Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
CAGL0L04070g2.151ON95954911e-65
ZYRO0G06490g2.151ON92922638e-31
KNAG0I021302.151ON92722638e-31
NDAI0F028202.151ON128802668e-31
Skud_14.2102.151ON103662533e-29
YNL122C2.151ON115662511e-28
Suva_14.2182.151ON112942474e-28
Smik_14.2062.151ON113662422e-27
KAFR0J020902.151ON92672384e-27
TDEL0B051302.151ON93712377e-27
NCAS0G024702.151ON88952342e-26
KLLA0F24068g2.151ON95802272e-25
SAKL0E10978g2.151ON95672264e-25
Ecym_82022.151ON98672247e-25
KLTH0B05214g2.151ON91672221e-24
ABR133W2.151ON96872203e-24
Kwal_33.147622.151ON91902133e-23
TPHA0F018802.151ON99712118e-23
Kpol_505.212.151ON85692021e-21
TBLA0B012302.151ON97671733e-17
YMR031C (EIS1)2.590ON84357622.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0L04070g
         (95 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0L04070g Chr12 (478686..478973) [288 bp, 95 aa] {ON} highly ...   193   1e-65
ZYRO0G06490g Chr7 complement(515132..515410) [279 bp, 92 aa] {ON...   105   8e-31
KNAG0I02130 Chr9 (416674..416952) [279 bp, 92 aa] {ON} Anc_2.151...   105   8e-31
NDAI0F02820 Chr6 (693148..693534) [387 bp, 128 aa] {ON} Anc_2.15...   107   8e-31
Skud_14.210 Chr14 complement(388110..388406,388410..388421) [309...   102   3e-29
YNL122C Chr14 complement(398023..398370) [348 bp, 115 aa] {ON} P...   101   1e-28
Suva_14.218 Chr14 complement(394669..394965,394969..394983,39499...   100   4e-28
Smik_14.206 Chr14 complement(377692..377997,378001..378009,37801...    98   2e-27
KAFR0J02090 Chr10 (400769..401047) [279 bp, 92 aa] {ON} Anc_2.15...    96   4e-27
TDEL0B05130 Chr2 complement(904074..904355) [282 bp, 93 aa] {ON}...    96   7e-27
NCAS0G02470 Chr7 complement(439576..439842) [267 bp, 88 aa] {ON}...    95   2e-26
KLLA0F24068g Chr6 (2242939..2243226) [288 bp, 95 aa] {ON} simila...    92   2e-25
SAKL0E10978g Chr5 (919541..919828) [288 bp, 95 aa] {ON} some sim...    92   4e-25
Ecym_8202 Chr8 complement(418239..418535) [297 bp, 98 aa] {ON} s...    91   7e-25
KLTH0B05214g Chr2 (430231..430506) [276 bp, 91 aa] {ON} some sim...    90   1e-24
ABR133W Chr2 (644796..645086) [291 bp, 96 aa] {ON} Syntenic homo...    89   3e-24
Kwal_33.14762 s33 complement(808878..809153) [276 bp, 91 aa] {ON...    87   3e-23
TPHA0F01880 Chr6 (428432..428731) [300 bp, 99 aa] {ON} Anc_2.151...    86   8e-23
Kpol_505.21 s505 (56756..57013) [258 bp, 85 aa] {ON} (56756..570...    82   1e-21
TBLA0B01230 Chr2 complement(262437..262730) [294 bp, 97 aa] {ON}...    71   3e-17
YMR031C Chr13 complement(332212..334743) [2532 bp, 843 aa] {ON} ...    28   2.6  

>CAGL0L04070g Chr12 (478686..478973) [288 bp, 95 aa] {ON} highly
          similar to uniprot|P53921 Saccharomyces cerevisiae
          YNL122c
          Length = 95

 Score =  193 bits (491), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 95/95 (100%), Positives = 95/95 (100%)

