAEDTKLLSVRAEKALLSKITYLKICAQKLHNHILSITTTMISNWWHIYGELLNAHKHY
Sbjct: 961  YSAEDTKLLSVRAEKALLSKITYLKICAQKLHNHILSITTTMISNWWHIYGELLNAHKHY 1020

Query: 1021 TRAFPELANVTTENRDLALHRMISNPKRIKLEERLSEKIKDITEQLNSVGHDIKQMHELA 1080
            TRAFPELANVTTENRDLALHRMISNPKRIKLEERLSEKIKDITEQLNSVGHDIKQMHELA
Sbjct: 1021 TRAFPELANVTTENRDLALHRMISNPKRIKLEERLSEKIKDITEQLNSVGHDIKQMHELA 1080

Query: 1081 AEEVSRFIDLKTKFTLEYALQSYLTISKQEHIEKDRLHWEFQENKTVFKQ 1130
            AEEVSRFIDLKTKFTLEYALQSYLTISKQEHIEKDRLHWEFQENKTVFKQ
Sbjct: 1081 AEEVSRFIDLKTKFTLEYALQSYLTISKQEHIEKDRLHWEFQENKTVFKQ 1130

>Skud_13.152 Chr13 (249372..252644) [3273 bp, 1090 aa] {ON} YML002W
            (REAL)
          Length = 1090

 Score =  651 bits (1680), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 393/1084 (36%), Positives = 619/1084 (57%), Gaps = 44/1084 (4%)

Query: 19   AICNCGEPNSSPLKKLYTQLGKKDKYLILVPPTELLLYYSDKESNSELHDLCYTPNFASA 78
            AI NC EP  SPLKKL+  L K  ++++L PP   LL Y D ++   LH+LCY  +F ++
Sbjct: 16   AIFNCPEPEKSPLKKLFANL-KTRRFILLAPPLRFLLNYHDVKTKLPLHELCYNVDFINS 74

Query: 79   HILLLDATDTEVNNGDEAVLIKNIEKRYDVHFIKAMDQSWKFINWKNRVIYEFNKLGDQI 138
            HILL     T  N+     L        D H+ + +D     I WKN +I+  N  G  I
Sbjct: 75   HILL-----TTENSYLNTTL-------RDSHY-ETLDGKAVVIQWKNNIIHALN--GFPI 119

Query: 139  KNRAKILDIESIPIFNNYMKTTDNTITIMYIDDVFLNGTLECNLRSDIDLLRSPSMRSIP 198
            + R KIL+ + +P FN+Y +   +   I++ID       L C +  +  L    S   +P
Sbjct: 120  RQRLKILETKVLPNFNDYFEGAAD-FAILFIDQ-----PLNCEVAPNDYLKCFDSYEEVP 173

Query: 199  TAKRPSLINKKSTDYENSKSKATFDSILRVNKHWSSKFEQHFQKFRLLANQDDLPIDVFH 258
               + S+ N     YE  +S  +FD+IL ++    ++  Q F  +R LA  DD    +F 
Sbjct: 174  KNAQ-SVSNLPVNSYEQERS--SFDNILHIHSARLAQLGQLFSNYRRLAPNDDPSKKMFE 230

Query: 259  NIIEEMHEEMVSDNLFKNIVDLRNIIYEYVELNLFDDIWKMILRMNKEVEIDLNPFGNIS 318
            +I+++  + M SD+LFKN  +L ++I++Y ELNL+DDIW  ++   K  E+D   +   S
Sbjct: 231  DIVQQSFDGMKSDSLFKNFSNLYDLIHDYFELNLYDDIWSRLVTHFKGYEVDTEKYKYFS 290

Query: 319  IYQVDSEFLSTEYSKFFLENVITAERNIKEASKSLQKIESASNYKSKANILILTLRTLTG 378
            + Q+ ++F S ++ +F L ++   ER +  ASK  QK+    +Y  K+ IL+ TL+ L+G
Sbjct: 291  VNQLLADFFSKDFKEFKLSDITFIERRVNVASKHFQKLTLTHSYAEKSKILVETLQQLSG 350

Query: 379  NKENDGYSSKNDDGNLSFFPLAIDADRLMNLFVLVTCRAQIKNLKCHLSYLQNFYNNDSD 438
              E   +  +  +G  S   L +DAD L++LFVLV CR++ K+LK HL YLQNF NN S 
Sbjct: 351  PTEISSHQQELPNGLNS---LTMDADTLLSLFVLVVCRSEQKHLKSHLYYLQNFSNNPSS 407

Query: 439  TKFGILGYALSTLEAVVCYFEQL-KEKENYRKL-IDFCNSNERLVKVLSSTKKYETNAAL 496
            TKFGILGYA+STLEAVVCYFE   K  EN  K  + +  + E L K+ S     E     
Sbjct: 408  TKFGILGYAISTLEAVVCYFEDFDKNNENLAKANVSYQKTRELLDKLSSENPTNEIEN-- 465

Query: 497  YFLRKYEGSLRYRDSLGQSLLALCIIHGRNDFLYHILNEYETLFPIEDLLADESIDGSTL 556
              L  YE +L+YR+  GQS+L++CI + +N  L  +L EYE LFP+ED+L DE++DGSTL
Sbjct: 466  --LATYEDNLQYRNEQGQSILSICITNTKNCILLDVLTEYEDLFPMEDILEDETLDGSTL 523

Query: 557  LIQAVKHDNQYSASLLLNILKDNCTEIELIAYINRHDINKRTAGHFLTNELEVLKLMGKY 616
            LI+++K  N  +A +L+ I+  NC+E EL++Y+N+ D   RT  H+LT+E+++LK +G Y
Sbjct: 524  LIESIKTGNIEAAKILIGIMLLNCSEGELVSYVNKADKYARTVAHYLTHEMDILKSIGSY 583

Query: 617  INWVQKDNAGQTPLFTIFRSYDQDNYDEMVSQSMEYATNWYGLNGKNFNYLDHVDKKGNT 676
            ++W +K+++GQTPLF+IFR+YDQ NY+EMV  +   A +WY  +  +F+YLDH D KGN+
Sbjct: 584  VDWKRKNSSGQTPLFSIFRTYDQPNYEEMVKIAFNIANSWYQKHNSSFDYLDHTDSKGNS 643

Query: 677  LLHILKCNLPILLADKHINVNATNRSGQTPLMTSIRYKRTENIRDLLCDPRLRVDITQKN 736
            LLHILK ++ ILL    +++N  N  G TPLM  ++YKR  NI  +  D RL ++  Q +
Sbjct: 644  LLHILKSDVSILLQLSKLDINGRNYKGLTPLMIYVKYKRISNIDAITKDSRLILEKVQNS 703

Query: 737  NALTAFDFSKDDEITHLLGEHELLNSPWLAVYAHTLKYTNSRWNLSLTVKLK-DAP-KTT 794
               T FD++KD  +   +GE    +S +  VY H+L+Y N     ++T     D P  TT
Sbjct: 704  TFFTCFDYAKDHSVLSKIGERGARDSLFGLVYLHSLRYHNLNATTNITTASNTDKPFLTT 763

Query: 795  NFTLKTLRGILRVVIKNNMTVFLPVQELVEDLISFNRIRFSELMRIKVLEMLPFISFCLS 854
               +KT++G+LR ++K+N   FLP+   ++++   NR   + + +  V  +L  ++ C +
Sbjct: 764  VINMKTIQGLLRSILKDNQFTFLPLNSYIDEISHLNRSDLTIIGKADVRSLLHKLTNCFN 823

Query: 855  ALVHIKVLDLNVFQTEENAIKWVKMNGSVDKKTNQTSD----ITPEDISMIQNFLKFNIT 910
             L+ +K +  N+F  E + + W+++N S   +   + D    + PE+I+MIQ+FL+FN  
Sbjct: 824  VLLFLKKVPQNLFTDEASVLYWMRINTSKRNQKPPSKDNPKTMEPEEINMIQSFLRFNFD 883

Query: 911  EIERTKNKLEIAEKLSLFSRLKSKDLLNSNENYVTIVSQLSSKRFRSTLKYSAEDTKLLS 970
            EI   K  L I  K+ +F  LKS D  ++ ++   +  ++ +            +  + S
Sbjct: 884  EISSFKASLNILRKILIFLSLKSNDFEDTYDSLREMGRKIINGEAADAFARIFTNHNMFS 943

Query: 971  VRAEKALLSKITYLKICAQKLHNHILSITTTMISNWWHIYGELLNAHKHYTRAFPELA-- 1028
              A   LL  +++L+ C  +L   + +I    I+ WW  YGE L   K+Y +AFP +   
Sbjct: 944  DLALAELLEHVSFLEQCTIQLSTFVQTILFDKITKWWKHYGEFLALQKNYRKAFPSVVKP 1003

Query: 1029 -NVTTENRDLALHRMISNPKRIKLEERLSEKIKDITEQLNSVGHDIKQMHELAAEEVSRF 1087
             + T     + L   I   KR + E+RL+ +IK  ++ L  +G +I   HE  AEE+S +
Sbjct: 1004 KSATDTPSHIPLGSFIET-KREQSEQRLAVQIKASSKILKELGSEIFTAHEKLAEELSNY 1062

Query: 1088 IDLK 1091
            ++ +
Sbjct: 1063 MEFR 1066

>Smik_13.157 Chr13 (254644..257916) [3273 bp, 1090 aa] {ON} YML002W
            (REAL)
          Length = 1090

 Score =  639 bits (1647), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 392/1086 (36%), Positives = 621/1086 (57%), Gaps = 48/1086 (4%)

Query: 19   AICNCGEPNSSPLKKLYTQLGKKDKYLILVPPTELLLYYSDKESNSELHDLCYTPNFASA 78
            AI NC EP  SPLKKL+  L K  ++++L PP+E LL Y D ++   LH+LCY   F ++
Sbjct: 16   AIFNCPEPEKSPLKKLFATL-KTCRFILLAPPSEYLLNYHDVKTKLPLHELCYNAEFINS 74

Query: 79   HILLLDATDTEVNNGDEAVLIKNIEKRYDVHFIKAMDQSWKFINWKNRVIYEFNKLGDQI 138
            HILL+   ++ +N               D H+ + +D     I WKN VI+  N  G Q+
Sbjct: 75   HILLM-TENSFINTNSR-----------DSHY-ETLDGKTVVIQWKNNVIHALN--GFQV 119

Query: 139  KNRAKILDIESIPIFNNYMKTTDNTITIMYIDDVFLNGTLECNLRSDIDLLRSPSMRSIP 198
            + R KIL  + +P FN+Y +   + + I+YI+       L C    +  L    S + IP
Sbjct: 120  RRRLKILGTKILPNFNDYFEGATDFV-IIYIEQ-----PLSCESVPNDYLQCFHSYKKIP 173

Query: 199  TAKRPSLINKKSTDYENSKSKATFDSILRVNKHWSSKFEQHFQKFRLLANQDDLPIDVFH 258
              K    ++  S D  + + +++F++IL ++    ++  + F  +R LA  DD    +F 
Sbjct: 174  --KSVYSVHNLSLD-SSQQERSSFENILHIHPTRLTQLGEMFSNYRTLAPSDDPSEKIFE 230

Query: 259  NIIEEMHEEMVSDNLFKNIVDLRNIIYEYVELNLFDDIWKMILRMNKEVEIDLNPFGNIS 318
             I+++  E M SD+LFK   +L ++I+EY ELNL+DDIW  +    K  E+    +   S
Sbjct: 231  CIVQQAFEGMKSDSLFKKFPNLYDLIHEYFELNLYDDIWSRLTSHFKSYEVGTEEYKYFS 290

Query: 319  IYQVDSEFLSTEYSKFFLENVITAERNIKEASKSLQKIESASNYKSKANILILTLRTLTG 378
            I  + ++F S ++ +F L++V   E+ +  ASK  QK+    +Y  K+ IL+ TL+ L+G
Sbjct: 291  INHLLADFYSKDFREFKLQDVTFIEKRVHLASKHFQKLTLTHSYTEKSKILVETLQELSG 350

Query: 379  NKENDGYSSKNDDGNLSFFPLAIDADRLMNLFVLVTCRAQIKNLKCHLSYLQNFYNNDSD 438
              +  G    +  G L+   LA+DAD L++LFVLV CR++ K+LK HL YLQNF NN S 
Sbjct: 351  TTDM-GSHQLDVPGRLN--NLAMDADTLISLFVLVICRSEQKHLKSHLYYLQNFSNNSSS 407

Query: 439  TKFGILGYALSTLEAVVCYFEQLKE-KENYRKLIDFCNSNERLVKVLSS---TKKYETNA 494
            +KFGILGYA+STLEAVVCYFE  K+  +N  K        +RLV +LS    T K E   
Sbjct: 408  SKFGILGYAVSTLEAVVCYFEDFKKNSDNMAKANVLLQKTKRLVNMLSCENVTNKVEN-- 465

Query: 495  ALYFLRKYEGSLRYRDSLGQSLLALCIIHGRNDFLYHILNEYETLFPIEDLLADESIDGS 554
                L  Y+  L YR+  GQS+L++CI + +N  L  IL+EY+++FP+EDLL DE+IDGS
Sbjct: 466  ----LATYKDILPYRNGQGQSILSICISNNKNHILLDILSEYDSIFPLEDLLEDETIDGS 521

Query: 555  TLLIQAVKHDNQYSASLLLNILKDNCTEIELIAYINRHDINKRTAGHFLTNELEVLKLMG 614
            TLLI+++K  N  +A +L+ I+  NCTE ELI+YINR D   RT  H+LT+E+++LK +G
Sbjct: 522  TLLIESIKSGNLEAAKILIRIMMLNCTEEELISYINRTDKYSRTVAHYLTHEIDILKSIG 581

Query: 615  KYINWVQKDNAGQTPLFTIFRSYDQDNYDEMVSQSMEYATNWYGLNGKNFNYLDHVDKKG 674
             Y++W +K++ GQTPLF+IFRSYDQ NY+ MV  +   A  WY    ++F+Y DH D KG
Sbjct: 582  NYVDWKRKNSGGQTPLFSIFRSYDQPNYEAMVKIAFNIANTWYRKQNRSFDYRDHTDNKG 641

Query: 675  NTLLHILKCNLPILLADKHINVNATNRSGQTPLMTSIRYKRTENIRDLLCDPRLRVDITQ 734
            N LLH+LK +  ILL    +++N  N  G TPLM  ++YKR  NI  ++ D RL ++  Q
Sbjct: 642  NDLLHVLKTDASILLQLTKLDINGENYKGLTPLMVYVKYKRLNNIEAIIKDQRLVLEKIQ 701

Query: 735  KNNALTAFDFSKDDEITHLLGEHELLNSPWLAVYAHTLKY--TNSRWNLSLTVKLKDAPK 792
            K+   T FD++KD  +   +GE    +S +  +Y H+L+Y   N+  N++     +    
Sbjct: 702  KSTFFTCFDYAKDHTVLSKVGERGAKDSLFGLIYFHSLRYHNLNAAVNITFASDTEKPFS 761

Query: 793  TTNFTLKTLRGILRVVIKNNMTVFLPVQELVEDLISFNRIRFSELMRIKVLEMLPFISFC 852
             T   +KT++G+LR ++K+N   FLP+   ++++   +R   + + +  V+ +L  +S C
Sbjct: 762  NTVINMKTIQGLLRSILKDNPFTFLPLNIYIDEISQLSRSDVTIIGKADVMSLLHKLSNC 821

Query: 853  LSALVHIKVLDLNVFQTEENAIKWVKMNGSVDKKTNQTSD----ITPEDISMIQNFLKFN 908
             + L+ +K +  ++F  E + + W+++N S   +   + +    + PE+I+MIQ+FL+FN
Sbjct: 822  FNVLLFLKKVPKSLFTDEASILYWMRINTSKRNQKQPSKENYKTMEPEEINMIQSFLRFN 881

Query: 909  ITEIERTKNKLEIAEKLSLFSRLKSKDLLNSNENYVTIVSQLSSKRFRSTLKYSAEDTKL 968
              EI   K  L I  K+ +F  LKS D  + N+N   +   + + +       +  +  +
Sbjct: 882  FDEISSFKASLSILRKILIFISLKSNDFKDVNDNLNEMGKSIYNAKAADAFAGNLTNHNM 941

Query: 969  LSVRAEKALLSKITYLKICAQKLHNHILSITTTMISNWWHIYGELLNAHKHYTRAFPELA 1028
             +  +   LL  + +L+ C  +L N +  I    I NWW  YGEL+  HK+Y +AFP + 
Sbjct: 942  FNDYSLAKLLEHVRFLEECTIQLSNLVQLILLEKIPNWWKHYGELITLHKNYRKAFPSVV 1001

Query: 1029 ---NVTTENRDLALHRMISNPKRIKLEERLSEKIKDITEQLNSVGHDIKQMHELAAEEVS 1085
               + T  +  + L   I   KR + E+RL+ +IK  ++ L  +G +I   HE  AEE+S
Sbjct: 1002 KPKSTTDTSGHIQLGGFIET-KREQSEQRLAVQIKVSSKSLKELGSEIFVAHEKLAEELS 1060

Query: 1086 RFIDLK 1091
             +++ +
Sbjct: 1061 NYMEFR 1066

>Suva_13.160 Chr13 (253437..256709) [3273 bp, 1090 aa] {ON} YML002W
            (REAL)
          Length = 1090

 Score =  633 bits (1632), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 391/1086 (36%), Positives = 614/1086 (56%), Gaps = 48/1086 (4%)

Query: 19   AICNCGEPNSSPLKKLYTQLGKKDKYLILVPPTELLLYYSDKESNSELHDLCYTPNFASA 78
            AI NC EP  SPLKKL+  L  + ++++L PP+ LLL Y D ++   LH+LCY  +F ++
Sbjct: 16   AIFNCPEPEKSPLKKLFANLQTR-RFILLAPPSHLLLNYHDVKTKLPLHELCYNADFINS 74

Query: 79   HILLLDATDTEVNNGDEAVLIKNIEKRYDVHFIKAMDQSWKFINWKNRVIYEFNKLGDQI 138
            HILL     T  N+     L        D H+ + +D     + WKN VI+  N  G  +
Sbjct: 75   HILL-----TTENSYINTTL-------RDDHY-ETLDGKTVVVQWKNNVIHTLN--GFPL 119

Query: 139  KNRAKILDIESIPIFNNYMKTTDNTITIMYIDDVFLNGTLECNLRSD--IDLLRSPSMRS 196
            + R KILD + +P FN+Y K  +    I+YID       L C    +  +    S    S
Sbjct: 120  RRRLKILDTKILPNFNDYFKGAE-YFAILYIDQ-----PLGCEFVPNDYLHCFNSYEETS 173

Query: 197  IPTAKRPSLINKKSTDYENSKSKATFDSILRVNKHWSSKFEQHFQKFRLLANQDDLPIDV 256
                  P+L+   S        +++F++IL ++  W ++  Q F  +R  A  DD    +
Sbjct: 174  KTARNAPNLLMDTS-----QLERSSFENILHIHPAWLTQLGQLFSNYRRAALNDDPSKKM 228

Query: 257  FHNIIEEMHEEMVSDNLFKNIVDLRNIIYEYVELNLFDDIWKMILRMNKEVEIDLNPFGN 316
            F  ++E+  + M SD+LFKN  +L ++I++Y ELNL++DIW  +    K  E++      
Sbjct: 229  FEELVEQAFDGMKSDSLFKNFSNLYDLIHDYFELNLYEDIWSRLTIHFKGYEVNTENCEY 288

Query: 317  ISIYQVDSEFLSTEYSKFFLENVITAERNIKEASKSLQKIESASNYKSKANILILTLRTL 376
             S+ Q+ +++ S ++  F L ++   ER +  ASK  QK+  + +Y  K+ IL+ TL+ L
Sbjct: 289  FSVNQLLTDYYSKDFESFKLSDITFIERRVSVASKHFQKLALSHSYAEKSKILVETLQHL 348

Query: 377  TGNKENDGYSSKNDDGNLSFFPLAIDADRLMNLFVLVTCRAQIKNLKCHLSYLQNFYNND 436
            +G    D  S K D  N  F  L +DAD L++LFVLV CR++ K+++ HL YLQNF NN 
Sbjct: 349  SGT--TDMGSHKPDLSN-GFNNLTMDADTLISLFVLVVCRSEQKHIRSHLYYLQNFSNNS 405

Query: 437  SDTKFGILGYALSTLEAVVCYFEQLKEKENYRKLIDF-CNSNERLVKVLSSTKKY-ETNA 494
            S +KFGILGYA+STLEAVVCYFE   +  N     +  C     L+  LS      E N 
Sbjct: 406  SSSKFGILGYAISTLEAVVCYFENFNKNNNNVAKANLLCIKTRDLLDKLSCENPTNEVND 465

