Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
CAGL0L04048g2.152ON58758730250.0
Kwal_33.147672.152ON59459515920.0
Smik_14.2072.152ON61756715830.0
YNL121C (TOM70)2.152ON61755615660.0
ZYRO0G06512g2.152ON60460315630.0
Suva_14.2192.152ON61755615640.0
Skud_14.2112.152ON61755615640.0
SAKL0E10956g2.152ON60051815470.0
NCAS0G024802.152ON59651515460.0
KLTH0B05170g2.152ON59352115190.0
NDAI0F028102.152ON60960515070.0
ABR131W2.152ON59451815020.0
TDEL0B051402.152ON59960014980.0
Kpol_1048.212.152ON59751814570.0
KLLA0F24046g2.152ON60451914460.0
Ecym_82042.152ON59751814440.0
CAGL0L12936g2.152ON60052714400.0
TPHA0I015102.152ON60360114370.0
TBLA0C055302.152ON61051614160.0
KNAG0H035302.152ON61452513880.0
KAFR0F007202.152ON60852313471e-180
NCAS0B070102.152ON62562413431e-179
Skud_8.1782.152ON63853913081e-174
YHR117W (TOM71)2.152ON63953113031e-173
Smik_8.1952.152ON63553412821e-170
Suva_15.3142.152ON64454012551e-165
NDAI0B043402.152ON66452711891e-155
NCAS0G008105.617ON584891662e-11
Ecym_20906.328ON172901525e-11
CAGL0H08195g5.617ON583891545e-10
Kwal_55.199355.617ON593891529e-10
KLTH0E02178g5.617ON593891483e-09
Suva_8.805.617ON586891474e-09
YOR027W (STI1)5.617ON589891431e-08
KLTH0F14542g3.481ON5131031421e-08
CAGL0D05060g3.481ON5101621422e-08
AEL224W5.617ON580891422e-08
SAKL0G07084g5.617ON585891403e-08
Smik_15.2055.617ON589891385e-08
Ecym_30256.21ON318981355e-08
Kwal_55.211753.481ON5111021376e-08
Kpol_1018.695.617ON590891377e-08
TPHA0D028805.617ON585891377e-08
TBLA0C039503.481ON5121051367e-08
Skud_15.1925.617ON5891261377e-08
NDAI0B057903.481ON5231691367e-08
KLLA0B09966g8.506ON3701421358e-08
SAKL0A01672g6.328ON128611251e-07
Kwal_27.118908.506ON3341341331e-07
NCAS0A00490singletonON620891332e-07
Kpol_513.28.506ON3741051312e-07
KNAG0A079003.481ON5121131323e-07
SAKL0E01210g6.21ON323981293e-07
Kwal_56.224336.21ON3221611293e-07
ACR005W6.21ON327891284e-07
TDEL0A048405.617ON576891304e-07
TPHA0L014208.506ON3741341285e-07
KAFR0C058905.617ON575891305e-07
Kpol_1037.266.21ON342941285e-07
Skud_2.2828.506ON3851051285e-07
TBLA0H033808.506ON3751141277e-07
YBR155W (CNS1)8.506ON3851051269e-07
TPHA0J003406.21ON338941251e-06
KAFR0E029808.506ON3801051251e-06
TDEL0D055003.481ON5121121261e-06
TBLA0E033005.617ON582891252e-06
ZYRO0A05676g5.617ON572711242e-06
CAGL0E02739g6.21ON343861232e-06
Smik_2.2958.506ON3851421232e-06
CAGL0C01903g7.412ON7691121243e-06
NDAI0F009105.617ON583891224e-06
Smik_15.1766.21ON345881214e-06
CAGL0H07425g8.506ON3801061214e-06
Skud_15.1686.21ON348881205e-06
TPHA0D032203.481ON5131051215e-06
SAKL0F03102g3.481ON513951207e-06
KNAG0B032005.617ON579891199e-06
Ecym_55825.617ON584891181e-05
ZYRO0F08624g8.506ON3791051171e-05
Ecym_44133.481ON510951172e-05
Kpol_505.413.481ON5131141172e-05
NDAI0D008106.21ON3491101152e-05
AGL268C8.506ON3791051152e-05
NDAI0C052908.506ON3791061152e-05
SAKL0H10934g8.506ON3801331152e-05
Ecym_25598.506ON3701051152e-05
AAR054C6.328ON133611072e-05
YOR007C (SGT2)6.21ON346881133e-05
AAR083C3.481ON5381681153e-05
KNAG0A039508.506ON3861061133e-05
TDEL0G044806.21ON343981134e-05
KAFR0J025706.328ON121951054e-05