Query: 1  MTLFNNAITACTSRLLSMKTMGVSSFGMVFCRTLMKTHRGALKRWRQTSTGFKRGIAGRK 60
          MTLFNNAITACTSRLLSMKTMGVSSFGMVFCRTLMKTHRGALKRWRQTSTGFKRGIAGRK
Sbjct: 1  MTLFNNAITACTSRLLSMKTMGVSSFGMVFCRTLMKTHRGALKRWRQTSTGFKRGIAGRK 60

Query: 61 HGNIGWSHRSLKSLTGRTDAHPTQMKRLRRLMPYK 95
          HGNIGWSHRSLKSLTGRTDAHPTQMKRLRRLMPYK
Sbjct: 61 HGNIGWSHRSLKSLTGRTDAHPTQMKRLRRLMPYK 95

>ZYRO0G06490g Chr7 complement(515132..515410) [279 bp, 92 aa] {ON}
          similar to uniprot|Q75D91 Ashbya gossypii ABR133W 50S
          ribosomal protein L35 and some similarites with YNL122C
          uniprot|P53921 Saccharomyces cerevisiae YNL122C
          Hypothetical ORF
          Length = 92

 Score =  105 bits (263), Expect = 8e-31,   Method: Compositional matrix adjust.
 Identities = 50/92 (54%), Positives = 65/92 (70%)

Query: 3  LFNNAITACTSRLLSMKTMGVSSFGMVFCRTLMKTHRGALKRWRQTSTGFKRGIAGRKHG 62
          +F N+I    SR       G +S  +VF R LMKTH+G  KRW++T+ GFKRG AGR HG
Sbjct: 1  MFFNSIVGLGSRSAFASFGGFNSSSLVFTRNLMKTHKGTAKRWKKTADGFKRGKAGRNHG 60

Query: 63 NIGWSHRSLKSLTGRTDAHPTQMKRLRRLMPY 94
          N+GWS RSLK L+G+T AH + ++RLRRL+PY
Sbjct: 61 NVGWSRRSLKVLSGKTPAHESHIQRLRRLLPY 92

>KNAG0I02130 Chr9 (416674..416952) [279 bp, 92 aa] {ON} Anc_2.151
          YNL122C
          Length = 92

 Score =  105 bits (263), Expect = 8e-31,   Method: Compositional matrix adjust.
 Identities = 46/72 (63%), Positives = 60/72 (83%)

Query: 23 VSSFGMVFCRTLMKTHRGALKRWRQTSTGFKRGIAGRKHGNIGWSHRSLKSLTGRTDAHP 82
          + S  M+  R+LMKTH+GA KRWR+ + GFKRGI+GRKHGN GWS R LK+LTGRT+AH 
Sbjct: 20 IPSASMIVTRSLMKTHKGAAKRWRKNANGFKRGISGRKHGNCGWSQRGLKALTGRTEAHQ 79

Query: 83 TQMKRLRRLMPY 94
          +Q+KRL++L+PY
Sbjct: 80 SQIKRLKKLLPY 91

>NDAI0F02820 Chr6 (693148..693534) [387 bp, 128 aa] {ON} Anc_2.151
           YNL122C
          Length = 128

 Score =  107 bits (266), Expect = 8e-31,   Method: Compositional matrix adjust.
 Identities = 49/80 (61%), Positives = 60/80 (75%)

Query: 15  LLSMKTMGVSSFGMVFCRTLMKTHRGALKRWRQTSTGFKRGIAGRKHGNIGWSHRSLKSL 74
           LLSM   G S   +V  R LMKTH+GA KRWR+++ GFKRGIAGR HGN+GWSHR L  L
Sbjct: 48  LLSMGLKGQSFNSLVITRNLMKTHKGAAKRWRKSAQGFKRGIAGRNHGNVGWSHRYLNKL 107

Query: 75  TGRTDAHPTQMKRLRRLMPY 94
           TGR +A PT +K L+R++PY
Sbjct: 108 TGRKEADPTHVKHLKRMLPY 127

>Skud_14.210 Chr14 complement(388110..388406,388410..388421) [309
           bp, 103 aa] {ON} YNL122C (REAL)
          Length = 103

 Score =  102 bits (253), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 47/66 (71%), Positives = 54/66 (81%)