Query: 495  ALYFLRKYEGSLRYRDSLGQSLLALCIIHGRNDFLYHILNEYETLFPIEDLLADESIDGS 554
                L  Y+  L YR+  GQS+L+LCI + +ND L  +L+EYE LFPIED+L DE+IDGS
Sbjct: 466  ----LATYKDILAYRNEQGQSILSLCITNNKNDILLDVLSEYEALFPIEDILEDETIDGS 521

Query: 555  TLLIQAVKHDNQYSASLLLNILKDNCTEIELIAYINRHDINKRTAGHFLTNELEVLKLMG 614
            TLLI+++K  N  +  +L+ I+  NCT+ EL+ Y+N+ D   R+  H+LT+E+++LK +G
Sbjct: 522  TLLIESIKVGNLEATKILIRIMLFNCTDEELVTYVNKTDKYARSVAHYLTHEMDILKSIG 581

Query: 615  KYINWVQKDNAGQTPLFTIFRSYDQDNYDEMVSQSMEYATNWYGLNGKNFNYLDHVDKKG 674
             YINW QK+++GQTPLF+IFRSYDQ NY+EMV  +   A++WY  +  +F Y DH D KG
Sbjct: 582  SYINWKQKNSSGQTPLFSIFRSYDQPNYEEMVKVAFNIASSWYQRHNTSFGYSDHTDNKG 641

Query: 675  NTLLHILKCNLPILLADKHINVNATNRSGQTPLMTSIRYKRTENIRDLLCDPRLRVDITQ 734
            N+LLH+LK ++ ILL    +N+N  N  G TPLM  ++YKR  NI  +  D RL ++  Q
Sbjct: 642  NSLLHVLKTDVSILLQLTKLNINGENYKGLTPLMVYVKYKRLSNIDAITKDHRLILEKVQ 701

Query: 735  KNNALTAFDFSKDDEITHLLGEHELLNSPWLAVYAHTLKY--TNSRWNLSLTVKLKDAPK 792
             +   T FD++KD  +   +GE    +S +  +Y H+L+Y   N+  N++   K ++   
Sbjct: 702  NSTFFTCFDYAKDRLVLSKIGERGANDSIFGLIYLHSLRYHNLNATVNVTSVSKTEEPFV 761

Query: 793  TTNFTLKTLRGILRVVIKNNMTVFLPVQELVEDLISFNRIRFSELMRIKVLEMLPFISFC 852
            T    +KT++G+LR ++K+N   FLP+   ++ +   NR   + + +  V  +L  ++ C
Sbjct: 762  TAVINMKTIQGLLRSIVKDNPFTFLPIDNYIDGISHLNRSDLTIIGKADVRSLLHKLTNC 821

Query: 853  LSALVHIKVLDLNVFQTEENAIKWVKMNGSVDKKTNQTSD----ITPEDISMIQNFLKFN 908
             + L+ +K +  N+F  E + + W+++N S   +   + D    + PE+I+MIQ+FL+FN
Sbjct: 822  FNVLLFLKKVPQNLFTDEASVLYWMRINTSRRNQKPPSKDNPKTMEPEEINMIQSFLRFN 881

Query: 909  ITEIERTKNKLEIAEKLSLFSRLKSKDLLNSNENYVTIVSQLSSKRFRSTLKYSAEDTKL 968
              EI   K  L I  K+ +F  LKS D  ++  + + + +++++ +         ++ K+
Sbjct: 882  FDEILSFKASLNILRKILIFLSLKSSDFEDAYASLLKMGTKVTNGKAADAFTTIIKNHKM 941

Query: 969  LSVRAEKALLSKITYLKICAQKLHNHILSITTTMISNWWHIYGELLNAHKHYTRAFPELA 1028
             S  +   LL  + +L+ C  +L N I +I    I NWW  YGE L  HK+Y +AFP   
Sbjct: 942  FSDLSLDELLEHVQFLEECTIQLFNSIQTILFDRIPNWWKHYGEFLTLHKNYRKAFPSAV 1001

Query: 1029 ---NVTTENRDLALHRMISNPKRIKLEERLSEKIKDITEQLNSVGHDIKQMHELAAEEVS 1085
               +    +  + L   I   KR + E+RLS +IK  ++ L  +G +I   HE  AEE+S
Sbjct: 1002 KPKSTAGTSSHIPLGGFIET-KREQSEQRLSVQIKASSKILKELGSEIFSAHENLAEELS 1060

Query: 1086 RFIDLK 1091
             +++ +
Sbjct: 1061 NYMEFR 1066

>TDEL0G04490 Chr7 complement(814781..818062) [3282 bp, 1093 aa] {ON}
            Anc_6.20 YML002W
          Length = 1093

 Score =  633 bits (1632), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 378/1115 (33%), Positives = 617/1115 (55%), Gaps = 65/1115 (5%)

Query: 19   AICNCGEPNSSPLKKLYTQLGKKDKYLILVPPTELLLYYSDKESNSELHDLCYTPNFASA 78
            A+ NC  P++S LKKL++ L K  K+++LVPP + LL  +DK S S L +LCY+  F ++
Sbjct: 15   AVFNCPNPSTSNLKKLFSNL-KDRKFILLVPPCDRLLDCNDKLSGSPLQELCYSYEFVAS 73

Query: 79   HILLLDATDTEVNNGDEAVLIKNIEKRYDVHFIKAMDQSWKFINWKNRVIYEFNKLGDQI 138
            H+LL+D  + E         +K             ++     +  +NR+I   +  G Q+
Sbjct: 74   HVLLIDEQNAEYMTTAPPSQVK----------FDTLNGKKVIVRSQNRIILTSD--GFQV 121

Query: 139  KNRAKILDIESIPIFNNYMKTTDNTITIMYIDDVFLNGTLECNLRSDIDLLRSPSMRSIP 198
            K R  I   +    FN Y+   +    I+ ID+     ++           R    +++ 
Sbjct: 122  KKRCHITKTDLFVNFNEYL-LQEYKFPILCIDEPICAESVRTQ--------RVQISQTLG 172

Query: 199  TAKRPSLINKKSTDYENSKSKATFDSILRVNKHWSSKFEQHFQKFRLLANQDDLPIDVFH 258
            + KR +      T   +  SK++FD+ILR++  W+ KF + F ++R     DD  I++FH
Sbjct: 173  SGKRETKDGSSPTLDSSQGSKSSFDNILRIHPDWALKFNELFAEYRSTPEGDDPHIELFH 232

Query: 259  NIIEEMHEEMVSDNLFKNIVDLRNIIYEYVELNLFDDIWKMILRMNKEVEIDLNPFGNIS 318
            +II   +  M SD LF ++ DL ++IY+YVELNL+DDIW  I    K+ E++ N    +S
Sbjct: 233  DIIRRAYSAMRSDALFASMPDLSDLIYDYVELNLYDDIWVRITHHFKDSEVESNGLRYLS 292

Query: 319  IYQVDSEFLSTEYSKFFLENVITAERNIKEASKSLQKIESASNYKSKANILILTLRTLTG 378
            ++Q+++     ++ +F L++V++ E NI+ A  S  ++  A  +  KA  LI TLR L  
Sbjct: 293  LHQLETGLYPDKFEEFNLKSVVSMENNIELAMNSFSRLPLAHAHADKAMYLIDTLRNL-- 350

Query: 379  NKENDGYSSKNDDGNLSFFPLAIDADRLMNLFVLVTCRAQIKNLKCHLSYLQNFYNNDSD 438
                    S+ D       P+AI AD L++LFVLV CR Q++NLK  L YLQNF  N++ 
Sbjct: 351  --------SRVDKSIQEVSPVAIGADTLLSLFVLVICRTQLRNLKGQLFYLQNFAKNETS 402

Query: 439  TKFGILGYALSTLEAVVCYFEQLKEKENYRKLIDFCNSNERLVKVLSSTKKYETNAALYF 498
              FG+LGYA+STLEA VCYF++LK  +   +L   C +   LV  LSS       ++   
Sbjct: 403  ITFGVLGYAISTLEAAVCYFDELKGSKKMSRLESECENARSLVDKLSS------ESSSVN 456

Query: 499  LRKYEGSLRYRDSLGQSLLALCIIHGRNDFLYHILNEYETLFPIEDLLADESIDGSTLLI 558
            L  Y+ +L YR   G+SLL++CI +G+ND L  +L++ E  FP+ED+L D++ +G TLL+
Sbjct: 457  LIHYQKTLSYRTEQGESLLSICIANGKNDILQELLSD-ERSFPLEDILEDQTTEGCTLLM 515

Query: 559  QAVKHDNQYSASLLLNILKDNCTEIELIAYINRHDINKRTAGHFLTNELEVLKLMGKYIN 618
            Q++K  N  +ASL+++++K +CT+ E+ AY NR D +KRTA H+LT+E+ +L+ +G + +
Sbjct: 516  QSLKCGNGDAASLIVDLIKSSCTQEEMFAYFNRSDKDKRTAAHYLTHEINILEQIGNFFD 575

Query: 619  WVQKDNAGQTPLFTIFRSYDQDNYDEMVSQSMEYATNWYGLNGKNFNYLDHVDKKGNTLL 678
            W  KD++G T LFTIFRSYDQ NYD+M+  S   A  WY    + F +  H D+K NTLL
Sbjct: 576  WDVKDSSGHTALFTIFRSYDQPNYDDMIRASFRCAAEWYACRMRPFCFTVHEDRKENTLL 635

Query: 679  HILKCNLPILLADKHINVNATNRSGQTPLMTSIRYKRTENIRDLLCDPRLRVDITQKNNA 738
            HILK ++ ILL  + ++VNA NR G TPLM   +Y R +N + +L D R+ +   Q    
Sbjct: 636  HILKRSISILLEYESVDVNARNRKGLTPLMVYAKYNRLDNTKSILTDKRVILGKIQHPLL 695

Query: 739  LTAFDFSKDDEITHLLGEHELLNSPWLAVYAHTLKYTNSRWNLSLTVKL--KDAPKTTNF 796
            L + D++K+  I H + +   +++ +   + HTLKY +S W +++TV+   K   +T  F
Sbjct: 696  LCSIDYAKNPLILHEIAKQSAMDTAFGKCFVHTLKYESSSWLVNITVQADRKGNFETVEF 755

Query: 797  TLKTLRGILRVVIKNNMTVFLPVQELVEDLISFNRIRFSELMRIKVLEMLPFISFCLSAL 856
             LKT++   R V++     FLP+   +  L S  + R S + +++ +  L  ++ C + L
Sbjct: 756  HLKTVQNFFRTVLRTCPMTFLPLDSTLNQLASLGKARLSSIGKLETVCYLRSLTNCFNVL 815

Query: 857  VHIKVLDLNVFQTEENAIKWVKMNGSVDKKTNQ---TSDITPEDISMIQNFLKFNITEIE 913
            ++ + L  ++   E   + W+K+     +       +  + PE++S+IQ FL+FN  E+ 
Sbjct: 816  INSQELPKDILANESKLLSWIKVQYKAFRNGTTHIFSKKVEPEEMSIIQGFLRFNQAELS 875

Query: 914  RTKNKLEIAEKLSLFSRLKSKDLLNSNENYVTIVSQ-------LSSKRFRSTLKYSAEDT 966
              ++KL + +KL++F RLKS D+  S E  + + S+       L+  +F  T  Y   D+
Sbjct: 876  TLRSKLHVMKKLAIFLRLKSSDVEQSVELLLPLGSEGMGDLYPLTDHKFSCTTVY-GNDS 934

Query: 967  KLLSVRAEKALLSKITYLKICAQKLHNHILSITTTMISNWWHIYGELLNAHKHYTRAFPE 1026
             +L       L+  I  +  C  +L++HI ++    I  WW +YGELLN  K Y + FP 
Sbjct: 935  MIL-------LVEDIDLMLKCTIRLYDHINNLLQVKIPEWWKLYGELLNFRKQYAQNFPH 987

Query: 1027 LANVTTENRDLALHRMISNPKRIKLEERLSEKIKDITEQLNSVGHDIKQMHELAAEEVSR 1086
            L      + D  +   I   K+ KLE+RLS  I +    +N  G  I   HE  AE++S+
Sbjct: 988  LVKNGETSTDAGIIGKILEGKKEKLEKRLSFSIAETRRSMNQAGAIIAHDHESLAEQLSK 1047

Query: 1087 FIDLKTKFTLEYALQSYLTISKQE------HIEKD 1115
            F++ K  +     ++ ++  + +E      HI++D
Sbjct: 1048 FMEFKGAYICRGVIKRWVRENIKELKERLIHIQRD 1082

>ZYRO0C07810g Chr3 complement(591035..594334) [3300 bp, 1099 aa] {ON}
            similar to uniprot|Q04257 Saccharomyces cerevisiae
            YML003W/YML002W Hypothetical ORF
          Length = 1099

 Score =  620 bits (1598), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 371/1091 (34%), Positives = 617/1091 (56%), Gaps = 60/1091 (5%)

Query: 19   AICNCGEPNSSPLKKLYTQLGKKDKYLILVPPTELLLYYSDKESNSELHDLCYTPNFASA 78
            ++ NC  P+ S  KKL+ +L K +++++LVPPTE LLY+ D ES S ++DLC   +F ++
Sbjct: 15   SVFNCSNPSDSQFKKLFGKL-KTERFILLVPPTEKLLYHVDAESGSSMNDLCQNYDFVAS 73

Query: 79   HILLLDATDTEVNNGDEAVLIKNIEKRYDVHFIKAMDQSWKFINWKNRVIYE-----FNK 133
            HILLL   DT  + G                 + A    +K +N K   +          
Sbjct: 74   HILLLQQ-DTYSDGGFN---------------LSASQTEYKTLNDKRVAVRSSSGEILTT 117

Query: 134  LGDQIKNRAKILDIESIPIFNNYMKTTDNTITIMYIDDVFLNGTLECNLRSDIDLLRSPS 193
             G  ++ RA+I ++E I  FN+Y+  ++    +++ID   + GTL   +R  ID+ R  +
Sbjct: 118  EGFPLRRRARIQNVELITNFNDYLNGSEK-FALVHIDHPLI-GTL---IRK-IDIPRGLA 171

Query: 194  MRSIPTAKRPSLINKKSTDYENSKSKATFDSILRVNKHWSSKFEQHFQKFRLLANQDDLP 253
              +         + +  T     KS ++F++ILR++  WS+    +F ++R     +   
Sbjct: 172  QGNFNGVDAKGSLVRDLT----QKSWSSFENILRLHPDWSNILNGYFNRYRSTPLTEGPY 227

Query: 254  IDVFHNIIEEMHEEMVSDNLFKNIVDLRNIIYEYVELNLFDDIWKMILRMNKEVEIDLNP 313
             ++F  I++++H +MV+D LF+ I  L ++I++YVELNLFDD+W  I+   ++ EID  P
Sbjct: 228  EELFRMIVKQVHAKMVNDELFRKIPHLYDLIFDYVELNLFDDVWIRIVNSYRKDEIDTEP 287

Query: 314  FGNISIYQVDSEFLSTEYSKFFLENVITAERNIKEASKSLQKIESASNYKSKANILILTL 373
               +SI ++++E    +Y KF L++V T E+NI  A  S   +     +  KA+ LI TL
Sbjct: 288  LKFLSINELETELYQKKYEKFRLQDVTTMEKNIDLAINSFVGLPLTHTHAEKADCLINTL 347

Query: 374  RTLTGNKENDGYSSKNDDGNLSFFPLAIDADRLMNLFVLVTCRAQIKNLKCHLSYLQNFY 433
            ++L+  +E D         ++   P+ +DAD L++ FVLV CR Q+KN+K HL YL+ F 
Sbjct: 348  QSLSNTREQDM--------DIQTLPITMDADTLISFFVLVVCRTQVKNIKSHLFYLKKFS 399

Query: 434  NNDSDTKFGILGYALSTLEAVVCYFEQLKEKENYRKLIDFCNSNERLVKVLSSTKKYETN 493
             +++  KFGILGYA+STLEAVV YF+ LK  +  +KL D  N  + L  ++S      T 
Sbjct: 400  KDENSIKFGILGYAISTLEAVVFYFDGLKGTKKLQKLQDDSNKAKELYILISDK---STG 456

Query: 494  AALYFLRKYEGSLRYRDSLGQSLLALCIIHGRNDFLYHILNEYETLFPIEDLLADESIDG 553
             A+  + ++  +L +R   G+S+L+ CII+ +N  LY +L  YE +FP+ED+L DE++DG
Sbjct: 457  QAVLDISQFRSNLEFRTPQGESVLSQCIINDKNGLLYELLKNYEDIFPLEDILDDETVDG 516

Query: 554  STLLIQAVKHDNQYSASLLLNILKDNCTEIELIAYINRHDINKRTAGHFLTNELEVLKLM 613
            STLLIQA+K DN  +A +++ +L+++CTE EL  Y+NR D N+RT  H+LT+E+ +L+ +
Sbjct: 517  STLLIQALKCDNSEAAQMIVEVLQNSCTEQELREYVNRADKNRRTVAHYLTHEMNILESI 576

Query: 614  GKYINWVQKDNAGQTPLFTIFRSYDQDNYDEMVSQSMEYATNWYGLNGKNFNYLDHVDKK 673
            GKYINW  +D+ G TPLFTIFR YDQ NY+ M+S +   A  WY  NG++F + DH D K
Sbjct: 577  GKYINWKSQDSNGHTPLFTIFRCYDQQNYEAMISAAFRSAVRWYQANGEDFQFSDHEDNK 636

Query: 674  GNTLLHILKCNLPILLADKHINVNATNRSGQTPLMTSIRYKRTENIRDLLCDPRLRVDIT 733
            GNTLLHI+K N+ ILL   ++++N TN+ G TPLM   RY R +N++ ++ D R+ +D  
Sbjct: 637  GNTLLHIIKNNVSILLDYDNVDINCTNKKGLTPLMIYTRYNRFDNVKTIIRDQRIILDKL 696

Query: 734  QKNNALTAFDFSKDDEITHLLGEHELLNSPWLAVYAHTLKYTNSRWNLSLTVKLKDAP-- 791
            Q  + L +FD++++  +   L    +  + +   + H LKY    W   +TVK+      
Sbjct: 697  QHPSFLNSFDYARNPLVLKELVSQAIKTTAFELAFVHHLKYEAPSWFFHITVKIGAGADE 756

Query: 792  --KTTNFTLKTLRGILRVVIKNNMTVFLPVQELVEDLISFNRIRFSELMRIKVLEMLPFI 849
              KT    +KTL+ + +V++K +   FLP+++ +EDL +  + R   + +++ L     +
Sbjct: 757  EYKTVKLHIKTLQNLFQVLLKMHFASFLPLEKALEDLSNLYKSRMPSIAKLETLYFFYML 816

Query: 850  SFCLSALVHIKVLDLNVFQTEENAIKWVKMNGSVDKKTNQT------SDITPEDISMIQN 903
            + C   L+    L+  V + E   + W++   S DKK N +       ++ PE+I ++ +
Sbjct: 817  TDCFDVLLRHDNLNKLVLR-ESRLVSWIR---SQDKKCNNSKKLQKQKNVEPEEIGIMAS 872

Query: 904  FLKFNITEIERTKNKLEIAEKLSLFSRLKSKDLLNSNENYVTIVSQLSSKRFRSTLKYSA 963
            FL+FN  E+   K KL   +KL +F +LK+ DL +S +      ++ +  + R   K   
Sbjct: 873  FLRFNRGELSAVKLKLMTMKKLLIFLKLKNTDLTHSYQFLSLFGTEYNLAQDRLLFKDLE 932

Query: 964  EDTKLLSVRAEKALLSKITYLKICAQKLHNHILSITTTMISNWWHIYGELLNAHKHYTRA 1023
             +       A    + +I +L+ C  KL + +  + +  I  WW +YG++L  HK Y + 
Sbjct: 933  INCCAFGEEATMTFVREIAFLENCTGKLLDRVEQLLSVDIPEWWKLYGDVLEMHKVYKQK 992

Query: 1024 FPELANVTTENRDLALHRMISNPKRIKLEERLSEKIKDITEQLNSVGHDIKQMHELAAEE 1083
            FP   N++  +    +       KR K+E +LS  + D  +++  VG  I   HE+ AEE
Sbjct: 993  FP---NISRNDSGTGIIASFFEGKREKMESKLSSDLADCKKRMRRVGDRISSTHEILAEE 1049

Query: 1084 VSRFIDLKTKF 1094
            +S++++ K+ F
Sbjct: 1050 LSKYMEFKSNF 1060

>Sklu_YGOB_Anc_6.20b Chr5 (89924..92470,92474..93193) [3267 bp, 1088
            aa] {ON} ANNOTATED BY YGOB -
          Length = 1088

