Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
CAGL0L04620g6.65ON26426413620.0
YOR174W (MED4)6.65ON2842516712e-87
Suva_8.2276.65ON2872476617e-86
Smik_15.3526.65ON2882346555e-85
NCAS0F003306.65ON2811976461e-83
AGR270W6.65ON2942586434e-83
Skud_15.3366.65ON2862396419e-83
ZYRO0D14190g6.65ON2952746411e-82
Kpol_1042.116.65ON2922616313e-81
KAFR0G025006.65ON2892596131e-78
NDAI0J013206.65ON3342916135e-78
KNAG0M010206.65ON2792656052e-77
KLTH0G15444g6.65ON2632325944e-76
TBLA0G005506.65ON3182205961e-75
SAKL0A08426g6.65ON2991735811e-73
Ecym_31246.65ON2742575755e-73
TPHA0F025906.65ON3062635776e-73
Kwal_56.232426.65ON2561775536e-70
KLLA0F20185g6.65ON2852675183e-64
TDEL0G040606.65ON2201934602e-56
Ecym_5175singletonON141059731.0
Kwal_33.133891.81ON69457721.4
TDEL0G04880singletonON44665693.0
Kpol_489.16singletonON38551683.3
ZYRO0E01078g2.633ON66894683.9
Smik_10.781.191ON69956684.2
TPHA0J026605.453ON96869684.7
NCAS0C033708.305ON78887667.0
KNAG0C042007.272ON99537667.3
NDAI0D048501.76ON154468667.6
Suva_6.2351.191ON69973658.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0L04620g
         (264 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0L04620g Chr12 (533791..534585) [795 bp, 264 aa] {ON} simila...   529   0.0  
YOR174W Chr15 (658747..659601) [855 bp, 284 aa] {ON}  MED4Subuni...   263   2e-87
Suva_8.227 Chr8 (408722..409585) [864 bp, 287 aa] {ON} YOR174W (...   259   7e-86
Smik_15.352 Chr15 (614812..615678) [867 bp, 288 aa] {ON} YOR174W...   256   5e-85
NCAS0F00330 Chr6 (53650..54495) [846 bp, 281 aa] {ON} Anc_6.65 Y...   253   1e-83
AGR270W Chr7 (1244264..1245148) [885 bp, 294 aa] {ON} Syntenic h...   252   4e-83
Skud_15.336 Chr15 (607340..608200) [861 bp, 286 aa] {ON} YOR174W...   251   9e-83
ZYRO0D14190g Chr4 (1200325..1201212) [888 bp, 295 aa] {ON} simil...   251   1e-82
Kpol_1042.11 s1042 (21260..22138) [879 bp, 292 aa] {ON} (21260.....   247   3e-81
KAFR0G02500 Chr7 complement(519629..520498) [870 bp, 289 aa] {ON...   240   1e-78
NDAI0J01320 Chr10 complement(308327..309331) [1005 bp, 334 aa] {...   240   5e-78
KNAG0M01020 Chr13 complement(180570..181409) [840 bp, 279 aa] {O...   237   2e-77
KLTH0G15444g Chr7 complement(1353833..1354624) [792 bp, 263 aa] ...   233   4e-76
TBLA0G00550 Chr7 (115655..116611) [957 bp, 318 aa] {ON} Anc_6.65...   234   1e-75
SAKL0A08426g Chr1 complement(746101..747000) [900 bp, 299 aa] {O...   228   1e-73
Ecym_3124 Chr3 complement(232769..233593) [825 bp, 274 aa] {ON} ...   226   5e-73
TPHA0F02590 Chr6 (565725..566645) [921 bp, 306 aa] {ON} Anc_6.65...   226   6e-73
Kwal_56.23242 s56 (459387..460157) [771 bp, 256 aa] {ON} YOR174W...   217   6e-70
KLLA0F20185g Chr6 complement(1882094..1882951) [858 bp, 285 aa] ...   204   3e-64
TDEL0G04060 Chr7 complement(741796..742458) [663 bp, 220 aa] {ON...   181   2e-56
Ecym_5175 Chr5 (360152..364384) [4233 bp, 1410 aa] {ON} Similar ...    33   1.0  
Kwal_33.13389 s33 complement(197441..199525) [2085 bp, 694 aa] {...    32   1.4  
TDEL0G04880 Chr7 (901871..903211) [1341 bp, 446 aa] {ON}               31   3.0  
Kpol_489.16 s489 complement(46657..47814) [1158 bp, 385 aa] {ON}...    31   3.3  
ZYRO0E01078g Chr5 (73042..75048) [2007 bp, 668 aa] {ON} similar ...    31   3.9  
Smik_10.78 Chr10 complement(124678..126777) [2100 bp, 699 aa] {O...    31   4.2  
TPHA0J02660 Chr10 (588337..591243) [2907 bp, 968 aa] {ON} Anc_5....    31   4.7  
NCAS0C03370 Chr3 (660234..662600) [2367 bp, 788 aa] {ON} Anc_8.3...    30   7.0  
KNAG0C04200 Chr3 complement(820365..823352) [2988 bp, 995 aa] {O...    30   7.3  
NDAI0D04850 Chr4 complement(1147963..1152597) [4635 bp, 1544 aa]...    30   7.6  
Suva_6.235 Chr6 (421197..423296) [2100 bp, 699 aa] {ON} YJL156C ...    30   8.4  

>CAGL0L04620g Chr12 (533791..534585) [795 bp, 264 aa] {ON} similar
           to uniprot|Q12343 Saccharomyces cerevisiae YOR174w MED4
          Length = 264

 Score =  529 bits (1362), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 264/264 (100%), Positives = 264/264 (100%)

Query: 1   MSLVAESNSGTISEQELDKVQLYSDLCLYEEALTKLVDSVDNFKPQLEIGKQLIEADKKL 60
           MSLVAESNSGTISEQELDKVQLYSDLCLYEEALTKLVDSVDNFKPQLEIGKQLIEADKKL
Sbjct: 1   MSLVAESNSGTISEQELDKVQLYSDLCLYEEALTKLVDSVDNFKPQLEIGKQLIEADKKL 60

Query: 61  YSTLDLLPQYDSVFTRLRTLDDEISKVDQQTKNILSILNECHDDLNALPLLEEVEFEKKM 120
           YSTLDLLPQYDSVFTRLRTLDDEISKVDQQTKNILSILNECHDDLNALPLLEEVEFEKKM
Sbjct: 61  YSTLDLLPQYDSVFTRLRTLDDEISKVDQQTKNILSILNECHDDLNALPLLEEVEFEKKM 120

Query: 121 ILKQREKIKSNVLLEYATKLAKFTKIPPTFDKGTIGPNNFIWPAEDALRKGMLAMASLHG 180
           ILKQREKIKSNVLLEYATKLAKFTKIPPTFDKGTIGPNNFIWPAEDALRKGMLAMASLHG
Sbjct: 121 ILKQREKIKSNVLLEYATKLAKFTKIPPTFDKGTIGPNNFIWPAEDALRKGMLAMASLHG 180

Query: 181 KELTKLPGQEDGEEDGSTANEDKNIVKDAEGAEGEIRQDDKKEDDSFVFGANANDAEGDE 240
           KELTKLPGQEDGEEDGSTANEDKNIVKDAEGAEGEIRQDDKKEDDSFVFGANANDAEGDE
Sbjct: 181 KELTKLPGQEDGEEDGSTANEDKNIVKDAEGAEGEIRQDDKKEDDSFVFGANANDAEGDE 240