KLLA0A07062g5.617ON581891144e-05
TDEL0B013108.506ON3801401125e-05
Kpol_1032.86.21ON3431101125e-05
NCAS0B024008.506ON380831125e-05
Kpol_1028.516.328ON117611045e-05
TPHA0E007407.412ON7461791126e-05
TBLA0G010506.21ON3501231107e-05
Suva_4.4058.506ON3851051117e-05
Suva_15.1826.21ON346881108e-05
NCAS0H008306.21ON338781099e-05
TDEL0A074306.328ON124611021e-04
KAFR0L004106.21ON331701081e-04
ZYRO0C07788g6.21ON334791081e-04
KLLA0D01155g6.21ON335641082e-04
TBLA0I023106.328ON116621002e-04
NCAS0F034903.481ON5121131082e-04
Skud_3.1356.328ON11876992e-04
KNAG0M011706.21ON339921062e-04
KLTH0C11220g6.21ON327781063e-04
Kpol_1018.1067.412ON7531591063e-04
NCAS0D045006.328ON12177984e-04
KLTH0E11748g8.506ON3781051054e-04
KNAG0F040107.546ON14181581064e-04
NDAI0I022406.21ON350731036e-04
NDAI0I004406.328ON12880967e-04
Smik_2.367.412ON7511381038e-04
Suva_2.347.412ON7631381020.001
KLLA0B10912g3.481ON512991010.001
YBL084C (CDC27)7.412ON7581381010.001
NCAS0A112003.367ON9071241010.001
ZYRO0B04224g3.481ON513951000.001
KLLA0C08910g6.328ON11560920.002
KAFR0B066103.481ON51199990.002
Suva_7.4083.481ON51395980.003
NCAS0B025608.470ON578132990.003
Smik_4.4918.470ON612114970.004
Skud_2.247.412ON769157970.004
SAKL0H11946g8.470ON57392970.004
KNAG0H006103.367ON973124970.005
KAFR0L018707.412ON712173960.005
KNAG0A041208.470ON60291960.006
TDEL0C027207.412ON700156960.006
KLTH0E10934g8.470ON56892950.006
KNAG0I025206.328ON11789880.006
TBLA0H015203.367ON689106950.007
Suva_3.956.328ON11176880.007
TBLA0A016908.470ON66291950.008
Smik_3.1596.328ON11569870.008
YDR244W (PEX5)8.470ON612118940.009
TPHA0M016303.367ON1043124950.009
ZYRO0C16522g3.367ON974126940.010
TPHA0D038606.328ON12071860.012
CAGL0D01364g3.367ON1148124930.015
Kwal_27.107407.412ON628156920.015
YGR123C (PPT1)3.481ON513102920.016
KLTH0C06204g7.412ON627136910.022
Skud_4.5068.470ON611114910.022
KNAG0B022407.412ON739192900.028
Smik_6.2153.481ON513102900.029
Kwal_27.117378.470ON57592900.031
ZYRO0B03828g7.412ON727164900.032
TBLA0A072706.21ON373107890.033
TDEL0B016608.470ON549152890.035
CAGL0H07095g5.352ON661113890.037
Ecym_13968.470ON57392890.038
Kpol_172.23.367ON41891880.039
KAFR0H008703.367ON88794890.042
AFR663W1.88ON103885880.050
Skud_7.4323.481ON51395880.051
Suva_2.4108.470ON611114880.052
Suva_4.3613.367ON963124880.052
ZYRO0A02926g8.470ON57789870.060
Kpol_1031.648.470ON60791870.064
TDEL0E027505.352ON564133870.066
NCAS0E024907.412ON809137870.066
YDR320C (SWA2)5.352ON668113870.067
CAGL0K11209g8.470ON59091870.067
TDEL0C050903.367ON75983870.070
YBR112C (CYC8)3.367ON96694870.071
AFR453W8.470ON56992860.075
Skud_2.2403.367ON98483870.076
Smik_2.2543.367ON102094870.078
Smik_4.5795.352ON667113860.081
TDEL0D036003.265ON879178860.090
NCAS0F028705.352ON700113860.092
KLLA0C15455g8.470ON56692850.099
SAKL0F16236g7.546ON1408190860.10
YCR060W (TAH1)6.328ON11175790.11
KLTH0F10428g3.367ON79583840.14
KLTH0A00638g7.546ON1411110850.14
Kwal_23.36703.367ON80283840.15
NDAI0A051003.367ON100783840.18
KLLA0B09262g3.367ON941100830.20
SAKL0B07986g3.367ON88083830.21
TBLA0F012303.367ON1189121830.21