 Score =  572 bits (1474), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 372/1113 (33%), Positives = 603/1113 (54%), Gaps = 86/1113 (7%)

Query: 19   AICNCGEPNSSPLKKLYTQLGKKDKYLILVPPTELLLYYSDKESNSELHDLCYTPNFASA 78
            ++ NC  P++SPLKK++  L +  +++++VP   +LL+Y D ++ S L DLCYT  F + 
Sbjct: 15   SVFNCPTPSTSPLKKIFASL-RDQRFILVVPNVNILLHYQDLDTGSSLQDLCYTYEFVAN 73

Query: 79   HILLLDATDTEVNNGDEAVLIKNIEKRYDVHFIKAMDQSWKFINWKNRVIYEFNKL---G 135
            HI++L                            K  DQ +K +N K  +I   N +   G
Sbjct: 74   HIIILKKDS------------------------KYSDQEFKTLNGKTVLIRSQNGIVLTG 109

Query: 136  DQI--KNRAKILDIESIPIFNNYMKTTDNTITIMYIDDVFLNGTLECNLRSDIDLLRSPS 193
            D    K R KI + E    FN+Y+K +     +++ID   ++  ++       D L+   
Sbjct: 110  DGFPSKRRCKITNTELFINFNDYLKGS-KYFPLIHIDKPLMSDAVKN------DELQVFG 162

Query: 194  MRSIPTAKRPSLINKKSTDYENSKSKATFDSILRVNKHWSSKFEQHFQKFRLLANQD--- 250
            +RS  T+  P      STD    +  ++F+ + R++     +F   F++ R   N +   
Sbjct: 163  VRSTNTSSLPL-----STDL-TQREVSSFEQLFRLHPQLGDRFSGLFKEQRQEINANFKG 216

Query: 251  -DLPIDVFHNIIEEMHEEMVSDNLFKNIVDLRNIIYEYVELNLFDDIWKMILRMNKEVEI 309
             D  +D F     E  E +  +  F+N   L   ++ YVELNL+DDIWK I ++ ++ EI
Sbjct: 217  LDSLVDFFDKFNYEAFELIRHERRFENHSKLHQTVHNYVELNLYDDIWKQITQLYRDDEI 276

Query: 310  ----DLNPFGNISIYQVDSEFLSTEYSKFFLENVITAERNIKEASKSLQKIESASNYKSK 365
                D N    I+I QV + F   + SKF L+ V   E+++++A+   +++  +S++  K
Sbjct: 277  EATYDYNLLKYIAISQVPTPFYPEKQSKFSLKKVTHFEKSLEQATDCFKRLAFSSSHSEK 336

Query: 366  ANILILTLRTLTGNKENDGYSSKNDDGNLSFFPLAIDADRLMNLFVLVTCRAQIKNLKCH 425
              I++ TL+TLT         S+  D ++    + IDAD L+ L VLV CR+Q+KNLK H
Sbjct: 337  TKIIMDTLQTLTD-------YSEFPDADIE--DVTIDADTLIGLMVLVVCRSQVKNLKSH 387

Query: 426  LSYLQNFYNNDSDTKFGILGYALSTLEAVVCYFEQLKEKENYRKLIDFCNSNERLVKVLS 485
            L YLQNF  +++  KFG++ YALSTLEAV+CYFE  +     R L   C  N++    LS
Sbjct: 388  LFYLQNFSLDENTIKFGVVAYALSTLEAVLCYFEDAENSGKIRSLEFNCRRNKQFWDHLS 447

Query: 486  STKKYETNAALYF--LRKYEGSLRYRDSLGQSLLALCIIHGRNDFLYHILNEYETLFPIE 543
                     A+ F  L+ Y   LR R + G+S L++CI  G    +  +L  +E   P+E
Sbjct: 448  C-------KAVSFDSLKSYRDILRIRTAGGESCLSVCIQKGNFSGIECLLQNFEHELPLE 500

Query: 544  DLLADESIDGSTLLIQAVKHDNQYSASLLLNILKDNCTEIELIAYINRHDINKRTAGHFL 603
            D+L D++I+GSTLL+Q ++  N   A +LL IL  +CT  EL  Y+NR +  KRTA H+L
Sbjct: 501  DILDDQTINGSTLLMQTLETGNTRMADVLLEILCQSCTINELREYLNRRNRWKRTAAHYL 560

Query: 604  TNELEVLKLMGKYINWVQKDNAGQTPLFTIFRSYDQDNYDEMVSQSMEYATNWYGLNGKN 663
            T +L++   +G + +W  KD +G TPLF IFRSYD  +Y +MV+ +   A+ WY + G+N
Sbjct: 561  TQDLQMADKIGIFFDWEAKDISGHTPLFAIFRSYDHPDYAQMVTNAFRTASKWYEIRGEN 620

Query: 664  FNYLDHVDKKGNTLLHILKCNLPILLADKHINVNATNRSGQTPLMTSIRYKRTENIRDLL 723
            FN+  H D KGNTLLH++K N+ ILL  ++I+VN  N+ G TPLM  ++Y R +N++ +L
Sbjct: 621  FNFSAHKDTKGNTLLHVMKTNIEILLEQENIDVNEVNKKGLTPLMVYVKYNRLDNVKCIL 680

Query: 724  CDPRLRVDITQKNNALTAFDFSKDDEITHLLGEHELLNSPWLAVYAHTLKYTNSRWNLSL 783
             D RL ++  QK+  L  FD+ K+  I   LG H    + +  V AHT ++ N+RW L +
Sbjct: 681  RDNRLIMEKHQKSLFLNCFDYVKNPVIQAELGFHAAEKTKFGEVVAHTFRFENNRWFLWI 740

Query: 784  TVKLKDAP---KTTNFTLKTLRGILRVVIKNNMTVFLPVQELVEDLISFNRIRFSELMRI 840
            T+K KD     +T    ++ ++G+L+V ++ N   FLP+  ++EDL    +     + ++
Sbjct: 741  TLKGKDRETDFQTVKHNIRAIQGLLQVYLRRNPMSFLPIDAVLEDLHEIGKTGLVSVGKL 800

Query: 841  KVLEMLPFISFCLSALVHIKVLDLNVFQTEENAIKWVKMNGSVDKKTNQTSDITPEDISM 900
            +V   L  ++  L  +   +     ++    + + W++ +G   K+TN +  I PE+I+ 
Sbjct: 801  EVHRFLCELTLVLKLICQKEEFKKALYLPASDLVNWIRESGR--KRTNVSRRIEPEEINS 858

Query: 901  IQNFLKFNITEIERTKNKLEIAEKLSLFSRLKSKDLLNSNENYVTIVSQLSSKRFRSTLK 960
            IQ+FL+FN++E+   ++K+ I +KLS+FS LK++D+   N+    + SQ  S R   T  
Sbjct: 859  IQSFLRFNLSELSLIRDKISILQKLSIFSELKAQDI---NQARCMLFSQ--SVRLEDTAI 913

Query: 961  YSAEDTKLLSVR-----AEKALLSKITYLKICAQKLHNHILSITTTMISNWWHIYGELLN 1015
              A     LS +     +   L S I +LK C  KL   I  +    ++ WW +Y ELL+
Sbjct: 914  SQAFGISGLSEKDSEDLSATILTSNIDFLKECTNKLVGKIDQLLQGKLTRWWKLYAELLD 973

Query: 1016 AHKHYTRAFPELANVTTENRDLALHRMISNPKRIKLEERLSEKIKDITEQLNSVGHDIKQ 1075
            A   Y + FP       ++ +  L       KR KLEE+LS +IK   E+L ++ +++KQ
Sbjct: 974  ARNQYNKNFPNSVKPHLDD-NKGLFGTYVEGKRSKLEEKLSAQIKSCLERLQTLTYEVKQ 1032

Query: 1076 MHELAAEEVSRFIDLKTKFTLEYALQSYLTISK 1108
             HE  AEE+S +++ KT +     +Q + T+ K
Sbjct: 1033 EHEALAEELSIYLEFKTNYLRTGIIQDF-TVGK 1064

>Kpol_1037.25 s1037 (56141..59458) [3318 bp, 1105 aa] {ON}
            (56141..59458) [3318 nt, 1106 aa]
          Length = 1105

 Score =  519 bits (1337), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 359/1090 (32%), Positives = 605/1090 (55%), Gaps = 51/1090 (4%)

Query: 19   AICNCGEPNSSPLKKLYTQLGKKDKYLILVPPTELLLYYSDKESNSELHDLCYTPNFASA 78
            A+ NC +P +SPL+KL+ ++  K+ ++++VPP E+LL+Y D E    L +LCY   F ++
Sbjct: 18   AVFNCPDPINSPLRKLFERIKYKN-FMLIVPPNEILLHYRDPEKGLTLKELCYEFEFVAS 76

Query: 79   HILLLDATDTEVNNGDEAVLIKNIEKRYDVHFIKAMDQSWKFINWKNRVIYEFNKLGDQI 138
            HI+L    DT+ ++ +  V  KN  +  D  + K+++ +   I   N +  +FN    + 
Sbjct: 77   HIIL----DTDNSSNNLQVKGKNSNETLDNRY-KSLNNNQLLIKNNNIIPLDFNNSTQKK 131

Query: 139  KNRAKILDIESIPIFNNYMKTTDNTITIMYIDDVFLNGTLECNLRSDIDLLRSPSMRSIP 198
            K +   +  + +P FN Y+  ++   TI+Y D  F N  L    + +I+     S +   
Sbjct: 132  KYKIIDI--KILPNFNEYLSGSE-KYTIIYTDYPFSNSWLP---KIEIESFYI-SKKESN 184

Query: 199  TAKRPSLINKKSTDYEN--SKSKATFDSILRVNKHWSSKFEQHFQKFR-LLANQDDLPID 255
              K   + N KS   ++   K+K++F  I+ ++K W++ F+ +   F+    N   LPI 
Sbjct: 185  NIKAAQITNHKSPLSQDLAQKTKSSFRHIINIHKEWNNIFDSYIIDFKNKQLNLTSLPI- 243

Query: 256  VFHNIIEEMHEEMVSDNLFKNIV-DLRNIIYEYVELNLFDDIWKMILRM---NKEVEIDL 311
             F  I+++ +++M  + +F +   DL N+I+EY+E + ++ IW  I R    N+ +  ++
Sbjct: 244  YFREIVDKAYQKMKFEEIFLSFHNDLYNLIFEYLESSFYNSIWDHIDRNMIDNQFLHTEM 303

Query: 312  NPFGNISIYQVDSEFLSTEYSKFFLENVITAERNIKEASKSLQKIESASNYKSKANILIL 371
              F  +SI Q++ E  +  + KF L NVI  ER +K+A+   +KI  + ++  K  ILI 
Sbjct: 304  MDF--LSIDQLELELYNQNFQKFNLVNVIKVERCVKDATDQFKKIIDSKSHSEKCQILID 361

Query: 372  TLRTLTGNKENDGYSSKNDDGNLSFFPLAIDADRLMNLFVLVTCRAQIKNLKCHLSYLQN 431
             L+ LT            DD  + + PL +DAD LMNLF+LV CR+++  L+ HL YLQN
Sbjct: 362  ALQKLTSY----------DD--VHYEPLMVDADTLMNLFLLVICRSKVPFLRNHLYYLQN 409

Query: 432  FYNNDSDTKFGILGYALSTLEAVVCYFEQLKEKENYRKLIDFCNSNERLVKVLSSTKKYE 491
            F  ++++ KFG+LGY +ST EA +CY +  +  E + K +  C  N+ L+  +SS    E
Sbjct: 410  FSTDENNVKFGLLGYGISTFEATLCYLKDFQAGEKFNKQVLNCIRNKELISKISS----E 465

Query: 492  TNAALYFLRKYEGSLRYRDSLGQSLLALCIIHGRNDFLYHILNEYETLFPIEDLLADESI 551
             + + + ++ Y+   ++R+ +G+S+LALCI H +N+ L+ IL  +E +FP+ED+L DE I
Sbjct: 466  ADHSTFQVKLYKDCFKFRNEMGESILALCIKHKKNETLFEILLNFEDMFPLEDILDDEDI 525

Query: 552  DGSTLLIQAVKHDNQYSASLLLNILKDNCTEIELIAYINRHDINKRTAGHFLTNELEVLK 611
            +G+TLL++A+K +N+  A L++++L+ +C+E ELI Y NR D N+R A H++TN+++VLK
Sbjct: 526  EGTTLLMKALKVENEVGAKLIVDVLQSSCSEDELIKYFNRTDNNQRIAAHYITNQIDVLK 585

Query: 612  LMGKYINWVQKDNAGQTPLFTIFRSYDQDNYDEMVSQSMEYATNWYGLNGKNFNYLDHVD 671
             +G + NW  KD+ G TPL TI R+YDQ+ Y++M+  +   A  WY    +  N+ DH D
Sbjct: 586  RIGLFFNWKIKDDKGYTPLTTICRTYDQECYEQMIETAFFEAQKWYENRNQKLNFKDHND 645

Query: 672  KKGNTLLHILKCNLPILLADKHINVNATNRSGQTPLMTSIRYKRTENIRDLLCDPRLRVD 731
             K NTLLHILKC++ +LL   +IN+NA N    TPLMT ++Y R  NI++++ D RL + 
Sbjct: 646  SKENTLLHILKCDIQVLLKYDNININAHNLKYITPLMTYVKYNRVSNIQEIIRDERLILG 705

Query: 732  ITQKNNALTAFDFSKDDEITHLLGEHELLNSPWLAVYAHTLKYTNSRWNLSLTVKL--KD 789
              QK+  L  +DF K+  I   LG   + NS +    A++L+  NS W L  T K   +D
Sbjct: 706  KYQKHTFLDCYDFVKNTIIFEDLGVRSVRNSMFNLFSAYSLRVENSNWVLYFTFKDTNQD 765

Query: 790  APKTTNFTLKTLRGILRVVIKNNMTVFLPVQELVEDLISFNRIRFSE-LMRIKVLEMLPF 848
            +  T + +LK L  I++   K     F+P +E++  L    +   +  + ++K    L  
Sbjct: 766  SYITKSVSLKILFNIIKKYNKLYPLHFIPHKEVLLRLTGIVKNNPNNGIQKLKNRAFLNL 825

Query: 849  ISFCLSALVHIKVLDLNVFQTEENAIKWVKMNGSVDKKTNQTSDITPEDISMIQNFLKFN 908
            IS     L+     D  +F+  E+  KW+K      KK N    +T +DI+MI++F++FN
Sbjct: 826  ISNYFGTLIETDDFDTELFKNPESLTKWIKAGKRKHKKENYYKRMTLDDINMIKSFVQFN 885

Query: 909  ITEIERTKNKLEIAEKLSLFSRLKSKDLLNSNENYVTIVSQLSSKRFRSTLKYSAEDTKL 968
            I E+ +    L I +KL  F  LK  D+  S + +    + L  K   + +K   +   L
Sbjct: 886  INELGKLNRTLAILKKLCTFLALKINDVNESYKLFRNFGALLQQKDISNQMK---KIDGL 942

Query: 969  LSVRAEKA----LLSKITYLKICAQKLHNHILSITTTMISNWWHIYGELLNAHKHYTRAF 1024
            +  +  ++    LL +I++L+IC   + ++   +    I  W  ++  L N  K Y R F
Sbjct: 943  IKPKYFQSIFLILLDQISFLEICTIHMSDNFNDLIKNDIPEWHSVHFILSNLKKQYKRDF 1002

Query: 1025 PELANVTTENRDLALHRMISNPKRIKLEERLSEKIKDITEQLNSVGHDIKQMHELAAEEV 1084
             +  +    N ++ L R   N KR   E+R+SE+I + T   + V   I   HE  AEE 
Sbjct: 1003 SDFDSRNGLNENI-LSRYTKN-KREAAEKRISEEIIENTTLFDKVTAHIWYAHENLAEEF 1060

Query: 1085 SRFIDLKTKF 1094
            ++F+  K++F
Sbjct: 1061 NKFLTFKSRF 1070

>KNAG0M01160 Chr13 (207940..211335) [3396 bp, 1131 aa] {ON} Anc_6.20
            YML002W
          Length = 1131

 Score =  508 bits (1308), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 358/1162 (30%), Positives = 609/1162 (52%), Gaps = 98/1162 (8%)

Query: 19   AICNCGEPNSSPLKKLYTQLGKKDKYLILVPPTELLLYYSDKESNSELHDLCYTPNFASA 78
            A+ NC +  +SPL+K+Y+ L     +++LVPPT  L YY D+ +   LH+LC++P F S+
Sbjct: 11   AVFNCQDVEASPLRKVYSSL-HDIPFILLVPPTFALWYYDDRNTKFPLHELCHSPEFVSS 69

Query: 79   HILLLDATDTEVNNGDEAVLIKNIEKRYDVHFIKAMDQSWKFIN--WKNRVIYEFNKLGD 136
            HIL      T  +  D   +  ++ +   V   K    + K IN  +  + +Y  +  G 
Sbjct: 70   HIL------TRYSGKDNKPIDTDLSRLRAVREAKFCTFNGKIINGLFSKQSLYTTD--GF 121

Query: 137  QIKNRAKILDIESIPIFNNYMKTTDNTITIMYIDDVFL--NGTLECNLRSDIDLLRSPSM 194
              ++  +IL  E++  F NY++ + +T  ++YID   +  N  L+C    D+D   + ++
Sbjct: 122  SFRSTRRILKYETLDHFQNYLQGS-STFILIYIDQPLIDTNRLLKCE---DLDCFPNLTI 177

Query: 195  RSIPTAKRPSLINKKSTDYENSKSKATFDSILRVNKHWSSKFEQHFQKFRL-LANQDDLP 253
             + P+ +  SL N  S +    ++    +S++    +W  KF   FQ +R  +   + + 
Sbjct: 178  NTTPSTR--SLANLSSAEVPPQRN-PLLNSMIHAQYNW--KFRAVFQNYRKEITQSESML 232

Query: 254  IDVFHNIIEEMHEEMVSDNLFKNIVDLRNIIYEYVELNLFDDIWKMIL-RMNKEVEIDLN 312
            I  F   I+++++ +  DN F  I  +R +I EYVE N++DD+W++++ R N E E +  
Sbjct: 233  IPGFRKTIDKIYDGL--DNSFHTIPTIRQLIQEYVEQNVYDDVWQVLINRNNAEGEKEKQ 290

Query: 313  P-----FGNISIYQVDSEFLSTEYSKFFLENVITAERNIKEASKSLQKIESASNYKSKAN 367
                  F  IS+ Q+D++F   ++SKF+L++++  E+NI +A+KS + +     Y  K  
Sbjct: 291  SESSDIFRFISLDQLDTDFYKAKFSKFYLKDIVQLEKNISKATKSFENLSVTHTYVEKCR 350

Query: 368  ILILTLRTLTGN-KENDGYSSKNDDGNLSFFPLAIDADRLMNLFVLVTCRAQIKNLKCHL 426
            +L+ TL+ L+   K   GY             + I AD L++LF+L+  R ++KN++CHL
Sbjct: 351  VLVETLQILSKPVKRVGGYQ------------VPITADTLVSLFILLIKRTKMKNIRCHL 398

Query: 427  SYLQNFYNNDSDTKFGILGYALSTLEAVVCYFEQLKEKENYRKLIDFCNSNERLVKVLSS 486
             YLQNF+ +++  KFG+LGYA+STLEAV+CY E ++  +     I+  ++N      L +
Sbjct: 399  YYLQNFHQDENSIKFGLLGYAISTLEAVICYLETIETDKERLDCIEKNDANLEEFLTLLT 458

Query: 487  TKKYETNAALYFLRKYEGSLRYRDSLGQSLLALCIIHGRNDFLYHILNE-YETLFPIEDL 545
              K  +N  L  L KY  + RYR+  G S L+LCII+ +ND  + +L+E YE+ F  EDL
Sbjct: 459  RSKCVSNEGLD-LSKYSHNFRYRNGDGNSTLSLCIINFKNDIFFELLSENYESYFAFEDL 517

Query: 546  LADESIDGSTLLIQAVKHDNQYSASLLLNILKDNCTEIELIAYINRHDINKRTAGHFLTN 605
            L D++ +G+TLL+Q+++H N      L +I+  N TE EL  Y  + D  KR  GH++  
Sbjct: 518  LEDQTTEGTTLLMQSLQHSNHEITEYLTDIMLKNSTEEELYYYCGKRDKYKRNIGHYICG 577

Query: 606  ELEVLKLMGKYINWVQKDNAGQTPLFTIFRSYDQDNYDEMVSQSMEYATNWYG-LNGKNF 664
            +  +L+ +GKYI W  KD  GQTPL  IFRSYDQ  YD MV  S   A  WY  +    F
Sbjct: 578  QQTLLQKIGKYIKWDSKDCTGQTPLCVIFRSYDQAFYDVMVETSFAIAVEWYSTVKNSKF 637