Query: 29  VFCRTLMKTHRGALKRWRQTSTGFKRGIAGRKHGNIGWSHRSLKSLTGRTDAHPTQMKRL 88
           +  RTLMKTH+G  KRWR+T   FKRGIAGRKHGNIGWSHRSLK+LTGR  AHP  +K L
Sbjct: 37  ITIRTLMKTHKGTAKRWRRTGNTFKRGIAGRKHGNIGWSHRSLKALTGRKTAHPAYLKHL 96

Query: 89  RRLMPY 94
           +RL+PY
Sbjct: 97  KRLLPY 102

>YNL122C Chr14 complement(398023..398370) [348 bp, 115 aa] {ON}
           Putative protein of unknown function; green fluorescent
           protein (GFP)-fusion protein localizes to mitochondria;
           YNL122C is not an essential gene
          Length = 115

 Score =  101 bits (251), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 47/66 (71%), Positives = 53/66 (80%)

Query: 29  VFCRTLMKTHRGALKRWRQTSTGFKRGIAGRKHGNIGWSHRSLKSLTGRTDAHPTQMKRL 88
           +  RTLMKTH+G  KRWR+T   FKRGIAGRKHGNIGWSHRSLK+LTGR  AHP   K L
Sbjct: 49  ITIRTLMKTHKGTAKRWRRTGNTFKRGIAGRKHGNIGWSHRSLKALTGRKIAHPAYSKHL 108

Query: 89  RRLMPY 94
           +RL+PY
Sbjct: 109 KRLLPY 114

>Suva_14.218 Chr14
           complement(394669..394965,394969..394983,394990..395013)
           [336 bp, 112 aa] {ON} YNL122C (REAL)
          Length = 112

 Score = 99.8 bits (247), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 49/94 (52%), Positives = 62/94 (65%)

Query: 1   MTLFNNAITACTSRLLSMKTMGVSSFGMVFCRTLMKTHRGALKRWRQTSTGFKRGIAGRK 60
             LFN  +    S    +  +  ++   +  RTLMKTH+G  KRWR+T   FKRGIAGRK
Sbjct: 18  FNLFNPLLKGSNSFKPRLNQLLFNNVSTITIRTLMKTHKGTAKRWRRTGNTFKRGIAGRK 77

Query: 61  HGNIGWSHRSLKSLTGRTDAHPTQMKRLRRLMPY 94
           HGNIGWSHRSLK LTGR  A+ + +K L+RL+PY
Sbjct: 78  HGNIGWSHRSLKVLTGRKTANSSYLKHLKRLLPY 111

>Smik_14.206 Chr14
           complement(377692..377997,378001..378009,378013..378036)
           [339 bp, 113 aa] {ON} YNL122C (REAL)
          Length = 113

 Score = 97.8 bits (242), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 46/66 (69%), Positives = 53/66 (80%)

Query: 29  VFCRTLMKTHRGALKRWRQTSTGFKRGIAGRKHGNIGWSHRSLKSLTGRTDAHPTQMKRL 88
           V  RTLMKTH+G  KRWR+T   FKRGIAGRKHGNIGWSHRSLK+LTGR  A+   +K L
Sbjct: 47  VTIRTLMKTHKGTAKRWRRTGNTFKRGIAGRKHGNIGWSHRSLKALTGRKTANSAYLKHL 106

Query: 89  RRLMPY 94
           +RL+PY
Sbjct: 107 KRLLPY 112

>KAFR0J02090 Chr10 (400769..401047) [279 bp, 92 aa] {ON} Anc_2.151
          YNL122C
          Length = 92

 Score = 96.3 bits (238), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 44/67 (65%), Positives = 53/67 (79%)

Query: 28 MVFCRTLMKTHRGALKRWRQTSTGFKRGIAGRKHGNIGWSHRSLKSLTGRTDAHPTQMKR 87
          ++  R LMKTH+G  KRWR+T+ GFKRGIAGR HGN GWS RSLK LTGR  A P+Q KR
Sbjct: 25 LIIARNLMKTHKGTAKRWRKTANGFKRGIAGRNHGNGGWSRRSLKCLTGRKTATPSQAKR 84