Query: 241 DKNAGEDEDEAMDSDLDLFNPDEF 264
           DKNAGEDEDEAMDSDLDLFNPDEF
Sbjct: 241 DKNAGEDEDEAMDSDLDLFNPDEF 264

>YOR174W Chr15 (658747..659601) [855 bp, 284 aa] {ON}  MED4Subunit
           of the RNA polymerase II mediator complex; associates
           with core polymerase subunits to form the RNA polymerase
           II holoenzyme; essential for transcriptional regulation
          Length = 284

 Score =  263 bits (671), Expect = 2e-87,   Method: Compositional matrix adjust.
 Identities = 136/251 (54%), Positives = 181/251 (72%), Gaps = 7/251 (2%)

Query: 1   MSLVAESNSGTISEQELDKVQLYSDLCLYEEALTKLVDSVDNFKPQLEIGKQLIEADKKL 60
           +SLVAE+ S T SE +L KVQLY DLC YE+ L+KLV+SVD FKP L+I K LI  D+ L
Sbjct: 21  VSLVAEATSNTNSEDKLSKVQLYEDLCRYEDTLSKLVESVDRFKPNLDIAKDLIRTDEAL 80

Query: 61  YSTLDLLPQYDSVFTRLRTLDDEISKVDQQTKNILSILNECHDDLNALPLLEEVEFEKKM 120
           +  + LL +YD+++  L+ +D +  ++D +T+ IL ILNECHD+L ALP+LE+VEFEK  
Sbjct: 81  FENVKLLAEYDNIYRNLQKIDKDSEELDSKTRKILEILNECHDELKALPMLEQVEFEKNT 140

Query: 121 ILKQREKIKSNVLLEYATKLAKFTKIPPTFDKGTIGPNNFIWPAEDALRKGMLAMASLHG 180
           IL+QR KI S  LL+YATKL+KFTKIPPTFDKG +GPNNFIWPAEDALR+GMLAMASLH 
Sbjct: 141 ILQQRSKINSTELLDYATKLSKFTKIPPTFDKGAVGPNNFIWPAEDALRRGMLAMASLHS 200

Query: 181 KELTKLPGQEDGEEDGSTANEDKNIVKDAEGAEGEI-RQDDKKEDDSFVFGANANDAEGD 239
           KELT++PG+E  E +  T    +     +E  +G++ +++   + DSF+F   A +  GD
Sbjct: 201 KELTRIPGEEVEETEVPTVPPSQ-----SEEQKGQMAKKEGTPKTDSFIFDGTAKEV-GD 254

Query: 240 EDKNAGEDEDE 250
           E  N  + E E
Sbjct: 255 EADNTKDKEKE 265

>Suva_8.227 Chr8 (408722..409585) [864 bp, 287 aa] {ON} YOR174W
           (REAL)
          Length = 287

 Score =  259 bits (661), Expect = 7e-86,   Method: Compositional matrix adjust.
 Identities = 137/247 (55%), Positives = 176/247 (71%), Gaps = 7/247 (2%)

Query: 1   MSLVAESNSGTISEQELDKVQLYSDLCLYEEALTKLVDSVDNFKPQLEIGKQLIEADKKL 60
           +SLVAE+ S   SE +  KVQLY DLC YE+ L KLV+SVD FKP LEI K LI+ D+ L
Sbjct: 21  VSLVAEATSSMNSEHKSSKVQLYEDLCRYEDILGKLVESVDRFKPNLEIAKDLIKTDESL 80

Query: 61  YSTLDLLPQYDSVFTRLRTLDDEISKVDQQTKNILSILNECHDDLNALPLLEEVEFEKKM 120
           ++ + LL  YD +   LR +D +  ++D +T+ IL ILNECHD+L+ALP+LE+VEFEKK 
Sbjct: 81  FNNVKLLADYDKIDLNLRKIDKDSEELDSKTRKILEILNECHDELSALPMLEQVEFEKKT 140

Query: 121 ILKQREKIKSNVLLEYATKLAKFTKIPPTFDKGTIGPNNFIWPAEDALRKGMLAMASLHG 180
           IL+QR KI S  LL+YATKL+KFT+IPPTFDKGT+GPNNFIWPAEDALR+GMLAMASLH 
Sbjct: 141 ILQQRSKINSTALLDYATKLSKFTRIPPTFDKGTVGPNNFIWPAEDALRRGMLAMASLHS 200

Query: 181 KELTKLPGQEDGEEDGSTANEDKNIVKD-AEGAEGEIRQDDKKEDDSFVFGANAN----D 235
           KELT++PG+E+ E +    +      K+  E +E   +    K  DSF+F   AN     
Sbjct: 201 KELTRIPGEEEQETEEVPTDTLSQPQKEKKESSENSPQNSPTK--DSFIFNGIANKDTDQ 258

Query: 236 AEGDEDK 242
           A+ D+DK
Sbjct: 259 ADNDKDK 265

>Smik_15.352 Chr15 (614812..615678) [867 bp, 288 aa] {ON} YOR174W
           (REAL)
          Length = 288

 Score =  256 bits (655), Expect = 5e-85,   Method: Compositional matrix adjust.
 Identities = 126/234 (53%), Positives = 170/234 (72%)

Query: 1   MSLVAESNSGTISEQELDKVQLYSDLCLYEEALTKLVDSVDNFKPQLEIGKQLIEADKKL 60
           +SLV E+ S   SE +L KVQLY DLC YE+ L KLV+SVD FKP +++ + LI+ D+ L
Sbjct: 21  VSLVVEATSNMNSEDKLSKVQLYEDLCRYEDTLKKLVESVDRFKPDIDVARDLIKIDESL 80

Query: 61  YSTLDLLPQYDSVFTRLRTLDDEISKVDQQTKNILSILNECHDDLNALPLLEEVEFEKKM 120
           ++ +DLL +YD++   LR +D +  ++D +TK IL I+NECHD+L ALP+LE+VEFEK  
Sbjct: 81  FNNVDLLSEYDNIDRNLRKIDKDSEELDSKTKRILEIMNECHDELGALPMLEQVEFEKNT 140

Query: 121 ILKQREKIKSNVLLEYATKLAKFTKIPPTFDKGTIGPNNFIWPAEDALRKGMLAMASLHG 180
           IL+QR KI S  LL+YATKL+KFT+IPPTFDKG+IGPNNFIWPAEDALR+GMLAMASLH 
Sbjct: 141 ILQQRSKINSTALLDYATKLSKFTRIPPTFDKGSIGPNNFIWPAEDALRRGMLAMASLHS 200

Query: 181 KELTKLPGQEDGEEDGSTANEDKNIVKDAEGAEGEIRQDDKKEDDSFVFGANAN 234
           KELT++PG+E  E   +      +  ++    E +  +++    DSF+F   AN
Sbjct: 201 KELTRVPGEEAEEAAETEEVLVSSPSQNGLDNEHKTAKEEVPSTDSFIFNGTAN 254

>NCAS0F00330 Chr6 (53650..54495) [846 bp, 281 aa] {ON} Anc_6.65
           YOR174W
          Length = 281

 Score =  253 bits (646), Expect = 1e-83,   Method: Compositional matrix adjust.
 Identities = 121/197 (61%), Positives = 155/197 (78%), Gaps = 2/197 (1%)