Query: 665  NYLDHVDKKGNTLLHILKCNLPILLADKHINVNATNRSGQTPLMTSIRYKRTENIRDLLC 724
             + DH D KGNTLLHI+KCN+  LL    +++N  N  G +PL  +  Y R EN+  LL 
Sbjct: 638  CFRDHTDSKGNTLLHIIKCNISFLLQSPDVDINKVNSQGLSPLTNNAMYDRGENVEALLK 697

Query: 725  DPRLRVDITQKNNALTAFDFSK---DDEITHLLGEHELLN-SPWLAVYAHTLKY-TNSRW 779
            DPRL           ++FDF K   + +   +L  + L N +P+  + A    +  +++ 
Sbjct: 698  DPRL---------IFSSFDFLKQYPNTKSAPILSHYCLDNEAPFRNIIASHFDFRISNKR 748

Query: 780  NLSLTVKLKDAPK----TTNFTLKTLRGILRVVIKNNMTVFLPVQELVEDLISFNRIRFS 835
            ++ LT + K+  +    +  F LK L+ + R+++K +   F P++EL+++L    +   S
Sbjct: 749  SVVLTSRSKEDAQELIGSEAFELKNLKALFRLLLKQHPFTFFPLEELLDELSVVEKTASS 808

Query: 836  E-LMRIKVL-EMLPFISFCLSALVHIKVLDLNVFQTE---ENAIKWVKMNGSVDKKTNQT 890
              LM+     ++L  +++CL ++V +++L     Q+    E  I   K+    +K   ++
Sbjct: 809  RSLMKSSFCSKVLKKLTYCLDSMVEMELLPTAALQSVALLERHIAKEKVTVDEEKLKRRS 868

Query: 891  SD--ITPEDISMIQNFLKFNITEIERTKNKLEIAEKLSLFSRLKSKDLLNSNENYVTIVS 948
             D  + PE I  I  FLK+ +  + + K  +    K S+ S+LKSKD+  S     T+ +
Sbjct: 869  KDKKMQPESIGTITTFLKYILESLLKLKGTIIELRKFSILSKLKSKDISESKNIVCTLGA 928

Query: 949  QLSSKRF-RSTLKYSAEDTKLLSVRAEKALLSKITYLKICAQKLHNHILSITTTMISNWW 1007
            ++SSK+  R+ ++YS  D K L  ++   L+ +I + + C   + N I  +    I  WW
Sbjct: 929  EVSSKKIGRAMVRYSTIDNKFLGEQSFDLLVFQIHFFESCLSSIINSIDHLLHLKIPEWW 988

Query: 1008 HIYGELL-------------NAHKHYTRAFPELANVTTEN-RDLALHRMISNPKRIKLEE 1053
              YG+LL             + HK    A   +   TT++   + +       KRIK +E
Sbjct: 989  KCYGQLLELSKEDPSVLARESDHKQTPNASNNVGTSTTDHTSGMGVLGTFIEGKRIKNQE 1048

Query: 1054 RLSEKIKDITEQLNSVGHDIKQMHELAAEEVSRFIDLKTKFTLEYALQSYLTI------- 1106
            R    I D+  +L  + ++I   + L   E   FI+ ++KF     L+ ++ +       
Sbjct: 1049 RTRAAISDLQRRLKLLDNEIDTNNTLVVIEYCIFINFQSKFIHSAMLEKWVKLNINLLKK 1108

Query: 1107 ----SKQEHIEKDRLHWEFQEN 1124
                SK++ I K+ +  +  +N
Sbjct: 1109 SLLDSKEKRIRKEAVRSKASDN 1130

>ACR006C Chr3 complement(364436..367651) [3216 bp, 1071 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YML002W and
            YML003W; YML002W and YML003W represent one ORF in this
            genome
          Length = 1071

 Score =  494 bits (1273), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 341/1113 (30%), Positives = 577/1113 (51%), Gaps = 89/1113 (7%)

Query: 19   AICNCGEPNSSPLKKLYTQLGKKDKYLILVPPTELLLYYSDKESNSELHDLCYTPNFASA 78
            A+ NC  P +SPLKKL+    K  K++++VP TE+LL Y D  +   L +LCY   F ++
Sbjct: 15   AVFNCPAPGASPLKKLFNN-AKDKKFILVVPRTEVLLQYQDATTYVPLTELCYNYEFVAS 73

Query: 79   HIL--LLDATDTEVNNGDEAVLIKNIEKRYDVHFIKAMDQSWKFINWKNRVIYEFNKL-- 134
            H L  L +A  TE+                           ++ IN K+ VI   + +  
Sbjct: 74   HTLVQLQEARVTEL--------------------------EFQTINGKSVVIRPQSGIIT 107

Query: 135  GDQIKNRAKILDIESIPIFNNYMKTTDNTITIMYIDDVFLNGTLECNLRSDIDLLRSPSM 194
                  + +I   E +  FN+Y+        ++YID           L  +I+L+ +P +
Sbjct: 108  AQPSAKKCRIQRCELLRSFNDYL-LGRTAFALLYIDR---------PLVGEIELI-TP-L 155

Query: 195  RSIPTAKRPSLINKKSTDYENSKSKATFDSILRVNKHWSSKFEQHF----QKFRLLANQD 250
            R     ++P    + +   + + +    +  LR++    ++ ++ F    ++ R +A   
Sbjct: 156  RVFGPQEQPLQYQRIT---QTADAPLPLEQFLRLHPQLGNQLDEVFKDAKERMRYIALSL 212

Query: 251  DLPIDVFHNIIEEMHEEMVSDNLFKNIVDLRNIIYEYVELNLFDDIWKMILRMNKEVEID 310
               + +FH ++E+++  +  D  F+N ++L  ++  YVELN+++D+W+ ++++N + E D
Sbjct: 213  KELVRLFHELVEKVYCLIKLDKNFRNYLNLLEMVQGYVELNMYEDVWRKLVQLNGKNEPD 272

Query: 311  LNPF----GNISIYQVDSEFLSTEYSKFFLENVITAERNIKEASKSLQKIESASNYKSKA 366
              P      +IS+ Q+ +     E  KF L  V   E+ + +A++   K+   +++  KA
Sbjct: 273  RVPGYYITRSISLNQLSTSIYPEELDKFNLSPVTEIEKRVVQATECFSKLTLTNSHHEKA 332

Query: 367  NILILTLRTLTGNKENDGYSSKNDDGNLSFFPLAIDADRLMNLFVLVTCRAQIKNLKCHL 426
             ILI T + LT         +K     L   P+ IDAD L+ L V+V CRAQ+KNLK HL
Sbjct: 333  RILISTFQKLT---------TKTSQATLD--PM-IDADTLLGLMVVVVCRAQVKNLKSHL 380

Query: 427  SYLQNFYNNDSDTKFGILGYALSTLEAVVCYFEQLKEKENYRKLIDFCNSNERLVKVLSS 486
             YL+ F  N  D KFG+LGY+LSTLEAVV YF+         +LI  C  N+    ++  
Sbjct: 381  DYLREFAQNSDDVKFGLLGYSLSTLEAVVGYFDIGGSSIKLERLITQCQRNKIFWNLIEQ 440

Query: 487  TKKYETNAALYFLRKYEGSLRYRDSLGQSLLALCIIHGRNDFLYHILNEYETLFPIEDLL 546
                        L+++E  L  R    +S+L+LCI +GR D  Y I+  Y++ F +ED+L
Sbjct: 441  GIPIN-------LKEHEEVLISRTPSCESVLSLCIQYGRQDVFYDIIANYQSHFTLEDIL 493

Query: 547  ADESIDGSTLLIQAVKHDNQYSASLLLNILKDNCTEIELIAYINRHDINKRTAGHFLTNE 606
             D +    +LLIQA++  N+     ++++L  NCT  E+ AYIN+ DI  RT GH+L   
Sbjct: 494  QDVNQSNCSLLIQALQAGNKDITEAVIDLLIANCTNTEMYAYINKCDIAGRTVGHYLPQN 553

Query: 607  LEVLKLMGKYINWVQKDNAGQTPLFTIFRSYDQDNYDEMVSQSMEYATNWYGLNGKNFNY 666
             E++  +GK+++W +KD    TPLFT+ R+YD  +Y E++S+  ++  ++Y   GK F++
Sbjct: 554  YEIVDRLGKFVDWKRKDLNMHTPLFTVCRAYDHPSYLELLSKCFQHCFDFYSTRGKRFSF 613

Query: 667  LDHVDKKGNTLLHILKCNLPILLADKHINVNATNRSGQTPLMTSIRYKRTENIRDLLCDP 726
             DH D  GNTLLHI+K  + + L+    NVN  N  G TPLM   +Y R ENIR++L D 
Sbjct: 614  ADHEDPLGNTLLHIIKDGIQLALSTPGANVNKCNTRGMTPLMVYAKYNRIENIREILNDK 673

Query: 727  RLRVDITQKNNALTAFDFSKDDEITHLLGEHELLNSPWLAVYAHTLKYTNSRWNLSLTVK 786
            RL +   Q   +L A D+ K+  I +L+G     NS +  +  H +KY  + W L +T  
Sbjct: 674  RLILSKLQDPQSLKAIDYVKNPIILNLIGTAMAKNSLYGCLSVHNIKYEENAWYLWITSS 733

Query: 787  L-KDAPKTTNFTLKTLRGILRVVIKNNMTVFLPVQELVEDLISFNRIRFSELMRIKVLEM 845
            L  ++ KT+++ LK ++ +L++  K +   FLP+   +E L +  +     ++ ++   +
Sbjct: 734  LSPESYKTSSYALKDIQSLLQIYNKKHPMSFLPIDHHLETLKTLGKSGIISVINLENSML 793

Query: 846  LPFISFCLSALVHIKVLDLNVFQ-TEENAIKWVKMNGSVDKKTNQTSDITPEDISMIQNF 904
            L  ++F LS ++  +    NVF  TE     W++ +  V +K N+   I PE+I  IQNF
Sbjct: 794  LEALTFSLS-IIQQREDYKNVFSYTESELSTWLRAS-MVKQKPNKRDKIEPEEIHSIQNF 851

Query: 905  LKFNITEIERTKNKLEIAEKLSLFSRLKSKDLLNSNENYVT----IVSQLSSKRFRSTLK 960
            LKF++TE    + K  + +KL +F   KS D+  S     +    I S + SKR R++  
Sbjct: 852  LKFSLTEFNYLREKFTVLKKLIIFEHYKSHDIECSQRILYSQGEIIASVVPSKRLRTS-P 910

Query: 961  YSAEDTKLLSVRAEKALLSKITYLKICAQKLHNHILSITTTMISNWWHIYGELLNAHKHY 1020
            +  E    +    E+A    + ++ +C   L + I+ +  + +S WW +YGE+ N  K Y
Sbjct: 911  FDNEFNDGID-PFEQA----VDFMCMCLDSLTSKIVEVLDSKVSTWWTLYGEITNLQKEY 965

Query: 1021 TRAFPELANVTTENRDLALHRMIS--NPKRIKLEERLSEKIKDITEQLNSVGHDIKQMHE 1078
             R FPE     + + + +    +S    KR KLE +L  ++   +E L  +  ++K  HE
Sbjct: 966  QRNFPEKGKPNSASSEDSKGFFVSYMEDKRQKLESKLQSRLSVCSENLQHLDAELKHCHE 1025

Query: 1079 LAAEEVSRFIDLKTKFTLEYALQSYLTISKQEH 1111
            L AEE+S FI  K    + + +++Y+    ++H
Sbjct: 1026 LLAEEISFFISSKNFAYMNFMVKAYVNRRIKQH 1058

>YML002W Chr13 (264541..266754) [2214 bp, 737 aa] {ON} Putative
            protein of unknown function; expression induced by heat
            and by calcium shortage
          Length = 737

 Score =  483 bits (1244), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 280/722 (38%), Positives = 424/722 (58%), Gaps = 24/722 (3%)

Query: 399  LAIDADRLMNLFVLVTCRAQIKNLKCHLSYLQNFYNNDSDTKFGILGYALSTLEAVVCYF 458
            + +DAD L++LFVLV CR++ K+LK HL YLQNF NN S TKFGILGYA+STLEAVVCYF
Sbjct: 15   MTMDADTLISLFVLVVCRSEQKHLKSHLYYLQNFSNNSSSTKFGILGYAVSTLEAVVCYF 74

Query: 459  EQL-KEKENYRKLIDFCNSNERLVKVLSS---TKKYETNAALYFLRKYEGSLRYRDSLGQ 514
            E   K   N  K    C   + L+  LS    T + E       L  Y+  L YR+  GQ
Sbjct: 75   EDFNKNTGNVAKANTLCEKTKNLLDKLSCENPTNEVED------LATYKDILTYRNEQGQ 128

Query: 515  SLLALCIIHGRNDFLYHILNEYETLFPIEDLLADESIDGSTLLIQAVKHDNQYSASLLLN 574
            S+L++CI + +N  L  IL+EYE  FP+EDLL DE+IDGSTLLI+++K  N  +A +L+ 
Sbjct: 129  SILSICITNHKNYILLDILSEYENDFPVEDLLEDETIDGSTLLIESIKAGNLEAAKVLIK 188

Query: 575  ILKDNCTEIELIAYINRHDINKRTAGHFLTNELEVLKLMGKYINWVQKDNAGQTPLFTIF 634
            I+  NCTE EL++YIN+ D   RT  H+LT+E+++LK +G YI+W +K+++GQTPLF+IF
Sbjct: 189  IMLFNCTEEELVSYINKTDKYARTVAHYLTHEMDILKSIGNYIDWKRKNSSGQTPLFSIF 248

Query: 635  RSYDQDNYDEMVSQSMEYATNWYGLNGKNFNYLDHVDKKGNTLLHILKCNLPILLADKHI 694
            RSYDQ NY+EMV  + + A  WY  +   F+YLDH D KGN+LLH+LK N+PILL    +
Sbjct: 249  RSYDQPNYEEMVKTAFDIANTWYRKHNSLFDYLDHTDNKGNSLLHVLKTNIPILLQLTKL 308

Query: 695  NVNATNRSGQTPLMTSIRYKRTENIRDLLCDPRLRVDITQKNNALTAFDFSKDDEITHLL 754
            ++N  N  G TPLM  ++YKR  NI  +  D RL ++  Q +   T FD++KD  +   +
Sbjct: 309  DINEENYKGLTPLMVYVKYKRLSNIDAITKDRRLILEKVQNSTFFTCFDYAKDHSVLSKI 368

Query: 755  GEHELLNSPWLAVYAHTLKYTNSRWNLSLT-VKLKDAP-KTTNFTLKTLRGILRVVIKNN 812
            GE  + +S +  +Y H+L+Y N     ++T V   + P  TT   +KT++G+LR ++K+N
Sbjct: 369  GERGVKDSLFGLIYFHSLRYHNLNATTNITSVSNAEKPFATTVINMKTIQGLLRSILKDN 428

Query: 813  MTVFLPVQELVEDLISFNRIRFSELMRIKVLEMLPFISFCLSALVHIKVLDLNVFQTEEN 872
               FLP+   ++++   NR   + + +  V  +L  ++ C + L+ +K +  N+F  E +
Sbjct: 429  PFTFLPLNTYIDEISHLNRSDLTIIGKTDVTSLLHQLTNCFNVLLFLKKIPENLFTDEAS 488

Query: 873  AIKWVKMNGSVDKKTNQTSD-------ITPEDISMIQNFLKFNITEIERTKNKLEIAEKL 925
             + W+++N S   K NQ          + PE+I+MIQ+FL+FN  EI   K  L I  K+
Sbjct: 489  ILYWMRINTS---KRNQKPSGKENPKTMEPEEINMIQSFLRFNFDEISSFKASLNILRKV 545

Query: 926  SLFSRLKSKDLLNSNENYVTIVSQLSSKRFRSTLKYSAEDTKLLSVRAEKALLSKITYLK 985
             +F  LKS D  ++ +    +  +L +    S  K    +  + S  +  ALL  + +L+
Sbjct: 546  LIFINLKSDDFEDAYKGLNEMGRKLINSEASSAFKGIITNHNMFSELSLAALLENVRFLE 605

Query: 986  ICAQKLHNHILSITTTMISNWWHIYGELLNAHKHYTRAFPELA--NVTTENRDLALHRMI 1043
             C  +L + +  I    I NWW  YGE L  HK Y +AFP +      ++    A     
Sbjct: 606  QCTIQLSSFVQIILFEKIPNWWKHYGEFLALHKSYRKAFPNMVKPKSASDTSSRAPLGGF 665

Query: 1044 SNPKRIKLEERLSEKIKDITEQLNSVGHDIKQMHELAAEEVSRFIDLKTKFTLEYALQSY 1103
               KR + E+RL+ +IK  ++ L  +G +I   HE  AEE+S +++ +     + +L ++
Sbjct: 666  IETKREQSEQRLAVQIKASSKMLKELGSEIFVAHERLAEELSNYMEFRKACLDQRSLVAF 725

Query: 1104 LT 1105
             T
Sbjct: 726  AT 727

>Sklu_YGOB_Anc_6.20 Chr5 (89924..92473) [2550 bp, 849 aa] {OFF}
           ANNOTATED BY YGOB -
          Length = 849

 Score =  463 bits (1191), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 297/888 (33%), Positives = 482/888 (54%), Gaps = 74/888 (8%)

Query: 19  AICNCGEPNSSPLKKLYTQLGKKDKYLILVPPTELLLYYSDKESNSELHDLCYTPNFASA 78
           ++ NC  P++SPLKK++  L +  +++++VP   +LL+Y D ++ S L DLCYT  F + 
Sbjct: 15  SVFNCPTPSTSPLKKIFASL-RDQRFILVVPNVNILLHYQDLDTGSSLQDLCYTYEFVAN 73

Query: 79  HILLLDATDTEVNNGDEAVLIKNIEKRYDVHFIKAMDQSWKFINWKNRVIYEFNKL---G 135
           HI++L                            K  DQ +K +N K  +I   N +   G
Sbjct: 74  HIIILKKDS------------------------KYSDQEFKTLNGKTVLIRSQNGIVLTG 109

Query: 136 DQI--KNRAKILDIESIPIFNNYMKTTDNTITIMYIDDVFLNGTLECNLRSDIDLLRSPS 193
           D    K R KI + E    FN+Y+K +     +++ID   ++  ++       D L+   
Sbjct: 110 DGFPSKRRCKITNTELFINFNDYLKGS-KYFPLIHIDKPLMSDAVKN------DELQVFG 162

Query: 194 MRSIPTAKRPSLINKKSTDYENSKSKATFDSILRVNKHWSSKFEQHFQKFRLLANQD--- 250
           +RS  T+  P      STD    +  ++F+ + R++     +F   F++ R   N +   
Sbjct: 163 VRSTNTSSLPL-----STDL-TQREVSSFEQLFRLHPQLGDRFSGLFKEQRQEINANFKG 216

Query: 251 -DLPIDVFHNIIEEMHEEMVSDNLFKNIVDLRNIIYEYVELNLFDDIWKMILRMNKEVEI 309
            D  +D F     E  E +  +  F+N   L   ++ YVELNL+DDIWK I ++ ++ EI
Sbjct: 217 LDSLVDFFDKFNYEAFELIRHERRFENHSKLHQTVHNYVELNLYDDIWKQITQLYRDDEI 276

Query: 310 ----DLNPFGNISIYQVDSEFLSTEYSKFFLENVITAERNIKEASKSLQKIESASNYKSK 365
               D N    I+I QV + F   + SKF L+ V   E+++++A+   +++  +S++  K
Sbjct: 277 EATYDYNLLKYIAISQVPTPFYPEKQSKFSLKKVTHFEKSLEQATDCFKRLAFSSSHSEK 336

Query: 366 ANILILTLRTLTGNKENDGYSSKNDDGNLSFFPLAIDADRLMNLFVLVTCRAQIKNLKCH 425
             I++ TL+TLT         S+  D ++    + IDAD L+ L VLV CR+Q+KNLK H
Sbjct: 337 TKIIMDTLQTLTD-------YSEFPDADIE--DVTIDADTLIGLMVLVVCRSQVKNLKSH 387

Query: 426 LSYLQNFYNNDSDTKFGILGYALSTLEAVVCYFEQLKEKENYRKLIDFCNSNERLVKVLS 485
           L YLQNF  +++  KFG++ YALSTLEAV+CYFE  +     R L   C  N++    LS
Sbjct: 388 LFYLQNFSLDENTIKFGVVAYALSTLEAVLCYFEDAENSGKIRSLEFNCRRNKQFWDHLS 447

