Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
CAGL0L04686g3.454ON45145124080.0
Kpol_1035.93.454ON42742611881e-160
ZYRO0C06270g3.454ON43045311471e-154
Skud_7.4153.454ON45243411141e-149
Suva_7.3953.454ON45143911141e-149
YGR110W (CLD1)3.454ON44541311131e-149
TDEL0F033903.454ON42445210871e-145
NCAS0E008603.454ON44041610871e-145
ABL019W3.454ON43142210791e-144
Smik_6.2003.454ON44541310781e-144
KAFR0I019703.454ON41141110701e-143
KLTH0E13948g3.454ON43841410721e-143
KNAG0B009503.454ON41841010611e-141
Ecym_24653.454ON43841310561e-140
SAKL0B06116g3.454ON43144110531e-140
Kwal_27.123173.454ON43544410491e-139
TPHA0O013103.454ON43840510441e-138
NDAI0G010903.454ON45641510161e-134
TBLA0F034603.454ON4414228741e-113
KLLA0B12914g3.454ON4264438711e-113
SAKL0G19074gna 1ON4324324372e-48
KLTH0C01254gna 1ON4344314207e-46
Kwal_14.985na 1ON4354184014e-43
Ecym_5577singletonON4334263962e-42
Skud_4.3868.284ON4463492023e-16
TDEL0F041008.284ON4343451988e-16
Suva_2.2888.284ON4353491952e-15
Skud_12.1678.284ON3943481915e-15
YDR125C (ECM18)8.284ON4533691917e-15
Suva_10.1838.284ON3943481872e-14
Smik_4.3718.284ON4353531872e-14
YLR099C (ICT1)8.284ON3943591853e-14
Smik_12.1588.284ON3943501782e-13
KLLA0F19624g8.284ON4093581773e-13
TPHA0A016908.284ON4053701755e-13
KAFR0B053808.284ON4113471731e-12
CAGL0B01969g8.284ON4233531694e-12
SAKL0H16500g8.284ON4193521684e-12
Kpol_543.498.284ON4293591669e-12
Ecym_42858.284ON4053541632e-11
CAGL0M11462g8.284ON3863691613e-11
NDAI0J012108.284ON4164271604e-11
Kwal_56.237028.284ON4163581604e-11
KNAG0G021408.284ON4082701596e-11
NDAI0J01200singletonON4273571596e-11
KNAG0H031208.284ON4343531552e-10
ZYRO0D06666g8.284ON3803481481e-09
AGR062C8.284ON3843351481e-09
NCAS0B037108.284ON4303371472e-09
KAFR0B028308.284ON3913461462e-09
KLTH0G13178g8.284ON4153481463e-09
NCAS0B051208.284ON3962491346e-08
TBLA0H014008.284ON4214101276e-07
ZYRO0F09064g8.524ON3493391052e-04
TDEL0B032508.524ON3481331034e-04
TPHA0L016008.524ON372130950.004
Skud_2.3318.524ON376148910.011
KAFR0D047005.358ON383117900.014
KNAG0A037708.524ON356116890.020
Smik_2.3458.524ON375165850.063
NCAS0B022608.524ON363115850.067
YBR204C (LDH1)8.524ON375208840.074
Suva_16.4763.488ON304130840.078
Kwal_27.10170na 2ON29373810.17
CAGL0M05467g8.524ON354137810.19
KLLA0E23035g8.524ON32597790.32
TPHA0G023602.411ON1172127800.34
Kwal_23.6592singletonON164112760.36
YPR147C3.488ON304133780.42
TBLA0H035408.524ON378124770.67
CAGL0J08547g5.693ON379125760.70
Kwal_26.9628singletonON25496750.79
Kwal_48.19391singletonON18396740.84
SAKL0H06886g8.662ON287155750.96
Kwal_43.16490singletonON28696750.99
Kwal_26.6639singletonON30396751.0
KLTH0E12188g8.524ON336119741.2
Skud_16.4423.488ON304130731.6
TBLA0D01150na 3ON46764731.9
Suva_8.2718.638ON93045732.1
Kwal_27.119758.524ON336111722.5
KAFR0E03110singletonON356109722.6
Skud_15.3858.638ON93140722.8
KLLA0A10395gna 2ON29448703.4
Smik_15.4048.638ON93069714.3
YOR219C (STE13)8.638ON93145696.7
TDEL0F006802.80ON38827687.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0L04686g
         (451 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0L04686g Chr12 (539203..540558) [1356 bp, 451 aa] {ON} simil...   932   0.0  
Kpol_1035.9 s1035 complement(19721..21004) [1284 bp, 427 aa] {ON...   462   e-160
ZYRO0C06270g Chr3 (475283..476575) [1293 bp, 430 aa] {ON} simila...   446   e-154
Skud_7.415 Chr7 (692655..694013) [1359 bp, 452 aa] {ON} YGR110W ...   433   e-149
Suva_7.395 Chr7 (684763..686118) [1356 bp, 451 aa] {ON} YGR110W ...   433   e-149
YGR110W Chr7 (713709..715046) [1338 bp, 445 aa] {ON}  CLD1Mitoch...   433   e-149
TDEL0F03390 Chr6 (624579..625853) [1275 bp, 424 aa] {ON} Anc_3.4...   423   e-145
NCAS0E00860 Chr5 (157521..158843) [1323 bp, 440 aa] {ON} Anc_3.454    423   e-145
ABL019W Chr2 (361560..362855) [1296 bp, 431 aa] {ON} Non-synteni...   420   e-144
Smik_6.200 Chr6 (329969..331306) [1338 bp, 445 aa] {ON} YGR110W ...   419   e-144
KAFR0I01970 Chr9 (401907..403142) [1236 bp, 411 aa] {ON}              416   e-143
KLTH0E13948g Chr5 complement(1231122..1232438) [1317 bp, 438 aa]...   417   e-143
KNAG0B00950 Chr2 (173167..174423) [1257 bp, 418 aa] {ON} Anc_3.4...   413   e-141
Ecym_2465 Chr2 complement(908173..909489) [1317 bp, 438 aa] {ON}...   411   e-140
SAKL0B06116g Chr2 complement(519929..521224) [1296 bp, 431 aa] {...   410   e-140
Kwal_27.12317 s27 complement(1173365..1174672) [1308 bp, 435 aa]...   408   e-139
TPHA0O01310 Chr15 complement(258745..260061) [1317 bp, 438 aa] {...   406   e-138
NDAI0G01090 Chr7 (230932..232302) [1371 bp, 456 aa] {ON} Anc_3.454    395   e-134
TBLA0F03460 Chr6 (853280..854605) [1326 bp, 441 aa] {ON}              341   e-113
KLLA0B12914g Chr2 (1126975..1128255) [1281 bp, 426 aa] {ON} simi...   340   e-113
SAKL0G19074g Chr7 (1646858..1648156) [1299 bp, 432 aa] {ON} cons...   172   2e-48
KLTH0C01254g Chr3 complement(113435..114739) [1305 bp, 434 aa] {...   166   7e-46
Kwal_14.985 s14 complement(142781..144088) [1308 bp, 435 aa] {ON...   159   4e-43
Ecym_5577 Chr5 (1185997..1187298) [1302 bp, 433 aa] {ON} similar...   157   2e-42
Skud_4.386 Chr4 complement(673125..674465) [1341 bp, 446 aa] {ON...    82   3e-16
TDEL0F04100 Chr6 complement(756762..758066) [1305 bp, 434 aa] {O...    81   8e-16
Suva_2.288 Chr2 complement(496577..497884) [1308 bp, 435 aa] {ON...    80   2e-15
Skud_12.167 Chr12 complement(322870..324054) [1185 bp, 394 aa] {...    78   5e-15
YDR125C Chr4 complement(701397..702758) [1362 bp, 453 aa] {ON}  ...    78   7e-15
Suva_10.183 Chr10 complement(344549..345733) [1185 bp, 394 aa] {...    77   2e-14
Smik_4.371 Chr4 complement(662692..663999) [1308 bp, 435 aa] {ON...    77   2e-14
YLR099C Chr12 complement(339744..340928) [1185 bp, 394 aa] {ON} ...    76   3e-14
Smik_12.158 Chr12 complement(319660..320844) [1185 bp, 394 aa] {...    73   2e-13
KLLA0F19624g Chr6 complement(1817206..1818435) [1230 bp, 409 aa]...    73   3e-13
TPHA0A01690 Chr1 (344521..345738) [1218 bp, 405 aa] {ON} Anc_8.2...    72   5e-13
KAFR0B05380 Chr2 (1107049..1108284) [1236 bp, 411 aa] {ON} Anc_8...    71   1e-12
CAGL0B01969g Chr2 complement(181406..182677) [1272 bp, 423 aa] {...    70   4e-12
SAKL0H16500g Chr8 (1450828..1452087) [1260 bp, 419 aa] {ON} simi...    69   4e-12
Kpol_543.49 s543 complement(108945..110234) [1290 bp, 429 aa] {O...    69   9e-12
Ecym_4285 Chr4 (612053..613270) [1218 bp, 405 aa] {ON} similar t...    67   2e-11
CAGL0M11462g Chr13 complement(1129244..1130404) [1161 bp, 386 aa...    67   3e-11
NDAI0J01210 Chr10 (282384..283634) [1251 bp, 416 aa] {ON} Anc_8....    66   4e-11
Kwal_56.23702 s56 complement(668862..670112) [1251 bp, 416 aa] {...    66   4e-11
KNAG0G02140 Chr7 complement(484440..485666) [1227 bp, 408 aa] {O...    66   6e-11
NDAI0J01200 Chr10 (280820..282103) [1284 bp, 427 aa] {ON}              66   6e-11
KNAG0H03120 Chr8 (586146..587450) [1305 bp, 434 aa] {ON} Anc_8.2...    64   2e-10
ZYRO0D06666g Chr4 (576172..577314) [1143 bp, 380 aa] {ON} simila...    62   1e-09
AGR062C Chr7 complement(833212..834366) [1155 bp, 384 aa] {ON} S...    62   1e-09
NCAS0B03710 Chr2 (664097..665389) [1293 bp, 430 aa] {ON} Anc_8.284     61   2e-09
KAFR0B02830 Chr2 complement(578530..579705) [1176 bp, 391 aa] {O...    61   2e-09
KLTH0G13178g Chr7 (1131579..1132826) [1248 bp, 415 aa] {ON} simi...    61   3e-09
NCAS0B05120 Chr2 complement(953798..954988) [1191 bp, 396 aa] {O...    56   6e-08
TBLA0H01400 Chr8 (312727..313992) [1266 bp, 421 aa] {ON} Anc_8.2...    54   6e-07
ZYRO0F09064g Chr6 (735162..736211) [1050 bp, 349 aa] {ON} simila...    45   2e-04
TDEL0B03250 Chr2 complement(575015..576061) [1047 bp, 348 aa] {O...    44   4e-04
TPHA0L01600 Chr12 (338450..339568) [1119 bp, 372 aa] {ON} Anc_8....    41   0.004
Skud_2.331 Chr2 complement(599967..601097) [1131 bp, 376 aa] {ON...    40   0.011
KAFR0D04700 Chr4 complement(923561..924712) [1152 bp, 383 aa] {O...    39   0.014
KNAG0A03770 Chr1 complement(494021..495091) [1071 bp, 356 aa] {O...    39   0.020
Smik_2.345 Chr2 complement(618817..619944) [1128 bp, 375 aa] {ON...    37   0.063
NCAS0B02260 Chr2 complement(374788..375879) [1092 bp, 363 aa] {O...    37   0.067
YBR204C Chr2 complement(632254..633381) [1128 bp, 375 aa] {ON}  ...    37   0.074
Suva_16.476 Chr16 complement(822104..823018) [915 bp, 304 aa] {O...    37   0.078
Kwal_27.10170 s27 complement(227197..228078) [882 bp, 293 aa] {O...    36   0.17 
CAGL0M05467g Chr13 complement(583722..584786) [1065 bp, 354 aa] ...    36   0.19 
KLLA0E23035g Chr5 (2051146..2052123) [978 bp, 325 aa] {ON} weakl...    35   0.32 
TPHA0G02360 Chr7 (477456..480974) [3519 bp, 1172 aa] {ON} Anc_2....    35   0.34 
Kwal_23.6592 s23 (1658078..1658572) [495 bp, 164 aa] {ON} [conti...    34   0.36 
YPR147C Chr16 complement(825645..826559) [915 bp, 304 aa] {ON} P...    35   0.42 
TBLA0H03540 Chr8 (863267..864403) [1137 bp, 378 aa] {ON} Anc_8.5...    34   0.67 
CAGL0J08547g Chr10 (846742..847881) [1140 bp, 379 aa] {ON} simil...    34   0.70 
Kwal_26.9628 s26 (1300688..1301449) [762 bp, 254 aa] {ON} YNR064...    33   0.79 
Kwal_48.19391 s48 (3319..3870) [552 bp, 183 aa] {ON} YNR064C - H...    33   0.84 
SAKL0H06886g Chr8 complement(604406..605269) [864 bp, 287 aa] {O...    33   0.96 
Kwal_43.16490 s43 (51..911) [861 bp, 286 aa] {ON} YNR064C - Hypo...    33   0.99 
Kwal_26.6639 s26 complement(252..1163) [912 bp, 303 aa] {ON} YNR...    33   1.0  
KLTH0E12188g Chr5 (1082142..1083152) [1011 bp, 336 aa] {ON} simi...    33   1.2  
Skud_16.442 Chr16 complement(779364..780278) [915 bp, 304 aa] {O...    33   1.6  
TBLA0D01150 Chr4 complement(293536..294939) [1404 bp, 467 aa] {O...    33   1.9  
Suva_8.271 Chr8 complement(491197..493989) [2793 bp, 930 aa] {ON...    33   2.1  
Kwal_27.11975 s27 (1028242..1029252) [1011 bp, 336 aa] {ON} YBR2...    32   2.5  
KAFR0E03110 Chr5 (621949..623019) [1071 bp, 356 aa] {ON}               32   2.6  
Skud_15.385 Chr15 complement(691276..694071) [2796 bp, 931 aa] {...    32   2.8  
KLLA0A10395g Chr1 complement(908097..908981) [885 bp, 294 aa] {O...    32   3.4  
Smik_15.404 Chr15 complement(701886..704678) [2793 bp, 930 aa] {...    32   4.3  
YOR219C Chr15 complement(752214..755009) [2796 bp, 931 aa] {ON} ...    31   6.7  
TDEL0F00680 Chr6 complement(114474..115640) [1167 bp, 388 aa] {O...    31   7.8  

>CAGL0L04686g Chr12 (539203..540558) [1356 bp, 451 aa] {ON} similar
           to uniprot|P53264 Saccharomyces cerevisiae YGR110w
          Length = 451

 Score =  932 bits (2408), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 451/451 (100%), Positives = 451/451 (100%)

Query: 1   MSISKFGKRSFRNVASKLLRLSSLGEKSSEVVGKDGSAIIHATAPTAKPLYEIVRDLPRL 60
           MSISKFGKRSFRNVASKLLRLSSLGEKSSEVVGKDGSAIIHATAPTAKPLYEIVRDLPRL
Sbjct: 1   MSISKFGKRSFRNVASKLLRLSSLGEKSSEVVGKDGSAIIHATAPTAKPLYEIVRDLPRL 60

Query: 61  FPRSLAESKRDYATFHSNVDLMQLELLRTLPFFERTGYNKRAYLRKTEIDSDGNYINELV 120
           FPRSLAESKRDYATFHSNVDLMQLELLRTLPFFERTGYNKRAYLRKTEIDSDGNYINELV
Sbjct: 61  FPRSLAESKRDYATFHSNVDLMQLELLRTLPFFERTGYNKRAYLRKTEIDSDGNYINELV 120

Query: 121 IEPANVDPNKKRKRLIFVHGYGAGLGFYLKNYEHLPLLDDSWSIHAIDLPGYGFSSRMDF 180
           IEPANVDPNKKRKRLIFVHGYGAGLGFYLKNYEHLPLLDDSWSIHAIDLPGYGFSSRMDF
Sbjct: 121 IEPANVDPNKKRKRLIFVHGYGAGLGFYLKNYEHLPLLDDSWSIHAIDLPGYGFSSRMDF 180

Query: 181 PFQFPRDDTSVVCDWFISRLRTLFEKRGFDKSDNIVMAHSMGAYLMAFYLNKYPDSVKKM 240
           PFQFPRDDTSVVCDWFISRLRTLFEKRGFDKSDNIVMAHSMGAYLMAFYLNKYPDSVKKM
Sbjct: 181 PFQFPRDDTSVVCDWFISRLRTLFEKRGFDKSDNIVMAHSMGAYLMAFYLNKYPDSVKKM 240

Query: 241 VMCSPAGISRSQYSINNNITEDISSGKEEIKLKIKKVPWWYTKLWDRNISPFVLVRKTGI 300
           VMCSPAGISRSQYSINNNITEDISSGKEEIKLKIKKVPWWYTKLWDRNISPFVLVRKTGI
Sbjct: 241 VMCSPAGISRSQYSINNNITEDISSGKEEIKLKIKKVPWWYTKLWDRNISPFVLVRKTGI 300

Query: 301 LGSKITSGWTYRRFKPILLNKENNYEQFEKLHRYSFAIFNMKGSGEYLLSFVLECGGDPR 360
           LGSKITSGWTYRRFKPILLNKENNYEQFEKLHRYSFAIFNMKGSGEYLLSFVLECGGDPR
Sbjct: 301 LGSKITSGWTYRRFKPILLNKENNYEQFEKLHRYSFAIFNMKGSGEYLLSFVLECGGDPR 360

Query: 361 SPLENSLFSSDANKFGIDNAGIKNSSCEWVWVYGANDWMDIHGAERVTKDFLMNNRKKSR 420
           SPLENSLFSSDANKFGIDNAGIKNSSCEWVWVYGANDWMDIHGAERVTKDFLMNNRKKSR
Sbjct: 361 SPLENSLFSSDANKFGIDNAGIKNSSCEWVWVYGANDWMDIHGAERVTKDFLMNNRKKSR 420

Query: 421 VVTIPESGHHLYFDNYPMFNSLLIDEMKSLQ 451
           VVTIPESGHHLYFDNYPMFNSLLIDEMKSLQ
Sbjct: 421 VVTIPESGHHLYFDNYPMFNSLLIDEMKSLQ 451

>Kpol_1035.9 s1035 complement(19721..21004) [1284 bp, 427 aa] {ON}
           complement(19721..21004) [1284 nt, 428 aa]
          Length = 427

 Score =  462 bits (1188), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 226/426 (53%), Positives = 288/426 (67%), Gaps = 26/426 (6%)

Query: 28  SSEVVGKDGSAIIHATAPTAKPLYEIVRDLPRLFPRSLAESKRDYATFHSNVDLMQLELL 87
           +S V  +D        AP A PLYEI+  LP LFPR+L ES  DY  FH ++D  Q ELL
Sbjct: 25  TSGVPSRDEKLPTVPAAPAAIPLYEIILKLPNLFPRTLKESLNDYHDFHKDIDKFQTELL 84

Query: 88  RTLPFFERTGYNKRAYLRKTEIDSDGNYINELVIEPANVDPNKKR-KRLIFVHGYGAGLG 146
            TLP++      K+A L  T++D +GNYINE  I P   + +++  K LIF+HGYGAGLG
Sbjct: 85  STLPYYPMANDGKKAELITTKVDDEGNYINEFCISPIGAEADQRDLKHLIFIHGYGAGLG 144

Query: 147 FYLKNYEHLPLLDDSWSIHAIDLPGYGFSSRMDFPFQFPRDDTSVVCDWFISRLRTLFEK 206
           F+LKN+EHLPLLD+ W IHAIDLPGYG+S R +FPF++P  D S V DWF  R+RT F+ 
Sbjct: 145 FFLKNFEHLPLLDNKWCIHAIDLPGYGYSKRCEFPFKYPEHDISDVQDWFHKRIRTWFKA 204

Query: 207 RGF--DKSDNIVMAHSMGAYLMAFYLNKYPDSVKKMVMCSPAGISRSQYSINNNITEDIS 264
           R       +N++MAHS+GAYLMA Y++K+P+  KK+VMCSPAGI +S  S      E+I 
Sbjct: 205 RSLLTTPENNMIMAHSLGAYLMALYIDKFPNDFKKIVMCSPAGICQSSTS------EEIG 258

Query: 265 SGKEEIKLKIKKVPWWYTKLWDRNISPFVLVRKTGILGSKITSGWTYRRFKPILLNKENN 324
           +          K PWW+ KLWD+N+SPF LVR T  LGSK+TSGW+YRRFK   L +  +
Sbjct: 259 N---------IKTPWWFNKLWDQNVSPFTLVRNTYYLGSKLTSGWSYRRFKQ--LKQSGH 307

Query: 325 YEQFEKLHRYSFAIFNMKGSGEYLLSFVLECGGDPRSPLENSLFSSDANKFGIDNAGIKN 384
             QFEKLHRY+++IFN KGSGEY+L F L+CGGDPR PLE++LF S   +      GI  
Sbjct: 308 LMQFEKLHRYAYSIFNQKGSGEYILGFALKCGGDPRIPLEDNLFKSPKTE------GIPK 361

Query: 385 SSCEWVWVYGANDWMDIHGAERVTKDFLMNNRKKSRVVTIPESGHHLYFDNYPMFNSLLI 444
           S CEW+WVYG  DWMDI G +RVT + +    KKS    +P+SGHHLYFDNY  FN LL+
Sbjct: 362 SDCEWLWVYGEKDWMDIGGGKRVTDELVTRFGKKSSTTVVPDSGHHLYFDNYKFFNELLV 421

Query: 445 DEMKSL 450
            EMK++
Sbjct: 422 KEMKNM 427

>ZYRO0C06270g Chr3 (475283..476575) [1293 bp, 430 aa] {ON} similar
           to uniprot|P53264 Saccharomyces cerevisiae YGR110W
           Hypothetical ORF
          Length = 430

 Score =  446 bits (1147), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 225/453 (49%), Positives = 293/453 (64%), Gaps = 31/453 (6%)

Query: 4   SKFGKRSFRNVASKLLRLSSLGEKSSEVVGKDGSAIIHATAPTAKPLYEIVRDLPRLFPR 63
           +KF     +++A+ +L   ++G K  ++ G  G+ +    APTA PL++I+  LP+LFPR
Sbjct: 3   TKFTTGYLKSIAASILSRKNVGIKK-KLHGTLGTRV--PAAPTAIPLHKIIMRLPKLFPR 59

Query: 64  SLAESKRDYATFHSNVDLMQLELLRTLPFFERTGYNKRAYLRKTEIDSDGNYINELVIEP 123
           S+  S RDY  F  +   +Q ELLRTLPF+     +K+A + KT +D  GNYINE  I P
Sbjct: 60  SVDASTRDYKDFCYHTGQLQEELLRTLPFYPYCAESKKAEVVKTTVDDQGNYINEFCITP 119

Query: 124 ANVD-PNKKRKRLIFVHGYGAGLGFYLKNYEHLPLLDDSWSIHAIDLPGYGFSSRMDFPF 182
                P+ K K LI +HGYGAGLGF+LKN E +PLLD+SW IHAIDLPGYGFSSR  FPF
Sbjct: 120 VKPSVPSHKMKHLICIHGYGAGLGFFLKNLEGIPLLDNSWVIHAIDLPGYGFSSRPKFPF 179

Query: 183 QFPRDDTSVVCDWFISRLRTLFEKRGF--DKSDNIVMAHSMGAYLMAFYLNKYPDSVKKM 240
           ++P+D  S V  WF  R+ T F+KRG   +  +N+VMAHS+GAYLMA Y  KY    KK+
Sbjct: 180 KYPKDSLSQVHSWFHDRIHTWFKKRGLLVNSQNNLVMAHSLGAYLMALYTTKYTTHFKKL 239

Query: 241 VMCSPAGISRSQYSINNNITEDISSGKEEIKLKIKKVPWWYTKLWDRNISPFVLVRKTGI 300
           VMCSPAG+ +S  + N   T                 PWWYTKLWD NISPF LVR    
Sbjct: 240 VMCSPAGVCKSTTAKNIGNTTP---------------PWWYTKLWDLNISPFCLVRNAAA 284

Query: 301 LGSKITSGWTYRRFKPILLNKEN---NYEQFEKLHRYSFAIFNMKGSGEYLLSFVLECGG 357
           LGS +TSGW+YRRF  +L +  N   +  QFE LHRY++AIFN +GSGEYLLSF L CGG
Sbjct: 285 LGSMVTSGWSYRRFNKLLQSNSNTNLDRLQFEALHRYAYAIFNRRGSGEYLLSFALSCGG 344

Query: 358 DPRSPLENSLFSSDANKFGIDNAGIKNSSCEWVWVYGANDWMDIHGAERVTKDFLMNNRK 417
           DPR PLE+++F           +GI  S+CEW+W+YG  DWMD++G ERV++       +
Sbjct: 345 DPRLPLEDTIFKDKT-------SGIFRSNCEWIWIYGERDWMDVNGGERVSRFIENQGGR 397

Query: 418 KSRVVTIPESGHHLYFDNYPMFNSLLIDEMKSL 450
           KS+V   P SGHHLYFDN+  FNS ++ +MK +
Sbjct: 398 KSQVHVAPNSGHHLYFDNHKFFNSFIVKQMKDM 430

>Skud_7.415 Chr7 (692655..694013) [1359 bp, 452 aa] {ON} YGR110W
           (REAL)
          Length = 452

 Score =  433 bits (1114), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 222/434 (51%), Positives = 285/434 (65%), Gaps = 22/434 (5%)

Query: 23  SLGEKSSEVVGKDGSAIIHATAPTAKPLYEIVRDLPRLFPRSLAESKRDYATFHSNVDLM 82
           S  ++S E  G +   +   +APTA PL EI+  +P LFPR L +S +D+  F  N D+ 
Sbjct: 36  SESDESPERDGTEERILRTPSAPTAIPLREIIYKVPGLFPRPLEDSVKDFRDFTKNEDVF 95