Query: 1   MSLVAESNSGTIS--EQELDKVQLYSDLCLYEEALTKLVDSVDNFKPQLEIGKQLIEADK 58
           +SL+AE N  +IS  E ++ KVQ+YSDLC YE+ L  LV+SVD FKP +   ++LIE D+
Sbjct: 23  VSLLAEVNPNSISNDEDDISKVQIYSDLCSYEQKLANLVNSVDKFKPDMNAARELIEVDR 82

Query: 59  KLYSTLDLLPQYDSVFTRLRTLDDEISKVDQQTKNILSILNECHDDLNALPLLEEVEFEK 118
            L+ TLD   +YD +   L+ L+ E  ++D +TK IL ILNECHD+LNALP+L++VEFE 
Sbjct: 83  HLFQTLDSFEEYDKIDNSLKKLNAESIELDARTKEILGILNECHDELNALPMLKQVEFEM 142

Query: 119 KMILKQREKIKSNVLLEYATKLAKFTKIPPTFDKGTIGPNNFIWPAEDALRKGMLAMASL 178
           + IL+QR KI S+VLL+YATKL+KFTKIPPTFDKG+IGPNNFIWPAEDALR+GMLA+ASL
Sbjct: 143 ETILQQRSKINSSVLLDYATKLSKFTKIPPTFDKGSIGPNNFIWPAEDALRRGMLALASL 202

Query: 179 HGKELTKLPGQEDGEED 195
           H  ELTK PG  +GEE+
Sbjct: 203 HADELTKAPGAHEGEEE 219

>AGR270W Chr7 (1244264..1245148) [885 bp, 294 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOR174W (MED4)
          Length = 294

 Score =  252 bits (643), Expect = 4e-83,   Method: Compositional matrix adjust.
 Identities = 129/258 (50%), Positives = 175/258 (67%), Gaps = 10/258 (3%)

Query: 12  ISEQELDKVQLYSDLCLYEEALTKLVDSVDNFKPQLEIGKQLIEADKKLYSTLDLLPQYD 71
           + + +L  V +Y DLC YEE+L +LV SVD F+P LE  ++LIE D KLYS L  LP+YD
Sbjct: 42  VEQNKLHSVAIYEDLCQYEESLQRLVTSVDKFQPDLEAAQELIEIDSKLYSNLAQLPKYD 101

Query: 72  SVFTRLRTLDDEISKVDQQTKNILSILNECHDDLNALPLLEEVEFEKKMILKQREKIKSN 131
            + ++L+ L++E   +D++T  IL IL EC++DLN+LP++E+VEFE   + KQ++K+ S+
Sbjct: 102 LIDSQLKKLEEESKDIDERTAKILGILGECYNDLNSLPMVEQVEFEMATMKKQKDKVNSS 161

Query: 132 VLLEYATKLAKFTKIPPTFDKGTIGPNNFIWPAEDALRKGMLAMASLHGKELTKLPGQED 191
           VLLEYA KL+KFT++PPTF+K  IGPNNFIWPAEDA+R+GMLAMASL  KELT LPGQ D
Sbjct: 162 VLLEYAMKLSKFTRVPPTFNKDAIGPNNFIWPAEDAIRRGMLAMASLKSKELTSLPGQSD 221

Query: 192 GEEDGSTANEDKNI----VKDAEGAEGEIRQDDKKEDDSFVF-GANANDAEGDEDKNAGE 246
            E + ++A ++ +     V   E A G           SF F G        D D +  +
Sbjct: 222 QEAEQASAGKEADTAGPGVSTLEPANG-----GHNRRGSFEFTGIRKPPPASDADSSVVD 276

Query: 247 DEDEAMDSDLDLFNPDEF 264
           D D +MD DL+LFNPDEF
Sbjct: 277 DGDASMDLDLNLFNPDEF 294

>Skud_15.336 Chr15 (607340..608200) [861 bp, 286 aa] {ON} YOR174W
           (REAL)
          Length = 286

 Score =  251 bits (641), Expect = 9e-83,   Method: Compositional matrix adjust.
 Identities = 131/239 (54%), Positives = 175/239 (73%), Gaps = 6/239 (2%)

Query: 1   MSLVAESNSGTISEQELDKVQLYSDLCLYEEALTKLVDSVDNFKPQLEIGKQLIEADKKL 60
           +SLVAE+ S   SE +L KVQLY DLC YE  L+KLV+SVD FKP L++ + LI AD+ L
Sbjct: 21  VSLVAEAASNMNSEDKLSKVQLYEDLCRYEGVLSKLVESVDRFKPDLDVARDLISADESL 80

Query: 61  YSTLDLLPQYDSVFTRLRTLDDEISKVDQQTKNILSILNECHDDLNALPLLEEVEFEKKM 120
           ++ + LL  YD++   L+ +D +  ++D +++ IL ILNECHD+L+ LP LE+VEFEK  
Sbjct: 81  FNNVKLLADYDNIDRNLQKIDKDSEELDSKSRKILEILNECHDELSGLPTLEQVEFEKNT 140

Query: 121 ILKQREKIKSNVLLEYATKLAKFTKIPPTFDKGTIGPNNFIWPAEDALRKGMLAMASLHG 180
           IL+QR KI S  LL+YATKL+KFTKIPPTFDKGT+GPNNFIWPAEDALR+GMLAMASLH 
Sbjct: 141 ILQQRSKINSTALLDYATKLSKFTKIPPTFDKGTVGPNNFIWPAEDALRRGMLAMASLHS 200

Query: 181 KELTKLPGQEDGE-EDGSTANEDKNIVKDAEGAEGEIRQDDKKEDDSFVF-GANANDAE 237
           KELT++PG+++ E E+  TA     + +  +  E E + +D  + D+F+F G    DAE
Sbjct: 201 KELTRVPGEDEQETEEVPTA----PLSQPGQQEEQEAQNEDISDKDTFIFKGTPHKDAE 255

>ZYRO0D14190g Chr4 (1200325..1201212) [888 bp, 295 aa] {ON} similar
           to uniprot|Q12343 Saccharomyces cerevisiae YOR174W MED4
           Member of RNA Polymerase II transcriptional regulation
           mediator Stoichiometric member of mediator complex
          Length = 295

 Score =  251 bits (641), Expect = 1e-82,   Method: Compositional matrix adjust.
 Identities = 143/274 (52%), Positives = 192/274 (70%), Gaps = 16/274 (5%)

Query: 2   SLVAES-NSGTISEQELDKVQLYSDLCLYEEALTKLVDSVDNFKPQLEIGKQLIEADKKL 60
           SL++++ +SG  ++ EL KVQ+Y+DL  YEE L  LV+SVDNFKP ++I  +LIE DK L
Sbjct: 27  SLISDAMSSGNNNDDELSKVQIYADLTQYEEKLAALVESVDNFKPDVKIVHELIEVDKSL 86

Query: 61  YSTLDLLPQYDSVFTRLRTLDDEISKVDQQTKNILSILNECHDDLNALPLLEEVEFEKKM 120
           Y +LD   +YD + + L  LD E +++D++TK +L  L+EC++ LN LP+LE+VEFEK+ 
Sbjct: 87  YKSLDSFAEYDRIDSELNRLDKESNELDRKTKEVLETLSECYEMLNGLPMLEQVEFEKQS 146