Query: 88 LRRLMPY 94
          L+RL+P+
Sbjct: 85 LKRLLPF 91

>TDEL0B05130 Chr2 complement(904074..904355) [282 bp, 93 aa] {ON}
          Anc_2.151 YNL122C
          Length = 93

 Score = 95.9 bits (237), Expect = 7e-27,   Method: Compositional matrix adjust.
 Identities = 45/71 (63%), Positives = 56/71 (78%)

Query: 23 VSSFGMVFCRTLMKTHRGALKRWRQTSTGFKRGIAGRKHGNIGWSHRSLKSLTGRTDAHP 82
          V +  ++  R+LMKTH+GA KRWR+T+T FKRG AGR HGN GWS RSLKSL+G+T AH 
Sbjct: 22 VEAPSLILTRSLMKTHKGAAKRWRKTATSFKRGKAGRSHGNAGWSRRSLKSLSGKTLAHE 81

Query: 83 TQMKRLRRLMP 93
          T +K L+RLMP
Sbjct: 82 THIKHLKRLMP 92

>NCAS0G02470 Chr7 complement(439576..439842) [267 bp, 88 aa] {ON}
          Anc_2.151 YNL122C
          Length = 88

 Score = 94.7 bits (234), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 49/95 (51%), Positives = 64/95 (67%), Gaps = 7/95 (7%)

Query: 1  MTLFNNAITACTSRLLSMKTMGVSSFGMVFCRTLMKTHRGALKRWRQTSTGFKRGIAGRK 60
          M  F+   T   +R L++ T+ ++       R LMKTH+G  KRWR+T+  FKRGIAGR 
Sbjct: 1  MLPFSFLPTFYRARCLNLTTLTIT-------RNLMKTHKGTAKRWRRTAQSFKRGIAGRN 53

Query: 61 HGNIGWSHRSLKSLTGRTDAHPTQMKRLRRLMPYK 95
          HGN GWS RSLK L+GR DA P+ ++ L+RLMPYK
Sbjct: 54 HGNAGWSRRSLKHLSGRKDADPSYLRHLKRLMPYK 88

>KLLA0F24068g Chr6 (2242939..2243226) [288 bp, 95 aa] {ON} similar
          to uniprot|P53921 Saccharomyces cerevisiae YNL122C
          Hypothetical ORF
          Length = 95

 Score = 92.0 bits (227), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 49/80 (61%), Positives = 58/80 (72%), Gaps = 3/80 (3%)

Query: 15 LLSMKTMGVSSFGMVFCRTLMKTHRGALKRWRQTSTGFKRGIAGRKHGNIGWSHRSLKSL 74
          LL  KT  VSS  ++  R LMKTH+GA KRWR+T+  FKRG AGR HGN GWS  SLKSL
Sbjct: 18 LLGSKT-NVSS--LILTRNLMKTHKGAAKRWRKTANSFKRGKAGRNHGNAGWSRNSLKSL 74

Query: 75 TGRTDAHPTQMKRLRRLMPY 94
          +GR+ A  T M RL+RL+PY
Sbjct: 75 SGRSLADSTHMHRLKRLLPY 94

>SAKL0E10978g Chr5 (919541..919828) [288 bp, 95 aa] {ON} some
          similarities with uniprot|P53921 Saccharomyces
          cerevisiae YNL122C Hypothetical ORF
          Length = 95

 Score = 91.7 bits (226), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 40/67 (59%), Positives = 52/67 (77%)

Query: 28 MVFCRTLMKTHRGALKRWRQTSTGFKRGIAGRKHGNIGWSHRSLKSLTGRTDAHPTQMKR 87
          +V  R LMKTH+GA KRW++T+  +KRG AGR HGN GW+  +LKSL G+T AHPT +K 
Sbjct: 28 LVLTRNLMKTHKGAAKRWKKTANSYKRGRAGRNHGNAGWNKSTLKSLDGKTLAHPTHIKH 87