Query: 83  QLELLRTLPFFERTGYNKRAYLRKTEIDSDGNYINELVIEPANVD-PNKKRKRLIFVHGY 141
           Q ELL TLPF+      K++ L KT +D DGNYINE  I P     P  + K L+F+HGY
Sbjct: 96  QTELLETLPFYPNPSKYKKSKLIKTVVDDDGNYINEFCIYPQKPSVPETELKHLVFIHGY 155

Query: 142 GAGLGFYLKNYEHLPLLDDSWSIHAIDLPGYGFSSRMDFPFQFPRDDTSVVCDWFISRLR 201
           GAGLGF++KN E +PLLD+ W IHAIDLPGYGFSSR  FPF++P+D+   V DWF  R+ 
Sbjct: 156 GAGLGFFIKNLEDIPLLDNEWCIHAIDLPGYGFSSRPKFPFEYPKDNLHTVQDWFHERIH 215

Query: 202 TLFEKRGF-DKSD-NIVMAHSMGAYLMAFYLNKYPDS--VKKMVMCSPAGISRSQYSINN 257
           T F KR    K D NIV+AHS+G+YLMA YL KY +S   KK+V+CSPAG+S   +   +
Sbjct: 216 TWFNKRNLLHKPDKNIVVAHSLGSYLMALYLQKYKESPSFKKLVLCSPAGVSNRDF---D 272

Query: 258 NITEDISSGKEEIKLKIKKVPWWYTKLWDRNISPFVLVRKTGILGSKITSGWTYRRFKPI 317
           N T ++         K K  PWWY KLWDRNISPF LVR    LGSKITSGW+YRRFK I
Sbjct: 273 NTTAEVG--------KWKPPPWWYVKLWDRNISPFTLVRNARQLGSKITSGWSYRRFKHI 324

Query: 318 LLNKENNYEQFEKLHRYSFAIFNMKGSGEYLLSFVLECGGDPRSPLENSLFSSDANKFGI 377
           L        +FE LHRY+++IFN +GSGEYLLSF L CGG+PR PLE  LF+ + +K   
Sbjct: 325 LNGDPGQSRRFEALHRYAYSIFNKRGSGEYLLSFALRCGGEPRLPLEEQLFNGENSKV-- 382

Query: 378 DNAGIKNSSCEWVWVYGANDWMDIHGAERVTKDFLMNNRKKSRVVTIPESGHHLYFDNYP 437
               +KNS+ EWVW+YG +DWMD+ G  RV+K       +KS V  +P +GHHLY DNY 
Sbjct: 383 ----LKNSNYEWVWLYGNDDWMDVDGGLRVSKYLNEKLGQKSNVFIVPHAGHHLYLDNYT 438

Query: 438 MFNSLLIDEMKSLQ 451
            FN +L+ EM++++
Sbjct: 439 FFNKILVKEMQNVK 452

>Suva_7.395 Chr7 (684763..686118) [1356 bp, 451 aa] {ON} YGR110W
           (REAL)
          Length = 451

 Score =  433 bits (1114), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 222/439 (50%), Positives = 292/439 (66%), Gaps = 29/439 (6%)

Query: 22  SSLGEKSSEVVGKDGSA---IIHATAPTAKPLYEIVRDLPRLFPRSLAESKRDYATFHSN 78
           SS   +S E   KD +    +   +APTA PL EI+  +P LFPR L +S +D+  F  N
Sbjct: 32  SSTQPESGETSIKDAAEKRILRTPSAPTAIPLREIIYKVPGLFPRPLEDSVKDFRDFIKN 91

Query: 79  VDLMQLELLRTLPFFERTGYNKRAYLRKTEIDSDGNYINELVIEPANVD-PNKKRKRLIF 137
            D  Q ELL TLPF+      K++ L KT +D DGNYINE  I P     P    K L+F
Sbjct: 92  EDSFQTELLATLPFYPNPSTTKKSKLIKTIVDDDGNYINEFCIYPQVPSVPEADLKHLVF 151

Query: 138 VHGYGAGLGFYLKNYEHLPLLDDSWSIHAIDLPGYGFSSRMDFPFQFPRDDTSVVCDWFI 197
           +HGYGAGLGF++KN+E +PLL++ W +HAIDLPGYGFSSR  FPF++PRDD   V DWF 
Sbjct: 152 IHGYGAGLGFFIKNFEDIPLLNNEWCVHAIDLPGYGFSSRPKFPFKYPRDDIHSVQDWFH 211

Query: 198 SRLRTLFEKRGF--DKSDNIVMAHSMGAYLMAFYLNKYPDS--VKKMVMCSPAGISRSQY 253
            R+ T FEKR        NIVMAHS+G+YLMA YL KY  S   KK+++CSPAG+S    
Sbjct: 212 ERIHTWFEKRNLLNKPEKNIVMAHSLGSYLMALYLQKYEGSPSFKKLILCSPAGVSH--- 268

Query: 254 SINNNITEDISSGKEEIKLKIKKVPWWYTKLWDRNISPFVLVRKTGILGSKITSGWTYRR 313
                   D  SG  +++ K K  PWWY KLWD+NISPF LVR +   GSKITSGW+YRR
Sbjct: 269 -------RDFDSGNSDVE-KWKPPPWWYVKLWDKNISPFTLVRNSRQFGSKITSGWSYRR 320

Query: 314 FKPILLNKENNYEQFEKLHRYSFAIFNMKGSGEYLLSFVLECGGDPRSPLENSLFSSDAN 373
           FK IL    +  ++FE LHRY+++IFN +GSGEYLLSF L+CGG+PR PLE  LF+    
Sbjct: 321 FKHILNGDPDQSKRFEALHRYAYSIFNKRGSGEYLLSFALKCGGEPRLPLEEQLFN---- 376

Query: 374 KFGIDNAGIKNSSCEWVWVYGANDWMDIHGAERVTKDFLMNN--RKKSRVVTIPESGHHL 431
             G +   +KN+  EWVW+YG +DWMD++G  RV+K  L+N+  ++KS V+T+P +GHHL
Sbjct: 377 --GKNANVLKNAKYEWVWLYGDDDWMDVNGGLRVSK--LLNDKLKQKSSVITVPNAGHHL 432

Query: 432 YFDNYPMFNSLLIDEMKSL 450
           Y DN+  FN+++++EM+ +
Sbjct: 433 YLDNHKFFNTIIMNEMQKV 451

>YGR110W Chr7 (713709..715046) [1338 bp, 445 aa] {ON}
           CLD1Mitochondrial cardiolipin-specific phospholipase;
           functions upstream of Taz1p to generate
           monolyso-cardiolipin; transcription increases upon
           genotoxic stress; involved in restricting Ty1
           transposition; has homology to mammalian CGI-58
          Length = 445

 Score =  433 bits (1113), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 218/413 (52%), Positives = 276/413 (66%), Gaps = 22/413 (5%)

Query: 43  TAPTAKPLYEIVRDLPRLFPRSLAESKRDYATFHSNVDLMQLELLRTLPFFERTGYNKRA 102
           +APTA PL EI+  +P LFPR L +S +D+  F  N D  Q ELL+TLPF+     +K A
Sbjct: 50  SAPTAIPLREIIYRVPSLFPRPLEDSVKDFRDFIKNEDAFQTELLKTLPFYPTPSESKTA 109

Query: 103 YLRKTEIDSDGNYINELVIEPANVD-PNKKRKRLIFVHGYGAGLGFYLKNYEHLPLLDDS 161
            L +T +D +GNYINE  I P     P    K L+F+HGYGAGLGF++KN+E +PLLD+ 
Sbjct: 110 RLIRTVVDDEGNYINEFCIRPRKTSVPEADLKHLVFIHGYGAGLGFFIKNFEDIPLLDNE 169

Query: 162 WSIHAIDLPGYGFSSRMDFPFQFPRDDTSVVCDWFISRLRTLFEKRGF--DKSDNIVMAH 219
           W IHAIDLPGYGFSSR  FPF++PRD+   V DWF  R+ T F KR        NIVMAH
Sbjct: 170 WCIHAIDLPGYGFSSRPKFPFEYPRDNIHSVQDWFHERIHTWFSKRNLLNRPEKNIVMAH 229

Query: 220 SMGAYLMAFYLNKYPDS--VKKMVMCSPAGISRSQYSINNNITEDISSGKEEIKLKIKKV 277
           S+G+YLMA YL KY +S   KK+++CSPAG+S   Y   NN   ++         K K  
Sbjct: 230 SLGSYLMALYLQKYKESPSFKKLILCSPAGVS---YRDFNNTASEVE--------KWKPP 278

Query: 278 PWWYTKLWDRNISPFVLVRKTGILGSKITSGWTYRRFKPILLNKENNYEQFEKLHRYSFA 337
           PWWY KLWDRNISPF LVR    LGSKITSGW+YRRFK IL       ++FE LHRY++A
Sbjct: 279 PWWYVKLWDRNISPFTLVRNFRQLGSKITSGWSYRRFKHILNGDPEQSKRFEALHRYAYA 338

Query: 338 IFNMKGSGEYLLSFVLECGGDPRSPLENSLFSSDANKFGIDNAGIKNSSCEWVWVYGAND 397
           IFN +GSGEYLLSF L+CGG+PR  LE  LF  D  K  I    +KNS+C+W+W+YG +D
Sbjct: 339 IFNKRGSGEYLLSFALKCGGEPRLSLEQQLF--DGKKSDI----LKNSNCDWLWLYGDDD 392

Query: 398 WMDIHGAERVTKDFLMNNRKKSRVVTIPESGHHLYFDNYPMFNSLLIDEMKSL 450
           WMD++G  RV++      ++KS V+ +P SGHHLY DNY  FN++L  EM+ +
Sbjct: 393 WMDVNGGLRVSRFLKEKLKQKSNVIIVPHSGHHLYLDNYKFFNNILTKEMQKI 445

>TDEL0F03390 Chr6 (624579..625853) [1275 bp, 424 aa] {ON} Anc_3.454
           YGR110W
          Length = 424

 Score =  423 bits (1087), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 221/452 (48%), Positives = 294/452 (65%), Gaps = 35/452 (7%)

Query: 4   SKFGKRSFRNVASKLLRLSSLGEKSSEVVGKDGSAIIHATAPTAKPLYEIVRDLPRLFPR 63
           ++F  +S + +   LLR + +  K+  V      ++    APTA PL EI+  LP LFPR
Sbjct: 3   TRFVTQSLKGIVGSLLR-NRVSLKAQSV------SLDVPAAPTAIPLREIIVKLPSLFPR 55

Query: 64  SLAESKRDYATFHSNVD-LMQLELLRTLPFFERTGYNKRAYLRKTEIDSDGNYINELVIE 122
           S  +S RDY     + D   Q +LL TLPF+     ++R+ + +T++D +GNYINE  I 
Sbjct: 56  SFGDSVRDYRDLCRHTDEKFQRDLLATLPFYGEGDLHRRSEVIRTKVDDEGNYINEFYIM 115

Query: 123 PANVD-PNKKRKRLIFVHGYGAGLGFYLKNYEHLPLLDDSWSIHAIDLPGYGFSSRMDFP 181
           P N   P  + K L+F+HGYGAGLGF+LKN+E++PLL++ W IHAIDLPGYGFSSR  FP
Sbjct: 116 PKNASVPRDRLKHLVFIHGYGAGLGFFLKNFENIPLLNNEWCIHAIDLPGYGFSSRCKFP 175

Query: 182 FQFPRDDTSVVCDWFISRLRTLFEKRGF--DKSDNIVMAHSMGAYLMAFYLNKYPDSVKK 239
           FQ+P+D  + V +WF  RL   F +R    +  +NIVMAHS+GAYLMA Y +K     KK
Sbjct: 176 FQYPKDTVTDVHEWFHKRLNRWFAERNLLRNPENNIVMAHSLGAYLMALYASKNSSHFKK 235

Query: 240 MVMCSPAGISRSQYSINNNITEDISSGKEEIKLKIKKVPWWYTKLWDRNISPFVLVRKTG 299
           +VMCSPAGI  S        T+ I +         +K PWWY+KLWDRNISPF LVR + 
Sbjct: 236 LVMCSPAGICES------TTTKAIGN---------RKPPWWYSKLWDRNISPFSLVRVSS 280

Query: 300 ILGSKITSGWTYRRFKPILLNKENNYE-QFEKLHRYSFAIFNMKGSGEYLLSFVLECGGD 358
            LGSK+TSGW+Y+RF  +L +K    E QFE LH+Y ++IFN  G GEYLLSF L CGGD
Sbjct: 281 RLGSKLTSGWSYKRFGKLLRSKSRKSEQQFEALHKYCYSIFNKPGCGEYLLSFALRCGGD 340

Query: 359 PRSPLENSLFSSDANKFGIDNAGIKNSSCEWVWVYGANDWMDIHGAERVTKDFLMNNRKK 418
           PR PLE+ LF +       +++GI N + EW+W+YG  DWMD +G +RV+ + L  + +K
Sbjct: 341 PRIPLEDMLFKT-------NDSGIMNGNLEWLWLYGERDWMDFNGGKRVS-EHLKKSGQK 392

Query: 419 SRVVTIPESGHHLYFDNYPMFNSLLIDEMKSL 450
           S V  +P +GHHLYFDNY  FNSL+I EMKS+
Sbjct: 393 SEVCIVPNAGHHLYFDNYDYFNSLIIREMKSM 424

>NCAS0E00860 Chr5 (157521..158843) [1323 bp, 440 aa] {ON} Anc_3.454
          Length = 440

 Score =  423 bits (1087), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 214/416 (51%), Positives = 274/416 (65%), Gaps = 34/416 (8%)

Query: 42  ATAPTAKPLYEIVRDLPRLFPRSLAESKRDYATFHSNVDLMQLELLRTLPFFERTGYNKR 101
           +T P A P+ +I+  LP LFPRSL +S+RDY TF +++D +QL LL+TLPFF      K 
Sbjct: 51  STPPVAIPITDIITSLPSLFPRSLHDSRRDYNTFTTDIDSLQLNLLKTLPFFPMGSSQKV 110

Query: 102 AYLRKTEIDSDGNYINELVIEPANVDPNKKR---KRLIFVHGYGAGLGFYLKNYEHLPLL 158
           A L +T ID +GNYINE  I PA  D +      K LIF+HGYGAGLGF+LKN E++PLL
Sbjct: 111 AKLIRTPIDDEGNYINEFCIMPAVKDGDYSSPDLKHLIFIHGYGAGLGFFLKNLENIPLL 170

Query: 159 DDSWSIHAIDLPGYGFSSRMDFPFQFPRDDTSVVCDWFISRLRTLFEKRGF--DKSDNIV 216
           D+ W IHAIDLPGYGFSSR  FPF +P D  + V  WF  R+   F +R    +  +N+V
Sbjct: 171 DNKWCIHAIDLPGYGFSSRFKFPFHYPNDSQTKVQKWFHDRIYRWFRERNLLQNPQNNLV 230

Query: 217 MAHSMGAYLMAFYLNKYPDSVKKMVMCSPAGISRSQYSINNNITEDISSGKEEIKLKIKK 276
           MAHS+GAYLMA Y   + +  KK++MCSPAG+  SQ+++          GK+      K+
Sbjct: 231 MAHSLGAYLMAHYAFHFSNHFKKIIMCSPAGV--SQFAV----------GKQN-----KQ 273

Query: 277 VPWWYTKLWDRNISPFVLVRKTGILGSKITSGWTYRRFKPILLNKENNYEQFEKLHRYSF 336
            PWWY KLWD N SPF LVR +GI GSKITSGW+YRRFKP   N  N   QFE LH+Y++
Sbjct: 274 PPWWYNKLWDLNYSPFSLVRNSGIYGSKITSGWSYRRFKPTSFNGLNE-SQFEALHKYTY 332

Query: 337 AIFNMKGSGEYLLSFVLECGGDPRSPLENSLFSSDANKFGIDNAGIKNSSCEWVWVYGAN 396
            IFN  GSGEYLLSF+L CGGDPR  LE++LF  +               C+WVWVYG  
Sbjct: 333 GIFNKNGSGEYLLSFILSCGGDPRFALEDNLFKEE---------NPPEDLCDWVWVYGDR 383

Query: 397 DWMDIHGAERVTKDFL--MNNRKKSRVVTIPESGHHLYFDNYPMFNSLLIDEMKSL 450
           DWMDI+GA R+++  +    +  KS+V  IP +GHHLY DNY  FN+L+I EM+++
Sbjct: 384 DWMDINGAHRISRRLVKKAGDTSKSKVHVIPSAGHHLYLDNYKAFNNLIIKEMETM 439

>ABL019W Chr2 (361560..362855) [1296 bp, 431 aa] {ON} Non-syntenic
           homolog of Saccharomyces cerevisiae YGR110W
          Length = 431

 Score =  420 bits (1079), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 214/422 (50%), Positives = 267/422 (63%), Gaps = 30/422 (7%)

Query: 33  GKDGSAIIHATAPTAKPLYEIVRDLPRLFPRSLAESKRDYATFHSNVDLMQLELLRTLPF 92
           G+    +   T PTA PLYEI+R+LP LFP   ++S  DY  F S+ +  Q+ LL TLPF
Sbjct: 33  GRHIHTVRKPTPPTAVPLYEIIRNLPNLFPLPTSQSWEDYKAFKSDREAFQVGLLSTLPF 92

Query: 93  FERTGYNKRAYLRKTEIDSDGNYINELVIEPANVDPNK--KRKRLIFVHGYGAGLGFYLK 150
           FER    K   + +T +D +GNYINE  I PA+++ N       LIF+HGYGAGLGF++K
Sbjct: 93  FERAREGKIGKIIRTPVDDEGNYINEFCIRPASMEENHGAATNHLIFIHGYGAGLGFFIK 152

Query: 151 NYEHLPLLDDSWSIHAIDLPGYGFSSRMDFPFQFPRDDTSVVCDWFISRLRTLFEKRGFD 210
           N+EHLPLLDD W IHAIDLPGYG+S+R  FPF         V  WF  RL T   KRG  
Sbjct: 153 NFEHLPLLDDQWVIHAIDLPGYGYSTRCQFPFDVNTHSVREVEAWFHERLETWLSKRGLL 212

Query: 211 KSD--NIVMAHSMGAYLMAFYLNKYPDSVKKMVMCSPAGISRSQYSINNNITEDISSGKE 268
           ++   N+VMAHSMGAYL A Y     +  KK++MCSPAGIS S                 
Sbjct: 213 QAPHRNMVMAHSMGAYLTAHYAQSRQNHFKKLIMCSPAGISPS----------------- 255

Query: 269 EIKLKIKKVPWWYTKLWDRNISPFVLVRKTGILGSKITSGWTYRRFKPILLNKENNYEQF 328
             K   K+ PWW+ KLWDRN+SPF LVR +G LGSK+TSGW++RRF+ +L   E    QF
Sbjct: 256 --KSMKKQPPWWFIKLWDRNVSPFSLVRNSGPLGSKLTSGWSFRRFRHLLNEGEIGMRQF 313

Query: 329 EKLHRYSFAIFNMKGSGEYLLSFVLECGGDPRSPLENSLFSSDANKFGIDNAGIKNSSCE 388
           E LH+YS+AIFNM GSGEYLLSFVL+CGGDPR PL  S+FS +         G K + CE
Sbjct: 314 EALHKYSYAIFNMPGSGEYLLSFVLKCGGDPRIPLLGSMFSPEKEH------GFK-AQCE 366

Query: 389 WVWVYGANDWMDIHGAERVTKDFLMNNRKKSRVVTIPESGHHLYFDNYPMFNSLLIDEMK 448
           W+W+YG + WMD  G +R +         KSRV  +P SGHHLYFDNY  FN +L+ EM+
Sbjct: 367 WLWLYGDHVWMDKEGGQRASSYITDRIGGKSRVEIVPNSGHHLYFDNYSYFNKILLREMQ 426

Query: 449 SL 450
           S+
Sbjct: 427 SI 428

>Smik_6.200 Chr6 (329969..331306) [1338 bp, 445 aa] {ON} YGR110W
           (REAL)
          Length = 445

 Score =  419 bits (1078), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 213/413 (51%), Positives = 281/413 (68%), Gaps = 22/413 (5%)

Query: 43  TAPTAKPLYEIVRDLPRLFPRSLAESKRDYATFHSNVDLMQLELLRTLPFFERTGYNKRA 102
           +APTA PL EI+  +P LFPR + +S +D+  F  + D+ Q ELL+TLPF+      K++
Sbjct: 50  SAPTAIPLREIIYKVPGLFPRPVGDSVKDFRDFIKSEDVFQTELLKTLPFYPNPSKLKKS 109

Query: 103 YLRKTEIDSDGNYINELVIEPANVD-PNKKRKRLIFVHGYGAGLGFYLKNYEHLPLLDDS 161
            + +T +D DGNYINE  I P N   P  + K LIF+HGYGAGLGF++KN+E +PLL++ 
Sbjct: 110 RVIRTVVDDDGNYINEFCIRPINPSVPETELKHLIFIHGYGAGLGFFIKNFEDIPLLNNE 169

Query: 162 WSIHAIDLPGYGFSSRMDFPFQFPRDDTSVVCDWFISRLRTLFEKRGF-DKSD-NIVMAH 219
           W +HAIDLPGYGFSSR  FPF++PRD+   V DWF  RL T F KR   +K D N+VMAH
Sbjct: 170 WCVHAIDLPGYGFSSRPKFPFEYPRDNLHDVQDWFHKRLHTWFNKRNLLNKPDKNVVMAH 229

Query: 220 SMGAYLMAFYLNKYPD--SVKKMVMCSPAGISRSQYSINNNITEDISSGKEEIKLKIKKV 277
           S+G+YLMA Y+ KY +  S KK+++CSPAG+S      +NN T +          K K  
Sbjct: 230 SLGSYLMALYVQKYKERPSFKKLILCSPAGVSHRD---SNNTTSEAE--------KWKPP 278

Query: 278 PWWYTKLWDRNISPFVLVRKTGILGSKITSGWTYRRFKPILLNKENNYEQFEKLHRYSFA 337
           PWWY KLWDRNISPF LVR +   GSKITSGW+YRRFK IL        +FE LHRY+++
Sbjct: 279 PWWYVKLWDRNISPFTLVRNSRQFGSKITSGWSYRRFKHILNGDLKQSSRFEALHRYAYS 338

Query: 338 IFNMKGSGEYLLSFVLECGGDPRSPLENSLFSSDANKFGIDNAGIKNSSCEWVWVYGAND 397
           IFN +GSGEYLLSF L+CGG+PR PLE  LF +D N   I    +++S+ EW+W+YG +D
Sbjct: 339 IFNKRGSGEYLLSFALKCGGEPRLPLEEQLF-NDRN-LNI----LRSSNYEWLWLYGDDD 392

Query: 398 WMDIHGAERVTKDFLMNNRKKSRVVTIPESGHHLYFDNYPMFNSLLIDEMKSL 450
           WMD++G  RV+K      R+KS V+ +P +GHHLY DN   FN +L+ EM+ +
Sbjct: 393 WMDVNGGIRVSKFLNEKLRQKSNVIIVPHAGHHLYLDNSKFFNDILVKEMRKV 445

>KAFR0I01970 Chr9 (401907..403142) [1236 bp, 411 aa] {ON} 
          Length = 411

 Score =  416 bits (1070), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 204/411 (49%), Positives = 271/411 (65%), Gaps = 32/411 (7%)

Query: 42  ATAPTAKPLYEIVRDLPRLFPRSLAESKRDYATFHSNVDLMQLELLRTLPFFERTGYNKR 101
           ++AP A PL +I+  LPRLFPRS+ ES +DY  +    + MQ +LL TLPF+     +K 
Sbjct: 31  SSAPVAIPLVKIIAQLPRLFPRSIDESFKDYRVYKEGPERMQEDLLSTLPFYPNVSKDKV 90

Query: 102 AYLRKTEIDSDGNYINELVIEPANVDPNKKRKRLIFVHGYGAGLGFYLKNYEHLPLLDDS 161
           A + KT +D +GNYINE  I P N   ++K K LIF+HGYGAG GF+LKN E +PLLD++
Sbjct: 91  ARIIKTVVDEEGNYINEFCITPKNTVNSQKLKHLIFIHGYGAGFGFFLKNLESIPLLDNN 150

Query: 162 WSIHAIDLPGYGFSSRMDFPFQFPRDDTSVVCDWFISRLRTLFEKRGF--DKSDNIVMAH 219
           W IHAIDLPG+GFSSR +FPF++P  +TS V  WF  R+R   E+R    +  +N+++AH
Sbjct: 151 WCIHAIDLPGFGFSSRKNFPFKYPTSNTSEVTAWFHERIRRWLEERTLLDNPKNNVIVAH 210

Query: 220 SMGAYLMAFYLNKYPDSVKKMVMCSPAGISRSQYSINNNITEDISSGKEEIKLKIKKVPW 279
           S+GAYLMA Y   YP  ++K++MCSPAG+S+SQ   NN+               + + PW
Sbjct: 211 SLGAYLMALYTQVYPAHLRKLIMCSPAGVSKSQ---NNSKA-------------VLQPPW 254

Query: 280 WYTKLWDRNISPFVLVRKTGILGSKITSGWTYRRFKPILLNKENNYEQFEKLHRYSFAIF 339
           WY KLWD N+SPF LVR +  LGSK+TSGW+YRRFK I      N  QFE LHRYS+AIF
Sbjct: 255 WYAKLWDMNLSPFTLVRLSKHLGSKLTSGWSYRRFKLI-----ENRMQFEMLHRYSYAIF 309

Query: 340 NMKGSGEYLLSFVLECGGDPRSPLENSLFSSDANKFGIDNAGIKNSSCEWVWVYGANDWM 399
           N  GSGEYLL F+LECGG+PR  LE++LFS++ N          +S  EW W+YG NDWM
Sbjct: 310 NQPGSGEYLLGFILECGGNPRCSLEDTLFSNNFN---------VSSKVEWAWIYGENDWM 360

Query: 400 DIHGAERVTKDFLMNNRKKSRVVTIPESGHHLYFDNYPMFNSLLIDEMKSL 450
           DI G  RV    L    + S+   +P +GHHLY DN   FN++++  M+++
Sbjct: 361 DIEGGRRVHNLLLEKFNRDSKFYMVPNAGHHLYLDNIRYFNNIIVQHMENV 411