Kpol_2000.601.88ON103357830.22
ADL344W3.367ON91083830.22
Smik_6.1321.88ON102557830.24
Skud_7.3461.88ON102557820.25
Skud_10.71.125ON651118820.29
KAFR0D004701.88ON105157810.35
Kwal_55.218395.689ON69085810.37
TBLA0H019705.352ON84069810.39
NCAS0G003505.689ON69883800.40
Suva_7.3311.88ON102457810.41
Kwal_23.54087.546ON141084800.44
KNAG0C005501.88ON106474800.47
Kpol_1006.43.367ON73257800.47
NDAI0C051308.470ON590114800.49
Ecym_71427.412ON675234790.52
YGR047C (TFC4)1.88ON102557800.52
NDAI0C043205.352ON706114790.57
Ecym_34593.367ON111583790.63
NDAI0E040407.412ON783170790.63
KLLA0B10197g5.352ON621113780.70
TBLA0A055001.88ON109757780.76
CAGL0I02288g5.72ON639266780.79
CAGL0K09240g6.328ON14255740.84
Kpol_1050.825.72ON639111780.85
KNAG0E006805.72ON639189780.85
Kpol_339.135.352ON686114770.92
NCAS0B080101.88ON106556771.0
ZYRO0C03564g3.5ON109686771.0
SAKL0H02244g5.72ON628131771.0
TPHA0B044301.88ON107057771.2
TPHA0M002706.21ON37764761.2
KAFR0B002507.546ON1420123771.2
KLLA0E20857g7.412ON710180761.3
KLTH0F02508g1.88ON1055174761.3
TBLA0D004607.412ON83554761.4
KLTH0H00704g5.72ON621125761.4
Kpol_1050.1127.546ON1360131751.8
KLLA0C02453g1.88ON102885751.9
TPHA0L012108.470ON58881741.9
CAGL0B01375g3.5ON111086752.0
NDAI0G037103.5ON112188752.1
KLTH0G04620g5.564ON44556742.3
KLTH0H14872g5.352ON623110742.4
KAFR0C038202.665ON70478742.6
Kwal_47.184645.564ON445100732.6
ZYRO0C11594g5.72ON62878733.0
NDAI0B053201.88ON103856733.0
AGL294W7.412ON65684733.1
TPHA0O018702.23ON433127723.6
NCAS0D026706.21ON35197723.7
KAFR0C018505.352ON646113723.9
TBLA0B079705.72ON687106724.4
TBLA0B049907.546ON141074724.4
Suva_12.1141.456ON370113714.6
ZYRO0A10120g8.457ON52776714.8
ZYRO0D10186g5.352ON635142714.8
TDEL0G009605.72ON62272714.9
YOL145C (CTR9)3.5ON1077386715.2
NDAI0C033505.72ON649191715.5
Skud_14.1982.134ON174102685.8
KNAG0C055005.352ON585116705.9
Kwal_56.247505.72ON619111706.3
TPHA0A052905.72ON666116707.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0L04048g
         (587 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0L04048g Chr12 (476407..478170) [1764 bp, 587 aa] {ON} simil...  1169   0.0  
Kwal_33.14767 s33 complement(809994..811778) [1785 bp, 594 aa] {...   617   0.0  
Smik_14.207 Chr14 complement(378339..380192) [1854 bp, 617 aa] {...   614   0.0  
YNL121C Chr14 complement(398684..400537) [1854 bp, 617 aa] {ON} ...   607   0.0  
ZYRO0G06512g Chr7 complement(515759..517573) [1815 bp, 604 aa] {...   606   0.0  
Suva_14.219 Chr14 complement(395316..397169) [1854 bp, 617 aa] {...   607   0.0  
Skud_14.211 Chr14 complement(388749..390602) [1854 bp, 617 aa] {...   607   0.0  
SAKL0E10956g Chr5 (916623..918425) [1803 bp, 600 aa] {ON} simila...   600   0.0  
NCAS0G02480 Chr7 complement(440105..441895) [1791 bp, 596 aa] {O...   600   0.0  
KLTH0B05170g Chr2 (427608..429389) [1782 bp, 593 aa] {ON} simila...   589   0.0  
NDAI0F02810 Chr6 (690977..692806) [1830 bp, 609 aa] {ON} Anc_2.1...   585   0.0  
ABR131W Chr2 (641631..643415) [1785 bp, 594 aa] {ON} Syntenic ho...   583   0.0  