Query: 88 LRRLMPY 94
          L+RL+PY
Sbjct: 88 LKRLLPY 94

>Ecym_8202 Chr8 complement(418239..418535) [297 bp, 98 aa] {ON}
          similar to Ashbya gossypii ABR133W
          Length = 98

 Score = 90.9 bits (224), Expect = 7e-25,   Method: Compositional matrix adjust.
 Identities = 41/67 (61%), Positives = 53/67 (79%)

Query: 28 MVFCRTLMKTHRGALKRWRQTSTGFKRGIAGRKHGNIGWSHRSLKSLTGRTDAHPTQMKR 87
          ++F R+LMKTH+GA KRWR+T+  FKRG AGR HGN GWS  SLK L+GR  A+ +Q+ R
Sbjct: 31 LIFSRSLMKTHKGAAKRWRKTANSFKRGKAGRSHGNSGWSKNSLKVLSGRALANGSQLNR 90

Query: 88 LRRLMPY 94
          L+RL+PY
Sbjct: 91 LKRLLPY 97

>KLTH0B05214g Chr2 (430231..430506) [276 bp, 91 aa] {ON} some
          similarities with uniprot|P53921 Saccharomyces
          cerevisiae YNL122C Hypothetical ORF
          Length = 91

 Score = 90.1 bits (222), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 42/67 (62%), Positives = 51/67 (76%)

Query: 28 MVFCRTLMKTHRGALKRWRQTSTGFKRGIAGRKHGNIGWSHRSLKSLTGRTDAHPTQMKR 87
          M+  R LMKTH+G  KRWR+TST +KRG AGR HGN GW   +LKSL G+T AHPT +K 
Sbjct: 24 MMQTRNLMKTHKGTAKRWRKTSTSYKRGRAGRNHGNAGWGKSTLKSLDGKTLAHPTHIKH 83

Query: 88 LRRLMPY 94
          L+RL+PY
Sbjct: 84 LKRLLPY 90

>ABR133W Chr2 (644796..645086) [291 bp, 96 aa] {ON} Syntenic
          homolog of Saccharomyces cerevisiae YNL122C
          Length = 96

 Score = 89.4 bits (220), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 44/87 (50%), Positives = 56/87 (64%)

Query: 8  ITACTSRLLSMKTMGVSSFGMVFCRTLMKTHRGALKRWRQTSTGFKRGIAGRKHGNIGWS 67
          +T    R  S      +   ++  RTLMKTH+GA KRWR+T+ G+KR  AGR HGN GW 
Sbjct: 9  LTGLPVRFGSGAFAATTQPSLIMVRTLMKTHKGAAKRWRKTAGGYKRSKAGRSHGNTGWG 68

Query: 68 HRSLKSLTGRTDAHPTQMKRLRRLMPY 94
           R+LK L+GRT A    +KRLRRL+PY
Sbjct: 69 QRALKQLSGRTMAASAHLKRLRRLLPY 95

>Kwal_33.14762 s33 complement(808878..809153) [276 bp, 91 aa] {ON}
          YNL122C - Hypothetical ORF [contig 101] FULL
          Length = 91

 Score = 86.7 bits (213), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 46/90 (51%), Positives = 56/90 (62%), Gaps = 10/90 (11%)

Query: 15 LLSMKTMGVSSFGMVFC----------RTLMKTHRGALKRWRQTSTGFKRGIAGRKHGNI 64
          +LS     V SFG  F           R LMKTH+G  KRWR+TST +KRG AGR HGN 
Sbjct: 1  MLSYLVRSVFSFGKSFSQIQQPFMQQTRNLMKTHKGTAKRWRKTSTSYKRGRAGRNHGNA 60

Query: 65 GWSHRSLKSLTGRTDAHPTQMKRLRRLMPY 94
          GW   +LK+L G+T AH T +K L+RL+PY
Sbjct: 61 GWGKSTLKALDGKTLAHSTHIKHLKRLLPY 90

>TPHA0F01880 Chr6 (428432..428731) [300 bp, 99 aa] {ON} Anc_2.151
          YNL122C
          Length = 99