>KLTH0E13948g Chr5 complement(1231122..1232438) [1317 bp, 438 aa]
           {ON} similar to uniprot|P53264 Saccharomyces cerevisiae
           YGR110W Hypothetical ORF
          Length = 438

 Score =  417 bits (1072), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 208/414 (50%), Positives = 264/414 (63%), Gaps = 27/414 (6%)

Query: 37  SAIIHATAPTAKPLYEIVRDLPRLFPRSLAESKRDYATFHSNVDLMQLELLRTLPFFERT 96
           S     ++P+A PL E+V +LPRLFPRS+ ES RDY  F  +   +Q +LL TLPFF   
Sbjct: 46  SITCRPSSPSAIPLRELVINLPRLFPRSMKESVRDYFAFRKDAGTLQHQLLSTLPFFPVA 105

Query: 97  GYNKRAYLRKTEIDSDGNYINELVIEPANVDPNKKRKRLIFVHGYGAGLGFYLKNYEHLP 156
           G +K A + +T +D   NYINE  + PA   P+   + LI VHGYGAGLGF+LKN E L 
Sbjct: 106 GDDKVAEVVQTPVDEQANYINEFCVRPAMPHPSGTLRHLIIVHGYGAGLGFFLKNLEKLN 165

Query: 157 LLDDSWSIHAIDLPGYGFSSRMDFPFQFPRDDTSVVCDWFISRLRTLFEKRGF--DKSDN 214
           L+D+ W IHAIDLPGYGFSSR  FP+++  D  + V  WF +R +T  EKRG       N
Sbjct: 166 LIDNRWVIHAIDLPGYGFSSRPKFPYKYKSDPAAQVEHWFHARFKTWLEKRGLLQHPEQN 225

Query: 215 IVMAHSMGAYLMAFYLNKYPDSVKKMVMCSPAGISRSQYSINNNITEDISSGKEEIKLKI 274
           +++AHSMGAYL A Y NKYP+  KK+VMCSPAGI             +  S K+      
Sbjct: 226 MLVAHSMGAYLAALYANKYPNHFKKLVMCSPAGIC------------NTPSNKQR----- 268

Query: 275 KKVPWWYTKLWDRNISPFVLVRKTGILGSKITSGWTYRRFKPILLNKENNYEQFEKLHRY 334
           +  PWW+ KLWDRNISPF LVR + +LGSK+TSGW+YRRF  +L       +QFE +H+Y
Sbjct: 269 RLPPWWFAKLWDRNISPFSLVRNSRLLGSKLTSGWSYRRFGQLLSEGYRGAQQFEAIHKY 328

Query: 335 SFAIFNMKGSGEYLLSFVLECGGDPRSPLENSLFSSDANKFGIDNAGIKNSSCEWVWVYG 394
           ++AIFN  GSGEYLLSF L+CGGDPR  LE  LF +  N+F         + CEW+W+YG
Sbjct: 329 AYAIFNSPGSGEYLLSFALKCGGDPRDALERRLFHNKMNQF--------KAKCEWLWLYG 380

Query: 395 ANDWMDIHGAERVTKDFLMNNRKKSRVVTIPESGHHLYFDNYPMFNSLLIDEMK 448
             DWMD+ G  RV+        KKS+V  + +SGHHLYFDNY  FN +L  EMK
Sbjct: 381 DQDWMDVGGGRRVSHFLNTAMGKKSKVEVVHDSGHHLYFDNYEQFNRILEKEMK 434

>KNAG0B00950 Chr2 (173167..174423) [1257 bp, 418 aa] {ON} Anc_3.454
           YGR110W
          Length = 418

 Score =  413 bits (1061), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 211/410 (51%), Positives = 266/410 (64%), Gaps = 34/410 (8%)

Query: 43  TAPTAKPLYEIVRDLPRLFPRSLAESKRDYATFHSNVDLMQLELLRTLPFFERTGYNKRA 102
           TAPTA PL EI+  LP LFPR +A+S  DY  F +N D +Q +LL TLPFF      KRA
Sbjct: 41  TAPTAIPLTEIIVKLPYLFPRGVAQSLEDYKVFSNNADKIQYDLLSTLPFFPEAKDGKRA 100

Query: 103 YLRKTEIDSDGNYINELVIEPANVDPNKKRKRLIFVHGYGAGLGFYLKNYEHLPLLDDSW 162
            + +T+ID D N+INE  I+PANV    K K LIF+HGYGAGLGF+LKN+E++ L D+SW
Sbjct: 101 EIVRTKIDEDDNFINEFFIQPANVTEPSKLKHLIFIHGYGAGLGFFLKNFENIQLKDNSW 160

Query: 163 SIHAIDLPGYGFSSRMDFPFQFPRDDTSVVCDWFISRLRTLFEKRGFDKS--DNIVMAHS 220
            IHAIDLPG+GFSSR  FPF++P DD S V  WF  RL+  FEKR   K+  +N+V+AHS
Sbjct: 161 CIHAIDLPGFGFSSRTKFPFKYPEDDVSKVQTWFHERLKIWFEKRDLLKNPGNNMVVAHS 220

Query: 221 MGAYLMAFYLNKYPDSVKKMVMCSPAGISRSQYSINNNITEDISSGKEEIKLKIKKVPWW 280
           +GAYLMA Y    P   KK++MCSPAG+       N+ + +             K+ PWW
Sbjct: 221 LGAYLMALYKRNNPLHFKKLIMCSPAGMC------NSTVVK-------------KQPPWW 261

Query: 281 YTKLWDRNISPFVLVRKTGILGSKITSGWTYRRFKPILLNKENNYEQFEKLHRYSFAIFN 340
           Y  LWD N+SPF LVR +G LGSK+TSGW+YRRF+ +     ++  QFE LH YS+AIFN
Sbjct: 262 YAALWDMNLSPFSLVRNSGWLGSKLTSGWSYRRFRSL-----HSKIQFENLHLYSYAIFN 316

Query: 341 MKGSGEYLLSFVLECGGDPRSPLENSLFSSDANKFGIDNAGIKNSSCEWVWVYGANDWMD 400
             G GEYLL+F L CGGDPR  LE +LF+   NK+        +S  EWVW+YG  DWMD
Sbjct: 317 RPGCGEYLLAFALRCGGDPRVSLEATLFNDVVNKW--------DSDSEWVWLYGDRDWMD 368

Query: 401 IHGAERVTKDFLMNNRKKSRVVTIPESGHHLYFDNYPMFNSLLIDEMKSL 450
           + G  R+++        KS V  IP +GHHLYFDN   FN++L  EM  L
Sbjct: 369 VKGGRRISQKINEIFPGKSSVEVIPNAGHHLYFDNISCFNAILEKEMTKL 418

>Ecym_2465 Chr2 complement(908173..909489) [1317 bp, 438 aa] {ON}
           similar to Ashbya gossypii ABL019W
          Length = 438

 Score =  411 bits (1056), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 209/413 (50%), Positives = 266/413 (64%), Gaps = 31/413 (7%)

Query: 43  TAPTAKPLYEIVRDLPRLFPRSLAESKRDYATFHSNVDLMQLELLRTLPFFERTGYNKRA 102
           T PTA PL EI+ ++P LFP  L ES +DY  FH +VD  Q  LL TLPFF      K  
Sbjct: 44  TPPTAIPLMEILLNIPSLFPMPLKESWKDYKIFHDDVDKFQTGLLSTLPFFPSAADGKIG 103

Query: 103 YLRKTEIDSDGNYINELVIEPAN--VDP-NKKRKRLIFVHGYGAGLGFYLKNYEHLPLLD 159
            + +T +D +GNYINE  I P +  V+P + K   LIFVHGYGAGLGF+LKN+E++ LL+
Sbjct: 104 EIIRTPVDEEGNYINEFCIRPNSPPVNPKDSKMHHLIFVHGYGAGLGFFLKNFENIKLLN 163

Query: 160 DSWSIHAIDLPGYGFSSRMDFPFQFPRDDTSVVCDWFISRLRTLFEKRGF--DKSDNIVM 217
           +SW+IHAID PGYGFSSR  FPF   ++  S V +WF  R     +KRG   D+  N+V+
Sbjct: 164 NSWTIHAIDFPGYGFSSRPKFPFSINKNTASEVENWFHDRFEIWLQKRGLLEDQERNLVL 223

Query: 218 AHSMGAYLMAFYLNKYPDSVKKMVMCSPAGISRSQYSINNNITEDISSGKEEIKLKIKKV 277
           AHS+GAYL+A Y    P  +KK++MCSPAGI  S     N +              IK+ 
Sbjct: 224 AHSLGAYLIALYAQSRPKHLKKLIMCSPAGICPS-----NKV--------------IKQP 264

Query: 278 PWWYTKLWDRNISPFVLVRKTGILGSKITSGWTYRRFKPILLNKENNYEQFEKLHRYSFA 337
           PWW+ KLWDRN+SPF LVR +GI GSK+TSGW++RRFK  L        QF+ LHRY++A
Sbjct: 265 PWWFVKLWDRNLSPFSLVRNSGIFGSKLTSGWSFRRFKQFLNEGTMGESQFQALHRYAYA 324

Query: 338 IFNMKGSGEYLLSFVLECGGDPRSPLENSLFSSDANKFGIDNAGIKNSSCEWVWVYGAND 397
           IFN  GSGEYLLSFVL+CGGDPRSPL + LF+S A       A    + C+W+W+YG  D
Sbjct: 325 IFNKPGSGEYLLSFVLKCGGDPRSPLLSRLFNSQA-------ADSFKAQCDWLWMYGDQD 377

Query: 398 WMDIHGAERVTKDFLMNNRKKSRVVTIPESGHHLYFDNYPMFNSLLIDEMKSL 450
           WMD  G E+ +   + +  K+S V  IP+SGHHLY DNY +FN LL  EM  +
Sbjct: 378 WMDCKGGEQASDFIVRHIGKESNVHVIPQSGHHLYLDNYSVFNELLQAEMAKM 430

>SAKL0B06116g Chr2 complement(519929..521224) [1296 bp, 431 aa] {ON}
           similar to uniprot|P53264 Saccharomyces cerevisiae
           YGR110W Hypothetical ORF
          Length = 431

 Score =  410 bits (1053), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 205/441 (46%), Positives = 278/441 (63%), Gaps = 33/441 (7%)

Query: 14  VASKLLRLSSLGEKSSEVVGKDGSAIIH--ATAPTAKPLYEIVRDLPRLFPRSLAESKRD 71
            A   + +++L  ++      + +AII+  +T PTA PL +I   LP LFP S   S RD
Sbjct: 18  AAVNSISITNLISRAKVRTSAETTAIINQKSTPPTAMPLIQIATQLPNLFPLSFEASIRD 77

Query: 72  YATFHSNVDLMQLELLRTLPFFERTGYNKRAYLRKTEIDSDGNYINELVIEPANVDPNKK 131
           Y+ F  N +  Q +LL TLPF+      + + + KT +D +GNYINE  I+P N   +  
Sbjct: 78  YSMFQENAESFQSQLLSTLPFYPSPANGRSSEILKTPVDDEGNYINEFTIKPMNPSSSSS 137

Query: 132 RKRLIFVHGYGAGLGFYLKNYEHLPLLDDSWSIHAIDLPGYGFSSRMDFPFQFPRDDTSV 191
            K LIFVHGYGAGLGF+LKN+E++PLL+++W IHAIDLPGYGFSSR  FPF +P  +  +
Sbjct: 138 MKHLIFVHGYGAGLGFFLKNFENIPLLNNNWCIHAIDLPGYGFSSRPKFPFNYPEHNPIM 197

Query: 192 VCDWFISRLRTLFEKRGF--DKSDNIVMAHSMGAYLMAFYLNKYPDSVKKMVMCSPAGIS 249
           V DWF  R++    KRG   +  +N+++AHS+GAY+ A Y NK+P+   K++MCSPAGI 
Sbjct: 198 VEDWFHQRIKGWLHKRGLLANPKNNLLVAHSLGAYISALYANKFPNHFSKLIMCSPAGIC 257

Query: 250 RSQYSINNNITEDISSGKEEIKLKIKKVPWWYTKLWDRNISPFVLVRKTGILGSKITSGW 309
            S                   KL  +  P W+ KLWDRNISPF LVR +  LGSK+TSGW
Sbjct: 258 PSP------------------KLG-QAPPQWFVKLWDRNISPFSLVRNSFHLGSKLTSGW 298

Query: 310 TYRRFKPILLNKENNYEQFEKLHRYSFAIFNMKGSGEYLLSFVLECGGDPRSPLENSLFS 369
           TYRRF+  L   +  YEQ + +H+Y++AIFN  GSGEYLLSF L+CGGDPR PLE  LF 
Sbjct: 299 TYRRFRQFLREGQRGYEQHKAMHKYTYAIFNKPGSGEYLLSFALKCGGDPRLPLEKRLF- 357

Query: 370 SDANKFGIDNAGIKNSSCEWVWVYGANDWMDIHGAERVTKDFLMNNRKKSRVVTIPESGH 429
                   DN     ++C+W+W+YG  DWMD+ G +R + +FL     KS V  +P +GH
Sbjct: 358 --------DNTSSFKANCDWLWLYGDEDWMDLRGGQRAS-EFLKKIGMKSDVKVVPSAGH 408

Query: 430 HLYFDNYPMFNSLLIDEMKSL 450
           HLY DNY  FN+++I EM+ +
Sbjct: 409 HLYLDNYKHFNNVVIKEMEKM 429

>Kwal_27.12317 s27 complement(1173365..1174672) [1308 bp, 435 aa]
           {ON} YGR110W - Hypothetical ORF [contig 20] FULL
          Length = 435

 Score =  408 bits (1049), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 210/444 (47%), Positives = 277/444 (62%), Gaps = 31/444 (6%)

Query: 11  FRNVASKL--LRLSSLGEKSSEVVGKDGSAIIHA--TAPTAKPLYEIVRDLPRLFPRSLA 66
            R+ A +L  L+L  L  +  E+  +  +   H   ++P+A PL EI+  LP LFPRSL 
Sbjct: 16  IRSAADQLSNLQLRRLRIRPLEIKNQVPNTSYHPKPSSPSAIPLNEIILKLPNLFPRSLE 75

Query: 67  ESKRDYATFHSNVDLMQLELLRTLPFFERTGYNKRAYLRKTEIDSDGNYINELVIEPANV 126
           +S RD+  F  N   +Q ELL TLPFF      + A + +T +D+ GNYINE  I P  V
Sbjct: 76  QSARDFKDFKLNAGALQSELLATLPFFPAGDSRRTAEIIRTTVDAQGNYINEFNIRPTAV 135

Query: 127 DPNKKRKRLIFVHGYGAGLGFYLKNYEHLPLLDDSWSIHAIDLPGYGFSSRMDFPFQFPR 186
           D +K  K LI VHGYGAGLGF+LK +E+L L++++W IHAIDLPGYGFSSR  FPF+   
Sbjct: 136 DTSKTMKHLILVHGYGAGLGFFLKTFENLNLINENWMIHAIDLPGYGFSSRPPFPFKVGD 195

Query: 187 DDTSVVCDWFISRLRTLFEKRGFDKS--DNIVMAHSMGAYLMAFYLNKYPDSVKKMVMCS 244
              + V  WF SR     E+RG  ++  +N+V+AHSMGAYL A Y NK+P   KK+VMCS
Sbjct: 196 STPAQVEQWFHSRFHRWMERRGLLETPENNMVVAHSMGAYLTALYANKHPGHFKKLVMCS 255

Query: 245 PAGISRSQYSINNNITEDISSGKEEIKLKIKKVPWWYTKLWDRNISPFVLVRKTGILGSK 304
           PAG+  S                   +++ +  PWW+ KLWD+NISPF LVR   +LGSK
Sbjct: 256 PAGVCHS-----------------APEMRKRPPPWWFAKLWDKNISPFSLVRNANVLGSK 298

Query: 305 ITSGWTYRRFKPILLNKENNYEQFEKLHRYSFAIFNMKGSGEYLLSFVLECGGDPRSPLE 364
           +TSGW+YRR   +L +K  N  Q E LHRY++AIFN KGSGEYLLSF L+CGG+PR PLE
Sbjct: 299 LTSGWSYRRLGQLLKDKVLNARQHEALHRYAYAIFNRKGSGEYLLSFALQCGGEPRVPLE 358

Query: 365 NSLFSSDANKFGIDNAGIKNSSCEWVWVYGANDWMDIHGAERVTKDFLMNNRKKSRVVTI 424
             LF +   +F         ++CEW+W+YG  DW+D  G ERV++        +S V  +
Sbjct: 359 RRLFHNRGQQF--------KANCEWLWLYGDQDWIDRRGGERVSQFLTAEMGHESCVKIV 410

Query: 425 PESGHHLYFDNYPMFNSLLIDEMK 448
             SGHHLY DN+ MFN +L DEM+
Sbjct: 411 KNSGHHLYLDNHRMFNKILEDEMR 434

>TPHA0O01310 Chr15 complement(258745..260061) [1317 bp, 438 aa] {ON}
           
          Length = 438

 Score =  406 bits (1044), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 195/405 (48%), Positives = 271/405 (66%), Gaps = 30/405 (7%)

Query: 50  LYEIVRDLPRLFPRSLAESKRDYATFHSNVDLMQLELLRTLPFFERTGYNKRAYLRKTEI 109
           L+E+++  PRLFPRS  +S +DY  FHS+V+  Q+ LL TLP+F        + +  T +
Sbjct: 61  LFELIKQFPRLFPRSFMKSFQDYKQFHSDVENFQVRLLETLPYFPDPSNGIYSKITNTIV 120

Query: 110 DSDGNYINELVIEPANVD-PNKKRKRLIFVHGYGAGLGFYLKNYEHLPLLDDSWSIHAID 168
           D +G+ INE V+ P+N+  P++K K LIFVHGYGAGLGF+LKN E++ LL+D W +HAID
Sbjct: 121 DDEGSSINEFVVYPSNISVPSEKLKHLIFVHGYGAGLGFFLKNLENIKLLNDEWCVHAID 180

Query: 169 LPGYGFSSRMDFPFQFPRDDTSVVCDWFISRLRTLFEKRGF--DKSDNIVMAHSMGAYLM 226
           LPGYGFS+R  FPFQ  +     V +WF SR+R    +R       +N ++AHS+GAYLM
Sbjct: 181 LPGYGFSTRAKFPFQVGKHRHDQVNEWFHSRIRNWMHQRNLLQHSQNNFLIAHSLGAYLM 240

Query: 227 AFYLNKYPDSVKKMVMCSPAGISRSQYSINNNITEDISSGKEEIKLKIKKVPWWYTKLWD 286
           A Y++K+P+ ++K++MCSPAGI  S                  + LK K   WW+ KLW+
Sbjct: 241 ALYVDKHPNDLQKILMCSPAGIGDS------------------MNLKKKTPAWWFEKLWE 282

Query: 287 RNISPFVLVRKTGILGSKITSGWTYRRFKPILLNKENNYEQFEKLHRYSFAIFNMKGSGE 346
           RNISPF LVR +  +GSK+TSGWTYRRF  +L   +NN +QFE LH+Y+++IFN +GSGE
Sbjct: 283 RNISPFTLVRSSSYIGSKLTSGWTYRRFSSLL--SQNNLKQFEALHKYTYSIFNQRGSGE 340

Query: 347 YLLSFVLECGGDPRSPLENSLFSSDANKFGIDNAGIKNSSCEWVWVYGANDWMDIHGAER 406
           YLL+F L+CGG PR PLE +LF +       ++ GI  SS EW+W YG NDWMD +G  R
Sbjct: 341 YLLNFALKCGGGPRYPLEKTLFMN-------NDKGISKSSTEWIWAYGDNDWMDKNGGIR 393

Query: 407 VTKDFLMNNRKKSRVVTIPESGHHLYFDNYPMFNSLLIDEMKSLQ 451
           V++      +K+S V  +P +GHHLYFDN+  FN L++ EM+ ++
Sbjct: 394 VSEILTKQLKKRSEVYIVPRAGHHLYFDNHQFFNDLILKEMECMK 438

>NDAI0G01090 Chr7 (230932..232302) [1371 bp, 456 aa] {ON} Anc_3.454
          Length = 456

 Score =  395 bits (1016), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 200/415 (48%), Positives = 268/415 (64%), Gaps = 36/415 (8%)

Query: 40  IHATAPTAKPLYEIVRDLPRLFPRSLAESKRDYATFHSNVDLMQLELLRTLPFFERTGYN 99
           I  T PTA PL  I+  LP+LFPRS+ +S +DY  F  + + +Q++LL+TLPFF      
Sbjct: 67  IAPTPPTAIPLLRIITSLPKLFPRSIKQSIQDYKIFQKDPERLQIDLLKTLPFFSNGAKF 126

Query: 100 KRAYLRKTEI-DSDGNYINELVIEP-ANVDPNKKR-KRLIFVHGYGAGLGFYLKNYEHLP 156
           K   + KT+I D+D  YINE  I P  N++ N    K LIF+HGYGAGLGF++KN E++P
Sbjct: 127 KTGKILKTQIEDNDDYYINEFCITPDTNININSADVKHLIFIHGYGAGLGFFIKNLENIP 186

Query: 157 LLDDSWSIHAIDLPGYGFSSR-MDFPFQFPRDDTSVVCDWFISRLRTLFEKRGFDK--SD 213
           LL++ W IHAIDLPGYG+S+R   FPF++PRD    V +WF  ++    +KR       +
Sbjct: 187 LLNNRWCIHAIDLPGYGYSTRNKKFPFKYPRDSQLKVQNWFHDKIHIWLQKRNLLNYPKN 246

Query: 214 NIVMAHSMGAYLMAFYLNKYPDSVKKMVMCSPAGISRSQYSINNNITEDISSGKEEIKLK 273
           N+++AHS+GAYLMA Y  K+P   +K++MCSPAG+++S     NN               
Sbjct: 247 NLIVAHSLGAYLMAQYAFKFPSHFQKLIMCSPAGVTKSSIKKLNN--------------- 291

Query: 274 IKKVPWWYTKLWDRNISPFVLVRKTGILGSKITSGWTYRRFKPILLNKENNYEQFEKLHR 333
               PWWY KLWD N SPF +VR +GI GSKITS W+YRRFKP+ L+    ++QFE LHR
Sbjct: 292 --SPPWWYEKLWDLNFSPFSIVRNSGIYGSKITSAWSYRRFKPLDLD----HKQFEALHR 345

Query: 334 YSFAIFNMKGSGEYLLSFVLECGGDPRSPLENSLFSSDANKFGIDNAGIKNSSCEWVWVY 393
           Y+++IFN  G GEYLLSF+L CGG+PR  LE++LF  +          +    C+W W+Y
Sbjct: 346 YAYSIFNRPGCGEYLLSFILSCGGNPRFSLEDTLFQRE---------NLSTELCDWGWIY 396

Query: 394 GANDWMDIHGAERVTKDFLMNNRKKSRVVTIPESGHHLYFDNYPMFNSLLIDEMK 448
           G NDWMDI+GA+RV++      + KS V  IP +GHHLY DNY  FN LLI EM+
Sbjct: 397 GDNDWMDINGAKRVSRLINEQQKGKSDVHVIPSAGHHLYLDNYKDFNKLLIKEME 451

>TBLA0F03460 Chr6 (853280..854605) [1326 bp, 441 aa] {ON} 
          Length = 441

 Score =  341 bits (874), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 189/422 (44%), Positives = 254/422 (60%), Gaps = 45/422 (10%)

Query: 42  ATAPTAKPLYEIVRDLPRLFPRSLAESKRDYATFHSNVDLMQLELLRTLPFFERTGYN-- 99
           +TAP A  L +I+R+LPRLFPRS+ +S RDY+ F +N +  Q  LL  L F+     N  
Sbjct: 45  STAPKAASLPQILRNLPRLFPRSMTDSIRDYSQFKTNPEFFQDRLLSQLSFYPSLYNNNS 104

Query: 100 ---------KRAYLRKTEIDSDGNYINELVIEPANVDPNKKRKRLIFVHGYGAGLGFYLK 150
                    ++  + KT ++ +  YINE  I P    P  + K LI +HGYGAGLGFY+ 
Sbjct: 105 NDTSGNDDPRQGQIIKTYVN-ENEYINEFQILPNTSTPYDRLKHLILIHGYGAGLGFYIN 163

Query: 151 NYEHLPLLDDSWSIHAIDLPGYGFSSRMDFPFQF--PRDDTSV-VCDWFISRLRTLFEKR 207
             +HL +  D+W IHA+DLPGYGFSSR+ FP+    PR  +   V DWF  RL+T F K+
Sbjct: 164 TLQHLSM--DNWCIHAVDLPGYGFSSRLKFPYGTINPRIYSKKDVLDWFQKRLKTWFHKK 221

Query: 208 GF--DKSDNIVMAHSMGAYLMAFYLNKYPDSVKKMVMCSPAGISRSQYSINNNITEDISS 265
           G      +N+V AHSMGAY+M  YLN +P   +K++MCSPAG     Y  +N +T     
Sbjct: 222 GLLAHPENNLVTAHSMGAYIMCHYLNNHPSDFRKIIMCSPAGF----YPASNPLTN---- 273

Query: 266 GKEEIKLKIKKVPWWYTKLWDRNISPFVLVRKTGILGSKITSGWTYRRFKPILLNKENNY 325
                      +P WYT LWDRN SPF LVR +G LGSK+TSGW+Y RF     N+  + 
Sbjct: 274 -----------IPLWYTYLWDRNYSPFSLVRISGPLGSKLTSGWSYSRF--FHSNQTISN 320

Query: 326 EQFEKLHRYSFAIFNMKGSGEYLLSFVLECGGDPRSPLENSLFSSDANKFGIDNAGIKNS 385
           E    LH Y+++IFN+ GSGEY LS +L+ GGDPR+PL+   F+  +      N GI+ S
Sbjct: 321 ELSLALHTYAYSIFNLPGSGEYSLSHILKAGGDPRTPLQEEFFTCQSTT----NNGIRRS 376