Query: 121 ILKQREKIKSNVLLEYATKLAKFTKIPPTFDKGTIGPNNFIWPAEDALRKGMLAMASLHG 180
           ILKQR K+ S+VLL YATKL+KFTKIPPTFDKGTIGPNNF+WPAEDALR+GMLA+ASLH 
Sbjct: 147 ILKQRSKVNSSVLLNYATKLSKFTKIPPTFDKGTIGPNNFVWPAEDALRRGMLAIASLHS 206

Query: 181 KELTKLPGQEDGEEDGSTANEDKNIVKDAEGAEGEIRQDDKK----------EDDSFVFG 230
           KE+T++PG+ + EE  +T   +K    D  G EGE  +  ++             SFVF 
Sbjct: 207 KEMTRIPGEPEEEEADAT---EKQGSGDKNGKEGEETKTGERPASPGAHGNERRQSFVFT 263

Query: 231 ANANDAEGDEDKNAGEDEDEAMDSDLDLFNPDEF 264
            N  +    +  N  E +DEA+D DLDLF PDEF
Sbjct: 264 ENPTETANAD--NNDEPDDEALDLDLDLFKPDEF 295

>Kpol_1042.11 s1042 (21260..22138) [879 bp, 292 aa] {ON}
           (21260..22138) [879 nt, 293 aa]
          Length = 292

 Score =  247 bits (631), Expect = 3e-81,   Method: Compositional matrix adjust.
 Identities = 137/261 (52%), Positives = 178/261 (68%), Gaps = 19/261 (7%)

Query: 15  QELDKVQLYSDLCLYEEALTKLVDSVDNFKPQLEIGKQLIEADKKLYSTLDLLPQYDSVF 74
            +L KVQ+Y+D+  YE  L KLV+SVD FKP +++  QLI+ D++L+ +LD   +YD + 
Sbjct: 40  NDLSKVQIYNDISEYENTLFKLVESVDKFKPDVKLAHQLIDVDERLFKSLDSFVEYDKIS 99

Query: 75  TRLRTLDDEISKVDQQTKNILSILNECHDDLNALPLLEEVEFEKKMILKQREKIKSNVLL 134
           T+L   D E +++D +TK IL  LNECH  LN+LP+LE+VEFEK +ILKQR KI S +LL
Sbjct: 100 TKLEECDKEAAELDTKTKEILGTLNECHGLLNSLPMLEQVEFEKDIILKQRSKINSKLLL 159

Query: 135 EYATKLAKFTKIPPTFDKGTIGPNNFIWPAEDALRKGMLAMASLHGKELTKLPG--QEDG 192
           +YATKL+KFTKIPPTF+KG+IGPNNFIWPAEDALR+GMLAMASLH KELTKLP   +E  
Sbjct: 160 DYATKLSKFTKIPPTFNKGSIGPNNFIWPAEDALRRGMLAMASLHSKELTKLPNEPEEAS 219

Query: 193 EEDGSTAN-------EDKNIVKDAEG--AEGEIRQDDKKEDDSFVFGANANDAEGDEDKN 243
           E D ST         E++ I  D EG  + G I  D   +           + + +E++ 
Sbjct: 220 EPDKSTEPDKSTEPIEEEKITVDNEGDISMGSIVYDGSHK--------VKENEKAEENEK 271

Query: 244 AGEDEDEAMDSDLDLFNPDEF 264
             E E + MD DLDLFNPDEF
Sbjct: 272 GSEAEADNMDLDLDLFNPDEF 292

>KAFR0G02500 Chr7 complement(519629..520498) [870 bp, 289 aa] {ON}
           Anc_6.65 YOR174W
          Length = 289

 Score =  240 bits (613), Expect = 1e-78,   Method: Compositional matrix adjust.
 Identities = 122/259 (47%), Positives = 177/259 (68%), Gaps = 5/259 (1%)

Query: 9   SGTISEQELDKVQLYSDLCLYEEALTKLVDSVDNFKPQLEIGKQLIEADKKLYSTLDLLP 68
           S + +   + KV +YSDL  YEE L++L+ S+D +KP  +I ++LI+ D KL+++LD   
Sbjct: 33  SASGASPAITKVGIYSDLSQYEETLSRLIQSIDTYKPDKKIAQELIDIDSKLFNSLDSFV 92

Query: 69  QYDSVFTRLRTLDDEISKVDQQTKNILSILNECHDDLNALPLLEEVEFEKKMILKQREKI 128
           QYD + +RL+  + +  +   +TK IL  LNECH+ LN LP +++V FE   +L+QR+KI
Sbjct: 93  QYDRISSRLKDFEKQEKESTLKTKEILETLNECHNALNLLPTVDQVHFEMNTMLEQRKKI 152

Query: 129 KSNVLLEYATKLAKFTKIPPTFDKGTIGPNNFIWPAEDALRKGMLAMASLHGKELTKLPG 188
            S+VLL+YATKL+KFTKIPPTFDKG+IGPNNF+WPAEDALR+GMLA+A+ H  ELTK+ G
Sbjct: 153 NSSVLLDYATKLSKFTKIPPTFDKGSIGPNNFVWPAEDALRRGMLALAASHTDELTKIAG 212

Query: 189 QEDGEEDGSTANEDKNIVKDAEGAEGEI--RQDDKKEDDSFVF-GANANDAEGDEDKNAG 245
            E    D ++   D+  +K  +  EG I  ++D      S++F G +  +AE   ++   
Sbjct: 213 VEMSLSDDNSIALDE--IKSVDAGEGPIPEKKDSSSRRGSYIFAGQSGKNAEHKNNEENK 270

Query: 246 EDEDEAMDSDLDLFNPDEF 264
           E+ D A+D DLDLFNPD+F
Sbjct: 271 EEADNAVDLDLDLFNPDDF 289

>NDAI0J01320 Chr10 complement(308327..309331) [1005 bp, 334 aa] {ON}
           Anc_6.65 YOR174W
          Length = 334

 Score =  240 bits (613), Expect = 5e-78,   Method: Compositional matrix adjust.
 Identities = 134/291 (46%), Positives = 188/291 (64%), Gaps = 29/291 (9%)

Query: 1   MSLVAES-NSGTISEQELDK-------------VQLYSDLCLYEEALTKLVDSVDNFKPQ 46
           +SL+AE+  +GT S  E ++             V++Y D+  YE+AL++L+DSVD FKP 
Sbjct: 46  VSLLAEAVTNGTPSSSEFNRSYDNDSSKDVLSEVRIYDDIITYEKALSRLIDSVDKFKPN 105

Query: 47  LEIGKQLIEADKKLYSTLDLLPQYDSVFTRLRTLDDEISKVDQQTKNILSILNECHDDLN 106
           L I ++LI+ADK L+ TL+   QYD +   L+ L+ + SK+D+ T++ L  LNECHDDLN
Sbjct: 106 LNIAQELIQADKSLFDTLNSFIQYDEIDLHLKALETKASKIDELTQSTLQTLNECHDDLN 165

Query: 107 ALPLLEEVEFEKKMILKQREKIKSNVLLEYATKLAKFTKIPPTFDKGTIGPNNFIWPAED 166
            LP L ++EFE   IL QR KI S +LL+YATKL+KFTKIPPTFDKG+IGPNNFIWPAED
Sbjct: 166 KLPTLPQIEFELNTILNQRTKINSTILLDYATKLSKFTKIPPTFDKGSIGPNNFIWPAED 225