 Score = 85.9 bits (211), Expect = 8e-23,   Method: Compositional matrix adjust.
 Identities = 42/71 (59%), Positives = 53/71 (74%), Gaps = 2/71 (2%)

Query: 26 FGMVFCRTLMKTHRGALKRWRQTS--TGFKRGIAGRKHGNIGWSHRSLKSLTGRTDAHPT 83
          F + F RTLMKTH+G  KRW+  S    FKRG +GR+HGNIGWS RSLK+L+GRT A  T
Sbjct: 28 FHLDFRRTLMKTHKGTAKRWKYISKLDTFKRGKSGRQHGNIGWSQRSLKTLSGRTYADKT 87

Query: 84 QMKRLRRLMPY 94
           + +LR+L+PY
Sbjct: 88 HVSKLRKLLPY 98

>Kpol_505.21 s505 (56756..57013) [258 bp, 85 aa] {ON}
          (56756..57013) [258 nt, 86 aa]
          Length = 85

 Score = 82.4 bits (202), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 39/69 (56%), Positives = 52/69 (75%), Gaps = 2/69 (2%)

Query: 28 MVFCRTLMKTHRGALKRWR--QTSTGFKRGIAGRKHGNIGWSHRSLKSLTGRTDAHPTQM 85
          +   R+LMKTH+G  KRW+  ++   FKRG +GR+HGN+GWS RSLK L+GRT AH T +
Sbjct: 16 LQITRSLMKTHKGTAKRWKFIKSLDTFKRGKSGRQHGNVGWSQRSLKHLSGRTYAHTTHV 75

Query: 86 KRLRRLMPY 94
           RLR+L+PY
Sbjct: 76 SRLRKLLPY 84

>TBLA0B01230 Chr2 complement(262437..262730) [294 bp, 97 aa] {ON}
          Anc_2.151 YNL122C
          Length = 97

 Score = 71.2 bits (173), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 35/67 (52%), Positives = 45/67 (67%), Gaps = 7/67 (10%)

Query: 35 MKTHRGALKRWRQ-------TSTGFKRGIAGRKHGNIGWSHRSLKSLTGRTDAHPTQMKR 87
          +KTH+G LKRWR+        +  F R  AGR HGNIGWSHR+L +L+ R  AH T +K 
Sbjct: 31 LKTHKGTLKRWRRRVAPGGPAAEQFVRSKAGRNHGNIGWSHRALAALSRRVPAHSTHVKA 90

Query: 88 LRRLMPY 94
          LR+L+PY
Sbjct: 91 LRKLLPY 97

>YMR031C Chr13 complement(332212..334743) [2532 bp, 843 aa] {ON}
           EIS1Component of the eisosome that is required for
           proper eisosome assembly; similarity to Ykl050cp and
           Uso1p; the authentic, non-tagged protein is detected in
           a phosphorylated state in highly purified mitochondria
           in high-throughput studies
          Length = 843

 Score = 28.5 bits (62), Expect = 2.6,   Method: Composition-based stats.
 Identities = 13/57 (22%), Positives = 31/57 (54%), Gaps = 4/57 (7%)

Query: 43  KRWRQTSTGFKRGIAGRKHGNI---GWSHRSLKSLTGRTDAHPTQ-MKRLRRLMPYK 95
           +RW    T F+ G+   +HGN+    +S+  + ++  + DA   Q +++++++   K
Sbjct: 224 ERWEPEKTNFQYGVKTDEHGNLNQFSFSNEMMNNIMAKVDAPKAQDLQKVKKVSAEK 280

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.326    0.133    0.416 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 8,579,919
Number of extensions: 257967
Number of successful extensions: 605
Number of sequences better than 10.0: 21
Number of HSP's gapped: 602
Number of HSP's successfully gapped: 21
Length of query: 95
Length of database: 53,481,399
Length adjustment: 66
Effective length of query: 29
Effective length of database: 45,913,443
Effective search space: 1331489847
Effective search space used: 1331489847
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.7 bits)
S2: 59 (27.3 bits)