Query: 486 STKKYETNAALYF--LRKYEGSLRYRDSLGQSLLALCIIHGRNDFLYHILNEYETLFPIE 543
                    A+ F  L+ Y   LR R + G+S L++CI  G    +  +L  +E   P+E
Sbjct: 448 C-------KAVSFDSLKSYRDILRIRTAGGESCLSVCIQKGNFSGIECLLQNFEHELPLE 500

Query: 544 DLLADESIDGSTLLIQAVKHDNQYSASLLLNILKDNCTEIELIAYINRHDINKRTAGHFL 603
           D+L D++I+GSTLL+Q ++  N   A +LL IL  +CT  EL  Y+NR +  KRTA H+L
Sbjct: 501 DILDDQTINGSTLLMQTLETGNTRMADVLLEILCQSCTINELREYLNRRNRWKRTAAHYL 560

Query: 604 TNELEVLKLMGKYINWVQKDNAGQTPLFTIFRSYDQDNYDEMVSQSMEYATNWYGLNGKN 663
           T +L++   +G + +W  KD +G TPLF IFRSYD  +Y +MV+ +   A+ WY + G+N
Sbjct: 561 TQDLQMADKIGIFFDWEAKDISGHTPLFAIFRSYDHPDYAQMVTNAFRTASKWYEIRGEN 620

Query: 664 FNYLDHVDKKGNTLLHILKCNLPILLADKHINVNATNRSGQTPLMTSIRYKRTENIRDLL 723
           FN+  H D KGNTLLH++K N+ ILL  ++I+VN  N+ G TPLM  ++Y R +N++ +L
Sbjct: 621 FNFSAHKDTKGNTLLHVMKTNIEILLEQENIDVNEVNKKGLTPLMVYVKYNRLDNVKCIL 680

Query: 724 CDPRLRVDITQKNNALTAFDFSKDDEITHLLGEHELLNSPWLAVYAHTLKYTNSRWNLSL 783
            D RL ++  QK+  L  FD+ K+  I   LG H    + +  V AHT ++ N+RW L +
Sbjct: 681 RDNRLIMEKHQKSLFLNCFDYVKNPVIQAELGFHAAEKTKFGEVVAHTFRFENNRWFLWI 740

Query: 784 TVKLKDAP---KTTNFTLKTLRGILRVVIKNNMTVFLPVQELVEDLISFNRIRFSELMRI 840
           T+K KD     +T    ++ ++G+L+V ++ N   FLP+  ++EDL    +     + ++
Sbjct: 741 TLKGKDRETDFQTVKHNIRAIQGLLQVYLRRNPMSFLPIDAVLEDLHEIGKTGLVSVGKL 800

Query: 841 KVLEMLPFISFCLSALVHIKVLDLNVFQTEENAIKWVKMNGSVDKKTN 888
           +V   L  ++  L  +   +     ++    + + W++ +G   K+TN
Sbjct: 801 EVHRFLCELTLVLKLICQKEEFKKALYLPASDLVNWIRESGR--KRTN 846

>NCAS0H00820 Chr8 (148184..151624) [3441 bp, 1146 aa] {ON} Anc_6.20
            YML002W
          Length = 1146

 Score =  469 bits (1206), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 351/1127 (31%), Positives = 586/1127 (51%), Gaps = 86/1127 (7%)

Query: 19   AICNCGEPNSSPLKKLYTQLGKKDK-YLILVPPTELLLYYSDKESNSELHDLCY-TPNFA 76
            +I NC  P++SPLKKLY  L  KDK +++LVPPTE LL Y+D ++  +L DLCY   +F 
Sbjct: 16   SIFNCPNPSNSPLKKLYASL--KDKSFILLVPPTETLLNYTDTKTKIQLEDLCYHNVDFI 73

Query: 77   SAHILLLDATDTEVNNGDEAVLIKNIEKRYDVHFIKAMDQSWKFINWKNRVIYEFNKLGD 136
             AHILL        +    + +     +   +     ++     + W+N  +   +  G 
Sbjct: 74   GAHILLPPKDSISSS---SSTIDDGYTRLASIEQFDTLNGDNILVKWRNNFLVLLS--GS 128

Query: 137  QIKNRAKILDIESIPIFNNYMKTTDNTITI-----MYIDDVFLNGTLECNLRSDIDLLRS 191
              + + KI  I+ +P FN+Y++ +   I +     +  D + LN  LEC    D   L  
Sbjct: 129  PNRQKIKIERIQVLPNFNDYLQGSTYFILVHIDKPLMKDVIRLNDELEC---FDTLTLHD 185

Query: 192  PSMRSIPTAKRPSLINKKSTDYENSKSKATFDSILRVNKHWSSKFEQHFQKFRLLANQDD 251
                S P A RP LI   S        ++ F++I+  N  W+ +F+    +++     ++
Sbjct: 186  NDGDSSPDA-RP-LIQDMS-----QHERSQFENIINTNDTWNKRFKDWMNEYKDSTTAEE 238

Query: 252  LPIDVFHNIIEEMHEEMVSDNLFKNIVDLRNIIYEYVELNLFDDIWKMILRMNK-EVEID 310
                +F  I+   + E+ S+ +FK    LR +I+EY+E+NL+D +W  I  +   + E  
Sbjct: 239  PNETLFKQIVAVAYNELKSNKIFKGFGHLRRLIHEYLEINLYDHLWLQITTLCALDDETK 298

Query: 311  LNPFGNISIYQVDSEFLSTEYSKFFLENVITAERNIKEASKSLQKIESASNYKSKANILI 370
                 NISI ++D +F    Y  F L+ +   E+N+  ++ S+ K+   +++  K+  LI
Sbjct: 299  GTRIKNISIEEIDDKF----YEMFPLDFITKLEKNMVRSTNSINKLNGKNSFNEKSENLI 354

Query: 371  LTLRTLTGNKENDG-YSSKNDDGNLSFFPLAIDADRLMNLFVLVTCRAQIK--NLKCHLS 427
             TL+ LT      G  + +N+ G  +     IDAD L+NL +L+ CR++I   +LK ++ 
Sbjct: 355  ATLQILTNMDNPIGELNQENEKGANNL----IDADTLINLLILIICRSEINIVDLKRNIF 410

Query: 428  YLQNFYNNDSDTKFGILGYALSTLEAVVCYFEQLKEKENYRKLIDFCNSNERLVKVLSST 487
            YL+ F  +++   FGIL Y +ST E V+  FE + E   Y KL  +    E+L+KV    
Sbjct: 411  YLKKFNYDENLINFGILSYTISTFEIVIYSFENIVE---YDKLKSYSEIIEKLIKVDDLK 467

Query: 488  KKYETNAALYFLRKYEGSLRYRDSLGQSLLALCIIHGRNDFLYHILNEYETLFPIEDLLA 547
            K  +T        K+E  L +R   G+S+L  CI + + +    +L +YE +F ++++L 
Sbjct: 468  KVPKT-------IKWEQFLTFRSDTGESILFSCITNNQTEKFLDLLVDYEEIFSMDNILD 520

Query: 548  DESIDGSTLLIQAVKHDNQYSASLLLNILKDNCTEIELIAYINRHDINKRTAGHFLTNEL 607
            D +++G+TLL+QA+ + N   + +L+N+L  NC+  +++ YIN+ D   R  GH+L NEL
Sbjct: 521  DANVEGTTLLMQALIYRNFKISMVLINLLLRNCSNKQIMEYINKIDKFNRNVGHYLINEL 580

Query: 608  EVLKLMGKYINWVQKDNAGQTPLFTIFRSYDQDNYDEMVSQSMEYATNWYGLNGKNFNYL 667
            E+LK++GKY+NW Q+D  G+TPLFTIFR YDQ NYDE++S   +   NWY  NG  F   
Sbjct: 581  EILKIIGKYVNWKQRDLVGRTPLFTIFRGYDQPNYDEVISTVFDITLNWYAENGLKFQMS 640

Query: 668  DHVDKKGNTLLHILKCNLPILLADK-----HINVNATNRSGQTPLMTSIRYKRTENIRDL 722
            DH D K N++LHIL+ N+ IL          I++N  N  G TPLM  ++Y R  N++ +
Sbjct: 641  DHYDLKDNSILHILRSNIDILFTYSKRNHFEIDINKRNYKGFTPLMIYVKYHRLSNVKLI 700

Query: 723  LCDPRLRVDITQKNNALTAFDFSKDDEITHLLGEHELLNSPWLA-VYAHTLKYTNS-RWN 780
            L D RL  +  Q+    T FD++ D  I++ LG+H L N+     +Y H+LK  +S    
Sbjct: 701  LGDDRLLFNRYQRELYTTCFDYATDSTISNELGKHALQNNTVFGRIYIHSLKVRSSTNAT 760

Query: 781  LSLTVKLKDA---PKTTNFTLKTLRGILRVVIKNNMTVFLPVQELVEDLISF-----NRI 832
             SLT  L D      T N  +K +  +L+V+ K +    LP+  +++ L+       N+I
Sbjct: 761  FSLTFPLPDKENETGTVNIKVKAIISLLKVIRKKSQISLLPLDRIIKVLVKLTSKENNKI 820

Query: 833  RFSELMRIKVLEMLPFISFCLSALVH--IKVLDLNVFQTEENAIKWV-----KMNGSVDK 885
               ++  ++   +L  ++ CL  L+   I +  L++   E   + WV     K+  +V+K
Sbjct: 821  IVRKIEMLRNQSLLRRLTDCLDTLLFFDIGIDYLSLITDETKLLGWVTNENTKLKHNVNK 880

Query: 886  KTNQTSDITPEDISMIQNFLKFNITEIERTKNKLEIAEKLSLFSRLKSKDLLNSNENYVT 945
               +   + PEDI++IQ+FLKFN+ E+      ++  EKL  F  LKS D+  S   +V 
Sbjct: 881  THGEKKSLKPEDINIIQSFLKFNVKELYNVLLNVKTLEKLLNFIHLKSIDVKESRLAFVH 940

Query: 946  IVSQLSSKRFRSTLKYSAED-TKLLSVRAE----KALLSKITYLKICAQKLHNHILSITT 1000
            +V  + + +       S E   ++ S+  +      +  ++ +LK C   L  +I  I  
Sbjct: 941  LVKSIKNDQIAQATNRSLEPIIEMQSLENQYYNNTLIRDELDFLKACTLILTGNIEDILR 1000

Query: 1001 TMISNWWHIYGELLNAHKHYTRAFP-------------ELANVTTENRDLALHRMISNPK 1047
            T I NWW +YGELL  +KHY + FP               A V+ +  +  +   +   +
Sbjct: 1001 TQIPNWWKLYGELLELNKHYNKLFPPNHYNNTLATDNQHSAEVSNDVNNGGVFGGLIENQ 1060

Query: 1048 RIKLEERLSEKIKDITEQLNSVGHDIKQMHELAAEEVSRFIDLKTKF 1094
            R K  ++L   I  +   L  +G++I + HE+ AEE++++++ K  F
Sbjct: 1061 RNKAVKKLKTDIDQLKYSLEILGNEIFRKHEMLAEELNKYMEFKGVF 1107

>TPHA0J00330 Chr10 (72684..76007) [3324 bp, 1107 aa] {ON} Anc_6.20
            YML002W
          Length = 1107

 Score =  465 bits (1196), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 339/1114 (30%), Positives = 584/1114 (52%), Gaps = 69/1114 (6%)

Query: 19   AICNCGEPNSSPLKKLYTQLGKKDKYLILVPPTELLLYYSDKESNSELHDLCYTPNFASA 78
            A+ NC +P++SP KKLY +L  KD +L+LVP   +LLYY D  SN    +LCYT +F +A
Sbjct: 15   AVFNCPDPHASPFKKLYNELRDKD-FLLLVPNDFILLYYKDSTSNISFRELCYTYDFVAA 73

Query: 79   HILLLDATDTEVNNGDEAVLIKNIEKRYDVHFIKAMDQSWKFINWKNRVIYEFNKL---G 135
            HIL+LD      N+  + +   N +K  DV+         K +N K  ++ +   +   G
Sbjct: 74   HILILDK-----NSSTDKISSSN-QKNGDVYL--------KSLNGKEVLLRQSLCIPIKG 119

Query: 136  DQIKNRAKILDIESIPIFNNYMKTTDNTITIMYIDDVFLNGTLECNLRSDIDLLRS-PSM 194
               K ++++ D   +  FN+Y+  + +   IM+ID  +  G  +  L   ID L+     
Sbjct: 120  YFSKRKSQMRDATLLTNFNDYLHGSGH-FGIMHID--YPLGVSDWTL---IDELKGFEES 173

Query: 195  RSIP----TAKRPSLINKKSTDYENSKSKATFDSILRVNKHWSSKFEQHFQKFRLLANQD 250
            R +P       +P L+ +     EN   +  F  + +  K W+ + E++ +K++ +    
Sbjct: 174  RELPFHSQDKDKPGLLQRTE---ENKADRVKFIQLFQERKDWTIELEKYLKKYQAMEPLQ 230

Query: 251  DLPIDVFHNIIEEMHEEMVSDNLFKNIVDLRNIIYEYVELNLFDDIWKMILRMNKEVEID 310
            ++  ++FH+I+  ++  +  +  F+   +L +I YEY+E  L+ DIW  +    ++  +D
Sbjct: 231  NIGSELFHDIVNMIYNTLKEEQRFQRFTNLYDIAYEYIESLLYQDIWNKLQEHYRDKILD 290

Query: 311  LNPFGNISIYQVDSEFLSTEYSKFFLENVITAERNIKEASKSLQKIESASNYKSKANILI 370
                  +S+  +D+ F +  +  F L +++  E  + +A    + I+SA++Y  K +++ 
Sbjct: 291  FRLVSQLSLDMLDTTFYNRTFKNFQLIDIVNMEACMVQAVSVFKGIKSANSYSKKVDVIF 350

Query: 371  LTLRTLTGNKENDGYSSKNDDGNLSFFPLAIDADRLMNLFVLVTCRAQIKNLKCHLSYLQ 430
             TL  +TG   +D       D  L   PL IDAD L++LF L+ CRA ++++  H+ YLQ
Sbjct: 351  KTLNIITGKNSDDTIR----DNTLPKLPL-IDADTLVSLFALLLCRAGVEDVFLHVQYLQ 405

Query: 431  NFYNNDSDTKFGILGYALSTLEAVVCYFEQLKEKENYR-KLIDFCNSNERLVKVLSSTKK 489
            +FY +++  KFG LGY LST+EA + YF +L   +  R +L       + L+K+ S    
Sbjct: 406  SFYKDENTVKFGALGYTLSTIEATLSYFYELSNSDESRIQLQKLSLLEDFLIKIRSQ--- 462

Query: 490  YETNAALYFLRKYEGSLRYRDSLGQSLLALCIIHGRNDFLYHILNEYETLFPIEDLLADE 549
               +  L  + +++   RYR   G+S+L+L I + +N+ L   L  +E +FP++DLL D 
Sbjct: 463  ---HDDLIPINQFKDYFRYRTQYGESILSLLIANKKNEALCEALLNFEDIFPLDDLLYDT 519

Query: 550  SIDGSTLLIQAVKHDNQYSASLLLNILKDNCTEIELIAYINRHDINKRTAGHFLTNELEV 609
             + GSTLLI+ +K  N  +A +L+ I +++CT  EL+ Y N+ D  KRT  H++T+E+E+
Sbjct: 520  DVSGSTLLIKCLKERNLEAAEILIEIFQNSCTNSELLNYYNKTDKTKRTLAHYITDEIEI 579

Query: 610  LKLMGKYINWVQKDNAGQTPLFTIFRSYDQDNYDEMVSQSMEYATNWYGLNGKNFNYLDH 669
            L+ +GKYINW  KD  G+T LFTIFRSYDQ  Y   +  +++ A  WY  N   F   DH
Sbjct: 580  LEKIGKYINWTLKDLKGRTALFTIFRSYDQTTYSSTIKIALDQALLWYKNNDIIFKVSDH 639

Query: 670  VDKKGNTLLHILKCNLPILLADKHINVNATNRSGQTPLMTSIRYKRTENIRDLLCDPRLR 729
             D  G++LLHILK  + +LL  + +++N  N  G TPLMT ++Y R +NI+ +L D RL 
Sbjct: 640  TDLFGDSLLHILKSQVSLLLKFEDLDINIPNLKGMTPLMTYVKYNRIDNIKTILEDGRLI 699

Query: 730  VDITQKNNALTAFDFSKDDEITHLLGEHELLNSPWLAVYAHTLKYTNSRWNLSLTVKLKD 789
            +   QK+  L   D+ K+  + +LL      +  +   Y    +Y  S W L ++V+  D
Sbjct: 700  IKKLQKDKYLNCLDYGKNFTVFNLLAAKLSKDVIFENAYISYARYEKSHWYLCISVQKDD 759

Query: 790  APKTTNFT-LKTLRGILRVVIKNNMTVFLPVQELVEDL---ISFNRIRFSELMRIKVLEM 845
               TTN   LK    ++  + K   + F+P  ++++ L   I  + I    + R+K+   
Sbjct: 760  LEYTTNIIKLKKYYNLINAMQKIYKSDFIPYSDMLDCLKKIIEGHNIL--PIRRLKIKNY 817

Query: 846  LPFISFCLSALVHIKVLDLNVFQTEENAIKWV-----KMNGSVDKKTNQTSDITPEDISM 900
            L F+S  LSAL++ + +D      E   IKW+     +   S+D  ++    ++ EDI+ 
Sbjct: 818  LNFLSHGLSALLYFEKIDPLTLLDENLIIKWISSKLQQQEKSIDDHSS-FKPLSAEDINN 876

Query: 901  IQNFLKFNITEIERTKNKLEIAEKLSLFSRLKSKDLLNSNENYVTIVSQLSSKRFRSTLK 960
            I+ F  F+  EI +T N ++   KLS+F  +K+ DL   N +Y  I+ +L S    + + 
Sbjct: 877  IKAFCDFSFQEIGKTNNVIQSFLKLSIFGEIKNTDL---NTSY-DILERLGSYFSNNEIS 932

Query: 961  YSAEDTKLLSVRAEKALL-----SKITYLKICAQKLHNHILSITTTMISNWWHIYGELLN 1015
             +  D + +S     +++       I ++K C   L + + S     +S W     +LL 
Sbjct: 933  RTLGDLQSISPHVHSSMVYYELSQDILFMKKCTLILTSKLASFIKDKLSIWLKKNTKLLE 992

Query: 1016 AHKHYTRAFPELANVTTEN--RDLALHRMISNPKRIKLEE-RLSEKIKDITEQLNSVGHD 1072
              K Y+  F + +N  T N   + ++ R   N    K EE RL   + ++   L  +G +
Sbjct: 993  HRKEYSIKFLQ-SNEETGNLSENTSVFRYAWNVTYRKEEERRLKFAMLELERDLKKLGTE 1051

Query: 1073 IKQMHELAAEEVSRFIDLKTKFTLEYALQSYLTI 1106
            I+  HE  AEE S ++ +K+KF     ++ ++++
Sbjct: 1052 IRVKHEELAEEFSDYVRMKSKFNSNLLVRKFVSL 1085

>Ecym_3024 Chr3 (46949..50188) [3240 bp, 1079 aa] {ON} similar to
            Ashbya gossypii ACR006C
          Length = 1079

 Score =  461 bits (1187), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 333/1114 (29%), Positives = 562/1114 (50%), Gaps = 90/1114 (8%)

Query: 19   AICNCGEPNSSPLKKLYTQLGKKDKYLILVPPTELLLYYSDKESNSELHDLCYTPNFASA 78
            A+ NC  P +SPLKKL+  + K  ++++LVP T++LL Y D +S   L +LCY  +F ++
Sbjct: 15   AVFNCPTPTTSPLKKLFNNV-KGQRFILLVPSTDVLLQYQDLDSGLPLSELCYNYDFVAS 73

Query: 79   HILLLDATDTEVNNGDEAVLIKNIEKRYDVHFIKAMDQSWKFINWKNRVIYEFNKLGDQI 138
            HIL+                         +   K  +Q ++ +N  N VI          
Sbjct: 74   HILI------------------------QLQESKVTEQEYRTLN-GNSVIIRSQAGIVMS 108

Query: 139  KNRAKILDIESIPIFNNYMKTTDNTI--TIMYIDDVFLNGTLECNLRSDIDLLRSPSMRS 196
            K   +   ++S  +  N+     N I   +++ID   + G L  N   ++ +  S  M +
Sbjct: 109  KPELRKCRVKSYEVLRNFNDYLSNVIYFPLLHIDRPLV-GALVRN--DELQVFGSYEMHN 165

Query: 197  IPTAKRPSLINKKSTDYENSKSKATFDSILRVNKHWSSKFEQHFQK----FRLLANQDDL 252
               +K  + I         S++   F+  +R+     ++ + +FQ+     R   +Q D 
Sbjct: 166  PSKSKTINTI---------SENHIPFEKFIRLYPQLGAQLDGYFQRDRQRIRNEVDQLDK 216