Query: 167 ALRKGMLAMASLHGKELTKLPGQ-EDGEEDGSTANEDKNIVKDAEGAEGEIRQDDKKEDD 225
           +LR+GMLAMASL   +LT +PGQ +   ++ +   E +   +  +  + +  +  ++E  
Sbjct: 226 SLRRGMLAMASLKADQLTYIPGQAQSMSKEKALPTEVQETQEQTQTQQQDQEEQPRRE-- 283

Query: 226 SFVF-GAN-----------ANDAEGDEDKNAGEDEDEAMDSDLDLFNPDEF 264
           SFVF G N            +     E+K+    +++AMD DLDLFNPDEF
Sbjct: 284 SFVFSGKNKEEEEETTHTHEDSKRKQEEKDHESGDEDAMDIDLDLFNPDEF 334

>KNAG0M01020 Chr13 complement(180570..181409) [840 bp, 279 aa] {ON}
           Anc_6.65 YOR174W
          Length = 279

 Score =  237 bits (605), Expect = 2e-77,   Method: Compositional matrix adjust.
 Identities = 132/265 (49%), Positives = 186/265 (70%), Gaps = 10/265 (3%)

Query: 1   MSLVAESNSGTISEQELDKVQLYSDLCLYEEALTKLVDSVDNFKPQLEIGKQLIEADKKL 60
           +SL+ E        ++L KV++YS +  YE+ L  LV+SVD++KP + + ++L++ADK+L
Sbjct: 24  VSLLQEGTDAAALAEDLKKVRIYSGIVEYEDTLAALVESVDSYKPDMAVAQRLVDADKEL 83

Query: 61  YSTLDLLPQYDSVFTRLRTLDDEISKVDQQTKNILSILNECHDDLNALPLLEEVEFEKKM 120
           +++LD   +YD + TRL  L  + + +D +T++IL  LNECHD+LN LP LE+V+FE   
Sbjct: 84  FASLDKFKEYDEISTRLGELKGKSTALDTKTRDILEKLNECHDELNKLPYLEQVQFEMDT 143

Query: 121 ILKQREKIKSNVLLEYATKLAKFTKIPPTFDKGTIGPNNFIWPAEDALRKGMLAMASLHG 180
           IL+QREKI S+ LL+YATKL+KFT+IPPTFDKG+IGPNNFIWPAEDALRKGMLA+A+LH 
Sbjct: 144 ILEQREKINSSELLDYATKLSKFTRIPPTFDKGSIGPNNFIWPAEDALRKGMLAIAALHS 203

Query: 181 KELTKLPGQEDGEEDGSTANEDKNIVKDAEGAEGEIRQDDKKEDDSFVFG-ANANDAEGD 239
           +ELT++PGQ+D  ED     E  ++ + A   E        +   SFVFG  +  D +  
Sbjct: 204 RELTRIPGQDDA-EDKKKQTEKPDVPEPAPVTE--------ERRSSFVFGDTSTADDQKS 254

Query: 240 EDKNAGEDEDEAMDSDLDLFNPDEF 264
              ++  D+D+AMD DLDLFNPDEF
Sbjct: 255 SSAHSDHDDDDAMDLDLDLFNPDEF 279

>KLTH0G15444g Chr7 complement(1353833..1354624) [792 bp, 263 aa]
           {ON} some similarities with uniprot|Q12343 Saccharomyces
           cerevisiae YOR174W MED4 Member of RNA Polymerase II
           transcriptional regulation mediator Stoichiometric
           member of mediator complex
          Length = 263

 Score =  233 bits (594), Expect = 4e-76,   Method: Compositional matrix adjust.
 Identities = 119/232 (51%), Positives = 160/232 (68%), Gaps = 11/232 (4%)

Query: 14  EQELDKVQLYSDLCLYEEALTKLVDSVDNFKPQLEIGKQLIEADKKLYSTLDLLPQYDSV 73
           E  L K+Q+Y+D+C +E+ L KLV SVD F P LE+ + LIEADK+LY +L+ LP+YD +
Sbjct: 19  ENPLSKLQVYNDICEFEDTLGKLVASVDRFNPDLELARALIEADKQLYKSLECLPKYDEI 78

Query: 74  FTRLRTLDDEISKVDQQTKNILSILNECHDDLNALPLLEEVEFEKKMILKQREKIKSNVL 133
            TR +TLD+E    D++T  IL  L EC  DLNALP+LE+VEFE++ +LKQREK+ ++VL
Sbjct: 79  DTRAKTLDEEHRDTDEKTIRILETLTECGSDLNALPMLEQVEFERETMLKQREKVFTDVL 138

Query: 134 LEYATKLAKFTKIPPTFDKGTIGPNNFIWPAEDALRKGMLAMASLHGKELTKLPGQEDGE 193
           L+YA KLAKFT +PPTFDKGT+GPNNF+WPAEDA+R+GMLA+ASL   E     G    E
Sbjct: 139 LDYAMKLAKFTHVPPTFDKGTVGPNNFVWPAEDAMRRGMLAIASLRASE-----GANAQE 193

Query: 194 EDGSTANEDKNIVKDAEGAEGEIRQDDKKED-----DSFVF-GANANDAEGD 239
           +  S+  +      + E A+ +IR  D KE+      SF F G+ A D E +
Sbjct: 194 QQASSEQKTSEKSSENEEAQTDIRSPDTKEEPVARRPSFGFDGSGAKDHESE 245

>TBLA0G00550 Chr7 (115655..116611) [957 bp, 318 aa] {ON} Anc_6.65
           YOR174W
          Length = 318

 Score =  234 bits (596), Expect = 1e-75,   Method: Compositional matrix adjust.
 Identities = 120/220 (54%), Positives = 155/220 (70%), Gaps = 4/220 (1%)

Query: 16  ELDKVQLYSDLCLYEEALTKLVDSVDNFKPQLEIGKQLIEADKKLYSTLDLLPQYDSVFT 75
           EL K+Q Y+DL  YEE L+KL  SVD +KP L+    LI+ D+KLYSTLD   +YD + T
Sbjct: 36  ELSKIQTYNDLIQYEETLSKLSSSVDKYKPDLQYAYDLIDIDRKLYSTLDSFVKYDEIST 95

Query: 76  RLRTLDDEISKVDQQTKNILSILNECHDDLNALPLLEEVEFEKKMILKQREKIKSNVLLE 135
           +L+ L+ +   +D++TK++L  LN+CH+ LN LP+LE+VEFEK  +LKQREKI S VLL+
Sbjct: 96  KLKKLEIDTKALDEKTKSVLDSLNDCHELLNTLPMLEQVEFEKNTMLKQREKINSKVLLD 155

Query: 136 YATKLAKFTKIPPTFDKGTIGPNNFIWPAEDALRKGMLAMASLHGKELTKLPGQ---EDG 192
           YATKLAKFTKIPPTF+K T+GPNNFIWPAEDALR+GMLA+AS H +ELT LPG    E+ 
Sbjct: 156 YATKLAKFTKIPPTFNKNTLGPNNFIWPAEDALRRGMLAVASAHTEELTALPGSVGDEEN 215

Query: 193 EEDGSTANEDKNIVKDAE-GAEGEIRQDDKKEDDSFVFGA 231
            +D S  N D    KD     +  +   D+    SF FG+
Sbjct: 216 SKDISQLNADDVTNKDNHMDMDITVEGQDRFRRGSFTFGS 255