TDEL0B05140 Chr2 complement(904626..906425) [1800 bp, 599 aa] {O...   581   0.0  
Kpol_1048.21 s1048 complement(67975..69768) [1794 bp, 597 aa] {O...   565   0.0  
KLLA0F24046g Chr6 (2240454..2242268) [1815 bp, 604 aa] {ON} simi...   561   0.0  
Ecym_8204 Chr8 complement(419900..421693) [1794 bp, 597 aa] {ON}...   560   0.0  
CAGL0L12936g Chr12 (1382623..1384425) [1803 bp, 600 aa] {ON} sim...   559   0.0  
TPHA0I01510 Chr9 complement(342661..344472) [1812 bp, 603 aa] {O...   558   0.0  
TBLA0C05530 Chr3 complement(1338666..1340498) [1833 bp, 610 aa] ...   550   0.0  
KNAG0H03530 Chr8 (657450..659294) [1845 bp, 614 aa] {ON} Anc_2.1...   539   0.0  
KAFR0F00720 Chr6 complement(141181..143007) [1827 bp, 608 aa] {O...   523   e-180
NCAS0B07010 Chr2 (1332351..1334228) [1878 bp, 625 aa] {ON} Anc_2...   521   e-179
Skud_8.178 Chr8 (316128..318044) [1917 bp, 638 aa] {ON} YHR117W ...   508   e-174
YHR117W Chr8 (342349..344268) [1920 bp, 639 aa] {ON}  TOM71Mitoc...   506   e-173
Smik_8.195 Chr8 (318688..320595) [1908 bp, 635 aa] {ON} YHR117W ...   498   e-170
Suva_15.314 Chr15 (544646..546580) [1935 bp, 644 aa] {ON} YHR117...   488   e-165
NDAI0B04340 Chr2 (1087851..1089845) [1995 bp, 664 aa] {ON} Anc_2...   462   e-155
NCAS0G00810 Chr7 complement(138192..139946) [1755 bp, 584 aa] {O...    69   2e-11
Ecym_2090 Chr2 complement(163340..163858) [519 bp, 172 aa] {ON} ...    63   5e-11
CAGL0H08195g Chr8 complement(804418..806169) [1752 bp, 583 aa] {...    64   5e-10
Kwal_55.19935 s55 (182767..184548) [1782 bp, 593 aa] {ON} YOR027...    63   9e-10
KLTH0E02178g Chr5 (194914..196695) [1782 bp, 593 aa] {ON} highly...    62   3e-09
Suva_8.80 Chr8 (142691..144451) [1761 bp, 586 aa] {ON} YOR027W (...    61   4e-09
YOR027W Chr15 (381053..382822) [1770 bp, 589 aa] {ON}  STI1Hsp90...    60   1e-08
KLTH0F14542g Chr6 complement(1191800..1193341) [1542 bp, 513 aa]...    59   1e-08
CAGL0D05060g Chr4 complement(486065..487597) [1533 bp, 510 aa] {...    59   2e-08
AEL224W Chr5 (207712..209454) [1743 bp, 580 aa] {ON} Syntenic ho...    59   2e-08
SAKL0G07084g Chr7 (580004..581761) [1758 bp, 585 aa] {ON} highly...    59   3e-08
Smik_15.205 Chr15 (346899..348668) [1770 bp, 589 aa] {ON} YOR027...    58   5e-08
Ecym_3025 Chr3 complement(50289..51245) [957 bp, 318 aa] {ON} si...    57   5e-08
Kwal_55.21175 s55 complement(716457..717992) [1536 bp, 511 aa] {...    57   6e-08
Kpol_1018.69 s1018 (197149..198921) [1773 bp, 590 aa] {ON} (1971...    57   7e-08
TPHA0D02880 Chr4 (599288..601045) [1758 bp, 585 aa] {ON} Anc_5.6...    57   7e-08
TBLA0C03950 Chr3 complement(950339..951877) [1539 bp, 512 aa] {O...    57   7e-08
Skud_15.192 Chr15 (340847..342616) [1770 bp, 589 aa] {ON} YOR027...    57   7e-08
NDAI0B05790 Chr2 complement(1406039..1407610) [1572 bp, 523 aa] ...    57   7e-08
KLLA0B09966g Chr2 complement(872760..873872) [1113 bp, 370 aa] {...    57   8e-08
SAKL0A01672g Chr1 complement(154932..155318) [387 bp, 128 aa] {O...    53   1e-07
Kwal_27.11890 s27 (990685..991689) [1005 bp, 334 aa] {ON} YBR155...    56   1e-07
NCAS0A00490 Chr1 complement(76652..78514) [1863 bp, 620 aa] {ON}       56   2e-07