Query: 386 SCEWVWVYGANDWMDIHGAERVTKDFLMNNRKKSRVVTIPESGHHLYFDNYPMFNSLLID 445
           + E+ W+YG +DW++  G  ++++ FL +  KKS V   P SGHHLYFDNY  FNS L  
Sbjct: 377 NVEYSWLYGQSDWINKTGGFKISQ-FLNSLNKKSNVFIAPNSGHHLYFDNYMWFNSYLAK 435

Query: 446 EM 447
           EM
Sbjct: 436 EM 437

>KLLA0B12914g Chr2 (1126975..1128255) [1281 bp, 426 aa] {ON} similar
           to uniprot|P53264 Saccharomyces cerevisiae YGR110W
          Length = 426

 Score =  340 bits (871), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 190/443 (42%), Positives = 258/443 (58%), Gaps = 48/443 (10%)

Query: 8   KRSFRNVASKLLRLSSLGEKSSEVVGKDGSAIIHATAPTAKPLYEIVRDLPRLFPRSLAE 67
           +R    V +    + S  +KS  V     + +  +TAP   PL +IV +L +LFP S AE
Sbjct: 28  QREHVGVTAGTGNVGSTNKKSVRV-----NTVRKSTAPIGLPLLQIVTNLHKLFPLSFAE 82

Query: 68  SKRDYATFHSNVDLMQLELLRTLPFFERTGYNKRAYLRKTEIDSDGNYINELVIEPANVD 127
           S +DY  ++ N +  Q +LL  LP++        + + KT ID+ GNYINE  I P   +
Sbjct: 83  SLKDYKQYNINKEQFQEDLLSVLPYYPEPSARFSSKIIKTPIDAAGNYINEFQITPIRPE 142

Query: 128 PN-KKRKRLIFVHGYGAGLGFYLKNYEHLPLLDDSWSIHAIDLPGYGFSSRMDFPFQFPR 186
            + K  K +I VHGYGAGLGFYLKN+    LL ++  +HAIDLPGYGFSSR  FPF +P+
Sbjct: 143 SDGKPLKHIILVHGYGAGLGFYLKNFN--ALLSENVVVHAIDLPGYGFSSRPMFPFHYPK 200

Query: 187 DDTSVVCDWFISRLRTLFEKRGFDKS--DNIVMAHSMGAYLMAFYLNKYPDSVKKMVMCS 244
           D    V D+F   L   F+K+G      +N V+AHSMGAY+ + Y NKY    KK+ MCS
Sbjct: 201 DSYLAVEDYFHDALHKWFDKKGLISCWENNYVIAHSMGAYIFSLYANKY-KHFKKLFMCS 259

Query: 245 PAGISRSQYSINNNITEDISSGKEEIKLKIKKVPWWYTKLWDRNISPFVLVRKTGILGSK 304
           P GISR++                     +   PWW+ KLWD+NISPF LVR  G +GSK
Sbjct: 260 PGGISRNK--------------------DMPPPPWWFLKLWDQNISPFSLVRNAGHVGSK 299

Query: 305 ITSGWTYRRFKPILLNKENNYEQFEKLHRYSFAIFNMKGSGEYLLSFVLECGGDPRSPLE 364
           + SGWT RRF         ++  F+KLH Y++ IFN  GSGEY+LSF+L CGG PR PLE
Sbjct: 300 LVSGWTARRFGL-------HHPNFDKLHHYTYGIFNQPGSGEYMLSFMLGCGGWPRVPLE 352

Query: 365 NSLFSSDANKFGIDNAGIKNSSCEWVWVYGANDWMDIHGAERVTKDFLMNNRKKSRVVTI 424
             LF+ +            +S  +WVW+YG +DWMDI+GA R+  DFL      +++  +
Sbjct: 353 TRLFTEE---------NFNSSHLDWVWLYGDSDWMDINGARRIN-DFLRKKCINTKLEIV 402

Query: 425 PESGHHLYFDNYPMFNSLLIDEM 447
           P +GHHLY+DN   FN++L  E+
Sbjct: 403 PNAGHHLYWDNDSFFNNVLRKEL 425

>SAKL0G19074g Chr7 (1646858..1648156) [1299 bp, 432 aa] {ON}
           conserved hypothetical protein
          Length = 432

 Score =  172 bits (437), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 126/432 (29%), Positives = 194/432 (44%), Gaps = 77/432 (17%)

Query: 65  LAESKRDY---ATFH-----SNVDLMQLELLRTLPFFERTGYNKRAYLRKTEIDSDGNYI 116
           L E K+DY   A+F      S++   +  +L  L F+     ++R      +I + GN I
Sbjct: 19  LEELKKDYDFKASFKTWKHASSLRESEENILSMLDFYPEGDESRRCETMDVDIGT-GNSI 77

Query: 117 NELVIEPANVDPNKKRKRLIFVHGYGAGLGFYLKNYEHLPLLDDSWSIHAIDLPGYGFSS 176
           +E  IE          + ++ VHGYGA LG +++N++ L  +     +HAID+ GYG SS
Sbjct: 78  HEFCIENTKESDRDYCRDMVLVHGYGAALGLFIRNFDGLSQIP-GIRLHAIDMLGYGLSS 136

Query: 177 RMDFP-----------FQFPRDDTSVVCDWFISRLRTLFEKRGFDKSDNIVMAHSMGAYL 225
           R  FP            +  ++D  +  D+FI  + T   KR  DK   +++ HS+G YL
Sbjct: 137 RPKFPDTGFLTSFWKKREVTKEDVLLAEDFFIDSIETWRHKRHLDKF--VLVGHSLGGYL 194

Query: 226 MAFYLNKYPDSVKKMVMCSPAGISRSQYSINNNITEDISSGKE---EIKLKIKKVPWWYT 282
              Y  KYP+ V+K+++ SP G+  S + +    T       E   +I  ++K VP   T
Sbjct: 195 SCRYALKYPERVEKLILVSPVGVETSIFDLTKEHTATHEHAAELGPDIAQELKVVPENST 254

Query: 283 K-------------------------------LWDRNISPFVLVRKTGILGSKITSGWTY 311
                                           +W+ NISPF ++R  G  G  + S W++
Sbjct: 255 TDKPVQPSSSFHVPNESGHVERIPNLPKIVRIIWENNISPFGILRSLGPWGPLLCSRWSF 314

Query: 312 RRFKPILLNKENNYEQFEKLHRYSFAIFNMKGSGEYLLSFVLECGGDPRSPLENSLFSSD 371
           RRF         + EQ  K H Y++  FN +GSGEY L+ +L  G   R PL        
Sbjct: 315 RRFSHC-----GDKEQVMKFHDYAYNTFNARGSGEYALTRILAPGVLARIPLL------- 362

Query: 372 ANKFGIDNAGIKNSSCEWVWVYGANDWMDIHGAERVTKDFLMNNRKKSRVVTIPESGHHL 431
                  +   KN  CE +W+YG++DWM       + K+ L      +    + ++GHHL
Sbjct: 363 -------SCAPKNLKCESLWMYGSHDWMSKEAGSVIVKE-LNKAGNTADYSVVSDAGHHL 414

Query: 432 YFDNYPMFNSLL 443
           Y DN   FN  L
Sbjct: 415 YLDNPHEFNQKL 426

>KLTH0C01254g Chr3 complement(113435..114739) [1305 bp, 434 aa] {ON}
           conserved hypothetical protein
          Length = 434

 Score =  166 bits (420), Expect = 7e-46,   Method: Compositional matrix adjust.
 Identities = 124/431 (28%), Positives = 203/431 (47%), Gaps = 77/431 (17%)

Query: 69  KRDYATFHSNVDLMQLE--LLRTLPFFERTGYNKRAYLRKTEIDSDGNYINELVIEPANV 126
           K+ + T+ S  D  + E  LL TL FF      +   L   +I  +  +I+E  I+    
Sbjct: 27  KKAFKTWWSRADAKENEKKLLSTLEFFPGGDSIRNCELLDVDI-GNKQHIHEFSIQNIES 85

Query: 127 DPNKKRKRLIFVHGYGAGLGFYLKNYEHLPLLDDSWSIHAIDLPGYGFSSRMDFPF---- 182
                 K L+ VHGYGA LG +++N++ L  +    ++HA+D+ G G SSR  FP     
Sbjct: 86  CSRDYCKDLVMVHGYGAALGLFVRNFDGLSRIP-GINLHALDMLGCGLSSRPRFPGTGLI 144

Query: 183 -------QFPRDDTSVVCDWFISRLRTLFEKRGFDKSDNIVMAHSMGAYLMAFYLNKYPD 235
                  +  +++     ++FI  L    ++R  DK   +++ HS+G YL   Y  K+P+
Sbjct: 145 SSVIKRGRVTKEEVYEAENFFIDSLEKWRQQRKLDKF--VLVGHSLGGYLSCCYALKFPE 202

Query: 236 SVKKMVMCSPAGISRSQYSI-------NNNITE---DIS------SGK----EEIKL--- 272
            V+K+V+ SP G+ +S + +       +NN +E   D+S      SG+    + +K    
Sbjct: 203 RVEKLVLVSPVGVEKSVFDLTKEHTPSHNNASELGPDLSKEVTNSSGRPTTDDPVKTSSS 262

Query: 273 -----------KIKKVPWWYTKLWDRNISPFVLVRKTGILGSKITSGWTYRRFKPILLNK 321
                      ++  +PW ++ +W  NISPF L+R  G  G  ++S W++RRF     + 
Sbjct: 263 FHVPDEAGNVERVPNMPWIFSSMWTYNISPFGLLRSAGPAGPLLSSRWSFRRF-----SF 317

Query: 322 ENNYEQFEKLHRYSFAIFNMKGSGEYLLSFVLECGGDPRSPLENSLFSSDANKFGIDNAG 381
             N EQ    H Y ++IF+  GSGEY L+ +L  G   R PL + +              
Sbjct: 318 AENTEQLLTFHEYCYSIFSGSGSGEYALTRILAPGVLARVPLLSRV-------------- 363

Query: 382 IKNSSCEWVWVYGANDWMDIHGAERVTKDFLMNNRKKSRV----VTIPESGHHLYFDNYP 437
            +N  C+  W+YG++DWM       + +     N+ K  V      + ++GHHLY DN  
Sbjct: 364 PENLKCDSFWMYGSHDWMSKEAGSVIVRQI---NKTKGSVKADYSVVSDAGHHLYLDNPE 420

Query: 438 MFNSLLIDEMK 448
            FN  L   +K
Sbjct: 421 EFNQKLAKFLK 431

>Kwal_14.985 s14 complement(142781..144088) [1308 bp, 435 aa] {ON}
           YDR125C (ECM18) - (putative) involved in cell wall
           biogenesis [contig 244] FULL
          Length = 435

 Score =  159 bits (401), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 116/418 (27%), Positives = 189/418 (45%), Gaps = 69/418 (16%)

Query: 77  SNVDLMQLELLRTLPFFERTGYNKRAYLRKTEIDSDGNYINELVIEPANVDPNKKRKRLI 136
           SN    + +LL TL FF +    ++  +   +I  D   I+EL IE            L+
Sbjct: 38  SNARENEKQLLSTLEFFPQGDSTRKCKILDVDI-GDKQTIHELEIENLKTSSRSYANDLV 96

Query: 137 FVHGYGAGLGFYLKNYEHLPLLDDSWSIHAIDLPGYGFSSRMDFPF-----------QFP 185
            VHGYGA LG +++N++ L  +     +HAID+ G G SSR  FP               
Sbjct: 97  LVHGYGAALGLFVRNFDGLSSVP-GIKLHAIDMLGCGLSSRPKFPGTGLISSLIKRGNVT 155

Query: 186 RDDTSVVCDWFISRLRTLFEKRGFDKSDNIVMAHSMGAYLMAFYLNKYPDSVKKMVMCSP 245
           +++     D+F+  +    +KR  +K   +++ HS+G YL + Y  KYP+ V+K+V+ SP
Sbjct: 156 KEEVYEAEDFFVDSMEKWRKKRQVEKF--VLVGHSLGGYLSSCYALKYPERVEKLVLVSP 213

Query: 246 AGISRSQYSINNNITEDISSGKE-------EIKLK------------------------I 274
            G+ +S + + +  TE      E       EI                           +
Sbjct: 214 VGVEKSIFDLTHEHTESHKGAAELGPDVAKEITNNPDKPTTDNPVKNSSSFHVPDEHGMV 273

Query: 275 KKVP---WWYTKLWDRNISPFVLVRKTGILGSKITSGWTYRRFKPILLNKENNYEQFEKL 331
           ++VP     ++ +W  NISPF ++R  G +G  I+S W++RRF     +  ++ +Q    
Sbjct: 274 ERVPNMSRIFSYMWTYNISPFGILRTLGPVGPLISSNWSFRRF-----SFTDDPKQLLTF 328

Query: 332 HRYSFAIFNMKGSGEYLLSFVLECGGDPRSPLENSLFSSDANKFGIDNAGIKNSSCEWVW 391
           H Y + +F+  GSGEY L+ +L  G   R PL + +                N  C+  W
Sbjct: 329 HEYCYGVFSGAGSGEYALTRILAPGVLARLPLLSRMPG--------------NLKCDSFW 374

Query: 392 VYGANDWMDIHGAERVTKDFLMN-NRKKSRVVTIPESGHHLYFDNYPMFNSLLIDEMK 448
           +YG+ DWM       + K    +    K+    + ++GHHLY DN   FN  L+  +K
Sbjct: 375 MYGSQDWMSKEAGSVMVKKLNESPGLGKADFSIVSDAGHHLYLDNPEEFNRKLLKFLK 432

>Ecym_5577 Chr5 (1185997..1187298) [1302 bp, 433 aa] {ON} similar to
           Saccharomyces cerevisiae YGR110W
          Length = 433

 Score =  157 bits (396), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 116/426 (27%), Positives = 188/426 (44%), Gaps = 74/426 (17%)

Query: 69  KRDYATFHSNVDLMQLE--LLRTLPFFERTGYNKRAYLRKTEIDSDGNYINELVIEPANV 126
           K  + T+ S+  L + E  +LR L F+      +   +   +I   G+Y++E  IE    
Sbjct: 25  KESFKTWKSSARLHEAEDNVLRMLSFYPDGDSERTCEVLHVDIGG-GDYMHEFCIENKLP 83

Query: 127 DPNKKRKRLIFVHGYGAGLGFYLKNYEHLPLLDDSWSIHAIDLPGYGFSSRMDFPFQ--- 183
                 K ++ VHGYG  LG +++N++ L  +     +HAID+ GYG SSR  FP     
Sbjct: 84  MTRDTCKDIVLVHGYGTALGVFIRNFDELSQIPGV-RLHAIDMLGYGLSSRPRFPRSGFW 142

Query: 184 --------FPRDDTSVVCDWFISRLRTLFEKRGFDKSDNIVMAHSMGAYLMAFYLNKYPD 235
                     ++       +F+  L    EKR  D    +++ HS+G YL +FY  ++P+
Sbjct: 143 DYYVKGKVVTKEQVEEALAFFVDSLEAWREKRNVDSF--VLVGHSLGGYLSSFYALRHPE 200

Query: 236 SVKKMVMCSPAGISRSQYSINNNIT------------------EDISSGKEEIKL----- 272
            + K+V+ SP G+  S Y +    T                  ED +    ++ +     
Sbjct: 201 RIDKLVLVSPVGVETSIYDLTAEHTPEHQHAGQLGPEVASEFKEDATEHTTDLSIDSNSP 260

Query: 273 ---------------KIKKVPWWYTKLWDRNISPFVLVRKTGILGSKITSGWTYRRFKPI 317
                           +  +PW    LW+ N+SPF L+R  G LG KI + W++RRF   
Sbjct: 261 QSSSLHIPNEKGFVEHVPNIPWLVKMLWNTNVSPFSLLRLLGPLGPKICANWSFRRFGAC 320

Query: 318 LLNKENNYEQFEKLHRYSFAIFNMKGSGEYLLSFVLECGGDPRSPLENSLFSSDANKFGI 377
              K+ N  +    H+Y++  F  KGSGEY +  +L  G   R PL + L          
Sbjct: 321 ---KDTN--ELMNFHQYAYNNFKAKGSGEYAMMKILAPGALARVPLLSQL---------- 365

Query: 378 DNAGIKNSSCEWVWVYGANDWMDIHGAERVTKDFLMNNRKKSRVVTIPESGHHLYFDNYP 437
               +K   C+ +W+YG+NDWM       + ++    +  ++    +  +GHHLY DN  
Sbjct: 366 -PGALK---CDSLWMYGSNDWMSKEAGCIIVEELQEKSDYRAEYKIVNNAGHHLYLDNPE 421

Query: 438 MFNSLL 443
            FN  L
Sbjct: 422 EFNREL 427

>Skud_4.386 Chr4 complement(673125..674465) [1341 bp, 446 aa] {ON}
           YDR125C (REAL)
          Length = 446

 Score = 82.4 bits (202), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 87/349 (24%), Positives = 141/349 (40%), Gaps = 75/349 (21%)

Query: 136 IFVHGYGAGLGFYLKNYEHLPLLDDSWSIHAIDLPGYGFSS------------------- 176
           + +HGY A    Y +NY  L        +++IDLP  G SS                   
Sbjct: 123 LLIHGYAASSMSYFRNYPGLS--KHIRDLYSIDLPASGLSSIPSLEINATTPLPLDIKFI 180

Query: 177 ---RMDFPFQFPRDDTSVVC----DWFISRLRTLFEKRGFDKSDNIVMAHSMGAYLMAFY 229
              +   P+    +    V     D+++ R+          K +  ++ HS GAYL   Y
Sbjct: 181 GKNKFKIPYTINANHHKFVIQMFEDFYLDRIEQWRIDNKLGKMN--IVGHSFGAYLSFKY 238

Query: 230 LNKYPDSVKKMVMCSPAGISRSQYSINNNI------TEDISSGKEEIKLKIKKVPWWYTK 283
             KYP+SV+K+ + SP G+ R+ +S+NNN       T D  +   +   K   +P +  +
Sbjct: 239 AVKYPNSVEKLCLVSPLGVERNIWSVNNNFRSNSPYTIDFENPSSKFYSKRNIIPRYLFQ 298

Query: 284 LWDRNISPFVLVRKTGILGSKITSGWTYRRFK--PILLNKENNYEQFEKLHRYSFAIFNM 341
                   F ++R  G LG+K+   +    +   P L  KE           Y F +F  
Sbjct: 299 ------QQFQILRMMGPLGAKLCWNYILAAYSRVPSLAYKE-----------YIFELFYG 341

Query: 342 KGSGEYLLSFVLECGGD----PRSPLENSLFSSDANKFGIDNAGIKNSSCEWVWVYGAND 397
           KG    + + + E         R PL +SL S +  K  +              VYG  D
Sbjct: 342 KGGIPAVTTEIFEGLFSRSILARDPLMDSLNSLNVRKLLV--------------VYGQYD 387

Query: 398 WMDIHGAERVTKDF--LMNNRKKSRVVTIPESGHHLYFDNYPMFNSLLI 444
           WM+ +    + K+   L ++ +K+    IP SGH+L+ DN   FN  ++
Sbjct: 388 WMNKNAGMLMVKELNNLGDHFEKATYTEIPFSGHNLFLDNPESFNQSIV 436

>TDEL0F04100 Chr6 complement(756762..758066) [1305 bp, 434 aa] {ON}
           Anc_8.284 YDR125C
          Length = 434

 Score = 80.9 bits (198), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 89/345 (25%), Positives = 150/345 (43%), Gaps = 66/345 (19%)

Query: 136 IFVHGYGAGLGFYLKNYEHLPLLDDSWSIHAIDLPGYGFSSRMDFPFQF--PR------- 186
           + +HGY A    Y +N+  L        ++AIDLP  G S+   F      PR       
Sbjct: 116 LLIHGYAASSMAYYRNFTGLS--QTVTDLYAIDLPANGLSAEQPFKLNGDKPRSLKVKYL 173

Query: 187 --DDTSV--VCD-----WFISRLRTLF-----EKRGFDKSDNI-VMAHSMGAYLMAFYLN 231
             D  SV  V D       I +  + +     E R  +K + I ++ HS G YL   Y  
Sbjct: 174 DNDKFSVQHVIDESGTKQMIQQCESYYLDKIEEWRKVNKLEKINLVGHSFGGYLSFKYAL 233

Query: 232 KYPDSVKKMVMCSPAGISRSQYSINNNITEDISSGKEEIKLKIKKVPWWYTKLWDRNISP 291
           KYP+S++K+ + SP G+  S YS+NN + ++    K  + L+      +YT+   R I  
Sbjct: 234 KYPNSIEKLCLVSPLGVETSIYSVNNKLEKNT---KYALDLE-DPTSNFYTR--RREIPK 287

Query: 292 FV------LVRKTGILGSKITSGWTYRRFKPILLNKENNYEQFEKLHRYSFAIFNMKG-- 343
           F+      ++R  G LG+K+   W Y      +L+  +   + E    Y F +   KG  
Sbjct: 288 FIFKNQSEILRWMGPLGAKMC--WNY------ILSAYSRIPEME-YKSYIFELLYGKGGI 338

Query: 344 --SGEYLLSFVLECGGDPRSPLENSLFSSDANKFGIDNAGIKNSSCEWVWVYGANDWMDI 401
             +   + + +       + P+ +SL    A K               + VYG +DWM+ 
Sbjct: 339 APTARQIFTNLFTRNLLAKDPIMDSLGQLQAKKV--------------LLVYGDHDWMNK 384

Query: 402 HGAERVTKDF-LMNNRKKSRVVTIPESGHHLYFDNYPMFNSLLID 445
           +   ++ +    + N   ++ + +PESGH+L+ DN   FN+ L +
Sbjct: 385 YAGYKLVERLNTIRNNTSAQYIEVPESGHNLFLDNPTFFNASLTE 429

>Suva_2.288 Chr2 complement(496577..497884) [1308 bp, 435 aa] {ON}
           YDR125C (REAL)
          Length = 435

 Score = 79.7 bits (195), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 86/349 (24%), Positives = 140/349 (40%), Gaps = 67/349 (19%)

Query: 132 RKRLIFVHGYGAGLGFYLKNYEHLPLLDDSWSIHAIDLPGYGFSS--------------- 176
           R   + +HGY A    Y +NY  L       ++++IDLP  G SS               
Sbjct: 108 RTPTLLIHGYAASSMSYFRNYSGLS--KHFQNLYSIDLPASGLSSIPPLEVNTTTPLPLD 165

Query: 177 -------RMDFPFQFPRDDTSVVC----DWFISRLRTLFEKRGFDKSDNIVMAHSMGAYL 225
                  +   P+         V     D++I R+         DK +  ++ HS G YL
Sbjct: 166 IKFIGKNKFKIPYTINASHHKFVIQMFEDFYIDRIEQWRIDNKLDKMN--IVGHSFGGYL 223

Query: 226 MAFYLNKYPDSVKKMVMCSPAGISRSQYSINNNI------TEDISSGKEEIKLKIKKVPW 279
              Y  KYP+SV+K+ + SP G+ R+ +S+NNN+      T D      +   K   +P 
Sbjct: 224 SFKYAVKYPNSVEKLCLVSPLGVERNIWSVNNNLSSNTLYTTDFKDPSSKFYSKGHLIPK 283

Query: 280 WYTKLWDRNISPFVLVRKTGILGSKITSGWTYRRFKPILLNKENNYEQFEKL--HRYSFA 337
           +   L++     F L+R  G LG+K+   W Y             Y +   L    Y F 
Sbjct: 284 Y---LFEEQ---FKLLRLMGPLGAKVC--WNYIMAA---------YSRVTSLAFKEYIFE 326

Query: 338 IFNMKGSGEYLLSFVLECGGDPRSPLENSLFSSDANKFGIDNAGIKNSSCEWVWVYGAND 397
           +F  KG    + + + + G   RS L         N   +    +         VYG  D
Sbjct: 327 LFYGKGGIPEVTTDIFK-GLFSRSILARDPILDSLNYLNVKKLLV---------VYGQYD 376

Query: 398 WMDIHGAERVTKDF--LMNNRKKSRVVTIPESGHHLYFDNYPMFNSLLI 444
           WM+ +    + ++   L N  +++  + +P SGH+L+ DN   FN  ++
Sbjct: 377 WMNKNAGMLLVENVNKLGNGLERASYLEVPSSGHNLFLDNPESFNQSIV 425

>Skud_12.167 Chr12 complement(322870..324054) [1185 bp, 394 aa] {ON}
           YLR099C (REAL)
          Length = 394

 Score = 78.2 bits (191), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 76/348 (21%), Positives = 150/348 (43%), Gaps = 71/348 (20%)

Query: 136 IFVHGYGAGLGFYLKNYEHLPLLDDSWSIHAIDLPGYGFS---------SRMDFPFQFPR 186
           + +HGY A    + + +E L   D+   ++AIDLP  G S         ++   P +F  
Sbjct: 74  VLIHGYAASSMAFYRTFESLS--DNIKDLYAIDLPANGASQAPALQVDKTKKIKPLRFKH 131

Query: 187 DDTSVVC--------------------DWFISRLRTLFEKRGFDKSDNIVMAHSMGAYLM 226
            +  VV                     ++F+ R+    +     + +  V+ HS G Y+ 
Sbjct: 132 IEDDVVVPVLDKHPPAEDIKSHLEQYENYFVDRIEQWRKDNKLRRIN--VVGHSFGGYIS 189

Query: 227 AFYLNKYPDSVKKMVMCSPAGISRSQYSINN----NITEDISSGKEEIKLKIKKVPWWYT 282
             Y  KYP+S+ K+ + SP G+  S ++I +    N T  ++      +   +K+     
Sbjct: 190 FKYALKYPNSIDKLCLISPLGVENSIHAIAHKWEPNTTYPLTFTDPSSRYYTRKL----- 244

Query: 283 KLWDRNISPFV------LVRKTGILGSKITSGWTYRRFKPILLNKENNYEQFEKLHRYSF 336
                N+  F+      +++  G +GSK+ S +    +  +    +  Y+ +  LH +  
Sbjct: 245 -----NVPQFIFENQLNVLKWMGPIGSKLCSNYISTAYVKV---PDQLYKDY-LLHSFVG 295