>SAKL0A08426g Chr1 complement(746101..747000) [900 bp, 299 aa] {ON}
           similar to gnl|GLV|KLLA0F20185g Kluyveromyces lactis
           KLLA0F20185g and weakly similar to YOR174W
           uniprot|Q12343 Saccharomyces cerevisiae YOR174W MED4
           Member of RNA Polymerase II transcriptional regulation
           mediator Stoichiometric member of mediator complex
          Length = 299

 Score =  228 bits (581), Expect = 1e-73,   Method: Compositional matrix adjust.
 Identities = 104/173 (60%), Positives = 135/173 (78%)

Query: 17  LDKVQLYSDLCLYEEALTKLVDSVDNFKPQLEIGKQLIEADKKLYSTLDLLPQYDSVFTR 76
           L +V++Y+D+C YEE L KLV SVD FKP L++ ++LIE DKKL+  L+  P+YD +  R
Sbjct: 44  LSRVEVYADICEYEETLGKLVSSVDKFKPDLKVAQELIETDKKLFKALEEFPKYDKIDGR 103

Query: 77  LRTLDDEISKVDQQTKNILSILNECHDDLNALPLLEEVEFEKKMILKQREKIKSNVLLEY 136
           L  L+ +  +VD++T  IL +LN CH  LN+LP LE+V  E+  +LKQREKI S VLL+Y
Sbjct: 104 LNDLEKQSQEVDKKTSKILEVLNGCHAQLNSLPALEQVLLERDTMLKQREKIYSGVLLDY 163

Query: 137 ATKLAKFTKIPPTFDKGTIGPNNFIWPAEDALRKGMLAMASLHGKELTKLPGQ 189
           A KLAKFT++PPTFDKG +GPNNFIWPAEDA+R+GMLAMASL  KELT++PGQ
Sbjct: 164 AMKLAKFTRVPPTFDKGMVGPNNFIWPAEDAMRRGMLAMASLKSKELTRIPGQ 216

>Ecym_3124 Chr3 complement(232769..233593) [825 bp, 274 aa] {ON}
           similar to Ashbya gossypii AGR270W
          Length = 274

 Score =  226 bits (575), Expect = 5e-73,   Method: Compositional matrix adjust.
 Identities = 131/257 (50%), Positives = 179/257 (69%), Gaps = 11/257 (4%)

Query: 16  ELDKVQLYSDLCLYEEALTKLVDSVDNFKPQLEIGKQLIEADKKLYSTLDLLPQYDSVFT 75
            + +V LY DLC +EE L KLV SVD F P L+  + LI +D KLYSTL+ LP YDS+  
Sbjct: 21  HVQQVTLYKDLCQFEEDLQKLVVSVDKFSPDLQAAQDLINSDLKLYSTLEQLPLYDSIDI 80

Query: 76  RLRTLDDEISKVDQQTKNILSILNECHDDLNALPLLEEVEFEKKMILKQREKIKSNVLLE 135
           +L+ LD+E  ++D++T  ILSIL++C+++LN LP++E+VEFE KM+ KQ+EKIKS VLLE
Sbjct: 81  QLKQLDNESQEIDERTGKILSILDKCYNNLNKLPMVEQVEFEMKMMKKQKEKIKSGVLLE 140

Query: 136 YATKLAKFTKIPPTFDKGTIGPNNFIWPAEDALRKGMLAMASLHGKELTKLPGQEDGEED 195
           YA KLAKFT++PPTF+K  IGPNNFIWPAEDA+R+GMLAMASL  +ELT++P + + EE 
Sbjct: 141 YAMKLAKFTRVPPTFNKDAIGPNNFIWPAEDAIRRGMLAMASLKSEELTRIPVELNSEEP 200

Query: 196 ------GSTANEDKNIVKDAEGAEGEIRQDDKKEDDSFVFGANANDAEGDE--DKNAGED 247
                 G +  ED+  V     ++    + D K  +SF F   A + +  +  +  A E+
Sbjct: 201 QEPPQKGQSQEEDE--VTPTHSSDTPSSKPDSK-SESFEFTGKAKNQQSTQYSETGAHEE 257

Query: 248 EDEAMDSDLDLFNPDEF 264
            D ++D DLDLFNPDEF
Sbjct: 258 ADGSIDLDLDLFNPDEF 274

>TPHA0F02590 Chr6 (565725..566645) [921 bp, 306 aa] {ON} Anc_6.65
           YOR174W
          Length = 306

 Score =  226 bits (577), Expect = 6e-73,   Method: Compositional matrix adjust.
 Identities = 122/263 (46%), Positives = 177/263 (67%), Gaps = 8/263 (3%)

Query: 7   SNSGTISEQELDKVQLYSDLCLYEEALTKLVDSVDNFKPQLEIGKQLIEADKKLYSTLDL 66
           SN  T +   L  V +Y+D+  YE+ L KLV S+DNF+P +E+ K LIE DK+LY  L  
Sbjct: 47  SNMNTAAVDSLANVAIYNDIKNYEDTLIKLVSSIDNFRPDVEVAKTLIEVDKRLYKNLGS 106

Query: 67  LPQYDSVFTRLRTLDDEISKVDQQTKNILSILNECHDDLNALPLLEEVEFEKKMILKQRE 126
             +YD + T++  + D+  K+D QTK+IL ILN+  + LN+LP+LEE+ FE+ ++ ++++
Sbjct: 107 FKEYDEIDTKISKIKDDSEKLDLQTKHILDILNDSRNMLNSLPMLEEIYFERDVMHEKQK 166

Query: 127 KIKSNVLLEYATKLAKFTKIPPTFDKGTIGPNNFIWPAEDALRKGMLAMASLHGKELTKL 186
           KI S +LL+YATK++KFTKIPPTF+KG+IGPNNFIWPAEDALR+GMLA+AS+H  ELTKL
Sbjct: 167 KINSKILLDYATKISKFTKIPPTFNKGSIGPNNFIWPAEDALRRGMLAVASIHRSELTKL 226

Query: 187 PGQEDGEEDGSTANEDKNIVKDAEGA-EGEIRQDDKKEDDSFVFGANANDAEGDEDKNAG 245
           P     + D     + +      E   E ++ Q+   +++SFVF     + E  E+ N  
Sbjct: 227 PNDTSYDSDKELEEQQEQEQHGTENTREADVEQE---QEESFVFDGKHKNEEKTENSNEA 283

Query: 246 ----EDEDEAMDSDLDLFNPDEF 264
               ++E++ MD DL+LFNPDEF
Sbjct: 284 NSNDDNENDNMDLDLELFNPDEF 306

>Kwal_56.23242 s56 (459387..460157) [771 bp, 256 aa] {ON} YOR174W
           (MED4) - Stoichiometric member of mediator complex
           [contig 183] FULL
          Length = 256

 Score =  217 bits (553), Expect = 6e-70,   Method: Compositional matrix adjust.
 Identities = 102/177 (57%), Positives = 131/177 (74%)

Query: 11  TISEQELDKVQLYSDLCLYEEALTKLVDSVDNFKPQLEIGKQLIEADKKLYSTLDLLPQY 70
           T +E  L K Q+YSD+C +EE L KLV SVD F P L+I + LIE DK+L  TL+ LP+Y
Sbjct: 16  TNAESRLSKAQIYSDICEFEETLGKLVASVDKFNPDLKIAESLIEVDKRLSKTLESLPRY 75