Query: 253  PIDVFHNIIEEMHEEMVSDNLFKNIVDLRNIIYEYVELNLFDDIWKMILRMNKEVEID-L 311
             I +F +++ +++  +  D  F+N ++L N+  EYVELN+++DIW  ++++N   E D +
Sbjct: 217  LIKIFKDLVIDVYGVIKEDKNFRNYMELLNVTQEYVELNMYEDIWLKLVQLNGSKEPDRV 276

Query: 312  NPFGN---ISIYQVDSEFLSTEYSKFFLENVITAERNIKEASKSLQKIESASNYKSKANI 368
            + + +   IS+  V +       + F L  V   E+ + +A+    K+   +++  KA I
Sbjct: 277  SGYSSTKYISLNNVATILYPEGTNSFDLRVVTEVEKRVVKATDCFAKLSLTNSHNEKAKI 336

Query: 369  LILTLRTLTGNKENDGYSSKNDDGNLSFFPLAIDADRLMNLFVLVTCRAQIKNLKCHLSY 428
            ++ T + LT   E   Y+S +           IDAD L+ L ++V CR+Q+KNLK HL Y
Sbjct: 337  VVSTFQILTTKME---YTSIDP---------TIDADTLIGLMLVVLCRSQVKNLKSHLEY 384

Query: 429  LQNFYNNDSDTKFGILGYALSTLEAVVCYFEQLKEKENYRKLIDFCNSNERLVKVLSSTK 488
            L+ F     D KFG+ GY+LST+EAV+ YFE     E  +KLI    +N     ++ S  
Sbjct: 385  LREFAPRPDDVKFGLTGYSLSTIEAVLAYFEAGDGTEKLKKLISLSEANRVFWDLIRS-- 442

Query: 489  KYETNAALYFLRKYEGSLRYRDSLGQSLLALCIIHGRNDFLYHILNEYETLFPIEDLLAD 548
                      L  Y+ SL  R S  +S L++CI  GR D +  IL  Y+    +EDLL D
Sbjct: 443  -----GVAVSLSSYKNSLISRSSNCESSLSICIHAGRLDLIKEILLNYQEQIKLEDLLFD 497

Query: 549  ESIDGSTLLIQAVKHDNQYSASLLLNILKDNCTEIELIAYINRHDINKRTAGHFLTNELE 608
             +   STLLIQA++  +   A LL++++  NCT  E   Y+NR +   RT  H+L     
Sbjct: 498  VNQANSTLLIQALETGHDEIAELLIDVMISNCTNNEFYEYVNRSNSAGRTVAHYLPQAFS 557

Query: 609  VLKLMGKYINWVQKDNAGQTPLFTIFRSYDQDNYDEMVSQSMEYATNWYGLNGKNFNYLD 668
            +++ +G Y++W +KD    TPLF I R+YDQ +Y EM+S+S EY   +    G++F++ D
Sbjct: 558  IIEKIGLYLDWRKKDVNMHTPLFIICRAYDQLHYSEMLSRSFEYVFEYCRRRGEDFSFTD 617

Query: 669  HVDKKGNTLLHILKCNLPILLADKHINVNATNRSGQTPLMTSIRYKRTENIRDLLCDPRL 728
            H D  GN+LLHI+K  +  +L+  +INVN +N  G TPLM   +Y R ENIRD+L D RL
Sbjct: 618  HEDPMGNSLLHIMKGGIQSILSQPNINVNKSNIKGMTPLMLYAKYNRIENIRDILEDKRL 677

Query: 729  RVDITQKNNALTAFDFSKDDEITHLLGEHELLNSPWLAVYAHTLKYTNSRWNLSLTVKLK 788
             V   Q    L A D+ K+  I +L+G H   NS +  + A  +K+ ++ W L +TVK  
Sbjct: 678  IVSKIQNPQTLKAIDYVKNPMILNLIGTHIAKNSLYGLLSADGIKFEDNCWYLWITVKFS 737

Query: 789  D-APKTTNFTLKTLRGILRVVIKNNMTVFLPVQELVEDLISFNRIRFSELMRIKVLEMLP 847
            D +  T   ++K ++G+L+   K +   FLP+  ++  L +  +     ++ ++    L 
Sbjct: 738  DNSYSTLRQSVKNIQGLLQFYNKKHPMNFLPIDHILSILKNIGKPGILPVINLENSIFLG 797

Query: 848  FISFCLSALV----HIKVLDLNVFQTEENAIKWVKMNGSVDKKTNQTSDITPEDISMIQN 903
             ++  LS +     ++ VL  N    E +   W++ N +   + N+   I PE++S IQ+
Sbjct: 798  LLTQLLSVIGQRNEYMAVLRYN----ESDLSTWLRTN-NFKPRANKDERIEPEEVSSIQS 852

Query: 904  FLKFNITEIERTKNKLEIAEKLSLFSRLKSKDLLNSNE---NYVTIVSQLSSKRFRSTLK 960
            FLKFN++E    K K  I  KL +F  LK++D+  +       + IVS         T  
Sbjct: 853  FLKFNLSEFSEIKEKFTILRKLVVFQSLKAQDIECAQRIIYQQMEIVSNSVGPSVEKTFI 912

Query: 961  YSAEDTKLLSVRAEKALLSKITYLKICAQKLHNHILSITTTMISNWWHIYGELLNAHKHY 1020
             S E+  L S +        I ++ +C + L + I  +  + ++ WW +YGEL +  + Y
Sbjct: 913  GSNENYSLDSFQ------QAIEFIAMCLETLSSKIQYVLDSKVTLWWRLYGELSSLRREY 966

Query: 1021 TRAFP---ELANVTTENRDLALHRMISNPKRIKLEERLSEKIKDITEQLNSVGHDIKQMH 1077
             R FP   + ++V+ E         I   KR K E++L  +++    +L ++  ++K+ H
Sbjct: 967  QRNFPSDFKSSDVSGEESKGFFESYIEG-KRQKTEDKLQARLRVCITKLQTLSGELKKDH 1025

Query: 1078 ELAAEEVSRFIDLKTKFTLEYALQSYLTISKQEH 1111
            E  AEE+S F+  K      + +++Y  I  + H
Sbjct: 1026 ENLAEEISFFVTFKNFAYESFVMKTYANICIKHH 1059

>KLTH0C11242g Chr3 complement(921970..925263) [3294 bp, 1097 aa] {ON}
            similar to uniprot|Q04263 Saccharomyces cerevisiae
            YML002W Hypothetical ORF
          Length = 1097

 Score =  457 bits (1175), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 339/1112 (30%), Positives = 562/1112 (50%), Gaps = 88/1112 (7%)

Query: 19   AICNCGEPNSSPLKKLYTQLGKKDKYLILVPPTELLLYYSDKESNSELHDLCYTPNFASA 78
            A+ NC  P +SPL+K++T++ +K ++ ++ P  E+LL Y D ES S L DLCY+ +F S 
Sbjct: 15   AVFNCPTPQNSPLRKVFTRI-EKQRFALVTPTPEILLEYEDLESGSSLQDLCYSASFVSD 73

Query: 79   HILLLDATDTEVNNGDEAVLIKNIEKRYDVHFIKAMDQSWKFINWKNRVIYEFNKLGDQI 138
            HILLL                 + E+ Y          S K I  +N+    F   G   
Sbjct: 74   HILLLGGGGC------------SHEEEYKT-------LSGKTITLRNQQKALFTGEGFDA 114

Query: 139  KNRAKILDIESIPIFNNYMKTTDNTITIMYIDDVFLNGTLECNLRSDIDLLRSPSMRSIP 198
            + R ++L+ E +  FN Y + + +T  I+++D   L G L    R D      P  ++  
Sbjct: 115  RRRCQVLETELLSNFNEYFQGS-STYPIIHVD-FPLTGRLA---RRD----EWPGFKAYR 165

Query: 199  TAKRPSLINKKSTDYENSKSKATFDSILRVNKHWSSKFEQHFQKFRLLA-----NQDDLP 253
             A   +  +  S+   +++ KA+ + +LR +  +  K     +  R        N D+L 
Sbjct: 166  FASTDT-TSANSSLAASTEPKASLEQMLRAHPSYGDKLSAIIRTQRAALSSSTYNADNLA 224

Query: 254  IDVFHNIIEEMHEEMVSDNLFKNIVDLRNIIYEYVELNLFDDIWKMILRMNKEVEI---- 309
               F    E+    +  D  F+   +LR  I+EYVE+NL+DD W  +    K+ EI    
Sbjct: 225  AH-FMQTCEKALAAIQEDQSFRAFPNLRLQIHEYVEMNLYDDFWAQLTNSLKDSEIENQS 283

Query: 310  DLNPFGNISIYQVDSEFLSTEYSKFFLENVITAERNIKEASKSLQKIESASNYKSKANIL 369
            D +   NISI QV S    T+  KF +  V   E+N++EA + L+++   +++ SKA ++
Sbjct: 284  DFSILRNISISQVPSFLYPTDRQKFDIRCVTQVEKNLREAVECLRRLPVTNSHSSKAKVI 343

Query: 370  ILTLRTLTGNKE-NDGYSSKNDDGNLSFFPLAIDADRLMNLFVLVTCRAQIKNLKCHLSY 428
            + TL+T++ + E ND               +++DAD L++L V+V C+A++K+LK HL Y
Sbjct: 344  VETLQTVSRSLEINDKV-------------ISVDADTLVSLLVVVVCQAEVKDLKSHLFY 390

Query: 429  LQNFYNNDSDTKFGILGYALSTLEAVVCYFEQLKEKENYRKLIDFCNSNERLVKVLSSTK 488
            LQ F  + +   FGIL Y +STLEAV+ YFE    +E  + L   C+SN    + L+  K
Sbjct: 391  LQEFAKDSNSITFGILAYGMSTLEAVLSYFES---REKLKLLEKHCSSNASYWEALADGK 447

Query: 489  KYETNAALYFLRKYEGS--LRYRDSLGQSLLALCIIHGRNDFLYHILNEYETLFPIEDLL 546
                   L  L   E    LR R   G S L++C+ + + +   H+  ++E  FP+EDLL
Sbjct: 448  -----LPLGSLNPSEVKDILRTRTPAGLSCLSICLQNRQPNLFLHLATKFEHCFPLEDLL 502

Query: 547  ADESIDGSTLLIQAVKHDNQYSASLLLNILKDNCTEIELIAYINRHDINKRTAGHFLTNE 606
             DE+++GS LLIQ + +     +   + +L  +CT+ EL +++N  +  +R++GH+L + 
Sbjct: 503  NDETVEGSNLLIQMLDNGCSSLSGNFIEMLFRSCTKTELESFLNHVNRYQRSSGHYLMHA 562

Query: 607  LEVLKLMGKYINWVQKDNAGQTPLFTIFRSYDQDNYDEMVSQSMEYATNWYGLNGKNFNY 666
            L+++  +GK+INW Q+D  G TPLF I R+YD  +YD MV ++ + A  W  L GK F  
Sbjct: 563  LDLIVKVGKFINWEQRDCNGHTPLFAIIRTYDHTDYDAMVLEAYKSARLWCTLKGKQFRL 622

Query: 667  LDHVDKKGNTLLHILKCNLPILLADKHINVNATNRSGQTPLMTSIRYKRTENIRDLLCDP 726
              H D KGNTLLH++K N+ ++L D  +NVN+ N+ G TP+M   RY R +NI+ +L D 
Sbjct: 623  SKHQDNKGNTLLHVIKSNVSVVLDDPLVNVNSFNKKGLTPIMVYARYNRLDNIKSILRDK 682

Query: 727  RLRVDITQKNNALTAFDFSKDDEITHLLGEHELLNSPWLAVYAHTLKYTNSRWNLSLTV- 785
            RL +   Q  + LT FD+ K+  +   LG+H         + AH +K+    W L +T+ 
Sbjct: 683  RLIIQKCQNGSYLTCFDYIKNPVVLGELGKHAFFLPQSYQIRAHNIKFEGDEWVLWMTLV 742

Query: 786  -KLKDAP-KTTNFTLKTLRGILRVVIKNNMTVFLPVQELVEDLISFNRIRFSELMRIKVL 843
              + +AP K    +LK ++  L    K N   F+P + L E+L    +++   + R++  
Sbjct: 743  GSVPNAPAKVIQRSLKFIQSFLISFSKTNSMTFIPAESLAEELSLLAKMKIISINRLETK 802

Query: 844  EMLPFISFCLSALVHIKVLDLNVFQTEENAIKWVKMNGSVDKKTNQTSDITPEDISMIQN 903
              L   S  LS +   +  + ++F     ++     +    +  +    I PE+++ IQ 
Sbjct: 803  HFLRRASVVLSLICRQEEFE-HIFNNPSGSLVNAAEHVQEQEANSTYGMIEPEEVASIQK 861

Query: 904  FLKFNITEIERTKNKLEIAEKLSLFSRLKSKDL------LNSNENYVTIVSQLSSKRFRS 957
             +KFN TEI   K+   + +KL++F  LK KDL        S+ N  T +   S+  F S
Sbjct: 862  IMKFNRTEILAIKSGALMLKKLAIFGILKGKDLERSHTMFQSHGNNFTKIIGRSTNVFGS 921

Query: 958  TLKYSAEDTKLLSVRAEKALL---SKITYLKICAQKLHNHILSITTTMISNWWHIYGELL 1014
             LK+S    +   +    ALL   S++   KI   K+ NH        I +WW  YGEL+
Sbjct: 922  -LKHSLPQCEFGYLANNTALLELSSRLLVQKI--DKILNH-------DIPHWWKTYGELV 971

Query: 1015 NAHKHYTRAFPELANVTTENRDLALHRMISNPKRIKLEERLSEKIKDITEQLNSVGHDIK 1074
            +    Y + FP+            +   I   KR++LE+ L  +I   ++ L      ++
Sbjct: 972  SLRHEYNKNFPDDVRPRVAENTGFISSYIET-KRVRLEQGLVGRINRSSKNLLRFSLMLR 1030

Query: 1075 QMHELAAEEVSRFIDLKTKFTLEYALQSYLTI 1106
            + +E  A E++ FI+ K +F +   ++ +  +
Sbjct: 1031 RSNESLAVELNNFINFKAEFWVSATIKEHAAM 1062

>Kwal_56.22424 s56 (121475..124744) [3270 bp, 1089 aa] {ON} YML002W -
            Hypothetical ORF [contig 185] FULL
          Length = 1089

 Score =  444 bits (1143), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 340/1097 (30%), Positives = 542/1097 (49%), Gaps = 83/1097 (7%)

Query: 19   AICNCGEPNSSPLKKLYTQLGKKDKYLILVPPTELLLYYSDKESNSELHDLCYTPNFASA 78
            A+ NC  P +S LKK+++ + +K +++++ PPTELLL Y D ES   L DLCY   F S 
Sbjct: 15   AVFNCPTPLNSSLKKVFSAI-EKVRFVLIAPPTELLLEYEDLESGLPLQDLCYATGFVSD 73

Query: 79   HILLLDATDTEVNNGDEAVLIKNIEKRYDVHFIKAMDQSWKFINWKNRVIYEFNKLGDQI 138
            HI+LLD        G E +     E+ Y     K +      +  +  +I  F       
Sbjct: 74   HIVLLD--------GREGLQ----EEEY-----KTLSGKTILLRSQQGII--FTAAAFDT 114

Query: 139  KNRAKILDIESIPIFNNYMKTTDNTITIMYIDDVFLNGTLECNLRSDIDLLRSPSMRSIP 198
            + R +I   E +  FN Y+K  D T  I+++D   L G L           R    +   
Sbjct: 115  RRRCRIQRAELLTNFNEYLKG-DTTFPIIHVD-FPLTGRLA----------RRDEWQCFR 162

Query: 199  TAKRPSLIN--KKSTDYENSKSKATFDSILRVNKHWSSKFEQHFQKFRLLANQDDLPI-- 254
              K     N  K S    +  +  + + +LR+N  +        +  R+  N        
Sbjct: 163  VTKNQEHTNGPKNSGKLSHGDNNISLEQLLRINPEYGESLNDIVKAQRISLNSSVTGTTH 222

Query: 255  --DVFHNIIEEMHEEMVSDNLFKNIVDLRNIIYEYVELNLFDDIWKMILRMNKEVEI--- 309
                F    ++  + + +   F+ + +L   ++EY+ELNL+DD W  +    ++ EI   
Sbjct: 223  LASHFVQTCKKALDVVRAYPAFQVLPNLPICVHEYIELNLYDDYWAQLTNSLRDSEIESS 282

Query: 310  -DLNPFGNISIYQVDSEFLSTEYSKFFLENVITAERNIKEASKSLQKIESASNYKSKANI 368
             D +   +IS+ QV S    +   KF L  +  AE+N+K A +S +KI   + + +KA +
Sbjct: 283  SDYSLLKHISVSQVPSFLYPSNPEKFDLRLITQAEKNVKGAVESFRKIAVTNCHSAKAKV 342

Query: 369  LILTLRTLTGNKENDGYSSKNDDGNLSFFPLAIDADRLMNLFVLVTCRAQIKNLKCHLSY 428
            +I TL+TL+ +   D  +            + IDAD L++LFV+V C AQ+K+L+ HL Y
Sbjct: 343  IIETLQTLSRSLLVDDRA------------VTIDADTLVSLFVVVVCHAQVKDLRSHLFY 390

Query: 429  LQNFYNNDSDTKFGILGYALSTLEAVVCYFEQLKEKENYRKLIDFCNSNERLVKVLSSTK 488
            LQ F  + +   FGIL Y +STLEAV+CYFE     E    L  +C +N    K +S   
Sbjct: 391  LQEFTKDTNLVTFGILAYGMSTLEAVLCYFES---PEKVASLEKYCRANLSHWKSISEGS 447

Query: 489  ---KYETNAALYFLRKYEGSLRYRDSLGQSLLALCIIHGRNDFLYHILNEYETLFPIEDL 545
                 +T   L      +  L+ R S GQS LA+C+ H R +    I N  E  FP+EDL
Sbjct: 448  IDLNADTTVPL------DDLLKIRTSDGQSCLAVCLQHRRTEEFELIKNTREAWFPLEDL 501

Query: 546  LADESIDGSTLLIQAVKHDNQYSASLLLNILKDNCTEIELIAYINRHDINKRTAGHFLTN 605
            L DE+ DGS LLI  ++      A +L+N L  NCT+ ELIA++N  +  +R+ GH+L +
Sbjct: 502  LHDETTDGSNLLIHMLESGCDRLAVMLINTLISNCTKDELIAFLNHTNKYQRSCGHYLMH 561

Query: 606  ELEVLKLMGKYINWVQKDNAGQTPLFTIFRSYDQDNYDEMVSQSMEYATNWYGLNGKNFN 665
              +++ L+G  +NW Q+D  G TPLF I R+YD+ +Y +MVS +   A     +    F 
Sbjct: 562  APQLIDLVGDILNWEQRDCNGHTPLFAIVRAYDRPDYFDMVSAAYRAAVGQSKVRNSRFR 621

Query: 666  YLDHVDKKGNTLLHILKCNLPILLADKHINVNATNRSGQTPLMTSIRYKRTENIRDLLCD 725
              +H D KGNTLLH++K ++ ILLAD  I+VNATN  G TPLM  +RY R  N+R +L D
Sbjct: 622  VSNHTDDKGNTLLHVIKSDVSILLADPFIDVNATNAKGLTPLMVYVRYNRIGNVRTILQD 681

Query: 726  PRLRVDITQKNNALTAFDFSKDDEITHLLGEHELLNSPWLAVYAHTLKYTNSRWNLSLTV 785
             RL +   Q    L+ FD+ K+  +   LG++        ++  H++K     W L +TV
Sbjct: 682  QRLIIGKHQSGAYLSCFDYVKNPAVLKELGKYASYLPFEFSINVHSVKREGDEWVLWITV 741

Query: 786  KL--KDAP-KTTNFTLKTLRGILRVVIKNNMTVFLPVQELVEDLISFNRIRFSELMRIKV 842
                K  P K    +L+ ++  L +    +   F+PV EL+ +L + ++ R   L ++  
Sbjct: 742  TGGEKQVPVKVFKRSLRFIQAFLTLFSDAHPMTFVPVDELLRELRALSQSRILILNKMDT 801

Query: 843  LEMLPFISFCLSALVHIKVLDLNVFQTEENAIKWVKMNGSVDKKTNQTSDITPEDISMIQ 902
               L   S  LS +V  + L  + F      +   +  GS +  T     + PE++  IQ
Sbjct: 802  KRFLKRCSVTLS-MVSQERLFADAFTDSNLNLSSSRGLGSSESFTQNMKMMEPEEVRSIQ 860