Query: 337 AIFNMKGSGEYLLSFVLECGGDPRSPLENSLFSSDANKFGIDNAGIKNSSCEWVWVYGAN 396
               ++     + + + E     R P+             I+N G+ N +   +++YG +
Sbjct: 296 KNQTVQPQTIKVFTHLFERNLIARDPI-------------INNVGLLNPATHVMFMYGEH 342

Query: 397 DWMDIHGAERVTKDFLMNNRKKSRVVTIPESGHHLYFDNYPMFNSLLI 444
           DWMD + A  +T + ++ N+ K+  V +P++GH+L+ DN   F S L+
Sbjct: 343 DWMDKY-AGYLTTESMLKNKAKASYVEVPDAGHNLFLDNPHHFTSSLV 389

>YDR125C Chr4 complement(701397..702758) [1362 bp, 453 aa] {ON}
           ECM18Protein of unknown function, similar to Rlp24p
          Length = 453

 Score = 78.2 bits (191), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 92/369 (24%), Positives = 148/369 (40%), Gaps = 79/369 (21%)

Query: 125 NVDPNKKRKRLIFVHGYGAGLGFYLKNYEHLPLLDDSWSIHAIDLPGYGFSS-------- 176
           N + +  R   + +HGY A    + +NY  L       ++++ID+P  G SS        
Sbjct: 119 NENTSTVRTPTLLIHGYAASSMSFFRNYPGLS--KHIRNLYSIDMPASGLSSVPSLEINT 176

Query: 177 --------------RMDFPFQFPRDDTSVVC----DWFISRLRTLFEKRGFDKSDNIVMA 218
                         +   P+    +    V     D+++ R+          K +  V+ 
Sbjct: 177 TTPLPLDIKFIGENKFKVPYTINANHNKFVIQMYEDFYLDRIEQWRIDNKLGKMN--VVG 234

Query: 219 HSMGAYLMAFYLNKYPDSVKKMVMCSPAGISRSQYSINNNI------TEDISSGKEEIKL 272
           HS G YL   Y  KYP+SV K+ + SP G+ R+ +S+NNN       T D  +   +   
Sbjct: 235 HSFGGYLSFKYAVKYPNSVNKLCLVSPLGVERNIWSVNNNFHSNTLYTIDFKNPNSKFYS 294

Query: 273 KIKKVPWWYTKLWDRNISPFVLVRKTGILGSKITSGWTYRRFK--PILLNKENNYEQFEK 330
           K   +P +   L+++    F ++R  G LG+K+   +    +   P L  KE        
Sbjct: 295 KRNMIPKY---LFEQQ---FHILRMMGPLGAKLCWNYIMAAYSRVPSLAYKE-------- 340

Query: 331 LHRYSFAIFNMKGSGEYLLSFVLECGGD----PRSPLENSLFSSDANKFGIDNAGIKNSS 386
              Y F +F  KG    + + + +         + PL +SL   +  K  I         
Sbjct: 341 ---YIFELFYGKGGIPEVTTDIFKALFSRCILAKDPLMDSLQYLNVKKLLI--------- 388

Query: 387 CEWVWVYGANDWMDIHGAERVTKDF--LMNNRKKSRVVTIPESGHHLYFDNYPMFN---- 440
                VYG  DWM+      + K+   L N  + +  + IP SGH+L+ DN   FN    
Sbjct: 389 -----VYGQYDWMNKKAGMFMVKELNNLKNCLEGASYLEIPSSGHNLFLDNPESFNQSIV 443

Query: 441 SLLIDEMKS 449
           S L DE KS
Sbjct: 444 SFLSDETKS 452

>Suva_10.183 Chr10 complement(344549..345733) [1185 bp, 394 aa] {ON}
           YLR099C (REAL)
          Length = 394

 Score = 76.6 bits (187), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 77/348 (22%), Positives = 151/348 (43%), Gaps = 71/348 (20%)

Query: 136 IFVHGYGAGLGFYLKNYEHLPLLDDSWSIHAIDLPGYGFSSR-----------MDFPFQF 184
           + +HGY A    + + +++L   D+   ++AIDLP  G S                 F+ 
Sbjct: 74  VLIHGYAASSMAFYRTFKNLS--DNIKDLYAIDLPANGASEAPALQVEGVKKIKSLRFKH 131

Query: 185 PRDD-TSVVCD-----------------WFISRLRTLFEKRGFDKSDNIVMAHSMGAYLM 226
             DD  + V D                 +F+ R+    +     K +  V+ HS G Y+ 
Sbjct: 132 VEDDMVTPVLDKRPPAEEIKSHLEQYESYFVDRIEQWRKDNNLRKIN--VVGHSFGGYIS 189

Query: 227 AFYLNKYPDSVKKMVMCSPAGISRSQYSINN----NITEDISSGKEEIKLKIKKVPWWYT 282
             Y  KYP+S+ K+ + SP G+  S ++IN+    N T  ++      +   +K+     
Sbjct: 190 FKYALKYPNSIDKLCLISPLGVENSIHAINHKWEANTTYPVTFTDPSSRYYTRKL----- 244

Query: 283 KLWDRNISPFV------LVRKTGILGSKITSGWTYRRFKPILLNKENNYEQFEKLHRYSF 336
                N+  F+      +++  G +GSK+ S +    +  +    +  Y+ +  LH +  
Sbjct: 245 -----NVPQFIFENQLNVLKWMGPIGSKLCSSYISTAYVKV---PDQLYKDY-LLHSFVG 295

Query: 337 AIFNMKGSGEYLLSFVLECGGDPRSPLENSLFSSDANKFGIDNAGIKNSSCEWVWVYGAN 396
              +++     + + + E     R P+             I+N G+ N +   +++YG +
Sbjct: 296 KNQSVQPQTIKVFTQLFERNLIARDPI-------------INNVGLLNPATHVMFMYGEH 342

Query: 397 DWMDIHGAERVTKDFLMNNRKKSRVVTIPESGHHLYFDNYPMFNSLLI 444
           DWMD + A  +T + ++ N+ K+  + +P++GH+L+ DN   F S L+
Sbjct: 343 DWMDKY-AGYLTTESMLKNKAKASYMEVPDAGHNLFLDNPNHFTSSLV 389

>Smik_4.371 Chr4 complement(662692..663999) [1308 bp, 435 aa] {ON}
           YDR125C (REAL)
          Length = 435

 Score = 76.6 bits (187), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 88/353 (24%), Positives = 143/353 (40%), Gaps = 83/353 (23%)

Query: 136 IFVHGYGAGLGFYLKNYEHLPLLDDSWSIHAIDLPGYGFSS------------------- 176
           + +HGY A    + +NY  L       ++++IDLP  G SS                   
Sbjct: 112 LLIHGYAASSMSFFRNYPGLS--KHIQNLYSIDLPASGLSSIPPLEINATTPLPLDIEFT 169

Query: 177 ---RMDFPFQFPRDDTSVVC----DWFISRLRTLFEKRGFDKSDNIVMAHSMGAYLMAFY 229
              +   P+    +    V     D+++ ++          K +  ++ HS G YL   Y
Sbjct: 170 GKNKFKIPYTINLNHHKFVIQMYEDFYLDKIEQWRIDNKLGKVN--IVGHSFGGYLSFKY 227

Query: 230 LNKYPDSVKKMVMCSPAGISRSQYSINNNITEDI--SSGKEEIKLKIKKVPWWYTKLWDR 287
             KYP+SV+K+ + SP G+ R+ +SINNN   +   + G E+   K      +Y+K   R
Sbjct: 228 AAKYPNSVEKLCLVSPLGVERNIWSINNNFRSNTLYTIGFEDPSSK------FYSK---R 278

Query: 288 NISP-------FVLVRKTGILGSKITSGWTYRRFK--PILLNKENNYEQFEKLHRYSFAI 338
           N+ P       F L+R  G +G+K+   +    +   P L  KE           Y F +
Sbjct: 279 NMIPKYLFERQFQLLRMMGPVGAKLCWNYIMAAYSRVPSLAYKE-----------YIFEL 327

Query: 339 FNMKG-----SGEYLLSFVLECGGDPRSPLENSLFSSDANKFGIDNAGIKNSSCEWVWVY 393
           F  KG     + E        C    + PL +SL   +  K  +              VY
Sbjct: 328 FYGKGGIPEVTTEIFKGLFSRCIL-AKDPLMDSLHYLNVRKLMV--------------VY 372

Query: 394 GANDWMDIHGAERVTKDF--LMNNRKKSRVVTIPESGHHLYFDNYPMFNSLLI 444
           G  DWM+      + ++   L N  +K+  + IP SGH+L+ DN   FN  ++
Sbjct: 373 GQYDWMNKKAGMLMVENLNSLGNCLEKASYLEIPSSGHNLFLDNPLSFNQSIV 425

>YLR099C Chr12 complement(339744..340928) [1185 bp, 394 aa] {ON}
           ICT1Lysophosphatidic acid acyltransferase, responsible
           for enhanced phospholipid synthesis during organic
           solvent stress; null displays increased sensitivity to
           Calcofluor white; highly expressed during organic
           solvent stress
          Length = 394

 Score = 75.9 bits (185), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 79/359 (22%), Positives = 149/359 (41%), Gaps = 71/359 (19%)

Query: 125 NVDPNKKRKRLIFVHGYGAGLGFYLKNYEHLPLLDDSWSIHAIDLPGYGFSSR------- 177
           N   NK     + +HGY A    + + +E+L   D+   ++AIDLP  G S         
Sbjct: 63  NKRANKVCTPTVLIHGYAASSMAFYRTFENLS--DNIKDLYAIDLPANGASEAPALQVNK 120

Query: 178 ----MDFPFQFPRDDTSVVC------------------DWFISRLRTLFEKRGFDKSDNI 215
                   F+   DD  +                     +F+ R+    +     K +  
Sbjct: 121 TKKIKSLRFKHIEDDVVIPVIEKRPPAEDIKSHLEQYESYFVDRIEQWRKDNKLRKIN-- 178

Query: 216 VMAHSMGAYLMAFYLNKYPDSVKKMVMCSPAGISRSQYSINN----NITEDISSGKEEIK 271
           V+ HS G Y+   Y  KYPDS++K+ + SP G+  S ++I +    N T  ++      +
Sbjct: 179 VVGHSFGGYISFKYALKYPDSIEKLCLISPLGVENSIHAITHKWEPNTTYPLTFTDPSSR 238

Query: 272 LKIKKVPWWYTKLWDRNISPFV------LVRKTGILGSKITSGWTYRRFKPILLNKENNY 325
              +K+          N+  F+      +++  G +GSK+ S +    +  +    +  Y
Sbjct: 239 YYTRKL----------NVPRFIFENQLNVLKWMGPIGSKLCSNYISTAYVKV---PDQIY 285

Query: 326 EQFEKLHRYSFAIFNMKGSGEYLLSFVLECGGDPRSPLENSLFSSDANKFGIDNAGIKNS 385
           + +  LH +      ++     + + + E     R P+             I+N    N 
Sbjct: 286 KDY-LLHSFVGKNQTVQPQTIKVFTHLFERNLIARDPI-------------INNVRFLNP 331

Query: 386 SCEWVWVYGANDWMDIHGAERVTKDFLMNNRKKSRVVTIPESGHHLYFDNYPMFNSLLI 444
           +   +++YG +DWMD + A  +T + ++ N+ K+  V +P++GH+L+ DN   F S L+
Sbjct: 332 ATPVMFMYGEHDWMDKY-AGYLTTESMLKNKAKASYVEVPDAGHNLFLDNPQHFASSLV 389

>Smik_12.158 Chr12 complement(319660..320844) [1185 bp, 394 aa] {ON}
           YLR099C (REAL)
          Length = 394

 Score = 73.2 bits (178), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 75/350 (21%), Positives = 149/350 (42%), Gaps = 71/350 (20%)

Query: 125 NVDPNKKRKRLIFVHGYGAGLGFYLKNYEHLPLLDDSWSIHAIDLPGYGFSS----RMD- 179
           N   NK     + +HGY A    + + +E L   ++   ++AIDLP  G S     ++D 
Sbjct: 63  NNGANKVSTPTVLIHGYAASSMAFYRTFESLS--NNIKDLYAIDLPANGASEAPVLQVDK 120

Query: 180 ------FPFQFPRDDTSVVC------------------DWFISRLRTLFEKRGFDKSDNI 215
                   F+   DD  +                    ++F+ R+    +     K +  
Sbjct: 121 TKKVKSLRFKHIEDDVVIPVLDRRPPAEDIKSHLEQYENYFVDRIEQWRKDNKLRKIN-- 178

Query: 216 VMAHSMGAYLMAFYLNKYPDSVKKMVMCSPAGISRSQYSINN----NITEDISSGKEEIK 271
           V+ HS G Y+   Y  KYP+S+ K+ + SP G+  S ++I +    N T  ++      +
Sbjct: 179 VVGHSFGGYISFKYALKYPNSIDKLCLISPLGVENSIHAITHKWEPNTTYPLTFTDPSSR 238

Query: 272 LKIKKVPWWYTKLWDRNISPFV------LVRKTGILGSKITSGWTYRRFKPILLNKENNY 325
              +K+          N+  F+      +++  G +GSK+ S +    +  +    +  Y
Sbjct: 239 YYTRKL----------NVPRFIFENQLNVLKWMGPIGSKLCSNYISTAYVKV---PDQIY 285

Query: 326 EQFEKLHRYSFAIFNMKGSGEYLLSFVLECGGDPRSPLENSLFSSDANKFGIDNAGIKNS 385
           + +  LH +      ++     + + + E     R P+             I+N G+ N 
Sbjct: 286 KDY-LLHSFVGKNQTVQPQTIKVFTHLFERNLIARDPI-------------INNVGLLNP 331

Query: 386 SCEWVWVYGANDWMDIHGAERVTKDFLMNNRKKSRVVTIPESGHHLYFDN 435
           +   +++YG +DWMD + A  +T + ++ N+ K+  + +P++GH+L+ DN
Sbjct: 332 TMHVMFMYGEHDWMDKY-AGYLTTESMLKNKAKASYIEVPDAGHNLFLDN 380

>KLLA0F19624g Chr6 complement(1817206..1818435) [1230 bp, 409 aa]
           {ON} similar to uniprot|Q04623 Saccharomyces cerevisiae
           YDR125C ECM18 Protein of unknown function, similar to
           Rlp24p
          Length = 409

 Score = 72.8 bits (177), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 91/358 (25%), Positives = 144/358 (40%), Gaps = 84/358 (23%)

Query: 136 IFVHGYGAGLGFYLKNYEHLPL-LDDSWSIHAIDLPGYGFSSRMD--------------- 179
           + +HGY A    + +N+E L L L D   ++A+DLPG G S  +                
Sbjct: 90  LMIHGYAASSMTFFRNFEQLSLSLKD---VYAVDLPGNGLSKELPLSVDSMQKPDRVEFN 146

Query: 180 -------FPFQFPRDDT------SVVCDWFISRLRTLFEKRGFDKSDNIVMAHSMGAYLM 226
                  F  Q P D+       +   D+++  L    ++    K +  ++ HS G YL 
Sbjct: 147 ETVKGQYFRLQNPVDEEKYKKHLAHYEDYYVDALEKWRKENKLSKIN--LVGHSYGGYLT 204

Query: 227 AFYLNKYPDSVKKMVMCSPAGISRSQYSINNNI---------TEDISSGKEEIKLKIKKV 277
             Y  KYPD+V K+ + SP G+ RS +SI+N++         +ED S      K  I K+
Sbjct: 205 FKYSLKYPDNVHKLCLVSPLGVERSIFSIHNHLEPERDYEIQSEDPSKSNYSNKRNIPKL 264

Query: 278 PWWYTKLWDRNISPFVLVRKTGILGSKITSGW---TYRRFKPILLNKENNYEQFEKLHRY 334
              Y             +R  G LG+K   G+   +Y R   +                Y
Sbjct: 265 ILQYQN---------KALRWMGPLGAKACWGYVNSSYGRVPSV------------PYREY 303

Query: 335 SFAIFNMKGSGEYLLSFVLECGGDPRSPLENSLFSSDANKFG-IDNAGIKNSSCEWVWVY 393
            F +   KG              D    + N LFS     +  I ++  K    + + VY
Sbjct: 304 VFQLVFGKG-----------IMTDTSIRIFNQLFSRSLLAYDPIMDSLDKVKVSKLMLVY 352

Query: 394 GANDWMDIHGAERVTKDFLMNNRKKSRVVT---IPESGHHLYFDNYPMFNSLLIDEMK 448
           G +DWM+        ++F  N+ +KS   T   +  +GH+L  DN   FNS L+D ++
Sbjct: 353 GEHDWMNKVAGRLAIEEF--NSIRKSYDGTFDIVSRAGHNLVLDNPSEFNSKLVDFLR 408

>TPHA0A01690 Chr1 (344521..345738) [1218 bp, 405 aa] {ON} Anc_8.284
           YDR125C
          Length = 405

 Score = 72.0 bits (175), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 87/370 (23%), Positives = 149/370 (40%), Gaps = 95/370 (25%)

Query: 136 IFVHGYGAGLGFYLKNYEHLP-LLDDSWSIHAIDLPGYGFSSRMDFP------------- 181
           + VHGY      Y +N+  L   + D   +++IDLP +G S   + P             
Sbjct: 65  LLVHGYATSSLAYYRNFAGLSSYIKD---LYSIDLPTFGLSKTPELPTRKVTKNLKVTLS 121

Query: 182 --------------FQFPRDDT--------------SVVCDWFISRLRTLFEKRGFDKSD 213
                         FQ  +DD                +  +++I R+     +   DK +
Sbjct: 122 NSNDKSDDPKKITSFQLSKDDIKHNEKYYNETKKELEINENYYIDRIEKWRIENKLDKIN 181

Query: 214 NIVMAHSMGAYLMAFYLNKYPDSVKKMVMCSPAGISRSQYSINNNITED-ISSGKEEIKL 272
             ++ HS G YL   Y  KYPDS++K+ + SP G+  + YSINN    D I   +EE   
Sbjct: 182 --LVGHSFGGYLSYKYATKYPDSIEKLCLVSPLGMESNIYSINNKFENDKIYEIEEEDPS 239

Query: 273 KIKKVPWWYTKLWDRNISPFV------LVRKTGILGSKITSGW---TYRRFKPILLNKEN 323
            I     ++T    R I  F+      ++R  G +GS +T  +   +YRR    L     
Sbjct: 240 SI-----FFTNT--RTIPKFLFNNQLNVLRWLGPVGSTLTWKYIKASYRRVDDAL----- 287

Query: 324 NYEQFEKLHRYSFAIFNMKGSGEYLLSFVLECGGDPRSPLENSLFSSDANKFGIDNAGIK 383
            Y+ +  +H   +    M+ +     + +       + P+ ++          +D    K
Sbjct: 288 -YKDY--IHELIYGKGGMEETTIKTFTNLFTTKLLAKDPITDT----------VDKLKAK 334

Query: 384 NSSCEWVWVYGANDWMDIHGAERVTKDF-LMNNRKKSRV--------VTIPESGHHLYFD 434
           N     + +YG  DWM+ +   ++TK    +     S+V        + +PE+GH+L+ D
Sbjct: 335 NV----LLLYGQEDWMNNYAGYQMTKKLNELKGYNTSKVGELNYATYMEVPEAGHNLFLD 390

Query: 435 NYPMFNSLLI 444
           N   FN  L+
Sbjct: 391 NPSFFNKALL 400

>KAFR0B05380 Chr2 (1107049..1108284) [1236 bp, 411 aa] {ON}
           Anc_8.284 YDR125C
          Length = 411

 Score = 71.2 bits (173), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 82/347 (23%), Positives = 147/347 (42%), Gaps = 77/347 (22%)

Query: 136 IFVHGYGAGLGFYLKNYEHLPLLDDSWSIHAIDLPGYGFSSRM----------------- 178
           + +HG+ +    + +N+  L    D   ++AIDLP  G S  +                 
Sbjct: 91  LLLHGFASSSMSFFRNFTGLS--QDIMDLYAIDLPANGLSRSLSTKFYRVSPKETRKFDM 148

Query: 179 --DFPFQF--------PRDDTSVVCDWFISRLRTLFEKRGFDKSDNIVMAHSMGAYLMAF 228
             D  FQ          ++      D++I  +          K +  ++AHS G YL   
Sbjct: 149 LDDIHFQLLSHGNYHAEKELIQKCEDYYIDTIERWRRSNELHKIN--IVAHSFGGYLSFK 206

Query: 229 YLNKYPDSVKKMVMCSPAGISRSQYSINN--NITEDISSGKEE----IKLKIKKVPWWYT 282
           Y  KYP+S+ K+ + SP G+  + YSINN  N+ E  +  + +      +   ++P +  
Sbjct: 207 YALKYPESINKLCLVSPLGVEANIYSINNNFNVGETYTVNRLDPSSCCYINENEIPKY-- 264

Query: 283 KLWDRNISPFVLVRKTGILGSKITSGWTYRRFKPILLNKENNYEQFEKL--HRYSFAIFN 340
            ++D   + F ++R +G +G+K+   W Y     +L    ++Y +   L   RY F +  
Sbjct: 265 -VFD---NLFKILRLSGPIGAKLC--WNY-----VL----SSYSRISSLDFKRYVFELLY 309

Query: 341 MKG----SGEYLLSFVLECGGDPRSPLENSLFSSDANKFGIDNAGIKNSSCEWVWVYGAN 396
            KG    +   L + +       R PL +S  S   N  GI            + +YG  
Sbjct: 310 GKGGMTATAINLFTQLFTTRLLARDPLMDSAHSLSCN--GI------------LLLYGEY 355

Query: 397 DWMDIHGAERVTKDFLMNNR---KKSRVVTIPESGHHLYFDNYPMFN 440
           DWM  +  + +  +   +N+    K++ + +P+SGH+L+ DN   FN
Sbjct: 356 DWMAKNAGKSLLTNCKADNKGSASKTKYLEVPKSGHNLFLDNPAFFN 402

>CAGL0B01969g Chr2 complement(181406..182677) [1272 bp, 423 aa] {ON}
           similar to uniprot|Q04623 Saccharomyces cerevisiae
           YDR125c ECM18 or uniprot|Q12385 Saccharomyces cerevisiae
           YLR099c ICT1
          Length = 423

 Score = 69.7 bits (169), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 86/353 (24%), Positives = 145/353 (41%), Gaps = 78/353 (22%)

Query: 130 KKRKRLIFVHGYGAGLGFYLKNYEHLPLLD-DSWSIHAIDLPGYG--FSSRMDFP----- 181
           K R   + +HGY A    + ++   +P L+ D   ++ IDLPG G  F+  +D       
Sbjct: 104 KVRTPTVLIHGYAATSTAFFRS---IPYLNRDIKDLYTIDLPGNGLSFTPSLDLEVSKPL 160

Query: 182 ------------FQFP--------RDDTSVVCDWFISRLRTLFEKRGFDKSDNIVMAHSM 221
                       FQ P        R     + D+++ R+          K +  V+AHS 
Sbjct: 161 PLKIENIDDGNEFQLPYVIDSAHHRYVLQKLLDYYVDRIEQWRLDNKLGKIN--VVAHSY 218

Query: 222 GAYLMAFYLNKYPDSVKKMVMCSPAGISRSQYSINNNITE---------DISSGKEEIKL 272
           G YL   Y  KYP ++  + + SP G+ R+ YSINN             D +S   + K 
Sbjct: 219 GGYLSFNYALKYPANINTLGLISPLGVERNIYSINNEFHSRTIYKREWNDCNSMFYDRKF 278

Query: 273 KIKKVPWWYTKLWDRNISPFVLVRKTGILGSKITSGWTYRRFKPILLNKENNYEQFEKL- 331
           K+         L+ + + P   +R  G +G+K+   W Y R         + Y +   + 
Sbjct: 279 KLNDY------LFQKQLKP---LRWLGPIGAKLC--WNYIR---------SAYARVPSID 318

Query: 332 -HRYSFAIFNMKGSGEYLLSFVLECGGDPRSPLENSLFSSDANKFGIDNAGIKNSSCEWV 390
              Y+F  F  +G      S +        S L +SL + D     +    +     + +
Sbjct: 319 YKDYTFETFYGRGGLPEQTSQIFT------SLLTSSLLARDPLLDHVSQLQVP----KLI 368

Query: 391 WVYGANDWMDIHGAERVTKDFLMNNRKKSRVVTIPESGHHLYFDNYPMFNSLL 443
            +YG  DWM+ +G + +T+ F      +++ + IP +GH+L+ DN   F S L
Sbjct: 369 MMYGQYDWMNKNGGKLMTQIF----NGETKYIDIPNAGHNLFLDNPSDFASQL 417

>SAKL0H16500g Chr8 (1450828..1452087) [1260 bp, 419 aa] {ON} similar
           to uniprot|Q04623 Saccharomyces cerevisiae YDR125C
          Length = 419

 Score = 69.3 bits (168), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 81/352 (23%), Positives = 145/352 (41%), Gaps = 71/352 (20%)

Query: 136 IFVHGYGAG-LGFYLKNYEHLPLLDDSWSIHAIDLPGYGFSSRMDFP------------- 181
           + +HGY A  +GF+ +N+  L       +++AIDLP  G S     P             
Sbjct: 100 LLLHGYAAASMGFH-RNFAGLS--SRIQNLYAIDLPANGLSPGSSQPLVVSCGEPLPMKA 156

Query: 182 ------FQFPRDDTSVVCDWFISRLRTLF----EKRGFDKSDNIV--MAHSMGAYLMAFY 229
                 F+ P     +    FI +L   +    E+   D   N +  +AHS G YL   Y
Sbjct: 157 EFSNDRFKIPYTLEYLHQKSFIQQLEDYYLNSIEQWRIDNKLNKINIVAHSFGGYLSTKY 216

Query: 230 LNKYPDSVKKMVMCSPAGISRSQYSINNNITEDI-------SSGKEEIKLKIKKVPWWYT 282
             KYP +V+++ + SP G+ R+ +S+NN+   +          G +    +++ +P   +
Sbjct: 217 AIKYPHAVERLCLVSPLGVERNIHSVNNHWCSNTWYDLNYEDPGSKYYMRRMRGIP---S 273