Query: 71  DSVFTRLRTLDDEISKVDQQTKNILSILNECHDDLNALPLLEEVEFEKKMILKQREKIKS 130
           D +  R + LD +  + D++   IL  L EC  DLNALP+LE+VEFE++ +LKQREK+ +
Sbjct: 76  DEIDLRAKELDQKHLETDERMVRILETLTECSTDLNALPMLEQVEFERQTMLKQREKVFT 135

Query: 131 NVLLEYATKLAKFTKIPPTFDKGTIGPNNFIWPAEDALRKGMLAMASLHGKELTKLP 187
           NVLL+YA KLAKFT +PPTFDKG +GPNNF+WPAEDA+R+GMLA+ASL   E  K P
Sbjct: 136 NVLLDYAMKLAKFTHVPPTFDKGAVGPNNFVWPAEDAMRRGMLAIASLQASEDAKKP 192

>KLLA0F20185g Chr6 complement(1882094..1882951) [858 bp, 285 aa]
           {ON} similar to uniprot|Q12343 Saccharomyces cerevisiae
           YOR174W MED4 Member of RNA Polymerase II transcriptional
           regulation mediator Stoichiometric member of mediator
           complex
          Length = 285

 Score =  204 bits (518), Expect = 3e-64,   Method: Compositional matrix adjust.
 Identities = 126/267 (47%), Positives = 162/267 (60%), Gaps = 28/267 (10%)

Query: 15  QELDKVQLYSDLCLYEEALTKLVDSVDNFKPQLEIGKQLIEADKKLYSTLDLLPQYDSVF 74
           +EL  V +Y DL  YEE + +L  SVD FKP L +  ++IE DKKLY TL+   +Y  + 
Sbjct: 30  EELQSVGIYQDLERYEETIQQLSKSVDTFKPDLSLIDKVIECDKKLYETLEEFDEYYKIE 89

Query: 75  TRLRTLDDEISKVDQQTKNILSILNECHDDLNALPLLEEVEFEKKMILKQREKIKSNVLL 134
             L  LD E   +D +T+ IL  LN C++ LN LP+LE+VEFE+K++LKQREKI S V+L
Sbjct: 90  EELSRLDKEQKNIDNKTREILETLNTCYNSLNELPMLEQVEFEQKVMLKQREKIHSKVVL 149

Query: 135 EYATKLAKFTKIPPTFDKGTIGPNNFIWPAEDALRKGMLAMASLHGKEL----------- 183
           +YA KLAKFT+ PPTFDK  IGPNNFIWPAED+LRKGMLAMASL  KEL           
Sbjct: 150 DYAMKLAKFTRFPPTFDKSMIGPNNFIWPAEDSLRKGMLAMASLKKKELLLDALDEDNVN 209

Query: 184 -----TKLPGQEDGEEDGSTAN-EDKNIVKDAEGAEGEIRQDDKKEDDSFVFGANANDAE 237
                +K+    +  ED       +K  V+DA         +D +   SF F AN  +  
Sbjct: 210 NDNNTSKIDEMRNTNEDSVDDRFNNKEQVQDA--------TEDTERRGSFEFTANGKE-- 259

Query: 238 GDEDKNAGEDEDEAMDSDLDLFNPDEF 264
            D +  + E+ D  +D DLDLFNPDEF
Sbjct: 260 -DSETKSEENPDLELDLDLDLFNPDEF 285

>TDEL0G04060 Chr7 complement(741796..742458) [663 bp, 220 aa] {ON}
           Anc_6.65 YOR174W
          Length = 220

 Score =  181 bits (460), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 93/193 (48%), Positives = 129/193 (66%), Gaps = 8/193 (4%)

Query: 21  QLYSDLCLYEEALTKLVDSVDNFKPQLEIGKQLIEADKKLYSTLDLLPQYDSVFTRLRTL 80
           Q+Y DL  YEEAL +LV+SVD F+P L   ++L+EAD+ L  +LD    YD V   L+ L
Sbjct: 3   QVYGDLTRYEEALGRLVESVDQFRPDLSCARELVEADRALGKSLDKFGLYDEVDKELQRL 62

Query: 81  DDEISKVDQQTKNILSILNECHDDLNALPLLEEVEFEKKMILKQREKIKSNVLLEYATKL 140
           D E  ++++ T   L  L+EC+  L+ALP+LE+V+FE++ +L+QR ++ S VLLEYATKL
Sbjct: 63  DRESERLNRHTARTLETLDECYRALSALPMLEQVKFEQRKVLEQRGRVNSAVLLEYATKL 122

Query: 141 AKFTKIPPTFDKGTIGPNNFIWPAEDALRKGMLAMASLHGKELTKLPGQEDGEEDGSTAN 200
           +KFTK P       +GPNNF+WPAEDALR+G LA+A+LH +E+T       GE  GS   
Sbjct: 123 SKFTKAPAGV---AVGPNNFVWPAEDALRRGQLAVAALHSEEITL---GSTGERSGSV-- 174

Query: 201 EDKNIVKDAEGAE 213
           E    V+ +E AE
Sbjct: 175 ESSEPVQPSESAE 187

>Ecym_5175 Chr5 (360152..364384) [4233 bp, 1410 aa] {ON} Similar to
           Saccharomyces cerevisiae YGR109W-B Retrotransposon TYA
           Gag and TYB Pol genes; transcribed/translated as one
           unit; polyprotein is processed to make a
           nucleocapsid-like protein (Gag), reverse transcriptase
           (RT), protease (PR), and integrase (IN); similar to
           retroviral genes [Saccharomyces cerevisiae S288c]
          Length = 1410

 Score = 32.7 bits (73), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 21/59 (35%), Positives = 29/59 (49%), Gaps = 2/59 (3%)

Query: 180 GKELTKLPGQEDGEEDGSTANEDKNIVKDAEGAEGEIRQDDKKEDDSFVFGANANDAEG 238
           GK    LPG+E G   G  +N+  ++V  A G EG I +    +  S V   + ND EG
Sbjct: 228 GKSNKALPGREQG--GGMASNKGASLVCYACGEEGHIARRCPHQRQSLVQLKDRNDIEG 284

>Kwal_33.13389 s33 complement(197441..199525) [2085 bp, 694 aa]
          {ON} YNL272C (SEC2) - GDP/GTP exchange factor for Sec4p
          [contig 118] FULL
          Length = 694

 Score = 32.3 bits (72), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 20/57 (35%), Positives = 32/57 (56%), Gaps = 3/57 (5%)

Query: 34 TKLVDSVDNFKPQLEIGKQLIEADKKLYSTLDLLPQYDSVFTRLRTLDDEISKVDQQ 90
          T+L++S+D    Q  + +QL++A K + S  D L  Y+SV  RL   + E+  V  Q
Sbjct: 19 TQLIESIDK---QSHLEEQLLQARKVISSQRDALKSYESVGKRLEETEAELESVRAQ 72

>TDEL0G04880 Chr7 (901871..903211) [1341 bp, 446 aa] {ON} 
          Length = 446

 Score = 31.2 bits (69), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 21/65 (32%), Positives = 36/65 (55%), Gaps = 3/65 (4%)

Query: 167 ALRKGMLAMASLHGKELTKLPGQEDGEEDGSTANEDKNIVKDAE--GAEGEIRQDDKKED 224
           A  KG+L+  S+H       PG++D E D S    D+ + +D +  GA+G I++  ++  
Sbjct: 296 AHEKGLLSDTSIHAAIRGPYPGKKDVEHDIS-CGFDRILARDIDKIGADGIIKKIKQRVG 354