Query: 903  NFLKFNITEIERTKNKLEIAEKLSLFSRLKSKDLLNSNENYVTIVSQLSSKRFRSTLKYS 962
            + LKFN++EI   K  + + +KL++F  LK KDL  +   +      ++  + +S   + 
Sbjct: 861  SILKFNLSEISALKTAMLLMKKLAVFEGLKGKDLSEACMTFGAKCKYVTQGKIQSFDHF- 919

Query: 963  AEDTKLLSVRAE-----KALLSKITYLKICAQKLHNHILSITTTMISNWWHIYGELLNAH 1017
                  L+V+A      + + + I   ++C+  L  HI  +    I  WWH YGELL+  
Sbjct: 920  ------LNVQAPNLFDFEGIANNIALCELCSSLLCKHIGQVLNDDIPKWWHTYGELLSLR 973

Query: 1018 KHYTRAFPELANVTTENRDLALHRMISNPKRIKLEERLSEKIKDITEQLNSVGHDIKQMH 1077
            + Y ++FP+ AN    + +  L       KR KLE+  + +I   + +L+ +   I Q +
Sbjct: 974  REYKKSFPD-ANRPHVSENSGLFGSYIETKRTKLEQSYAARINHTSVRLSEISTKINQDN 1032

Query: 1078 ELAAEEVSRFIDLKTKF 1094
            E  A E++ FI+ K +F
Sbjct: 1033 ERLAVELNNFINFKNEF 1049

>KLLA0D01133g Chr4 (101580..104783) [3204 bp, 1067 aa] {ON} some
            similarities with uniprot|Q04257 Saccharomyces cerevisiae
            YML002W and some similarities with uniprot|Q04257
            Saccharomyces cerevisiae YML003W Hypothetical ORF
          Length = 1067

 Score =  404 bits (1039), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 320/1129 (28%), Positives = 550/1129 (48%), Gaps = 102/1129 (9%)

Query: 19   AICNCGEPNSSPLKKLYTQLGKKDKYLILVPPTELLLYYSDKESNSELHDLCYTPNFASA 78
            AI NC  P +S LK+++++L   +++ ILVP TE LL + D ES  EL +LCY  +F ++
Sbjct: 15   AIFNCPSPKTSSLKQMFSRLDD-ERFFILVPSTETLLQFQDLESGLELAELCYHYDFVAS 73

Query: 79   HILLLDATDTEVNNGDEAVLIKNIEKRYDVHFIKAMDQSWKFINWKNRVIYEFNKLGDQI 138
            HI+++     +V +             Y+  F     +    I ++N  I      GD  
Sbjct: 74   HIVVIKDPTKDVPDQRSI---------YNTDFTTLNGRKLS-IRYRNSTIVT----GDGF 119

Query: 139  KNRAKIL--DIESIPIFNNYMKTTDNTITIMYIDDVFLNGTLECNLRSDIDLLRSPSMRS 196
              R KI   +I  +P FN+Y+K ++ T  I++I            L  D+  L    + S
Sbjct: 120  TERRKITIKEINLLPTFNDYLKGSNYT-PILHIS---------MPLCGDLVPLDELQVFS 169

Query: 197  IPTAKRPSLINKKSTDYENSKSKATF-----DSILRVNKHWSSKFEQHFQKFRLLANQDD 251
                 + S   +    ++  + K  +      SI  V +  +  F  H  K R+      
Sbjct: 170  KVAGNKYSKQEQAPLPFDEEQKKVLYFEQRIQSISDVAERVALTF--HLTKARIKKAISV 227

Query: 252  LPIDV-FHNIIEEMHEEMVSDNLFKNIVDLRNIIYEYVELNLFDDIWKMILRMNKEVEI- 309
            + I   + N  + + + +  D    ++ DL  +IY+YVEL LF DI + +  + ++ E+ 
Sbjct: 228  IGIRTEWLNTRDSIRQIISLDKRLNHLEDLDAMIYDYVELKLFTDIQQQLSEIVEDQELE 287

Query: 310  ---DLNPFGNISIYQVDSEFLSTEYSKFFLENVITAERNIKEASKSLQKIESASNYKSKA 366
               D     +IS+ QV + F   +   F L +V+  E+++ +A + L+ I+  + +  K 
Sbjct: 288  HRFDFKALRSISLNQVPTNFYPKDEKSFSLASVVELEKSVNDALEYLKSIDLKTTHSGKL 347

Query: 367  NILILTLRTLTGNKENDGYSSKNDDGNLSFFPLAIDADRLMNLFVLVTCRAQIKNLKCHL 426
             +L  T+R L+  +E +G S+              DAD L++LFVL+ CR+Q+  L   L
Sbjct: 348  EVLSTTMRLLS--REINGIST--------------DADTLLSLFVLLICRSQVTGLVRTL 391

Query: 427  SYLQNFYNNDSDTKFGILGYALSTLEAVVCYFEQLKEKENYRKLIDFCNSNERLVKVLSS 486
            +YL NF  +++  KFG+ GY LST EA + +F Q    +    L   C SN+++   +  
Sbjct: 392  TYLTNFEISETSIKFGLQGYVLSTFEAALSFFHQ----DTVDSLTKKCASNKKIWASIQK 447

Query: 487  TKKYETNAALYFLRKYEGSLRYRDSLGQSLLALCIIHGRNDFLYHILNEYETLFPIEDLL 546
              K E             +LR R   G+SLL++CI    N+ L  +L  +E+ FP+ED+L
Sbjct: 448  HSKVEAELL-------SSNLRIRTDSGESLLSICIQSHNNEVLTTLLANFESEFPLEDIL 500

Query: 547  ADESIDGSTLLIQAVKHDNQYSASLLLNILKDNCTEIELIAYINRHDINKRTAGHFLTNE 606
             D     STLLIQA++  N  +A++L  I+  +CTE E+ +Y+N  +++ R   H++  +
Sbjct: 501  DDRDFALSTLLIQALQVQNSQAAAILSEIILKSCTESEVRSYLNSPNLHNRITAHYIMQD 560

Query: 607  LEVLKLMGKYINWVQKDNAGQTPLFTIFRSYDQDNYDEMVSQSMEYATNWYGLNGKNFNY 666
            + +L+ +G+Y NW  KD  G TPLF +FRSYD  NYDE+V++ ++    WY  N K FN+
Sbjct: 561  ISLLESVGRYFNWEHKDINGHTPLFAVFRSYDAVNYDEIVTKVLDQVVKWYANNNKPFNF 620

Query: 667  LDHVDKKGNTLLHILKCNLPILLADKHINVNATNRSGQTPLMTSIRYKRTENIRDLLCDP 726
              H D KGNTLLH++K  +  LL    +NVN  +  G TPLM   RY R  NI  ++ D 
Sbjct: 621  KIHEDPKGNTLLHVMKSGIESLLKLPDVNVNKPDSKGLTPLMIYSRYNRITNIETIMKDE 680

Query: 727  RLRVDITQKNNALTAFDFSKDDEITHLLGEHELLNSPWLAVYAHTLKYTNSRWNLSLTVK 786
            RL  D+ Q+   +T+ DF+K+ ++T  + +      P   V  H+L++   +W + +   
Sbjct: 681  RLLCDLVQQPLVMTSLDFTKNPKVTKTILDATFNREP---VVIHSLRFEERKWKIGIF-- 735

Query: 787  LKDAPKTTNFTLKTLRGILRVVIKNNMTVFLPVQELVEDLISFNRIRFSELMRIKVLEML 846
                     ++L  ++  LR +       F PVQ L  +L          ++R++     
Sbjct: 736  --SEGIFKKYSLDLIQYYLRYLKIMYPCSFHPVQLLTNELRLLGIYGVPGVLRLQSYHTF 793

Query: 847  PFISFCLSALVHIKVLDLNVFQTEENAIKWVKMNGSVDKKTNQTSDITPEDISMIQNFLK 906
              +    S +     L L   + EE     + +      ++ +   + PE+I+ IQ FLK
Sbjct: 794  KKLDMLFSYVNTRGKLWLG--KDEEELKVLLDVPTPYLSESERFIKLEPEEINGIQTFLK 851

Query: 907  FNITEIERTKNKLEIAEKLSLFSRLKSKDLLNSNENYVTIVSQLSSKRFRSTLKYSAEDT 966
            +N+ E ++ +N L I +KL++  ++K +D++    +++++ +Q+S K     +  S E+T
Sbjct: 852  YNLAEFQKLRNCLIILKKLAIVQQIKHRDVITMRNSFLSLGNQMSQK----GVAKSFENT 907

Query: 967  KLLSVR--AEKALLSKITYLKICAQKLHNHILSI--TTTMISNWWHIYGELLNAHKHYTR 1022
                    +       + YL+     L N+  S+   TT+   WW  +GEL+   K + +
Sbjct: 908  NCAWSYDLSYYEFTRNLEYLEHSVVTLLNNFESLLAKTTL---WWKHFGELMELKKEWKK 964

Query: 1023 AFP-ELANVTTENRDLALHRMISNPKRIKLEERLSEKIKDITEQLNSVGHDIKQMHELAA 1081
             FP + A  ++ NR+  +   I   KR K   +LS ++K  +  L  +G +IK  HE  A
Sbjct: 965  NFPNDKAPPSSANRNF-IDTYIEG-KRSKFRNKLSNQLKMSSLNLKKIGGEIKTTHESIA 1022

Query: 1082 EEVSRFIDLKTKFTLEYALQSYLTISKQEHIEKDRLHWEFQENKTVFKQ 1130
              ++ FI+ K +F               +HI K  +    +ENK + +Q
Sbjct: 1023 VGINLFIEFKEQFY-------------HDHIVKSIVDQRIRENKQIMQQ 1058

>NDAI0D00800 Chr4 (177862..181443) [3582 bp, 1193 aa] {ON} Anc_6.20
            YML002W
          Length = 1193

 Score =  379 bits (974), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 360/1205 (29%), Positives = 578/1205 (47%), Gaps = 194/1205 (16%)

Query: 19   AICNCGEPNSSPLKKLYTQLGKKDKYLILVPPTELLLYYSDKESNSELHDLCY-TPNFAS 77
            A+ NC +P+ SP KKL+T L K  ++++LVPPT  LL Y+D      L++LCY   +F  
Sbjct: 16   AVFNCPDPSHSPFKKLFTTL-KNQQFILLVPPTSTLLNYTDSYYKLSLNELCYHNSDFLG 74

Query: 78   AHIL----LLDAT-DTEVNNGDEAVLIKNIEKRYDVHFIKAMDQSWKFINWKNRVIYEFN 132
            +HIL     +D+  D+   N DE     N  K     FI         I WK+ +I+   
Sbjct: 75   SHILTWSNAIDSNKDSTTTNDDEEFDNLNGNK-----FI---------IKWKHNIIFTRG 120

Query: 133  KLGDQIKNRAKILDIESIPIFNNYMKTTDNTITI-----MYIDDVFLNGTLECNLRSDID 187
               +    R KIL I  +  FN+Y   +     I     + +  +  N +L+C L     
Sbjct: 121  NFSND--QRFKILKIHPLTNFNDYFHGSKEFFLIFIDKPITVSSLIANDSLKCLL----- 173

Query: 188  LLRSPSMRSIPTAKRPSLINKKSTDYENSKSKATFDSILRVNKHW--------------S 233
                P+ R + + ++ + + +  +     +SK++F++ L  N+ W              S
Sbjct: 174  ----PNTRDLKSQEKETPLVQDLS----QQSKSSFENDLNKNEAWNLKFGILSNNYKIES 225

Query: 234  SKFEQHFQKFRLLANQDDLPIDVFHNIIEEMHEEMVSDNLFKNIVDLRNIIYEYVELNLF 293
            S+ E + + FR L N+  + ID       +  +   SD LF+       + ++Y+E +L+
Sbjct: 226  SELEPNHKLFRELVNEAFIEID--SKKFFQKKKNFTSDQLFQ-------LTHDYMERHLY 276

Query: 294  DDIW----KMILRMNKEVEIDLNP---FGNISIYQVDSEFLSTEYSKFFLENVITAERNI 346
            D+IW    KM++   K    D        + SI ++D  F    Y  F L+ V   E+N+
Sbjct: 277  DEIWSRIWKMMMNSVKNYADDQKAQHLIKHFSIVEIDPNF----YDIFPLKFVPMLEKNL 332

Query: 347  KEASKSLQKIESASNYKSKANILILTLRTLT-GNKENDGYSSKNDDGNLSFFPLAIDADR 405
            K +   + K++S  +Y  K+ ILI +L+ +T  N   +    KN  G L      IDAD 
Sbjct: 333  KHSVTCINKLKSTKSYTEKSTILIESLQIITDSNTGGEESKDKNKSGYL------IDADN 386

Query: 406  LMNLFVLVTCRAQI--KNLKCHLSYLQNFYNNDSDTKFGILGYALSTLEAV------VCY 457
            L+NL  LV  ++ I   +LK +L YL+ F  ++S + FGIL Y ++T   V      V  
Sbjct: 387  LLNLLTLVILQSNITLHDLKANLYYLKYFSTDESSSSFGILNYTIATFHMVSHVLENVID 446

Query: 458  FEQLKEKENYRKLIDFCNSNERLVKVLSSTKKYETNAALYFLRKYEGSLRYRDSLGQSLL 517
            +++LKEK +             L++ L  T    T ++  F    +  L YR+S G+SLL
Sbjct: 447  WDRLKEKSD-------------LIEELIMTDDLSTLSST-FENDKKTLLMYRNSNGESLL 492

Query: 518  ALCIIHGRNDFLYHILNEYETLFPIEDLLADESIDGSTLLIQAVKHDNQYSASLLLNILK 577
            AL II+ +N      L EYE +  ++ +  D+S+D STLL+QA++ +N  +A +L+ +L 
Sbjct: 493  ALSIINKQNKKFTQYLIEYEDILNMDIISNDQSMDSSTLLLQAIRSNNFEAAIILVKLLF 552

Query: 578  DNC-TEIELIAYINRHDINKRTAGHFLTNELEVLKLMGKYINWVQKDNAGQTPLFTIFRS 636
             NC  + ELI+YIN+ DI+ R  GH+L   L +LK++G++INW QKD  G+TPLFTIFRS
Sbjct: 553  QNCRNQKELISYINQVDIHNRNIGHYLVINLTILKIIGQFINWKQKDVNGRTPLFTIFRS 612

Query: 637  YDQDNYDEMVSQSMEYATNWYGLNGKNFNYLDHVDKKGNTLLHILKCNLPILL---ADKH 693
            YDQ NYDE+V Q  + A  WY  N   F   DH D  GN+LLHIL+ N+ ILL    D++
Sbjct: 613  YDQSNYDELVCQVFQIAIKWYAANNLKFQMNDHDDSNGNSLLHILQNNISILLDYAKDQN 672

Query: 694  --INVNATNRSGQTPLMTSIRYKRTENIRDLLCDPRLRVDITQKNNALTAFDFSKDDEIT 751
              IN+N  N  G TPLM   +YKR +NIR ++ + +L  +  Q  N +  FD+S D  I 
Sbjct: 673  IPINLNKMNCKGFTPLMMYFKYKRYDNIRMIIKEEKLIFNKFQSPNFIDCFDYSVDSSIM 732

Query: 752  HLLGEHELLNSPWLA-VYAHTLKYTNSR-------WNLSLTVKLKDAPKTT---NFTLKT 800
            + +GE  L N      +   +LK   S          ++ T+ + +A K+T        +
Sbjct: 733  NDIGEFLLSNGQLFGKIIVLSLKKQMSTVPSLPRGLYINYTILIDEADKSTLTKTMKFTS 792

Query: 801  LRGILRVVIKNNMTVFLPVQELVEDLISF--------NRIRFSELMRIKVLEMLPF---I 849
            L   L+++ +     FLP+  L+ +  SF        N +R   L  I+ L +  F   +
Sbjct: 793  LVKFLKIMKRKYAISFLPLDTLLNESQSFLDKKSKNNNNLRTIPLRYIEKLRIRRFLKRL 852

Query: 850  SFCLSALVHI--KVLDLNVFQTEENAIKWVKMNGSVDKKTNQTSDITPE----------- 896
            + CL  L+H     +   +  +E   ++W+ +  S  ++++ T     +           
Sbjct: 853  NTCLDVLLHFDDSTIATPLLLSETELLEWISIEESKLRRSSTTPSAKSKLENAMGEKKKK 912

Query: 897  -----DISMIQNFLKFNITEIERTKNKLEIAEKLSLFSRLKSKDLLNSNENYVTIVSQLS 951
                 +I++IQNFLKFN+ E+      L++  KL +F  LK+ D+ ++   +  +V  L+
Sbjct: 913  ELKPENINIIQNFLKFNLNELNTISMNLKVLSKLVIFMNLKTLDIHDAQIRFNGLVKGLN 972

Query: 952  SKRFRSTLKYSAEDTKLLSVRAEKALL-----SKITYLKICAQKLHNHILSITTTMISNW 1006
            +K   S ++ S           +K +L       I++   C  KL + + +I    I NW
Sbjct: 973  NKEVPSIIEKSFNVIDSSRYDDDKGVLLESLHEDISFFNECTLKLIHDVENIIKIKIPNW 1032

Query: 1007 WHIYGELLNAHKHYTRAFPELANVTTENRDL----------------------ALHR--- 1041
            W +YGELL  +K+Y + FP    V     DL                       LH    
Sbjct: 1033 WKLYGELLELNKYYHKNFPNCV-VHARRTDLLSGNNANTNTNTNTNTNTNSPQRLHHHSE 1091

Query: 1042 ------------MISNPKRIKLEERLSEKIKDITEQLNSVGHDIKQMHELAAEEVSRFID 1089
                        +I N K  KLE + S  I +    L S+G  +   HE  AEE++R+++
Sbjct: 1092 HQNNSNNGVFANLIENQKN-KLERKTSHHIDETISLLESLGSGLLNKHEHLAEELNRYME 1150

Query: 1090 LKTKF 1094
             K +F
Sbjct: 1151 FKNRF 1155

>TBLA0A07260 Chr1 (1807831..1811445) [3615 bp, 1204 aa] {ON} Anc_6.20
            YML002W
          Length = 1204

 Score =  328 bits (841), Expect = 4e-94,   Method: Compositional matrix adjust.
 Identities = 316/1177 (26%), Positives = 531/1177 (45%), Gaps = 171/1177 (14%)

Query: 48   VPPTELLLYYSDKE----------SNSE-LHDLCYTP-NFASAHILLLDATDTEVNNGDE 95
             PPT++LL Y D            SN++ L DLC    +F ++HILL D+   +V   D+
Sbjct: 42   APPTDILLNYLDSSNITPRNPYNGSNAKPLEDLCMNSYDFIASHILLYDS---KVIKNDQ 98

Query: 96   AVLIKNIEKRYDVHFIKAMDQSWKFINWKNRVIYEFNKLGDQIKNRAKILDIESIPIFNN 155
             V+ ++I  +     IK +  +    N +  VI   +K  +  K   KI+ ++    FN+
Sbjct: 99   CVM-ESINGKTIT--IKRVTGNGALNNGEMLVITP-SKNYNTPKKMLKIIKMDLWHNFNS 154

Query: 156  YMKTTDNTITIMYIDDVFLNGTLECNLRSDIDLLRSPSMRSIPTAKRPSLINKKSTDYEN 215
            Y++  +N   I YID       ++    +  D       R +   ++ S I +   D EN
Sbjct: 155  YLQGMEN-YPIWYIDYPLYPNIIKNEFLTAFD-------RKLIETEQYSDIAQPVNDLEN 206

Query: 216  S--------------------KSKATFDSILRVNKH-WSSKFEQHFQKFRLLANQDDLPI 254
            +                      +  F  +++ ++  W      +    + +   + LP 
Sbjct: 207  TTKDQNHKIRNISKLEPDISQSDRGGFTKLIKDDRVIWQPLINSYRATTKHIEQAEGLPQ 266

Query: 255  DVFHNIIEEMHEEMVSD---NLFKNIVD-----------LRNIIYEYVELNLFDDIWKMI 300
             +  N   +++ EMV D   +LF+ + D           L  +IYE++E+ L DDIW  I
Sbjct: 267  AIDENQ-TDVNIEMVRDINCDLFEQLKDEKRYNFLSHDNLMELIYEFIEIKLHDDIWGRI 325

Query: 301  LRMNKEVEIDLNPFGNISIYQVDSEFLSTE-YSKFFLENVITAERNIKEASKSLQKIESA 359
                 E + D +   NIS+ ++   F ST  +  F L +++  E+ I  A    QK  + 
Sbjct: 326  SFKFTESDFDFSKLSNISVNKLLLNFYSTNNFKNFKLHDIVMMEKKISRAVTYFQKFING 385