Query: 283 KLWDRNISPFVLVRKTGILGSKITSGWTYRRFKPILLNKENNYEQFEKLHRYSFAIF--- 339
            ++   +    L+R  G LG+K+   W Y       +N   +  + EK   Y F +F   
Sbjct: 274 TVFQSQVK---LLRLLGPLGAKLC--WNY-------INAAYSRVKNEKYKEYVFELFYGK 321

Query: 340 -NMKGSGEYLLSFVLECGGDPRSPLENSLFSSDANKFGIDNAGIKNSSCEWVWVYGANDW 398
             +  +   + + +       + PL +SL      +  +               YG +DW
Sbjct: 322 EGVTQTAMDIFTNLFTRQLLAKDPLMDSLQHLHVGRLML--------------AYGEHDW 367

Query: 399 MDIHGAERVTKDF--LMNNRKKSRVVTIPESGHHLYFDNYPMFNSLLIDEMK 448
           M+ +    +TK+F  L      +    I  SGH+++ DN   FN  +I+ +K
Sbjct: 368 MNKYAGVLMTKEFNHLRGKSDAATYTVISSSGHNMFLDNPDEFNEKVINFLK 419

>Kpol_543.49 s543 complement(108945..110234) [1290 bp, 429 aa] {ON}
           complement(108945..110234) [1290 nt, 430 aa]
          Length = 429

 Score = 68.6 bits (166), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 82/359 (22%), Positives = 148/359 (41%), Gaps = 78/359 (21%)

Query: 136 IFVHGYGAGLGFYLKNYEHLPLLDDSWSIHAIDLPGYGFSSRMDFPFQ------------ 183
           + +HGY A    Y + +  L   D   +++AIDLP +G S+     F+            
Sbjct: 103 LLIHGYAASSLAYFRTFSGLS--DKIKNLYAIDLPSFGLSNAPPLDFKEKVSDIKIKLSD 160

Query: 184 ----FPRDDTSVVCDWFISRLRTLFEK---------RGFDKSDNI-VMAHSMGAYLMAFY 229
               F   D++ V    + +L   +E          R  +K + I ++ HS G Y+   Y
Sbjct: 161 DNTKFKISDSNRVDSLDLKKLIGKYEDYYVEKIEDWRKANKLEKINLVGHSFGGYISFKY 220

Query: 230 LNKYPDSVKKMVMCSPAGISRSQYSINNNITE------DISSGKEEIKLKIKKVPWWYTK 283
             KYPD++ ++ + SP G+  + +S+NNN         D+         K +++P +  K
Sbjct: 221 AIKYPDAINRLCLVSPLGMESNIHSVNNNFETKKEYPLDLEDPSSRFYAKERRIPNFLFK 280

Query: 284 LWDRNISPFVLVRKTGILGSKITSGW---TYRRFKPILLNKENNYEQFEKLHRYSFAIFN 340
                 +   ++R  G +GSK+   +   +YRR    L                      
Sbjct: 281 ------NQLNVLRWMGPIGSKLCWNYINASYRRVPNPLFK-------------------- 314

Query: 341 MKGSGEYLLSFVLECGGDPRSPLE--NSLFS-SDANKFGIDNAGIKNSSCEWVWVYGAND 397
                EYL   +   GG P   ++   +LF+ S   +  I ++  K  + + + +YG +D
Sbjct: 315 -----EYLFELLYGKGGMPSVTIDIFTNLFTRSLLARDPIMDSISKLKAEKVLLLYGEHD 369

Query: 398 WMDIHGAERVTKDF--LMNNRKKSRV-----VTIPESGHHLYFDNYPMFNSLLIDEMKS 449
           WM+      + +    L  N   S +     V +P++GH+L+ DN   FNS ++   K+
Sbjct: 370 WMNNLAGYNMVESLNQLKPNNNISTIDYANYVEVPDAGHNLFLDNPQFFNSAVLSFFKA 428

>Ecym_4285 Chr4 (612053..613270) [1218 bp, 405 aa] {ON} similar to
           Ashbya gossypii AGR062C
          Length = 405

 Score = 67.4 bits (163), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 81/354 (22%), Positives = 147/354 (41%), Gaps = 77/354 (21%)

Query: 136 IFVHGYGAGLGFYLKNYEHLPLLDDSWS-IHAIDLPGYGFSSRMDF------PFQFPRDD 188
           + +HGY      Y +N   +P L +    ++ IDLP  G S  +        P  F  + 
Sbjct: 87  LLLHGYATSSMCYHRN---MPQLSEGIKHLYTIDLPANGLSKELPLELDIAKPIVFKPEF 143

Query: 189 TSV---------------------VCDWFISRLRTLFEKRGFDKSDNIVMAHSMGAYLMA 227
            SV                     + D++I  +  L+ ++    + N+V  HS G Y+  
Sbjct: 144 NSVKSEFHIPYTIDGLHHRCAIQKLEDYYIDSIE-LWRRKNSLGAINLV-GHSFGGYISF 201

Query: 228 FYLNKYPDSVKKMVMCSPAGISRSQYSINNNIT---------EDISSGKEEIKLKIKKVP 278
            Y  KYP +VKK+ + SP G+ R+ YS++NN           ED SS     K  I +  
Sbjct: 202 KYSIKYPQNVKKLCLISPIGVERNIYSVHNNWRSNCPYSIDYEDPSSKHFANKTMIPEF- 260

Query: 279 WWYTKLWDRNISPFVLVRKTGILGSKITSGWTYRRFKPILLNKENNYEQFEKLHRYSFAI 338
                +++       L+R  G LG+K+  GW Y      + +K  N+   E +    +  
Sbjct: 261 -----VFNEQTK---LLRLMGPLGAKL--GWKYIN---AVYSKVPNFLYLEFIFTLIYGK 307

Query: 339 FNMKGSGEYLLSFVLECGGDPRSPLENSLFSSDANKFGIDNAGIKNSSCEWVWVYGANDW 398
             M  +   + +++       R P+ +SL     +K               + +YG +DW
Sbjct: 308 NVMTDTSRNIFTYLFTNSLLARDPMLDSLEHLHVDKL--------------LMLYGEHDW 353

Query: 399 MDIHGAERVTKDFLMNNRKKSR----VVTIPESGHHLYFDNYPMFNSLLIDEMK 448
           +     + + ++F   N+++S     +  +P++ H+L+ DN   FN  L++ +K
Sbjct: 354 VRSQPGKMMVEEF---NKQRSHPSGTLTVVPDASHNLFLDNPVFFNVALLNFLK 404

>CAGL0M11462g Chr13 complement(1129244..1130404) [1161 bp, 386 aa]
           {ON} similar to uniprot|Q12385 Saccharomyces cerevisiae
           YLR099c ICT1
          Length = 386

 Score = 66.6 bits (161), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 92/369 (24%), Positives = 147/369 (39%), Gaps = 95/369 (25%)

Query: 136 IFVHGYGAGLGFYLKNYEHLPLLDDSWSIHAIDLPGYGFS------SRMDFP-------- 181
           + VHGYGA    Y + +   PL      ++AIDLP  G S      +  + P        
Sbjct: 48  LLVHGYGASSMAYHRCFA--PLSRHIRDLYAIDLPANGLSEAPPLVAEGEAPKAKFKIEE 105

Query: 182 -----FQFPRDDTSVVCDWFISR---LRTLFEKRGF---------------DKSDNI--- 215
                 Q  R     V D  + +   LRT  EKR +                K +N+   
Sbjct: 106 NKFTVVQGARRAAEPVTDAQVDQELMLRTHREKRRYLQQYEDYYVESIEQWRKENNLDKF 165

Query: 216 -VMAHSMGAYLMAFYLNKYPDSVKKMVMCSPAGISRSQYSINNNITEDISSGKEE----- 269
            ++ HS G YL   Y  KYP+SV K+ + SP G+ R+ +SINN   E++    +E     
Sbjct: 166 NLVGHSFGGYLSYKYALKYPESVNKLCLLSPLGMERNIHSINNTFEENVVYELQESDPSS 225

Query: 270 -IKLKIKKVPWWYTKLWDRNISPFVLVRKTGILGSKITSGWTYRRFK--PILLNKENNYE 326
            +  + +K P +  +      + F ++R  G +G K+   +    +   P    K+  +E
Sbjct: 226 YLYTRKRKAPKFLFE------NQFSVLRWMGPIGDKLCLSFINSSYAKVPSQAYKDYLFE 279

Query: 327 QFEKLHRYSFAIFNMKGSGEYLLSFVLECGGDPRSPLENSLFSSDANKFGIDNAGIKNSS 386
            F  L +  FA  N+                  +     SL + D     ID   + + S
Sbjct: 280 SF--LGKKHFAKQNVHAL---------------KHLFTRSLLARDPIMDTIDKLKVPDVS 322

Query: 387 CEWVWVYGANDWMDIHGAERVTKDFLMNNR-KKSRVVT----------IPESGHHLYFDN 435
                 YG +DWM+ +        +LM  R KK RV +          +P++GH+L+ DN
Sbjct: 323 V----FYGDHDWMNSYAG------YLMVERLKKFRVASTSGGSASYLEVPDAGHNLFLDN 372

Query: 436 YPMFNSLLI 444
              F+  L+
Sbjct: 373 PDYFSKKLV 381

>NDAI0J01210 Chr10 (282384..283634) [1251 bp, 416 aa] {ON} Anc_8.284
          Length = 416

 Score = 66.2 bits (160), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 92/427 (21%), Positives = 174/427 (40%), Gaps = 73/427 (17%)

Query: 62  PRSLAESKRDYATFHSNVDLMQLELLRTLPFFERTGYNKRAYLRK------TEIDSDGNY 115
           PR L+   R     +SN D + +   +T      + +N    L+        +I+ +G  
Sbjct: 12  PRLLSRLIRSMVQSNSNKDTINISAFKTWTSHLSSSWNTVEQLKMLQAKLMNQIEVEGTM 71

Query: 116 INELVIEPANV------DPNKKRKRLIFVHGYGAGLGFYLKNYEHLPLLDDSWSIHAIDL 169
            NE+V +  N       + +      + +HGY A    + + +   PL ++  +++AIDL
Sbjct: 72  TNEMVNDELNQWSFYNNNTSTVTIPTLLLHGYAASSMSFYRTFA--PLSNNFKNLYAIDL 129

Query: 170 PGYGFSSRMDFPFQFPR-----------DDTSVVCDWFISRLRTLFEK---------RGF 209
           P  G S  +       R           +  S+     I   + L E+         R +
Sbjct: 130 PANGLSVAIPLKITKQRKRLYEVKYKENNKFSISYPVPIEEQKPLIEQYENYYLDAMRSW 189

Query: 210 DKSDNI----VMAHSMGAYLMAFYLNKYPDSVKKMVMCSPAGISRSQYSINNNITEDISS 265
             ++NI    ++ HS G Y    Y  ++PDS+ K+ + SP G+  + +SI+N   E+   
Sbjct: 190 QVANNIEKFNLVGHSFGGYFSFKYALRFPDSINKLCLVSPLGMESNIFSIHNKFEEN--- 246

Query: 266 GKEEIKLKIKKVPWWYTKLWDRNI---SPFVLVRKTGILGSKITSGWTYRRFK--PILLN 320
               + L     P++  K    N    +   ++RK G  G+++   +    +K  P +  
Sbjct: 247 KIYNVNLTDPTSPFYGKKFQIPNYLFENQLDVIRKLGPFGARLCWNYILSAYKRVPSMEY 306

Query: 321 KENNYEQFEKLHRYSFAIFNMKGSGEYLLSFVLECGGDPRSPLENSLFSSDANKFGIDNA 380
           KE  +E F    + S  +         L + +L      R P+ +S          ID  
Sbjct: 307 KEYLFELFYGNRQVSPILCE-------LFTNLLTRNLLARDPILDS----------IDQL 349

Query: 381 GIKNSSCEWVWVYGANDWMDIHGAERVTKDFLMNNRKKS----RVVTIPESGHHLYFDNY 436
            + N     + +YG +DWM+ +    +     +NN +++    + + +P +GH+L+ DN 
Sbjct: 350 QLSNV----LVMYGEHDWMNRYAGYCMVSR--LNNIRRTPNTAQYLQVPAAGHNLFLDNP 403

Query: 437 PMFNSLL 443
             F+S L
Sbjct: 404 EYFSSAL 410

>Kwal_56.23702 s56 complement(668862..670112) [1251 bp, 416 aa] {ON}
           YDR125C (ECM18) - (putative) involved in cell wall
           biogenesis [contig 174] FULL
          Length = 416

 Score = 66.2 bits (160), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 90/358 (25%), Positives = 148/358 (41%), Gaps = 79/358 (22%)

Query: 132 RKRLIFVHGYGAG-LGFYLKNYEHLPLLDDSWS-IHAIDLPGYGFS----------SRMD 179
           R   + VHGY A  +GF+     + P L  S   ++AIDLP  G S            +D
Sbjct: 96  RTPTLLVHGYAASSMGFH----RNFPGLSQSIKDLYAIDLPASGLSPALPLEMRCTQPLD 151

Query: 180 FPFQFPRD------------DTSVVCDWFISRLRTLFEKRGFDKSDNI-VMAHSMGAYLM 226
                 +D              S++ ++    L  + + R  +K   I ++AHS G YL 
Sbjct: 152 LKINMSKDTFSLPYTINYLHHKSLIQNYEDYYLDAIEQWRHDNKLGPINIVAHSFGGYLS 211

Query: 227 AFYLNKYPDSVKKMVMCSPAGISRSQYSINN----NITEDISSGKEEIKLKIKKVPWWYT 282
             Y  K+P +V+K+ + SP G+ R+ +S+NN    N + ++       K  IKK P    
Sbjct: 212 FKYAVKFPHAVEKLCLVSPLGVERNIFSVNNQWRSNTSYNLDFENPASKFYIKKGPAIPR 271

Query: 283 KLWDRNISPFVLVRKTGILGSKITSGWT-----------YRRFKPILLNKENNYEQFEKL 331
            ++++      L+R  G LG+K++  +            Y+++   LL  +N   Q  K 
Sbjct: 272 LVFEQQTQ---LLRNLGPLGAKLSWNYINAAYSRVPSLDYKKYVFELLYGKNGLNQTSK- 327

Query: 332 HRYSFAIFNMKGSGEYLLSFVLECGGDPRSPLENSLFSSDANKFGIDNAGIKNSSCEWVW 391
                 +FN +         VL      R PL             +D+      S + + 
Sbjct: 328 -DLFIGLFNNR---------VLA-----RDPL-------------LDSIQFFGKSAKLMC 359

Query: 392 VYGANDWMDIH-GAERVTKDFLMNNRKKSRVVTIPESGHHLYFDNYPMFNSLLIDEMK 448
           +YG +DWM+   G E V +   +    K   V+   SGH+L+ DN   FN  L+  +K
Sbjct: 360 IYGDHDWMNRRAGMEMVNEANQLGIEAKYNEVS--SSGHNLFLDNPEEFNDKLVRFLK 415

>KNAG0G02140 Chr7 complement(484440..485666) [1227 bp, 408 aa] {ON} 
          Length = 408

 Score = 65.9 bits (159), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 66/270 (24%), Positives = 114/270 (42%), Gaps = 35/270 (12%)

Query: 187 DDTSVVCDWFISRLRTLFEKRGFDKSDNIVMAHSMGAYLMAFYLNKYPDSVKKMVMCSPA 246
           DD  V  D+F+ R+       GFD  +  V+ HS G Y+   Y  KY   V K+V+ SP 
Sbjct: 165 DDPGVYEDYFVDRIEKWRLAHGFDNIN--VVGHSFGGYMSFKYAIKYSKHVDKLVLLSPL 222

Query: 247 GISRSQYSINN----NITEDISSGKEEIKLKIK--KVPWWYTKLWDRNISPFVLVRKTGI 300
           G+ R+  S++N      T D++       L  +   VP +   L++  ++   ++RK G 
Sbjct: 223 GVERNIDSVSNKWDVGKTYDLTDIDATSPLYYRPFTVPGY---LFNNQLN---VLRKMGP 276

Query: 301 LGSKITSGWTYRRFKPILLNKENNYEQFEKLHRYSFAIFNMKGSGEYLLSFVLECGGDPR 360
           LG+ +       R+  +     + Y        ++F   N+          +L      R
Sbjct: 277 LGNHMAKRAIASRYSNVPGTAYHAYLHHVFYGAHTFPSANITAFTHLFTRQLLA-----R 331

Query: 361 SPLENSLFSSDANKFGIDNAGIKNSSCEWVWVYGANDWMDIHGAERVTKDFLMNNRKKSR 420
            PL +++     NK               + VYG +DWM+      + ++        ++
Sbjct: 332 DPLLDNIQRLKVNKL--------------MMVYGDHDWMNKEAGYGMVQEINKERYVPAK 377

Query: 421 VV--TIPESGHHLYFDNYPMFNSLLIDEMK 448
            V   +P +GH+L+ DN   FN LLID ++
Sbjct: 378 AVYAELPSAGHNLFLDNPSGFNKLLIDFLR 407

>NDAI0J01200 Chr10 (280820..282103) [1284 bp, 427 aa] {ON} 
          Length = 427

 Score = 65.9 bits (159), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 82/357 (22%), Positives = 137/357 (38%), Gaps = 81/357 (22%)

Query: 136 IFVHGYGAGLGFYLKNYEHLPLLDDSWSIHAIDLPGYGFSS-----------RMDFPFQF 184
           + +HGY      + + +   PL      ++AID P  G S               +  +F
Sbjct: 107 LLLHGYATSSIAFFRTFG--PLSKQIRDLYAIDFPANGLSKAPPLNVNHLKKHTPYKVKF 164

Query: 185 PRDDTSVVC-----------------DWFISRLRTLFEKRGFDKSDNIVMAHSMGAYLMA 227
             D+T                     ++++  +R        +K +  ++ HS G Y   
Sbjct: 165 KDDNTKFQISHTVDVQLQKETIEHYENYYLDAVRKWQLTNKIEKFN--LVGHSFGGYFAY 222

Query: 228 FYLNKYPDSVKKMVMCSPAGISRSQYSINNNIT---------EDISSGKEEIKLKIKKVP 278
            Y  +YPDSV K+ + SP G+ R+ YS+NNN           ED +S       +I K  
Sbjct: 223 KYALRYPDSVDKLCLVSPLGVERNIYSVNNNFEDKKVYNLELEDPTSKYYGRTFQIPKC- 281

Query: 279 WWYTKLWDRNISPFVLVRKTGILGSKITSGWTYRRFKPILLNKENNYEQFEKLHRYSFAI 338
                L++     F ++RK G LG + T  W Y                + ++    F  
Sbjct: 282 -----LFE---GQFDILRKFGPLGPRFT--WNYIN------------SSYRRVPSMEFK- 318

Query: 339 FNMKGSGEYLLSFVLECGGDPRSPLENSLFSSDANKFGIDNAGIKNSSCEW-----VWVY 393
                  EY+  F L  G    SP+   +FS+  ++  +    I +S  E      + +Y
Sbjct: 319 -------EYI--FELLYGNRKTSPILTEVFSNIVSRNLLARDPILDSIDELKASNVMLMY 369

Query: 394 GANDWMDIHGAERVTKDF--LMNNRKKSRVVTIPESGHHLYFDNYPMFNSLLIDEMK 448
           G  DWM+      + K+   +  N   +  V +P +GH+L+ DN   F S L   +K
Sbjct: 370 GQEDWMNSQAGYLMVKELNEIRENPNAASYVEVPNAGHNLFLDNPDFFCSSLTRFLK 426

>KNAG0H03120 Chr8 (586146..587450) [1305 bp, 434 aa] {ON} Anc_8.284
           YDR125C
          Length = 434

 Score = 64.3 bits (155), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 80/353 (22%), Positives = 136/353 (38%), Gaps = 77/353 (21%)

Query: 135 LIFVHGYGAGLGFYLKNYEHLPLLDDSWSIHAIDLPGYGFSSR----------------- 177
           ++ +HGY +    Y +N+  L        ++AIDLP  G S                   
Sbjct: 111 VLLIHGYASSSMSYFRNFRGLS--SQCKDVYAIDLPANGLSREISLSEDADLKDLVKYSL 168

Query: 178 ----MDFPFQ----------FPRDDTSVVCDWFISRLRTLFEKRGFDKSDNIVMAHSMGA 223
               +D P Q                 ++ D+++  +     +   D+    ++ HS G 
Sbjct: 169 QVKGLDSPGQVKVTKPYNNKLCATQLRILEDYYVDEIERWRVENQIDQLH--LVGHSFGG 226

Query: 224 YLMAFYLNKYPDSVKKMVMCSPAGISRSQYSINNNITED-ISSGKEEIK-----LKIKKV 277
           Y+   Y  KYP +V K+ + SP G+ R+ YS+NN++ +D I  G  E       L+  +V
Sbjct: 227 YISYKYALKYPQNVMKLALISPLGVERNLYSVNNHLPQDSIVQGTFEDPSSPSYLRKLEV 286

Query: 278 PWWYTKLWDRNISPFVLVRKTGILGSKITSGWTYRRFKPILLNKENNYEQFEKLHRYSFA 337
           P +  +      +   ++R  G +G+++   W Y                + K+    F 
Sbjct: 287 PRYIFE------NQLKILRWGGPMGARLC--WNYIT------------SAYAKVPSREFK 326

Query: 338 IFNMKGSGEYLLSFVLECGGDPRSPLENSLFSSDANKFGIDNAGIKNSSCEW-----VWV 392
                   EYL       GG  ++ L   +     N    D   I +S  E      ++ 
Sbjct: 327 --------EYLFELFYGDGGITKTALTTFILLFTRNLLARD--PIMDSIAELKVKDVMFQ 376

Query: 393 YGANDWMDIHGAERVTKDFLMNNRKKSRV-VTIPESGHHLYFDNYPMFNSLLI 444
           YG  DWM+ +   R  +         S + + IPESGH+L+ D+   FN  LI
Sbjct: 377 YGQYDWMNKNAGARAAELLRKQPYNNSALYLEIPESGHNLFLDSPQSFNFSLI 429

>ZYRO0D06666g Chr4 (576172..577314) [1143 bp, 380 aa] {ON} similar
           to uniprot|Q04623 Saccharomyces cerevisiae YDR125C
          Length = 380

 Score = 61.6 bits (148), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 81/348 (23%), Positives = 138/348 (39%), Gaps = 73/348 (20%)

Query: 136 IFVHGYGAGLGFYLKNYEHLPLLDDSWSIHAIDLPGYGFSSRMDFPF--QFP-------- 185
           + +HGY A    Y + ++ L   D    ++ IDLP  G S  +      Q P        
Sbjct: 62  LLIHGYAASSMAYYRTFQGLT--DKISDLYTIDLPSNGLSKELPLILDGQTPPPLKVEIH 119

Query: 186 ----------RDDT----SVVC---DWFISRLRTLFEKRGFDKSDNIVMAHSMGAYLMAF 228
                     R D     SVV    D+++  +    +  G  + +  ++ HS G Y+   
Sbjct: 120 KDGSKFKIIERVDAEHCRSVVKQYEDYYLDSIELWRKHNGIGRFN--LVGHSFGGYIAFK 177

Query: 229 YLNKYPDSVKKMVMCSPAGISRSQYSINNNITEDISSGKEEIKLKIKKVPWWYTKLWDRN 288
           Y  KYP +V+++ + SP G+  + YS+NN+   D     E      +     Y K W+  
Sbjct: 178 YAVKYPKAVEQLGLISPLGVESNIYSVNNDWKLDTVYEMESTDPASRM----YGKNWE-- 231

Query: 289 ISPFVLVRKTGILGSKITSGWTYRRFKPILLNKENNY--EQFEKLHRYSFAIFNMKGSGE 346
           I   +  R+T +L          R   PI      NY    + KL    +         +
Sbjct: 232 IPKVLFERQTELL----------RWMGPIGAKLCWNYITAAYNKLPTMEYK--------D 273

Query: 347 YLLSFVLECGGDPRSP-------LENSLFSSDANKFGIDNAGIKNSSCEWVWVYGANDWM 399
           Y+   +   GG P++           SL + D     +D  G +      + +YG +DWM
Sbjct: 274 YVFELLYGNGGIPKTARKVFGGLFTRSLLARDPIMDSMDKLGARKV----LLLYGDSDWM 329

Query: 400 DIHGAERVTKDFLMNNRKKSRVVT---IPESGHHLYFDNYPMFNSLLI 444
           + +   R+ +  L+N ++     T   +P++ H+L+ DN   FN  LI
Sbjct: 330 NNYAGYRMVE--LLNQKRGKGYATYDEVPDARHNLFLDNPDSFNDKLI 375

>AGR062C Chr7 complement(833212..834366) [1155 bp, 384 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR099C
           (ICT1) and YDR125C (ECM18)
          Length = 384

 Score = 61.6 bits (148), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 69/335 (20%), Positives = 132/335 (39%), Gaps = 51/335 (15%)

Query: 132 RKRLIFVHGYGAGLGFYLKNYEHLPLLDDSWSIHAIDLPGYGFSSRMDF---------PF 182
           R   + +HGY +    + +N   L    +   ++A+DLPG G S  +             
Sbjct: 82  RTPTVLLHGYASSAVSFHRNLAALGAQVEQ--LYALDLPGNGMSQELPLGPAAARALARR 139

Query: 183 QFPRDDTSVVCDWFISRLRTLFEKRGFDKSDNIVMAHSMGAYLMAFYLNKYPDSVKKMVM 242
              R D   + D+++  L       G +  +     HS G YL   Y  ++P  V+++ +
Sbjct: 140 CGARADIRALADYYLDALERWRAANGLETLN--AAGHSFGGYLAFKYALRHPARVQRLCL 197

Query: 243 CSPAGI-----SRSQYSINNNITEDISSGKEEIKLKIKKVPWWYTKLWDRNISPFVLVRK 297
            SP G+      R              +       +   +P     L+++ +    ++R 
Sbjct: 198 VSPLGVEAQTAGRRMPGRATRRRTRPPTPASPHYTRAAALP---PLLFEQQLR---VLRW 251