Kpol_513.2 s513 (1962..3086) [1125 bp, 374 aa] {ON} (1962..3086)...    55   2e-07
KNAG0A07900 Chr1 complement(1258164..1259702) [1539 bp, 512 aa] ...    55   3e-07
SAKL0E01210g Chr5 complement(93267..94238) [972 bp, 323 aa] {ON}...    54   3e-07
Kwal_56.22433 s56 complement(124778..125746) [969 bp, 322 aa] {O...    54   3e-07
ACR005W Chr3 (363355..364338) [984 bp, 327 aa] {ON} Syntenic hom...    54   4e-07
TDEL0A04840 Chr1 (851520..853250) [1731 bp, 576 aa] {ON} Anc_5.6...    55   4e-07
TPHA0L01420 Chr12 (293980..295104) [1125 bp, 374 aa] {ON} Anc_8....    54   5e-07
KAFR0C05890 Chr3 (1165932..1167659) [1728 bp, 575 aa] {ON} Anc_5...    55   5e-07
Kpol_1037.26 s1037 complement(59590..60618) [1029 bp, 342 aa] {O...    54   5e-07
Skud_2.282 Chr2 (517201..518358) [1158 bp, 385 aa] {ON} YBR155W ...    54   5e-07
TBLA0H03380 Chr8 (829314..830441) [1128 bp, 375 aa] {ON} Anc_8.5...    54   7e-07
YBR155W Chr2 (549771..550928) [1158 bp, 385 aa] {ON}  CNS1TPR-co...    53   9e-07
TPHA0J00340 Chr10 complement(76166..77182) [1017 bp, 338 aa] {ON...    53   1e-06
KAFR0E02980 Chr5 (596891..598033) [1143 bp, 380 aa] {ON} Anc_8.5...    53   1e-06
TDEL0D05500 Chr4 complement(991567..993105) [1539 bp, 512 aa] {O...    53   1e-06
TBLA0E03300 Chr5 complement(827677..829425) [1749 bp, 582 aa] {O...    53   2e-06
ZYRO0A05676g Chr1 (459999..461717) [1719 bp, 572 aa] {ON} highly...    52   2e-06
CAGL0E02739g Chr5 complement(259023..260054) [1032 bp, 343 aa] {...    52   2e-06
Smik_2.295 Chr2 (535786..536943) [1158 bp, 385 aa] {ON} YBR155W ...    52   2e-06
CAGL0C01903g Chr3 complement(199487..201796) [2310 bp, 769 aa] {...    52   3e-06
NDAI0F00910 Chr6 complement(223205..224956) [1752 bp, 583 aa] {ON}     52   4e-06
Smik_15.176 Chr15 complement(306259..307296) [1038 bp, 345 aa] {...    51   4e-06
CAGL0H07425g Chr8 (725307..726449) [1143 bp, 380 aa] {ON} highly...    51   4e-06
Skud_15.168 Chr15 complement(298955..300001) [1047 bp, 348 aa] {...    51   5e-06
TPHA0D03220 Chr4 complement(662868..664409) [1542 bp, 513 aa] {O...    51   5e-06
SAKL0F03102g Chr6 (258266..259807) [1542 bp, 513 aa] {ON} highly...    51   7e-06
KNAG0B03200 Chr2 complement(619530..621269) [1740 bp, 579 aa] {O...    50   9e-06
Ecym_5582 Chr5 complement(1195544..1197298) [1755 bp, 584 aa] {O...    50   1e-05
ZYRO0F08624g Chr6 (691992..693131) [1140 bp, 379 aa] {ON} simila...    50   1e-05
Ecym_4413 Chr4 complement(856330..857862) [1533 bp, 510 aa] {ON}...    50   2e-05
Kpol_505.41 s505 complement(91130..92671) [1542 bp, 513 aa] {ON}...    50   2e-05
NDAI0D00810 Chr4 complement(181659..182708) [1050 bp, 349 aa] {O...    49   2e-05
AGL268C Chr7 complement(205872..207011) [1140 bp, 379 aa] {ON} S...    49   2e-05
NDAI0C05290 Chr3 (1224979..1226118) [1140 bp, 379 aa] {ON} Anc_8...    49   2e-05
SAKL0H10934g Chr8 complement(945834..946976) [1143 bp, 380 aa] {...    49   2e-05
Ecym_2559 Chr2 (1089202..1090314) [1113 bp, 370 aa] {ON} similar...    49   2e-05
AAR054C Chr1 complement(440706..441107) [402 bp, 133 aa] {ON} Sy...    46   2e-05