Query: 225 DSFVF 229
           DS V+
Sbjct: 355 DSPVY 359

>Kpol_489.16 s489 complement(46657..47814) [1158 bp, 385 aa] {ON}
           complement(46657..47814) [1158 nt, 386 aa]
          Length = 385

 Score = 30.8 bits (68), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 17/51 (33%), Positives = 29/51 (56%), Gaps = 8/51 (15%)

Query: 49  IGKQLIEADKKLYSTLDLLPQYDSVFTR-----LRTLDDEISKVDQQTKNI 94
           +G QL EAD +LY+T   + ++D V+ +     LRT+ D    +D   +N+
Sbjct: 293 VGSQLTEADIRLYTT---MVRFDPVYVQHFKCNLRTIRDGYPFIDLWLRNL 340

>ZYRO0E01078g Chr5 (73042..75048) [2007 bp, 668 aa] {ON} similar to
           uniprot|Q759X8 Ashbya gossypii ADR145C ADR145Cp and
           weakly similar to YKL079W uniprot|P32364 Saccharomyces
           cerevisiae YKL079W SMY1 not believed to act as a kinesin
           colocalizes with Myo2p kinesin heavy chain homolog
          Length = 668

 Score = 30.8 bits (68), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 30/94 (31%), Positives = 52/94 (55%), Gaps = 13/94 (13%)

Query: 32  ALTKLVDSVDNFKPQLEIG---KQLIEADKKLYSTLDLLPQYDSVFTRLRTLDDEISKVD 88
           +L   + S+ NF  Q ++G   K L++   K  ST +     DS  TR++ L+DE+SK+ 
Sbjct: 347 SLGSRLRSIHNFPVQNKMGLNSKALLDLRLKNMSTRE-----DSYLTRIKYLEDEVSKLG 401

Query: 89  ---QQTKNILSILNECHDDLNALPLLEEVEFEKK 119
              QQ KN +S  N+   + N + L++++E  +K
Sbjct: 402 GTIQQNKNQVST-NKSLTEKN-MKLMDQLELYRK 433

>Smik_10.78 Chr10 complement(124678..126777) [2100 bp, 699 aa] {ON}
           YJL156C (REAL)
          Length = 699

 Score = 30.8 bits (68), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 16/56 (28%), Positives = 34/56 (60%), Gaps = 2/56 (3%)

Query: 93  NILSILNECHDDLNAL--PLLEEVEFEKKMILKQREKIKSNVLLEYATKLAKFTKI 146
           N++ I+++ H D+ ++   ++E +E+ K+ +   RE+I   V +E ++ L K  KI
Sbjct: 183 NLVDIMDDIHQDVISISKAVIEAIEYFKEFLPTIRERIPYRVNVEKSSSLRKINKI 238

>TPHA0J02660 Chr10 (588337..591243) [2907 bp, 968 aa] {ON} Anc_5.453
           YDR379W
          Length = 968

 Score = 30.8 bits (68), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 26/69 (37%), Positives = 40/69 (57%), Gaps = 10/69 (14%)

Query: 70  YDSVFTRLRTLDDEISKVD-QQTKNILSILNECHDDLNALPL-LEEVEFEKKMI---LKQ 124
           Y +V T     D EISK D  QTK+I S +NE  + L+ L L +EE+E +K  +   ++ 
Sbjct: 566 YSAVIT-----DFEISKYDTSQTKSIQSKINEAEERLSMLQLNIEELELKKSQLQKDIRT 620

Query: 125 REKIKSNVL 133
            E+ KS ++
Sbjct: 621 LERTKSTMM 629

>NCAS0C03370 Chr3 (660234..662600) [2367 bp, 788 aa] {ON} Anc_8.305
           YLR114C
          Length = 788

 Score = 30.0 bits (66), Expect = 7.0,   Method: Compositional matrix adjust.
 Identities = 25/87 (28%), Positives = 37/87 (42%), Gaps = 11/87 (12%)

Query: 163 PAEDALRKGMLAMASL---HGKELTKLPGQEDGEEDGSTANEDKNIVKDAEGAEGEIRQD 219
           PA+      +L +      H +E+T++   +D E    TA  DK  V   E A  + + D
Sbjct: 584 PAKKVFENALLGLGFHLPNHRQEVTEIAEVKDNESTPDTAERDKESVVLVESASNDDKVD 643

Query: 220 DKKEDDSFVFGANANDAEGDEDKNAGE 246
           +  E +S        DAE   D N GE
Sbjct: 644 ESIEQES--------DAEPTPDNNVGE 662

>KNAG0C04200 Chr3 complement(820365..823352) [2988 bp, 995 aa] {ON}
           Anc_7.272 YIL073C
          Length = 995

 Score = 30.0 bits (66), Expect = 7.3,   Method: Compositional matrix adjust.
 Identities = 16/37 (43%), Positives = 23/37 (62%), Gaps = 3/37 (8%)

Query: 30  EEALTKLVDSVD---NFKPQLEIGKQLIEADKKLYST 63
           EE L K++ SVD   NF   LE  K+L+E + K+ +T
Sbjct: 358 EEVLMKMISSVDIAPNFAQVLECAKELVEVNIKMGAT 394

>NDAI0D04850 Chr4 complement(1147963..1152597) [4635 bp, 1544 aa]
           {ON} Anc_1.76 YCR042C
          Length = 1544

 Score = 30.0 bits (66), Expect = 7.6,   Method: Compositional matrix adjust.
 Identities = 24/68 (35%), Positives = 34/68 (50%), Gaps = 5/68 (7%)

Query: 97  ILNECHDDLN-ALPLLEEV--EFEKKMILKQREKIKSNVLLEYATKLAKFTKIPPTFDKG 153
            L E   DLN   P+LE      + ++I+K    IK  + L+ A  LA FT I P+F  G
Sbjct: 127 FLREKFADLNEPSPILETTDDRTKSQLIIKVPSSIK--ITLQDANLLANFTPITPSFKGG 184

Query: 154 TIGPNNFI 161
           T   N ++
Sbjct: 185 TPSNNTYM 192

>Suva_6.235 Chr6 (421197..423296) [2100 bp, 699 aa] {ON} YJL156C
           (REAL)
          Length = 699

 Score = 29.6 bits (65), Expect = 8.4,   Method: Compositional matrix adjust.
 Identities = 17/73 (23%), Positives = 41/73 (56%), Gaps = 2/73 (2%)

Query: 76  RLRTLDDEISKVDQQTKNILSILNECHDDLNAL--PLLEEVEFEKKMILKQREKIKSNVL 133
           R  TLD+    + +   N++ I+++ H D+ ++   ++E +E+ K+ +   +++I   + 
Sbjct: 166 RAITLDNVHKSLTELEDNLVDIMDDIHQDVISISRAVIEAIEYFKEFLPTIKDRIPYRIS 225

Query: 134 LEYATKLAKFTKI 146
           +E ++ L K  KI
Sbjct: 226 VEKSSSLRKINKI 238

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.310    0.132    0.360 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 31,106,492
Number of extensions: 1583706
Number of successful extensions: 18975
Number of sequences better than 10.0: 1017
Number of HSP's gapped: 16816
Number of HSP's successfully gapped: 1437
Length of query: 264
Length of database: 53,481,399
Length adjustment: 107
Effective length of query: 157
Effective length of database: 41,212,137
Effective search space: 6470305509
Effective search space used: 6470305509
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.7 bits)
S2: 65 (29.6 bits)