Query: 298 TGILGSKITSGWTYRRFKPILLNKENNYEQFEKLHRYSFAIFN---MKGSGEYLLSFVLE 354
            G LG+ +   W Y       +N   +     + HRY+FA+ +   ++     L + +  
Sbjct: 252 LGPLGAHLL--WQY-------VNASFSRVPGREFHRYTFALLHRLALRPLPRKLFTGLFT 302

Query: 355 CGGDPRSPLENSLFSSDANKFGIDNAGIKNSSCEWVWVYGANDWMDIHGAERVTKDF-LM 413
                R PL +SL            A +K  + +   +YG +DWMD      +  +   +
Sbjct: 303 NALLARDPLLDSL------------AELKVPNVQ--LLYGDHDWMDARAGRALVAELNAL 348

Query: 414 NNRKKSRVVTIPESGHHLYFDNYPMFNSLLIDEMK 448
             R  + +  +P +GH+L+ DN   F+S L+D ++
Sbjct: 349 RGRPDASLAIVPAAGHNLFLDNPEDFHSWLLDFLR 383

>NCAS0B03710 Chr2 (664097..665389) [1293 bp, 430 aa] {ON} Anc_8.284
          Length = 430

 Score = 61.2 bits (147), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 77/337 (22%), Positives = 141/337 (41%), Gaps = 69/337 (20%)

Query: 136 IFVHGYGAGLGFYLKNYEHLPLLDDSWSIHAIDLPGYGFSSRMDF--------------- 180
           + +HGY A    + + +  +PL     +++A DLPG G S    F               
Sbjct: 112 LLLHGYAASSLCFFRTF--VPLSRSIKNLYATDLPGNGLSKNKSFFSVMYGNEYMKVKYE 169

Query: 181 ---PFQFP-----RDDTSVVC---DWFISRLRTLFEKRGFDKSDNIVMAHSMGAYLMAFY 229
               F        +D T+ +    D++I  +R         K +  ++ HS G YL   Y
Sbjct: 170 ENNKFSIKYLNSLKDQTNSIKHSEDYYIDAIREWQLSNNLPKIN--LVGHSFGGYLSFKY 227

Query: 230 LNKYPDSVKKMVMCSPAGISRSQYSINNNITE------DISSGKEEIKLKIKKVPWWYTK 283
             +YPD+V K+ + SP G+  + YS+NN++ E      D S  K     +   +P     
Sbjct: 228 ALRYPDNVNKLCLVSPLGVESNLYSVNNSLKENYLYDVDYSDPKSSYYSRNFAIP---KS 284

Query: 284 LWDRNISPFVLVRKTGILGSKITSGWTYRRFKPILLNKENNYEQFEKLHRYSFAIFNMKG 343
           L++     F ++R  G +G+++   W Y     IL    ++Y++   +    +    + G
Sbjct: 285 LFE---GQFGILRWMGPIGARVC--WNY-----IL----SSYKRVPSMKYKEYLFHLLFG 330

Query: 344 SGEYLLSFVLECGGDPRSPLENSLFSSDANKFGIDNAGIKNSSCEWVWV-YGANDWMDIH 402
           + + L++          +    +LF+ +          I+   CE + V YG +DWM+ +
Sbjct: 331 NAKKLVT---------SAKTFTNLFTRNLLAKDPIMDSIEKLQCEKLMVMYGQHDWMNKY 381

Query: 403 GAERVTKDFLMNNRKKSR----VVTIPESGHHLYFDN 435
               +     +NN + ++       IPE+GH+L  DN
Sbjct: 382 AGYCLIAK--LNNYRSTKDAGYFTEIPEAGHNLILDN 416

>KAFR0B02830 Chr2 complement(578530..579705) [1176 bp, 391 aa] {ON}
           Anc_8.284 YDR125C
          Length = 391

 Score = 60.8 bits (146), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 75/346 (21%), Positives = 138/346 (39%), Gaps = 64/346 (18%)

Query: 125 NVDPNKKRKRLIFVHGYGAGLGFYLKNYEHLPLLDDSWSIHAIDLPGYGFSSRMDFPFQF 184
           N + +K +   + +HGY A    + + +  L    D   ++AIDLPG G SS  +     
Sbjct: 61  NPNASKIKTPTLLIHGYAASSMAFHRTFNRLS--TDIKDLYAIDLPGNGLSSAPELSDVI 118

Query: 185 PRDDTSVVCD--------------------------WFISRLRTLFEKRGFDKSDNIVMA 218
              D  +  +                          +++SR+    +  G +K +  V+ 
Sbjct: 119 KMKDLKITLNKSKDGFTLKKAIDLEIEKANLAKYENYYLSRIDEWRKFHGIEKLN--VIG 176

Query: 219 HSMGAYLMAFYLNKYPDSVKKMVMCSPAGISRSQYSINNNI------TEDISSGKEEIKL 272
           HS G ++   Y   +P+ V  +++ SP G+ ++ +S+NNN       T D  +       
Sbjct: 177 HSFGGFISFKYAITHPNQVNDLILVSPLGMEKNIHSLNNNFELETKYTLDFENPASLYYA 236

Query: 273 KIKKVPWWYTKLWDRNISPFVLVRKTGILGSKITSGWTYRRFKPILLNKENNYEQFEKLH 332
           +   VP   + L++  ++   ++R  G LG ++   +    +K +      NY  +    
Sbjct: 237 RSFNVP---SILFNNQLN---ILRWMGPLGGRMARQYIDMAYKKVPDVAYKNYLYYVFYD 290

Query: 333 RYSFAIFNMKGSGEYLLSFVLECGGDPRSPLENSLFSSDANKFGIDNAGIKNSSCEWVWV 392
             SF    +          +L      R P+ ++L    A K               + V
Sbjct: 291 GKSFPKVTINNFTNMFSKNLL-----ARDPIMDNLLKLRAKKV--------------MLV 331

Query: 393 YGANDWMDIHGAERVTKDFLMNNRK-KSRV--VTIPESGHHLYFDN 435
           YG +DWMD +    + +    +N K K  V  V IP++GH+L+ DN
Sbjct: 332 YGEHDWMDKYAGYNMVELLSKSNYKLKDTVHYVEIPDAGHNLFLDN 377

>KLTH0G13178g Chr7 (1131579..1132826) [1248 bp, 415 aa] {ON} similar
           to uniprot|Q04623 Saccharomyces cerevisiae YDR125C
          Length = 415

 Score = 60.8 bits (146), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 81/348 (23%), Positives = 143/348 (41%), Gaps = 66/348 (18%)

Query: 136 IFVHGYGAGLGFYLKNYEHLP-LLDDSWSIHAIDLPGYGFSSRMDF--------PFQFPR 186
           + +HGY A    + +N+E L   + D   ++AIDLP  G S             P +   
Sbjct: 100 LLLHGYAASSMAFHRNFEGLSKCIRD---LYAIDLPANGLSPPQPLEIRCTEPQPLKIEI 156

Query: 187 DDTSVVCDWFISRLRTLFEKRGFD----------KSDNI-----VMAHSMGAYLMAFYLN 231
            + +    + I+ L      + F+          + DN      ++AHS G Y+   Y  
Sbjct: 157 SNDTFKLPYTINSLHHKSAIQNFEDYYLDALEQWRLDNKLGPINIVAHSFGGYISFRYAV 216

Query: 232 KYPDSVKKMVMCSPAGISRSQYSINNNITED----ISSGKEEIKLKIKKVPWWYTKLWDR 287
           KYP +VK++ + SP G+ R+ +S+NNN   +    +       K  I+K P     +++ 
Sbjct: 217 KYPHAVKRLCLLSPLGVERNIFSVNNNWRSNTQYKLDFENPASKFYIRKGPAIPPAIFEL 276

Query: 288 NISPFVLVRKTGILGSKITSGWTYRRFK--PILLNKENNYEQF---EKLHRYSFAIFNMK 342
                 ++R  G LG+++   +    +   P L  K+  +E F     L + S  IF   
Sbjct: 277 QTK---VLRGLGPLGARLCWNYITAAYARVPSLKYKQYIFEMFYGKNALTQTSKDIFTGL 333

Query: 343 GSGEYLLSFVLECGGDPRSPLENSLFSSDANKFGIDNAGIKNSSCEWVWVYGANDWMDIH 402
            +   L           R PL +SL    + K               + +YG +DWM+  
Sbjct: 334 FTNRLL----------ARDPLLDSLCHVRSKKL--------------LLMYGDHDWMNRK 369

Query: 403 -GAERVTKDFLMNNRKKSRVVTIPESGHHLYFDNYPMFNSLLIDEMKS 449
            G E VT+   +     ++   +  SGH+L+ DN    N L++  +++
Sbjct: 370 AGLEMVTEAKKLG--IDAQYGEVSSSGHNLFLDNPEESNELIVSFLRN 415

>NCAS0B05120 Chr2 complement(953798..954988) [1191 bp, 396 aa] {ON} 
          Length = 396

 Score = 56.2 bits (134), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 65/249 (26%), Positives = 111/249 (44%), Gaps = 44/249 (17%)

Query: 208 GFDKSDNIVMAHSMGAYLMAFYLNKYPDSVKKMVMCSPAGISRSQYSINNNITEDISSGK 267
           G DK +  ++ HS G YL   Y  KYP+ V K+ + SP G++ +  S+NN     +   K
Sbjct: 176 GLDKFN--LVGHSFGGYLSFKYAIKYPEVVDKLCLVSPLGVASNIRSVNN-----VFDTK 228

Query: 268 EEIKLKIKKVPWWYTKLWDRNISPFVLVRKTGIL------GSKITSGWTYRRF--KPILL 319
           +E  + ++  P        R I  F+   +  +L      GSK+T  +    +   P + 
Sbjct: 229 KEYVMDLQN-PGSMLYNRQRMIPNFLFNNQLNVLKWMGPVGSKLTRKYINSAYVKVPTMD 287

Query: 320 NKENNYEQFEK-LHRYSFAIFNMKGSGEYLLSFVLECGGDPRSPLENSLFSSDANKFGID 378
            K+  YE F+  + + +  IF    S   +           R P+             +D
Sbjct: 288 YKDYLYEYFQMGVPQVNVDIFTKLFSRNLM----------ARDPI-------------MD 324

Query: 379 NAGIKNSSCEWVWVYGANDWMDIHGAERVTKDF--LMNN-RKKSRVVTIPESGHHLYFDN 435
           N   +  S  ++ +YG NDWMD      + ++   + NN  +K+  V IP++GH+L+ DN
Sbjct: 325 NMN-RLKSTRFMMMYGDNDWMDKFSGYTLVQNINKIKNNFDRKATYVEIPDAGHNLFLDN 383

Query: 436 YPMFNSLLI 444
              F++ LI
Sbjct: 384 PEDFSNNLI 392

>TBLA0H01400 Chr8 (312727..313992) [1266 bp, 421 aa] {ON} Anc_8.284
           YDR125C
          Length = 421

 Score = 53.5 bits (127), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 87/410 (21%), Positives = 154/410 (37%), Gaps = 116/410 (28%)

Query: 125 NVDPNKKRKRLIFVHGYGAGLGFYLKNYEHLPLLDDSWSIHAIDLPGYGFS--------- 175
           N + +  +   + +HGY A    Y K + +L        ++ IDLPG+G S         
Sbjct: 43  NANASTIKTPTVLIHGYAASSMAYYKTFRYLT--GSIKDLYTIDLPGFGLSASPKIIIND 100

Query: 176 -----SRMDFPFQFPRDDT-------------------------SVVCDWFISRLRTLFE 205
                S+ D      +D                           S   D++I R+    +
Sbjct: 101 HNRKKSQFDIKLIDSKDSNNNKFSISKKNLKLLENGNIEDKAFISAFDDYYIDRIE---K 157

Query: 206 KRGFDKSDNI-VMAHSMGAYLMAFYLNKYPDSVKKMVMCSPAGISRSQYS---------- 254
            R F+    I V+ HS G Y+   Y  KYPDS++ + + SP G+  + YS          
Sbjct: 158 WRKFNNLGKINVIGHSFGGYISFKYAIKYPDSIENLCLVSPFGMESNVYSINNYDDWKEK 217

Query: 255 ---------------------INNNITEDISSGKE-EIKLKIKKVPWWYTKLWDRNISPF 292
                                +N++ T+   +  + + +L++  V       +   + P 
Sbjct: 218 FSNPSSTRTSSVSSLGSSNSILNDSGTKIFKTNSDTDTQLELDLVDPTSKYYFREKVVPG 277

Query: 293 VL-------VRKTGILGSKITSGWTYRRFKPILLNKENNY--EQFEKLHRYSFAIFNMKG 343
           VL       ++  G LGSK+T  +  RR++ I      N+  + F  +   +   F+   
Sbjct: 278 VLFNNQFNVLKCMGPLGSKLTWSFISRRYEHIASEAYQNFLFKLFATVPNVTINNFSNMF 337

Query: 344 SGEYLLSFVLECGGDPRSPLENSLFSSDANKFGIDNAGIKNSSCEWVWVYGANDWMDIHG 403
           +   L           + P+ +S+     NK           S + +  YG NDWM+   
Sbjct: 338 TRNLL----------AKDPIMDSI-----NKL---------QSKKLLLFYGENDWMNKEA 373

Query: 404 ----AERVTKDFLMNNRKKSRVVTIPESGHHLYFDNYPMFNSLLIDEMKS 449
               AE++  + L  + K +  + +P SGH+L  D+   F+  LID + S
Sbjct: 374 GFLMAEKL--NILKGDSKYANWIEVPNSGHNLILDDPKFFSKNLIDFLSS 421

>ZYRO0F09064g Chr6 (735162..736211) [1050 bp, 349 aa] {ON} similar
           to uniprot|P38139 Saccharomyces cerevisiae YBR204C
           Hypothetical ORF
          Length = 349

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 78/339 (23%), Positives = 134/339 (39%), Gaps = 114/339 (33%)

Query: 127 DPNKKRKRLIFVHGYGAGLGFYLKNYEHLPLLDDSWS--IHAIDLPGYGFSSRMDFPFQF 184
           D ++  +  +F+HG    LG  L+ +E L  L D+      A+DLPG+G S   D   ++
Sbjct: 78  DSSQVHELFLFIHG----LGGELEQFEPLLRLVDAMDQRFLALDLPGFGKSDEWD---EY 130

Query: 185 PRDDTSVVCDWFISRLRTLFEKRG-FDKSDNIVMAHSMGAYLMAFYLNKY--PDSVKKMV 241
           P           +  + T+ E    F+ +  +++ HSMG YL + +   Y    S+ ++V
Sbjct: 131 P----------MLKVVETIEEIAAKFNAAKIVLVGHSMGCYLTSHFYEAYHKVHSINRIV 180

Query: 242 MCSPAGISRSQYSINNNITE-DISSGKEEIKLKIKKVPW---WYTKLWDRNISPFVLVRK 297
           + SP    R  Y +  N+ +  I  G         K+PW   +Y   +D++      +  
Sbjct: 181 LLSPP--KRVLYELQGNVVQWGIWFG--------YKLPWLFDFYRSWFDQSKG----LAS 226

Query: 298 TGILG----SKITSGWTYRRFKPILLNKENNYE----------------QFEKLHRYSFA 337
           +GI G      IT+  TYR+    L    NN +                Q++KL++    
Sbjct: 227 SGIRGFFSNDTITTIQTYRK----LWQFHNNVQIKSRTIFGYLSGWQPIQWDKLNQ---- 278

Query: 338 IFNMKGSGEYLLSFVLECGG-DPRSPLENSLFSSDANKFGIDNAGIKNSSCEWVWVYGAN 396
           I+N+  +     + V+ CG  D  +P                                  
Sbjct: 279 IWNVTAT-----TLVVMCGDRDAVTP---------------------------------- 299

Query: 397 DWMDIHGAERVTKDFLMNNRKKSRVVTIPESGHHLYFDN 435
               I  A+ + +    +  KK  +VTIP+ GHH+ FD 
Sbjct: 300 ----ISAAQEIVESLPEHMEKK--LVTIPDCGHHVCFDT 332

>TDEL0B03250 Chr2 complement(575015..576061) [1047 bp, 348 aa] {ON}
           Anc_8.524 YBR204C
          Length = 348

 Score = 44.3 bits (103), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 40/133 (30%), Positives = 66/133 (49%), Gaps = 25/133 (18%)

Query: 135 LIFVHGYGAGLGFYLKNYEHLPLLDD----SWSIHAIDLPGYGFSSRMDFPFQFPRDDTS 190
            +F+HG    LG  L+ +E  P+L +    + S  A DLPG+G S   D   Q+P  D  
Sbjct: 81  FLFIHG----LGGTLEQFE--PVLRELDQRNKSFLAFDLPGFGKSDEWD---QYPMLDVV 131

Query: 191 VVCDWFISRLRTLFEKRGFDKSDNIVMAHSMGAYLMAFYLNKYPDS--VKKMVMCSPA-- 246
              DW I +L    +   F+K +  ++ HSMG YL   +   + +S  + ++V+ +P   
Sbjct: 132 KSIDWLIHQLTNNLK---FEKLN--LIGHSMGCYLAVHFYLLFHESWCISRLVLLAPPKP 186

Query: 247 ---GISRSQYSIN 256
               +S+S+Y I 
Sbjct: 187 NVDQLSKSKYLIQ 199

>TPHA0L01600 Chr12 (338450..339568) [1119 bp, 372 aa] {ON} Anc_8.524
           YBR204C
          Length = 372

 Score = 41.2 bits (95), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 35/130 (26%), Positives = 58/130 (44%), Gaps = 21/130 (16%)

Query: 136 IFVHGYGAGLGFYLKNYEHLPLLD----DSWSIHAIDLPGYGFSSRMDFPFQFPRDDTSV 191
           IF+HG G  L       + LPLL      + S  A+DLPG+G  S  +  +       S 
Sbjct: 93  IFIHGLGGSLE------QFLPLLKLTDLSNKSFIAVDLPGFG-QSEFNDEYNIANYSMSS 145

Query: 192 VCDWFISRLRTLFEKRGFDKSDNIVMAHSMGAYLMAFYLNKYPD--SVKKMVMCSPAG-- 247
           +  +  S++   F +     +  I+  HSMG YL   +  +Y     ++K+V+ +P    
Sbjct: 146 IIGFLKSQV---FSRYLTTNTKIILTGHSMGCYLALHFYQQYKTEYQIQKIVLLAPPNPH 202

Query: 248 ---ISRSQYS 254
              + +S YS
Sbjct: 203 ETRLDKSNYS 212

>Skud_2.331 Chr2 complement(599967..601097) [1131 bp, 376 aa] {ON}
           YBR204C (REAL)
          Length = 376

 Score = 39.7 bits (91), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 40/148 (27%), Positives = 68/148 (45%), Gaps = 17/148 (11%)

Query: 144 GLGFYLKNYEHL-PLLD-DSWSIHAIDLPGYGFSSR-MDFP-FQFPRDDTSVVCDWFISR 199
           GL   L+ +E L  L+D D  +  A+DLPG+G SS   D+P  +       +VCD     
Sbjct: 95  GLAGNLEQFEPLLKLIDSDQKAFLALDLPGFGHSSEWADYPMLKVVELIFVLVCDVLKKW 154

Query: 200 LRTLFEKRGFDKSDN---IVMAHSMGAYLMAFYLNKYPDSVK---KMVMCSPAGISRSQY 253
              + + R  +  DN   ++  HSMG +L      ++  ++K   KMV+ +P      Q 
Sbjct: 155 PAAVPKDREVNPFDNRKIVLTGHSMGCFLACHLYEQHLAALKVVEKMVLLTPPKAHIEQL 214

Query: 254 SINNNITEDISSGKEEIKLKIKKVPWWY 281
           S + ++ +    G       + K+PW +
Sbjct: 215 SKDRHLIQWALYG-------VFKLPWLF 235

>KAFR0D04700 Chr4 complement(923561..924712) [1152 bp, 383 aa] {ON}
           Anc_5.358 YHR075C
          Length = 383

 Score = 39.3 bits (90), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 29/117 (24%), Positives = 58/117 (49%), Gaps = 13/117 (11%)

Query: 136 IFVHGYGAG---LGFYLKNYEHLPLLDDSWSIHAIDLPGYGFSSRMDFPFQ-------FP 185
           +FV  +GAG   L F     E   ++    +  + D  G+G +  +D   +       F 
Sbjct: 102 VFVMHHGAGSSGLSFAQLGSELFKIMKGKCACISFDARGHGQTKPIDSSIELDFGIDAFI 161

Query: 186 RDDTSVVCDWFISRLRTLFEKRGFDKSDNIVMAHSMGAYLMAFYLNKYPDSVKKMVM 242
            D TS++  +F+++L +   K+   K   I++ HS+G  + +F  N++P+ V+K ++
Sbjct: 162 DDFTSLLNYFFLTKLDSSLNKQ---KLSIILVGHSLGGSISSFAYNRFPEQVRKHLL 215

>KNAG0A03770 Chr1 complement(494021..495091) [1071 bp, 356 aa] {ON}
           Anc_8.524 YBR204C
          Length = 356

 Score = 38.9 bits (89), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 36/116 (31%), Positives = 51/116 (43%), Gaps = 18/116 (15%)

Query: 136 IFVHGYGAGLGFYLKNYEHLPLLDDSWS-IHAIDLPGYGFS-SRMDFPFQFPRDDTSVVC 193
           IF+HG G  L  +   +  L LLD S     AIDLPG+G S    D+P          V 
Sbjct: 86  IFIHGLGGSLDQF---FPLLKLLDLSEKYFVAIDLPGFGKSDEHTDYPMIQVVKHIDAVI 142

Query: 194 DWFISRLRTLFEKRGFDKSDNIVMAHSMGAYL----MAFYLNKYPDSVKKMVMCSP 245
              ++  R  F+          ++ HSMG YL    M  +  KY   + K+V+ +P
Sbjct: 143 SELLNEARLAFDTVR-------LIGHSMGCYLTLHFMTLFSKKY--RIGKVVLLAP 189

>Smik_2.345 Chr2 complement(618817..619944) [1128 bp, 375 aa] {ON}
           YBR204C (REAL)
          Length = 375

 Score = 37.4 bits (85), Expect = 0.063,   Method: Compositional matrix adjust.
 Identities = 45/165 (27%), Positives = 73/165 (44%), Gaps = 19/165 (11%)

Query: 125 NVDPNKKRKRLIFVHGYGAGLGFYLKNYEHLPLLDDS--WSIHAIDLPGYGFSSR-MDFP 181
           N++    R   +FV  +  GL   L+ +E L  L DS   +  A+DLPG+G SS   D+P
Sbjct: 77  NLNDKGIRSDTVFV--FVPGLAGNLEQFEPLLKLVDSDRKAFLALDLPGFGDSSEWSDYP 134

Query: 182 -FQFPRDDTSVVCDWFISRLRTLFEKRG---FDKSDNIVMAHSMGAYLMA-FYLNKYPDS 236
             +       ++CD    R   L +      F+    +++ HSMG +L    Y     D+
Sbjct: 135 MLKVVELIFILLCDVLKGRPAVLSKDDNLNFFNGHKLVLVGHSMGCFLACHLYEQHLVDA 194

Query: 237 --VKKMVMCSPAGISRSQYSINNNITEDISSGKEEIKLKIKKVPW 279
             VK +V+ +P      Q S +  I + +  G       + K+PW
Sbjct: 195 KVVKTLVLLTPPKAHIEQLSKDKRIYQWVLYG-------VFKMPW 232

>NCAS0B02260 Chr2 complement(374788..375879) [1092 bp, 363 aa] {ON}
           Anc_8.524 YBR204C
          Length = 363

 Score = 37.4 bits (85), Expect = 0.067,   Method: Compositional matrix adjust.
 Identities = 30/115 (26%), Positives = 49/115 (42%), Gaps = 12/115 (10%)

Query: 136 IFVHGYGAGLGFY--LKNYEHLPLLDDSWSIHAIDLPGYGFSSRMD-FPFQFPRDDTSVV 192
           +F+HG G  LG +  L    HL           +DLPG+G S  ++ +  +   +    V
Sbjct: 85  LFIHGLGGSLGQFEPLLRLTHL----KGKKFLTLDLPGFGQSDELESYSMKSVIETIRSV 140

Query: 193 CDWFISRLRTLFEKRGFDKSDNIVMAHSMGAYLMAFYLNKYPDS--VKKMVMCSP 245
            D      ++L E         I+  HSMG YL   +   Y  +  ++K+ + SP
Sbjct: 141 VDLATGNQKSLGENTQLKL---ILTGHSMGCYLCLHFFETYSKNYDIRKIALLSP 192

>YBR204C Chr2 complement(632254..633381) [1128 bp, 375 aa] {ON}
           LDH1Serine hydrolase; exhibits active esterase plus weak
           triacylglycerol lipase activities; proposed role in
           lipid homeostasis, regulating phospholipid and non-polar
           lipid levels and required for mobilization of LD-stored
           lipids; localizes to the lipid droplet (LD) surface;
           contains a classical serine containing catalytic triad
           (GxSxG motif)
          Length = 375

 Score = 37.0 bits (84), Expect = 0.074,   Method: Compositional matrix adjust.
 Identities = 51/208 (24%), Positives = 87/208 (41%), Gaps = 39/208 (18%)

Query: 102 AYLRKTEIDSDG--NYINELVIEPANVDPNKKRKRLIFVHG-------------YGAGLG 146
           AY+RK E+D D    +I E   E  NV  + +  R+   H              +  GL 
Sbjct: 38  AYIRKPEVDLDFRLKFIAEHE-EFFNVQLSDRNSRIRTCHNLSDKGIRGDTVFVFVPGLA 96

Query: 147 FYLKNYEHLPLLD----DSWSIHAIDLPGYGFSSR-MDFP-FQFPRDDTSVVCDWFISRL 200
             L+ +E  PLL+    D  +   +DLPG+G SS   D+P  +       +VCD  + + 
Sbjct: 97  GNLEQFE--PLLELVDSDQKAFLTLDLPGFGHSSEWSDYPMLKVVELIFVLVCD-VLRKW 153

Query: 201 RTLFEKRG----FDKSDNIVMAHSMGAYLMAFYLNKY---PDSVKKMVMCSPAGISRSQY 253
            T          F+    +++ HSMG +L      ++     +V+ +V+ +P      Q 
Sbjct: 154 STAVPNNDNVNPFNGHKIVLVGHSMGCFLACHLYEQHMADTKAVQTLVLLTPPKAHIEQL 213