YOR007C Chr15 complement(338938..339978) [1041 bp, 346 aa] {ON} ...    48   3e-05
AAR083C Chr1 complement(492375..493991) [1617 bp, 538 aa] {ON} S...    49   3e-05
KNAG0A03950 Chr1 complement(529620..530780) [1161 bp, 386 aa] {O...    48   3e-05
TDEL0G04480 Chr7 (813648..814679) [1032 bp, 343 aa] {ON} Anc_6.2...    48   4e-05
KAFR0J02570 Chr10 (488372..488737) [366 bp, 121 aa] {ON} Anc_6.3...    45   4e-05
KLLA0A07062g Chr1 complement(636546..638291) [1746 bp, 581 aa] {...    49   4e-05
TDEL0B01310 Chr2 complement(234307..235449) [1143 bp, 380 aa] {O...    48   5e-05
Kpol_1032.8 s1032 complement(15762..16793) [1032 bp, 343 aa] {ON...    48   5e-05
NCAS0B02400 Chr2 complement(402763..403905) [1143 bp, 380 aa] {O...    48   5e-05
Kpol_1028.51 s1028 complement(123535..123888) [354 bp, 117 aa] {...    45   5e-05
TPHA0E00740 Chr5 complement(142456..144696) [2241 bp, 746 aa] {O...    48   6e-05
TBLA0G01050 Chr7 complement(262407..263459) [1053 bp, 350 aa] {O...    47   7e-05
Suva_4.405 Chr4 (719015..720172) [1158 bp, 385 aa] {ON} YBR155W ...    47   7e-05
Suva_15.182 Chr15 complement(313413..314453) [1041 bp, 346 aa] {...    47   8e-05
NCAS0H00830 Chr8 complement(151809..152825) [1017 bp, 338 aa] {O...    47   9e-05
TDEL0A07430 Chr1 (1296631..1297005) [375 bp, 124 aa] {ON} Anc_6....    44   1e-04
KAFR0L00410 Chr12 complement(75459..76454) [996 bp, 331 aa] {ON}...    46   1e-04
ZYRO0C07788g Chr3 (589880..590884) [1005 bp, 334 aa] {ON} simila...    46   1e-04
KLLA0D01155g Chr4 complement(104847..105854) [1008 bp, 335 aa] {...    46   2e-04
TBLA0I02310 Chr9 (528067..528417) [351 bp, 116 aa] {ON} Anc_6.32...    43   2e-04
NCAS0F03490 Chr6 complement(698757..700295) [1539 bp, 512 aa] {O...    46   2e-04
Skud_3.135 Chr3 (208664..209020) [357 bp, 118 aa] {ON} YCR060W (...    43   2e-04
KNAG0M01170 Chr13 complement(211476..212495) [1020 bp, 339 aa] {...    45   2e-04
KLTH0C11220g Chr3 (920972..921955) [984 bp, 327 aa] {ON} similar...    45   3e-04
Kpol_1018.106 s1018 (280224..282485) [2262 bp, 753 aa] {ON} (280...    45   3e-04
NCAS0D04500 Chr4 (855490..855855) [366 bp, 121 aa] {ON} Anc_6.32...    42   4e-04
KLTH0E11748g Chr5 (1043203..1044339) [1137 bp, 378 aa] {ON} simi...    45   4e-04
KNAG0F04010 Chr6 (757749..762005) [4257 bp, 1418 aa] {ON} Anc_7....    45   4e-04
NDAI0I02240 Chr9 (512140..513192) [1053 bp, 350 aa] {ON} Anc_6.2...    44   6e-04
NDAI0I00440 Chr9 complement(89650..90036) [387 bp, 128 aa] {ON} ...    42   7e-04
Smik_2.36 Chr2 complement(61159..63414) [2256 bp, 751 aa] {ON} Y...    44   8e-04
Suva_2.34 Chr2 complement(63832..65304,65365..66183) [2292 bp, 7...    44   0.001
KLLA0B10912g Chr2 (955948..957486) [1539 bp, 512 aa] {ON} simila...    44   0.001
YBL084C Chr2 complement(67169..69445) [2277 bp, 758 aa] {ON}  CD...    44   0.001
NCAS0A11200 Chr1 complement(2220419..2223142) [2724 bp, 907 aa] ...    44   0.001
ZYRO0B04224g Chr2 (350069..351610) [1542 bp, 513 aa] {ON} highly...    43   0.001
KLLA0C08910g Chr3 complement(781726..782073) [348 bp, 115 aa] {O...    40   0.002