Query: 360  SNYKSKANILILTLRTLTGNKENDGYSSKNDDGNLSFFPLAIDADRLMNLFVLVTCRAQI 419
              ++ K+  LI TL+ LT NK                     DAD L+ L  +V CR ++
Sbjct: 386  ITFQEKSTALIKTLQILTINK-------------------LTDADTLIGLLSIVICRLKV 426

Query: 420  KNLKCHLSYLQNFYNNDSDTKFGILGYALSTLEAVVCYFEQLKEKENYRKLIDFCNSNER 479
            +NLK HL YLQNF  + +  KFGILGY++STLEA+  YF+ +        LI FC+    
Sbjct: 427  RNLKSHLFYLQNFAADPNTIKFGILGYSISTLEAITYYFDHISHSHK-ADLIAFCDKLHN 485

Query: 480  LV-KVLSSTKKYETNAALYFLRKYEGSLRYRDSLGQSLLALCIIHGRNDFLYHILNEYET 538
            L   +L++ K  + +            L YR   G+SLL+LCII+ + D    +L  YE 
Sbjct: 486  LYDTILNNIKSLDNDI-----------LSYRSQNGESLLSLCIINNKMDIFLELLTTYEH 534

Query: 539  LFPIEDLLADESIDGSTLLIQAVKHDNQYSASLLLNILKDNCTEIELIAYINRHDINKRT 598
             FPIED+L D  ++GS+LL+QA K++N  ++ +L+ ILK++C E EL  ++N+ D   R+
Sbjct: 535  SFPIEDILDDSDLNGSSLLMQACKYNNYVASEILVTILKNSCNEEELRIFLNKTDKFNRS 594

Query: 599  AGHF--LTNELEVLKLMGKYINWVQKDNAGQTPLFTIFRSYDQDNYDEMVSQSMEYATNW 656
              H+  + N + +L   G  I+W  KD    TPL TIF+ +  +  +  +         W
Sbjct: 595  VAHYFNMKNSILILTEFGNLIDWELKDIKKLTPLLTIFKVHKVNYNESFIKILFRVVLTW 654

Query: 657  YGLNGKNFNYLDHVDKKGNTLLHILKCNLPILLADKH----INVNATNRSGQTPLMTSIR 712
            Y ++ K FN   HVD+ GN LLH++K  +  L+ +      IN+NA N  G +P M   +
Sbjct: 655  YKIHNKPFNLKAHVDQNGNNLLHVMKDYINCLIENPELCETININANNNKGLSPFMVYFK 714

Query: 713  YKRTENIRDLLCDPRLRVDITQKNNALTAFDFSKDDEITHLLGEHELLNSPWLAVYAHTL 772
              R +NIR +L +P L     Q    +T+ +   + ++ HLL  H L    +  +  H+L
Sbjct: 715  TNRYDNIRIILKNPTLITSEGQLPFLITSTNLY-NSKVNHLLATHFLRTLDFAYICLHSL 773

Query: 773  KY---------TNSRWNLSLTVKLKDAP---------KTTNFTLKTLRGILRVVIKNNMT 814
            ++         T+  W + +++  K++          +T    LKT++ +L   I+    
Sbjct: 774  RFNDPSSSTSGTSLAWLVDISILEKESEFPTSHPSICRTKTLKLKTIKSLLHHFIRKYKY 833

Query: 815  VFLPVQ---ELVEDLI--------SFNRIRFSELMRIKVLEM---LPFISFCLSALVHIK 860
              LP++   E   DLI        + NR      + I  LE+   L  IS CL+ L    
Sbjct: 834  SSLPLKSALEFCNDLIKSNNSISWTSNRHFLPLSLLIDKLEIQYNLKLISNCLNFLFITT 893

Query: 861  VLDLNVFQTEENAIKWVKMNGSVDKKTN------------QTSDIT----PEDISMIQNF 904
              D  +   E     ++K+N    K++N            QT++++    PEDI+ IQ F
Sbjct: 894  DFDFTLLFDELKLQAFLKINNKKLKESNSSNKFSHKNNSDQTTELSKAYQPEDINAIQTF 953

Query: 905  LKFNITEIERTKNKLEIAEKLSLFSRLKSKDLLNSNENYVTIVSQLSSKRFRSTLKYSAE 964
            +KFN+ E+E  KN +   + +S+  + K  DL +S   +     ++        LKY + 
Sbjct: 954  IKFNLGELENFKNTITTIKDVSILIKYKIMDLNSSQFFFQKNTLKIGINNLSEILKYYST 1013

Query: 965  DTKLLS-----------------VRAEKALLSKITYLKICAQKLHNHILSITTTMISNWW 1007
               L++                 V     LL  + + +    KL+     ++   I  WW
Sbjct: 1014 QKPLITNAYTSRKFYDYNSYDYKVEFLNKLLENLIFFEKLVCKLYYDFEDLSNGTIKTWW 1073

Query: 1008 HIYGELLNAHKHYTRAFPELA---NVTTENRDLALHRMISNPKRIKLEERLSEKIKDITE 1064
            + YG LL+    Y + +P      N   E+ +    + ++       E  +   IK+ + 
Sbjct: 1074 YHYGRLLDYEAQYNKHYPNRKIDINNNFESFNTMFDKRVNFDSITHFERNIILNIKNTST 1133

Query: 1065 QLNSVGHDIKQMHELAAEEVSRFIDLKTKFTLEYALQ 1101
             L    + IK +HE  A E++ F++ K KF  EY ++
Sbjct: 1134 LLRRFNNKIKFLHENLAIELNNFMNFKNKFIREYIIK 1170

>KAFR0L00400 Chr12 (72520..75348) [2829 bp, 942 aa] {ON} Anc_6.20
            YML002W
          Length = 942

 Score =  273 bits (699), Expect = 2e-76,   Method: Compositional matrix adjust.
 Identities = 254/837 (30%), Positives = 413/837 (49%), Gaps = 118/837 (14%)

Query: 289  ELNLFDDIW-KMILRMNKEVEIDLNPFGNISIYQVD-SEFLSTEYSKFFLENVITAERNI 346
            E  L+  IW K++ + ++   ID      IS ++++ +++ S  ++KF L +V+  E  +
Sbjct: 179  EARLYSSIWNKLVHQTSEPQNIDKFYGCYISFHELNINDYYSLPFNKFSLRDVVFIENVV 238

Query: 347  KEASKSLQKIESASNYKSKANILILTLRTLTGNKENDGYSSKNDDGNLSFFP-LAIDADR 405
              A K   K+  + ++  K +IL+ T   LT                 S  P L IDAD 
Sbjct: 239  DLACKEFVKLRESLSFDEKIDILLSTFNILT-----------------SKLPQLEIDADN 281

Query: 406  LMNLFVLVTCRAQIKNLKCHLSYLQNFYNNDSDTKFGILGYALSTLEAVVCYFEQLKEKE 465
            L+N  +++  R ++ NL  H  YLQNF N   +  FGIL YA+STL AV+ Y +   +K 
Sbjct: 282  LLNFMLIIINRVKLNNLNEHFHYLQNF-NFKQNKDFGILNYAISTLGAVLYYIDNNLDK- 339

Query: 466  NYRKLIDFCNSNERLVKVLSSTKKYETNAALYFLRKYEGSLRYRDSLGQSLLALCIIHGR 525
             +++  D                      A+   +  E  L+YR+  G+S L  CII   
Sbjct: 340  -FKRYTD----------------------AIQDSKISEEKLKYRNENGESYLCHCIITKD 376

Query: 526  NDFLYHIL--NEYETLFPIEDLLADESIDGSTLLIQAVKHDNQYSASLLLNILKDNCTEI 583
            ND L  +L  +EY   FP+ED+L D++IDGSTLL+ AVK  N  +AS+L+NI+ +N T  
Sbjct: 377  NDTLRELLFSSEYIKNFPMEDILDDQTIDGSTLLMVAVKCLNTTAASILINIIINNGTPD 436

Query: 584  ELIAYINRHDINKRTAGHFLTNELEVLKLMGKYINWVQKDN-AGQTPLFTIFRSYDQD-- 640
            E+  Y+N  D N R  GHF+TN+  +L  +G Y+NW  KD   GQTPLF IFRSYDQ   
Sbjct: 437  EIRTYVNSVDENNRNVGHFITNQYYLLCKIGPYLNWNCKDKRTGQTPLFNIFRSYDQSIK 496

Query: 641  NYDEMVSQSMEYATNWYGLNGKNFNYLDHVDKKGNTLLHILKCNLPILLADKHINVNATN 700
            +Y +M  +S  +A     ++  +F    H+D   NTLLHILK N+ ++L    + +N+ N
Sbjct: 497  SYKKMSRRSFRFA-----MDSGDFQLKKHIDNSNNTLLHILKTNIQMILPHASLFINSPN 551

Query: 701  RSGQTPLMTSIRYKRTENIRDLLCDP-RLRVDI---TQKNNALT-AFDFSKDDEITHLLG 755
              G TPLM   +Y+R  NI+ LL    + RV I    Q +NA +  F  + DD+I +LLG
Sbjct: 552  SLGMTPLMVFCKYRRLYNIQILLSSKFKDRVSIFETQQVHNAWSNCFSLTNDDQILNLLG 611

Query: 756  EHELLN-SPWLAVYAHTLKY--------TNSRWNLSLTVKLKDAPKTTNFTLKTLRGILR 806
            +  + N S +   + H+LK           +++++ +T+K +   KT  F +KT++ ++ 
Sbjct: 612  KFAIKNYSIFGNCFTHSLKQFLHKSKHGNKNQYSVKITLKFEKKYKTIRFNIKTIKALIN 671

Query: 807  VVIKNNMTV--FLPVQELVEDLISFNRIRFSELMRIKVLEMLPFISFCLSALVHIKVLDL 864
            +V+ +N  V  FLP+ ++  +L   N I      + K+L  +  ++  L  ++ ++++  
Sbjct: 672  MVLTSNSHVSSFLPLYKVFNEL---NGIASMISTKSKIL-FINNLNVILDTILFLELVPR 727

Query: 865  NVFQTEENAIKWVKMNGSVDKKTNQTSDITPEDISMIQNFLKFNITEIERTKNKLEIAEK 924
              F  E     +++    +     ++  +  EDI+MI NFLKFN+ E+   KN ++   +
Sbjct: 728  EGFILEARLKDYLRNQRKIKTVATKSKKLQIEDINMISNFLKFNLNELNAFKNGVKKILR 787

Query: 925  ------LSLF-SRLKSKDLLNSNENYVTIVSQLSSKRFRSTLKYSAEDTKLLSVRAEKAL 977
                  L LF  R+   DLL+  +    +V  L++  +         + ++L    E ++
Sbjct: 788  QMNSINLKLFDQRISYMDLLHCPD----VVVHLNNPLWNLNYNILISNFQIL----ENSI 839

Query: 978  LSKITYLKICAQKLHNHILSITTTMISNWWHIYGELLNAHKHYTRAFPELANVTTENRDL 1037
             + + +LK+                I  WW +  EL+N  K               N D 
Sbjct: 840  DNTLHFLKV-----------FQNEKIRKWWKLNNELINLTK------------LASNSDD 876

Query: 1038 ALHRMISNPKRIKLEERLSEKIKDITEQLNSVGHDIKQMHELAAEEVSRFIDLKTKF 1094
             L R   N K     E+LS +I D    +N +  DI   HEL A E++ F+  K  F
Sbjct: 877  DLLRSFFNRK-----EKLSIEIDDKIRSINELNCDIFVSHELLAVEINNFMKFKPLF 928

>YML003W Chr13 (263483..264355) [873 bp, 290 aa] {OFF} Putative
           protein of unknown function
          Length = 290

 Score =  144 bits (362), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 96/292 (32%), Positives = 154/292 (52%), Gaps = 25/292 (8%)

Query: 19  AICNCGEPNSSPLKKLYTQLGKKDKYLILVPPTELLLYYSDKESNSELHDLCYTPNFASA 78
           AI NC EP  SPLKKL+  L K  ++++L PP+E LL Y D +S   LHDLCY   F ++
Sbjct: 16  AIFNCPEPERSPLKKLFANL-KTRRFILLAPPSEYLLNYHDVKSKLPLHDLCYNAEFINS 74

Query: 79  HILLLDATDTEVNNGDEAVLIKNIEKRYDVHFIKAMDQSWKFINWKNRVIYEFNKLGDQI 138
           +ILL+   ++ +N               D H+ + +D     I WKN VI+  N  G  I
Sbjct: 75  YILLM-TENSYINTNSR-----------DSHY-ETLDGKTVVIQWKNNVIHALN--GFHI 119

Query: 139 KNRAKILDIESIPIFNNYMKTTDNTITIMYIDDVFLNGTLECNLRSDIDLLRSPSMRSIP 198
           + R KIL+ + +P FN+Y +   + I +      F++  L C    +  L    +   IP
Sbjct: 120 RRRLKILETKILPNFNDYFEGAADFIIL------FIDQPLNCEFVPNDYLQCFHNYEKIP 173

Query: 199 TAKRPSLINKKSTDYENSKSKATFDSILRVNKHWSSKFEQHFQKFRLLANQDDLPIDVFH 258
                ++ N     ++  +S  +F++IL ++    ++  Q F  +R LA  DD    +F 
Sbjct: 174 KNAH-AMPNLSIDSFQQERS--SFENILHIHPARLTQLGQLFSSYRTLAPGDDPSRSIFE 230

Query: 259 NIIEEMHEEMVSDNLFKNIVDLRNIIYEYVELNLFDDIWKMILRMNKEVEID 310
           +I+++  + M SD+LFKN  +L ++I++Y ELNL+DDIW  +    K  E+D
Sbjct: 231 SIVQQAFDGMKSDSLFKNFSNLYDLIHDYFELNLYDDIWSRLTTHFKGHEVD 282

>TDEL0A06780 Chr1 complement(1182697..1183299) [603 bp, 200 aa] {ON}
           Anc_6.265 YPL239W
          Length = 200

 Score = 34.3 bits (77), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 26/71 (36%), Positives = 39/71 (54%), Gaps = 3/71 (4%)

Query: 549 ESIDGSTLLIQAVKHDNQYSASLLLNILKDNCTEIELIAYINRHDINKRTAGHF--LTNE 606
           ES   ST L  A  + +      LL ++K+N T  EL  Y+N+ +    TA H+  L  +
Sbjct: 46  ESETKSTALHMACANGHTDVVKYLLTLVKENATSEELKDYVNKQNETGNTALHWASLNGK 105

Query: 607 LEVLKLM-GKY 616
           L+V+KLM G+Y
Sbjct: 106 LDVVKLMCGEY 116

>TBLA0A04090 Chr1 complement(1014784..1016967) [2184 bp, 727 aa]
           {ON} Anc_8.346 YLR139C
          Length = 727

 Score = 34.3 bits (77), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 23/60 (38%), Positives = 34/60 (56%), Gaps = 7/60 (11%)

Query: 529 LYHILNEYET-LFPIEDLLADESIDGSTLLIQAVKHDNQYSASLLLNILKDNCTEIELIA 587
           L  ILN   T +FPI+D+L   SI+G+T L      D ++  S+L +I ++NC   E I 
Sbjct: 288 LGKILNNISTKVFPIDDILKTHSINGATPL------DEKHLDSILSSIERENCVYFEKIP 341

>Ecym_2595 Chr2 (1158968..1159480) [513 bp, 170 aa] {ON} similar to
           Ashbya gossypii AFR268C
          Length = 170

 Score = 32.7 bits (73), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 33/116 (28%), Positives = 48/116 (41%), Gaps = 25/116 (21%)

Query: 668 DHVDKKGNTLLHILKCNLP-------ILLADKHINVNATNRSGQTPLMTSIRYKRTE--- 717
           D  D  GNT LH+  C          IL  D  I ++  N  G TPL T ++Y   E   
Sbjct: 42  DTKDPFGNTCLHMC-CKYGSWDVLDTILDVDCPIEIDPQNVEGDTPLHTVVKYSEEEPEH 100

Query: 718 ------NIRDLLCDPRLRVDITQKNNALTAFDFSKDDEITHLLGEHELLNSPWLAV 767
                 N+  +  DPR++      N+     +   +D+ T L+   +LL S  LA 
Sbjct: 101 GTFIASNLIQVGADPRIK-----NNSGRKPIELIHNDKFTDLI---DLLQSAELAA 148

>KLLA0E20285g Chr5 (1803791..1804540) [750 bp, 249 aa] {ON} similar
           to uniprot|P34227 Saccharomyces cerevisiae YBL064C PRX1
           Mitochondrial peroxiredoxin (1-Cys Prx) with thioredoxin
           peroxidase activity has a role in reduction of
           hydroperoxides induced during respiratory growth and
           under conditions of oxidative stress
          Length = 249

 Score = 33.5 bits (75), Expect = 2.8,   Method: Composition-based stats.
 Identities = 22/72 (30%), Positives = 33/72 (45%), Gaps = 11/72 (15%)

Query: 704 QTPLMTSIRYKRTENIRDLLCDPRLRVDITQKNNALTAFDFSKDDEITHLLGEHELLNSP 763
           Q PL TS+R+ RT    D    PRLR++    N   TA      D     +  HE + + 
Sbjct: 17  QQPLRTSVRFIRTFKQED---QPRLRINSVAPN--FTA------DTTAGKVNFHEYIGNS 65

Query: 764 WLAVYAHTLKYT 775
           W  +++H   +T
Sbjct: 66  WAVLFSHPADFT 77

>YBR098W Chr2 (441515..443590) [2076 bp, 691 aa] {ON}  MMS4Subunit of
            the structure-specific Mms4p-Mus81p endonuclease that
            cleaves branched DNA; involved in recombination, DNA
            repair, and joint molecule formation/resolution during
            meiotic recombination; phosphorylation of the
            non-catalytic subunit Mms4p by Cdc28p and Cdcp during
            mitotic cell cycle activates the function of Mms4p-Mus81p
          Length = 691

 Score = 32.7 bits (73), Expect = 7.1,   Method: Compositional matrix adjust.
 Identities = 32/117 (27%), Positives = 47/117 (40%), Gaps = 22/117 (18%)

Query: 1003 ISNWWHIYGELLNAHKHYTRAFPELANVTTENR-DLALHRMISNPKRIKLEERLSEKIKD 1061
            I   WH+    +N+H  +  + P L ++  + R D A+  M       K      +  +D
Sbjct: 565  IDREWHVKIHTVNSHMEFINSLPNLVSLIGKQRMDPAIRYM-------KYAHLNVKSAQD 617

Query: 1062 ITEQLNSVGHDIKQMHELAAEEVSRFIDLKTKFTLEYALQSYLTISKQEHIEKDRLH 1118
             TE L    H I +M E+ A  V          +L  + QS L     E IEK RL 
Sbjct: 618  STETLKKTFHQIGRMPEMKANNV---------VSLYPSFQSLL-----EDIEKGRLQ 660

>NCAS0B02280 Chr2 complement(377630..383134) [5505 bp, 1834 aa] {ON}
           Anc_8.520
          Length = 1834

 Score = 32.3 bits (72), Expect = 8.3,   Method: Compositional matrix adjust.
 Identities = 24/78 (30%), Positives = 37/78 (47%), Gaps = 7/78 (8%)

Query: 451 LEAVVCYFEQLKEKENYRKLIDFCNSN------ERLVK-VLSSTKKYETNAALYFLRKYE 503
           LE   C +E     E Y  + DF   N      + +VK ++ S KK+    A  F  K +
Sbjct: 303 LELARCLYEGPWVAERYSAVKDFLQKNPSSKGFDHVVKSIIDSAKKFSAVDAFQFEYKRQ 362

Query: 504 GSLRYRDSLGQSLLALCI 521
           G L+  D L +++ ALC+
Sbjct: 363 GLLQKIDKLLENIDALCV 380

>TBLA0H01400 Chr8 (312727..313992) [1266 bp, 421 aa] {ON} Anc_8.284
           YDR125C
          Length = 421

 Score = 32.0 bits (71), Expect = 8.8,   Method: Compositional matrix adjust.
 Identities = 13/44 (29%), Positives = 24/44 (54%)

Query: 584 ELIAYINRHDINKRTAGHFLTNELEVLKLMGKYINWVQKDNAGQ 627
           +L+ +   +D   + AG  +  +L +LK   KY NW++  N+G 
Sbjct: 358 KLLLFYGENDWMNKEAGFLMAEKLNILKGDSKYANWIEVPNSGH 401

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.319    0.134    0.385 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 125,326,744
Number of extensions: 5943981
Number of successful extensions: 23255
Number of sequences better than 10.0: 177
Number of HSP's gapped: 24013
Number of HSP's successfully gapped: 189
Length of query: 1130
Length of database: 53,481,399
Length adjustment: 120
Effective length of query: 1010
Effective length of database: 39,721,479
Effective search space: 40118693790
Effective search space used: 40118693790
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 71 (32.0 bits)