Query: 254 SINNNITEDISSGKEEIKLKIKKVPWWY 281
           S + +I +    G       + K+PW +
Sbjct: 214 SKDKHIIQWALYG-------VFKLPWLF 234

>Suva_16.476 Chr16 complement(822104..823018) [915 bp, 304 aa] {ON}
           YPR147C (REAL)
          Length = 304

 Score = 37.0 bits (84), Expect = 0.078,   Method: Compositional matrix adjust.
 Identities = 31/130 (23%), Positives = 52/130 (40%), Gaps = 10/130 (7%)

Query: 119 LVIEPANVDPNKKRKRLIFVHGYGAGLGFYLKNYEHLPLLDDSWSIHAIDLPGYGFSSRM 178
           L I+P     N+    L+++ G    L +Y +   HL L    W I  I   G   ++R 
Sbjct: 16  LNIKPTVTTDNEDAPLLVWIPGNPGLLHYYQEMIHHLHLKHPDWEILGISHAGMSSNARS 75

Query: 179 DFPFQFPRDDTSVVCDWFISRLRTLFEKRGFDKSDNIVMAHSMGAYLM--AFYLNKYPDS 236
           + P    +D         +     +      D    I+M HS+GAY++      N+   S
Sbjct: 76  NTPIFSLQDQ--------VDHQVKVINNFSHDNRKIIIMGHSVGAYIVQKVCLSNELVGS 127

Query: 237 VKKMVMCSPA 246
           V K+ + +P 
Sbjct: 128 VTKVGLITPT 137

>Kwal_27.10170 s27 complement(227197..228078) [882 bp, 293 aa] {ON}
           YNR064C - Hypothetical ORF [contig 41] FULL
          Length = 293

 Score = 35.8 bits (81), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 20/73 (27%), Positives = 41/73 (56%), Gaps = 4/73 (5%)

Query: 129 NKKRKRLIFVHGYGAGLGFYLKNYEHLPLLDDSWSIHAIDLPGYGFSSRMDFPFQFPRDD 188
           ++ +  ++ +HGY      + +N   +PL+  S+ + A DLPG+GF++ MD PF F  ++
Sbjct: 27  SRDKPTILLLHGYPTSSNMF-RNL--IPLIAASFHVVAPDLPGFGFTT-MDEPFSFSFEN 82

Query: 189 TSVVCDWFISRLR 201
            +     F+  ++
Sbjct: 83  LANTIADFVRAMQ 95

>CAGL0M05467g Chr13 complement(583722..584786) [1065 bp, 354 aa]
           {ON} weakly similar to uniprot|P38139 Saccharomyces
           cerevisiae YBR204c peroxisomal serine-active lipase
          Length = 354

 Score = 35.8 bits (81), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 31/137 (22%), Positives = 61/137 (44%), Gaps = 15/137 (10%)

Query: 127 DPNKKRKRLIFVHGYGAGLGFYLKNYEHLPLLDDSWSIHAIDLPGYGFSSRMDFPFQFPR 186
           D  ++    + +HG G  +  +    + L LL   + + A+DLPG+G S      +    
Sbjct: 70  DGERRDSVFLLIHGLGGSMDQFQPLMKLLTLL--KYRVIALDLPGFGQSGSSTNGYDML- 126

Query: 187 DDTSVVCDWFISRLRTLFEKRGFDKSDN--IVMAHSMGAYLMAFYLNKYPD--SVKKMVM 242
                   +  S ++ + +    +K+D    V+ HSMG Y+ + ++  Y +  ++ K+V+
Sbjct: 127 --------YVTSVVKKVVDNNIENKTDIDFKVVGHSMGCYIASHFVQMYHEEYNIDKLVL 178

Query: 243 CSPAGISRSQYSINNNI 259
             P   S S    +N I
Sbjct: 179 TCPPPPSISTLRQDNYI 195

>KLLA0E23035g Chr5 (2051146..2052123) [978 bp, 325 aa] {ON} weakly
           similar to uniprot|P38139 Saccharomyces cerevisiae
           YBR204C Hypothetical ORF
          Length = 325

 Score = 35.0 bits (79), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 31/97 (31%), Positives = 44/97 (45%), Gaps = 21/97 (21%)

Query: 133 KRLIFVHGYGAGLGFY---LKNYEHLPLLDDSWSIHAIDLPGYGFSSRMDFPFQFPRDDT 189
           K ++ +HG G  L  Y   +  Y H     D     A DLPG+G S  +D   Q+   D 
Sbjct: 79  KLVLMIHGLGGNLTHYEPLISKYVH-----DHTPFLAFDLPGFGDSDELD---QYNMGDV 130

Query: 190 -SVVCDWFISRLRTLFEKRGFDKSDNIVMAHSMGAYL 225
            S++C+        L  K    K+ +I+  HSMGA L
Sbjct: 131 ISLICE--------LVHKMCQCKTISII-GHSMGALL 158

>TPHA0G02360 Chr7 (477456..480974) [3519 bp, 1172 aa] {ON} Anc_2.411
            YLR032W
          Length = 1172

 Score = 35.4 bits (80), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 26/127 (20%), Positives = 57/127 (44%), Gaps = 9/127 (7%)

Query: 37   SAIIHATAPTAKPLYEIVRDLPRLFPRSLAESKRDYATFHSNVDLMQLELLRTLPFFERT 96
            + I + T+  +  +  ++  L RLF +S  E    ++ F S +D+++ EL++ LP     
Sbjct: 986  TVIPYITSSKSAKIEALIVHLGRLFEKSPGEQVVVFSQFSSYLDILEKELMQALPKNTTE 1045

Query: 97   GYNKRAYLRKTEIDSDGNYINELVIEPANVDPNKKRKRLIFVHGYGAGLGFYLKNYEHLP 156
             Y    +  K  +    N + +  I+        ++++++ +     G+G  L    H  
Sbjct: 1046 IY---KFDGKLSLKERSNVLQQFKIKSL------EKQKILLLSLKAGGVGLNLTCCSHAF 1096

Query: 157  LLDDSWS 163
            ++D  WS
Sbjct: 1097 IMDPWWS 1103

>Kwal_23.6592 s23 (1658078..1658572) [495 bp, 164 aa] {ON} [contig
           358] FULL
          Length = 164

 Score = 33.9 bits (76), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 31/112 (27%), Positives = 54/112 (48%), Gaps = 24/112 (21%)

Query: 147 FYLKNYEH--------LPLLDDSWSIHAIDLPGYGFSSRMDFPFQFPRD--DTSVVCDWF 196
           FYL+++          +PLL +S+ + A+DLPG G S +       P D  DT  + +  
Sbjct: 18  FYLRSFPESWYAWRNVIPLLAESYWVIAVDLPGQGDSDK-------PGDGYDTQTLAN-- 68

Query: 197 ISRLRTLFEKRGFDKSDNIVMAHSMGAYLMAFYLNKYPDSVKKMVMCSPAGI 248
             +L  L +  G   S   + AH +GA++   Y   + + +++M +   AGI
Sbjct: 69  --KLHILIQSLGL--SRYFLAAHDVGAWVAFPYSLLFGEEIERMALLD-AGI 115

>YPR147C Chr16 complement(825645..826559) [915 bp, 304 aa] {ON}
           Putative protein of unknown function; green fluorescent
           protein (GFP)-fusion protein localizes to the cytoplasm
           and is induced in response to the DNA-damaging agent MMS
          Length = 304

 Score = 34.7 bits (78), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 33/133 (24%), Positives = 54/133 (40%), Gaps = 16/133 (12%)

Query: 119 LVIEPANVDPNKKRKRLIFVHGYGAGLGFYLKNYEHLPLLDDSWSIHAIDLPGYGFSSRM 178
           L I+P      +    L+++ G    L +Y +   HL L    W I  I   G   ++  
Sbjct: 16  LNIKPTVTKSGEDAPLLVWIPGNPGLLYYYQEMLHHLHLKHPDWEILGISHAGMTLNAHS 75

Query: 179 DFP---FQFPRDDTSVVCDWFISRLRTLFEKRGFDKSDNIVMAHSMGAYLM--AFYLNKY 233
           + P    Q   D    V + F  + R +           I+M HS+GAY++      NK 
Sbjct: 76  NTPIFSLQDQVDHQVEVINNFSCKNRKI-----------IIMGHSVGAYIVQKVCLSNKL 124

Query: 234 PDSVKKMVMCSPA 246
             SV+K+ + +P 
Sbjct: 125 VGSVQKVGLVTPT 137

>TBLA0H03540 Chr8 (863267..864403) [1137 bp, 378 aa] {ON} Anc_8.524
           YBR204C
          Length = 378

 Score = 34.3 bits (77), Expect = 0.67,   Method: Compositional matrix adjust.
 Identities = 33/124 (26%), Positives = 54/124 (43%), Gaps = 27/124 (21%)

Query: 138 VHGYGAGLGFYLKNYEHLPLLDDSWSIHAI--DLPGYGFSSRMDFPFQFPRDDTSV---- 191
           ++ +  GLG  L  YE L  L D  +   I  DLPG+G S           +DTS     
Sbjct: 96  IYVFLPGLGGSLDQYEPLLRLMDILNEKFIGFDLPGFGGS----------EEDTSEGGYN 145

Query: 192 ---VCDWFISRLRTLFEKRGFDKSDNI---VMAHSMGAYLMAFYLNKYPD----SVKKMV 241
              VC      L+++   + +   D I   ++ HSMG YL+  + N +       + +++
Sbjct: 146 MIKVCHIINEALQSII-TQNYSTRDTIELRLVGHSMGCYLVLHFFNSFQTKTEYKISQLI 204

Query: 242 MCSP 245
           + SP
Sbjct: 205 LTSP 208

>CAGL0J08547g Chr10 (846742..847881) [1140 bp, 379 aa] {ON} similar
           to uniprot|Q12405 Saccharomyces cerevisiae YOR084w
          Length = 379

 Score = 33.9 bits (76), Expect = 0.70,   Method: Compositional matrix adjust.
 Identities = 27/125 (21%), Positives = 53/125 (42%), Gaps = 12/125 (9%)

Query: 130 KKRKRLIFVHGYGAGLGFYLKNYEHLPLLDDSW---SIHAIDLPGYGFSSRMDFPFQFPR 186
           KK+  L+F HG G     +  + + +  L+ +W    I  ID   +G S+ ++      +
Sbjct: 53  KKKVNLVFCHGSGMNRAIWEYHADRIADLNSNWVVDKIVVIDQVNHGDSALLN------K 106

Query: 187 DDTSVVCDWFISR---LRTLFEKRGFDKSDNIVMAHSMGAYLMAFYLNKYPDSVKKMVMC 243
               +  DWF       +   E+  F  + N+++ HSMG +     +   P+  +  ++ 
Sbjct: 107 GRLGLEFDWFDGARDICKVAEEEFNFMNNYNVIVGHSMGGFQTLAAVAHNPNLFQLAIVI 166

Query: 244 SPAGI 248
            P  I
Sbjct: 167 EPVII 171

>Kwal_26.9628 s26 (1300688..1301449) [762 bp, 254 aa] {ON} YNR064C -
           Hypothetical ORF [contig 363] PARTIAL
          Length = 254

 Score = 33.5 bits (75), Expect = 0.79,   Method: Compositional matrix adjust.
 Identities = 28/96 (29%), Positives = 48/96 (50%), Gaps = 16/96 (16%)

Query: 155 LPLLDDSWSIHAIDLPGYGFSSRMDFPFQFPRD--DTSVVCDWFISRLRTLFEKRGFDKS 212
           +PLL +S+ + A+DLPG G S +       P D  DT  + +    +L  L +  G   S
Sbjct: 53  IPLLAESYWVIAVDLPGQGDSDK-------PGDGYDTQTLAN----KLHILIQSLGL--S 99

Query: 213 DNIVMAHSMGAYLMAFYLNKYPDSVKKMVMCSPAGI 248
              + AH +GA++   Y   + + +++M +   AGI
Sbjct: 100 RYFLAAHDVGAWVAFPYSLLFGEEIERMALLD-AGI 134

>Kwal_48.19391 s48 (3319..3870) [552 bp, 183 aa] {ON} YNR064C -
           Hypothetical ORF [contig 322] FULL
          Length = 183

 Score = 33.1 bits (74), Expect = 0.84,   Method: Compositional matrix adjust.
 Identities = 28/96 (29%), Positives = 48/96 (50%), Gaps = 16/96 (16%)

Query: 155 LPLLDDSWSIHAIDLPGYGFSSRMDFPFQFPRD--DTSVVCDWFISRLRTLFEKRGFDKS 212
           +PLL +S+ + A+DLPG G S +       P D  DT  + +    +L  L +  G   S
Sbjct: 53  IPLLAESYWVIAVDLPGQGDSDK-------PGDGYDTQTLAN----KLHILIQSLGL--S 99

Query: 213 DNIVMAHSMGAYLMAFYLNKYPDSVKKMVMCSPAGI 248
              + AH +GA++   Y   + + +++M +   AGI
Sbjct: 100 RYFLAAHDVGAWVAFPYSLLFGEEIERMALLD-AGI 134

>SAKL0H06886g Chr8 complement(604406..605269) [864 bp, 287 aa] {ON}
           conserved hypothetical protein
          Length = 287

 Score = 33.5 bits (75), Expect = 0.96,   Method: Compositional matrix adjust.
 Identities = 39/155 (25%), Positives = 62/155 (40%), Gaps = 40/155 (25%)

Query: 128 PNKKRKRLIFVHGYGAGLGFYLKNYEHLPLLDD-----SWSIHAIDL----PGYGFSSRM 178
           P  ++K LIFV G G G    L    ++P+L D     +WS+  I L     G+G SS  
Sbjct: 21  PTLRKKVLIFVGGMGDG----LLTVPYIPILVDKLATLNWSLVQIQLDSSFKGWGTSSLT 76

Query: 179 DFPFQFPRDDTSVVCDWFISRLRTLFE----KRGFDKSDNIVMAHSMGAYLMAFYLNKYP 234
           D                 I  +R L +    ++G  +   ++M HS G+     YL  + 
Sbjct: 77  D----------------DIEGIRALVDYLKSEQGGSREKIVLMGHSTGSQDTIHYLLNHG 120

Query: 235 DSVKKMVMCSPAGISRSQYSINNNITEDISSGKEE 269
           D++        AGI +   S   +   +I    +E
Sbjct: 121 DTID-------AGILQGSVSDRESFASEIDPQAQE 148

>Kwal_43.16490 s43 (51..911) [861 bp, 286 aa] {ON} YNR064C -
           Hypothetical ORF [contig 357] PARTIAL
          Length = 286

 Score = 33.5 bits (75), Expect = 0.99,   Method: Compositional matrix adjust.
 Identities = 28/96 (29%), Positives = 48/96 (50%), Gaps = 16/96 (16%)

Query: 155 LPLLDDSWSIHAIDLPGYGFSSRMDFPFQFPRD--DTSVVCDWFISRLRTLFEKRGFDKS 212
           +PLL +S+ + A+DLPG G S +       P D  DT  + +    +L  L +  G   S
Sbjct: 36  IPLLAESYWVIAVDLPGQGDSDK-------PGDGYDTQTLAN----KLHILIQSLGL--S 82

Query: 213 DNIVMAHSMGAYLMAFYLNKYPDSVKKMVMCSPAGI 248
              + AH +GA++   Y   + + +++M +   AGI
Sbjct: 83  RYFLAAHDVGAWVAFPYSLLFGEEIERMALLD-AGI 117

>Kwal_26.6639 s26 complement(252..1163) [912 bp, 303 aa] {ON}
           YNR064C - Hypothetical ORF [contig 294] FULL
          Length = 303

 Score = 33.5 bits (75), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 28/96 (29%), Positives = 48/96 (50%), Gaps = 16/96 (16%)

Query: 155 LPLLDDSWSIHAIDLPGYGFSSRMDFPFQFPRD--DTSVVCDWFISRLRTLFEKRGFDKS 212
           +PLL +S+ + A+DLPG G S +       P D  DT  + +    +L  L +  G   S
Sbjct: 53  IPLLAESYWVIAVDLPGQGDSDK-------PGDGYDTQTLAN----KLHILIQSLGL--S 99

Query: 213 DNIVMAHSMGAYLMAFYLNKYPDSVKKMVMCSPAGI 248
              + AH +GA++   Y   + + +++M +   AGI
Sbjct: 100 RYFLAAHDVGAWVAFPYSLLFGEEIERMALLD-AGI 134

>KLTH0E12188g Chr5 (1082142..1083152) [1011 bp, 336 aa] {ON} similar
           to uniprot|P38139 Saccharomyces cerevisiae YBR204C
           Hypothetical ORF
          Length = 336

 Score = 33.1 bits (74), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 33/119 (27%), Positives = 51/119 (42%), Gaps = 15/119 (12%)

Query: 136 IFVHGYGAGLGFYLKNYEHLPLLDDSWSIHAIDLPGYGFSSRMDFPFQFPRDDTSVVCDW 195
           +F HG G  L  +      L  L++ +   A+DLPG+G S   D  +Q  +  T V+ D 
Sbjct: 82  LFFHGLGGNLTQFEPLLRLLGELNEGFV--AMDLPGFGLSEEQD-GYQMLQ-VTQVIHDA 137

Query: 196 FISRLRTLFEKRGFDKSDNIVMAHSMGAYLMAFY--LNKYPDSVKKMVMCSPAGISRSQ 252
           F+            D    I++ HSMG +L+  +  L      +K  V  SP   +  Q
Sbjct: 138 FLQIT---------DHKKIILVGHSMGCHLVLHFAILFGLEFDIKDSVFLSPPAPTLPQ 187

>Skud_16.442 Chr16 complement(779364..780278) [915 bp, 304 aa] {ON}
           YPR147C (REAL)
          Length = 304

 Score = 32.7 bits (73), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 27/130 (20%), Positives = 53/130 (40%), Gaps = 10/130 (7%)

Query: 119 LVIEPANVDPNKKRKRLIFVHGYGAGLGFYLKNYEHLPLLDDSWSIHAIDLPGYGFSSRM 178
           L I+P+    N+    L+++ G    L +Y +  +HL      W I  +   G   ++  
Sbjct: 16  LNIKPSVATENEDAPLLVWIPGNPGLLYYYQEMLQHLHSKHPDWEILGVSHAGMTLNAHS 75

Query: 179 DFPFQFPRDDTSVVCDWFISRLRTLFEKRGFDKSDNIVMAHSMGAYLM--AFYLNKYPDS 236
           + P    +D         +     +      +    I+M HS+GAY++      +K   S
Sbjct: 76  NTPIFSLQDQ--------VDHQVEVINNFSHENRKIIIMGHSVGAYILQKVCLSDKLVGS 127

Query: 237 VKKMVMCSPA 246
           V+K+ + +P 
Sbjct: 128 VRKIGLITPT 137

>TBLA0D01150 Chr4 complement(293536..294939) [1404 bp, 467 aa] {ON} 
           YMR210W
          Length = 467

 Score = 32.7 bits (73), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 22/64 (34%), Positives = 34/64 (53%), Gaps = 8/64 (12%)

Query: 197 ISRLRTLFEKRGFDKSDNIVMAHSMGAYLMAFYLNKYP---DSVKKMVMCSPAGISRSQY 253
           + +LR L+  R F      ++  S+GA ++A YL +     D    +VM +P  +SRS Y
Sbjct: 217 VKKLRELYPNRPF-----YMIGFSLGASMLANYLGEESSKSDIKCAVVMGNPWNLSRSSY 271

Query: 254 SINN 257
            INN
Sbjct: 272 YINN 275

>Suva_8.271 Chr8 complement(491197..493989) [2793 bp, 930 aa] {ON}
           YOR219C (REAL)
          Length = 930

 Score = 32.7 bits (73), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 17/45 (37%), Positives = 26/45 (57%)

Query: 106 KTEIDSDGNYINELVIEPANVDPNKKRKRLIFVHGYGAGLGFYLK 150
           K+ + SDG  +N + I+PAN+DP KK   L+ ++G      F  K
Sbjct: 668 KSMVLSDGIEVNYIEIKPANLDPKKKYPILVNIYGGPGSQSFTTK 712

>Kwal_27.11975 s27 (1028242..1029252) [1011 bp, 336 aa] {ON} YBR204C
           - Hypothetical ORF [contig 26] FULL
          Length = 336

 Score = 32.3 bits (72), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 29/111 (26%), Positives = 51/111 (45%), Gaps = 15/111 (13%)

Query: 136 IFVHGYGAGLGFYLKNYEHLPLLDDSWSIHAIDLPGYGFSSRMDFPFQFPRDDTSVVCDW 195
           +F+HG G  L  +      L +L++ +    IDLPG+G S  +D    +   D + +   
Sbjct: 82  VFIHGLGGTLTQFEPLLRVLDVLNEGFL--TIDLPGFGHSDELD---SYSMLDIAKI--- 133

Query: 196 FISRLRTLFEKRGFDKSDNIVMAHSMGAYLMAFYLNKYPD--SVKKMVMCS 244
               +R +  +   +K   IV+ HSMG ++   +   Y    ++K MV  S
Sbjct: 134 ----IREVLVETTKNKK-VIVVGHSMGCHIALHFGQLYNAEFAIKDMVFLS 179

>KAFR0E03110 Chr5 (621949..623019) [1071 bp, 356 aa] {ON} 
          Length = 356

 Score = 32.3 bits (72), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 34/109 (31%), Positives = 52/109 (47%), Gaps = 17/109 (15%)

Query: 144 GLGFYLKNYEHLPLLDDSWSIH--AIDLPGYGFSSRMDFPFQFPRDDTSVVCDWFISRLR 201
           GLG  L+ +E L  L D+ + +  AIDLPG+G S           D ++       + + 
Sbjct: 88  GLGGNLEQFEPLVRLIDASNKNFLAIDLPGFGKS----------EDYSNYSMTHIATLID 137

Query: 202 TLFEKRGFDKSDNI---VMAHSMGAYL-MAFY-LNKYPDSVKKMVMCSP 245
            + E       DN    VM HSMG +L + FY L     +V+K+++ SP
Sbjct: 138 QMLETVIGTAPDNYKINVMGHSMGTHLALHFYELFNKKYTVEKLILVSP 186

>Skud_15.385 Chr15 complement(691276..694071) [2796 bp, 931 aa] {ON}
           YOR219C (REAL)
          Length = 931

 Score = 32.3 bits (72), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 17/40 (42%), Positives = 23/40 (57%)

Query: 111 SDGNYINELVIEPANVDPNKKRKRLIFVHGYGAGLGFYLK 150
           +DG  IN + I+PANVDP KK   L+ ++G      F  K
Sbjct: 672 NDGIEINYIEIKPANVDPKKKYPILVNIYGGPGSQTFTTK 711

>KLLA0A10395g Chr1 complement(908097..908981) [885 bp, 294 aa] {ON}
           similar to uniprot|P53750 Saccharomyces cerevisiae
           YNR064C
          Length = 294

 Score = 31.6 bits (70), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 16/48 (33%), Positives = 26/48 (54%), Gaps = 5/48 (10%)

Query: 129 NKKRKRLIFVHGYGAGLGFYLKNYEHL-PLLDDSWSIHAIDLPGYGFS 175
           +K    ++ +HGY      +     HL PL+ D + + A DLPG+GF+
Sbjct: 27  DKSNPSIVLLHGYPTSSTMF----RHLIPLISDKFHVIAPDLPGFGFT 70

>Smik_15.404 Chr15 complement(701886..704678) [2793 bp, 930 aa] {ON}
           YOR219C (REAL)
          Length = 930

 Score = 32.0 bits (71), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 22/69 (31%), Positives = 36/69 (52%), Gaps = 1/69 (1%)

Query: 84  LELLRTLPFFER-TGYNKRAYLRKTEIDSDGNYINELVIEPANVDPNKKRKRLIFVHGYG 142
           L+L R   F E+   Y+      ++ + +DG  IN + I+PAN++P KK   L+ V+G  
Sbjct: 643 LQLTRDEKFKEKLKNYDIPTTSYQSMVLNDGIEINYIEIKPANINPKKKYPILVNVYGGP 702

Query: 143 AGLGFYLKN 151
               F  K+
Sbjct: 703 GSQTFTTKS 711

>YOR219C Chr15 complement(752214..755009) [2796 bp, 931 aa] {ON}
           STE13Dipeptidyl aminopeptidase, Golgi integral membrane
           protein that cleaves on the carboxyl side of repeating
           -X-Ala- sequences, required for maturation of alpha
           factor, transcription is induced by a-factor
          Length = 931

 Score = 31.2 bits (69), Expect = 6.7,   Method: Compositional matrix adjust.
 Identities = 17/45 (37%), Positives = 25/45 (55%)

Query: 106 KTEIDSDGNYINELVIEPANVDPNKKRKRLIFVHGYGAGLGFYLK 150
           KT +  DG  IN + I+PAN++P KK   L+ ++G      F  K
Sbjct: 667 KTMVLDDGVEINYIEIKPANLNPKKKYPILVNIYGGPGSQTFTTK 711

>TDEL0F00680 Chr6 complement(114474..115640) [1167 bp, 388 aa] {ON}
           Anc_2.80 YNL175C
          Length = 388

 Score = 30.8 bits (68), Expect = 7.8,   Method: Compositional matrix adjust.
 Identities = 14/27 (51%), Positives = 18/27 (66%)

Query: 107 TEIDSDGNYINELVIEPANVDPNKKRK 133
           TE++ D N I E+ I+ A  DP KKRK
Sbjct: 2   TEVEQDQNSIKEVEIKKALADPTKKRK 28

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.320    0.137    0.418 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 52,541,457
Number of extensions: 2489035
Number of successful extensions: 6244
Number of sequences better than 10.0: 93
Number of HSP's gapped: 6266
Number of HSP's successfully gapped: 113
Length of query: 451
Length of database: 53,481,399
Length adjustment: 113
Effective length of query: 338
Effective length of database: 40,524,141
Effective search space: 13697159658
Effective search space used: 13697159658
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 67 (30.4 bits)