KAFR0B06610 Chr2 (1372434..1373969) [1536 bp, 511 aa] {ON} Anc_3...    43   0.002
Suva_7.408 Chr7 complement(706942..708483) [1542 bp, 513 aa] {ON...    42   0.003
NCAS0B02560 Chr2 complement(427447..429183) [1737 bp, 578 aa] {O...    43   0.003
Smik_4.491 Chr4 (895429..897267) [1839 bp, 612 aa] {ON} YDR244W ...    42   0.004
Skud_2.24 Chr2 complement(50790..53099) [2310 bp, 769 aa] {ON} Y...    42   0.004
SAKL0H11946g Chr8 complement(1020512..1022233) [1722 bp, 573 aa]...    42   0.004
KNAG0H00610 Chr8 (99931..102852) [2922 bp, 973 aa] {ON} Anc_3.36...    42   0.005
KAFR0L01870 Chr12 (345757..347895) [2139 bp, 712 aa] {ON} Anc_7....    42   0.005
KNAG0A04120 Chr1 complement(556919..558727) [1809 bp, 602 aa] {O...    42   0.006
TDEL0C02720 Chr3 (477529..479631) [2103 bp, 700 aa] {ON} Anc_7.4...    42   0.006
KLTH0E10934g Chr5 (981831..983537) [1707 bp, 568 aa] {ON} simila...    41   0.006
KNAG0I02520 Chr9 complement(487699..488052) [354 bp, 117 aa] {ON...    39   0.006
TBLA0H01520 Chr8 (344716..346785) [2070 bp, 689 aa] {ON} Anc_3.3...    41   0.007
Suva_3.95 Chr3 (137419..137754) [336 bp, 111 aa] {ON} YCR060W (R...    39   0.007
TBLA0A01690 Chr1 complement(404419..406407) [1989 bp, 662 aa] {O...    41   0.008
Smik_3.159 Chr3 (222475..222822) [348 bp, 115 aa] {ON} YCR060W (...    38   0.008
YDR244W Chr4 (950563..952401) [1839 bp, 612 aa] {ON}  PEX5Peroxi...    41   0.009
TPHA0M01630 Chr13 complement(340500..343631) [3132 bp, 1043 aa] ...    41   0.009
ZYRO0C16522g Chr3 complement(1281166..1284090) [2925 bp, 974 aa]...    41   0.010
TPHA0D03860 Chr4 (807913..808275) [363 bp, 120 aa] {ON} Anc_6.32...    38   0.012
CAGL0D01364g Chr4 (152033..155479) [3447 bp, 1148 aa] {ON} simil...    40   0.015
Kwal_27.10740 s27 complement(476617..478503) [1887 bp, 628 aa] {...    40   0.015
YGR123C Chr7 complement(736662..738203) [1542 bp, 513 aa] {ON}  ...    40   0.016
KLTH0C06204g Chr3 complement(538533..540416) [1884 bp, 627 aa] {...    40   0.022
Skud_4.506 Chr4 (905143..906978) [1836 bp, 611 aa] {ON} YDR244W ...    40   0.022
KNAG0B02240 Chr2 complement(434466..436685) [2220 bp, 739 aa] {O...    39   0.028
Smik_6.215 Chr6 complement(354154..355695) [1542 bp, 513 aa] {ON...    39   0.029
Kwal_27.11737 s27 (926622..928349) [1728 bp, 575 aa] {ON} YDR244...    39   0.031
ZYRO0B03828g Chr2 (318153..320336) [2184 bp, 727 aa] {ON} simila...    39   0.032
TBLA0A07270 Chr1 complement(1811640..1812761) [1122 bp, 373 aa] ...    39   0.033
TDEL0B01660 Chr2 complement(295823..297472) [1650 bp, 549 aa] {O...    39   0.035
CAGL0H07095g Chr8 (700262..702247) [1986 bp, 661 aa] {ON} simila...    39   0.037
Ecym_1396 Chr1 (820413..822134) [1722 bp, 573 aa] {ON} similar t...    39   0.038
Kpol_172.2 s172 (4270..5523) [1254 bp, 418 aa] {ON} (4270..5523)...    39   0.039
KAFR0H00870 Chr8 (162118..164781) [2664 bp, 887 aa] {ON} Anc_3.3...    39   0.042
AFR663W Chr6 (1648116..1651232) [3117 bp, 1038 aa] {ON} Syntenic...    39   0.050
Skud_7.432 Chr7 complement(715852..717393) [1542 bp, 513 aa] {ON...    39   0.051
Suva_2.410 Chr2 (729992..731827) [1836 bp, 611 aa] {ON} YDR244W ...    39   0.052
Suva_4.361 Chr4 complement(631697..632812,632933..633154,633188....    39   0.052
ZYRO0A02926g Chr1 complement(238036..239769) [1734 bp, 577 aa] {...    38   0.060
Kpol_1031.64 s1031 (161135..162958) [1824 bp, 607 aa] {ON} (1611...    38   0.064
TDEL0E02750 Chr5 (529920..531614) [1695 bp, 564 aa] {ON} Anc_5.3...    38   0.066
NCAS0E02490 Chr5 complement(493779..496208) [2430 bp, 809 aa] {O...    38   0.066
YDR320C Chr4 complement(1106095..1108101) [2007 bp, 668 aa] {ON}...    38   0.067
CAGL0K11209g Chr11 (1089300..1091072) [1773 bp, 590 aa] {ON} sim...    38   0.067
TDEL0C05090 Chr3 complement(908033..910312) [2280 bp, 759 aa] {O...    38   0.070
YBR112C Chr2 complement(462870..465770) [2901 bp, 966 aa] {ON}  ...    38   0.071
AFR453W Chr6 (1251460..1253169) [1710 bp, 569 aa] {ON} Syntenic ...    38   0.075
Skud_2.240 Chr2 complement(431507..434461) [2955 bp, 984 aa] {ON...    38   0.076
Smik_2.254 Chr2 complement(447517..450579) [3063 bp, 1020 aa] {O...    38   0.078
Smik_4.579 Chr4 complement(1032558..1034561) [2004 bp, 667 aa] {...    38   0.081
TDEL0D03600 Chr4 (661898..664537) [2640 bp, 879 aa] {ON} Anc_3.2...    38   0.090
NCAS0F02870 Chr6 complement(573068..575170) [2103 bp, 700 aa] {O...    38   0.092
KLLA0C15455g Chr3 (1341570..1343270) [1701 bp, 566 aa] {ON} simi...    37   0.099
SAKL0F16236g Chr6 (1313573..1317799) [4227 bp, 1408 aa] {ON} sim...    38   0.10 
YCR060W Chr3 (224399..224734) [336 bp, 111 aa] {ON}  TAH1Compone...    35   0.11 
KLTH0F10428g Chr6 (902697..905084) [2388 bp, 795 aa] {ON} highly...    37   0.14 
KLTH0A00638g Chr1 complement(63363..67598) [4236 bp, 1411 aa] {O...    37   0.14 
Kwal_23.3670 s23 (387536..389944) [2409 bp, 802 aa] {ON} YBR112C...    37   0.15 
NDAI0A05100 Chr1 (1157935..1160958) [3024 bp, 1007 aa] {ON} Anc_...    37   0.18 
KLLA0B09262g Chr2 (814303..817128) [2826 bp, 941 aa] {ON} highly...    37   0.20 
SAKL0B07986g Chr2 complement(675999..678641) [2643 bp, 880 aa] {...    37   0.21 
TBLA0F01230 Chr6 complement(304299..307868) [3570 bp, 1189 aa] {...    37   0.21 
Kpol_2000.60 s2000 (119866..122967) [3102 bp, 1033 aa] {ON} (119...    37   0.22 
ADL344W Chr4 (103565..106297) [2733 bp, 910 aa] {ON} Syntenic ho...    37   0.22 
Smik_6.132 Chr6 complement(212341..215418) [3078 bp, 1025 aa] {O...    37   0.24 
Skud_7.346 Chr7 complement(573751..576828) [3078 bp, 1025 aa] {O...    36   0.25 
Skud_10.7 Chr10 (12019..13974) [1956 bp, 651 aa] {ON} YJL209W (R...    36   0.29 
KAFR0D00470 Chr4 (70746..73901) [3156 bp, 1051 aa] {ON} Anc_1.88...    36   0.35 
Kwal_55.21839 s55 (998426..1000498) [2073 bp, 690 aa] {ON} YOR08...    36   0.37 
TBLA0H01970 Chr8 (464239..466761) [2523 bp, 840 aa] {ON} Anc_5.3...    36   0.39 
NCAS0G00350 Chr7 complement(60735..62831) [2097 bp, 698 aa] {ON}...    35   0.40 
Suva_7.331 Chr7 complement(561665..564739) [3075 bp, 1024 aa] {O...    36   0.41 
Kwal_23.5408 s23 (1146253..1150485) [4233 bp, 1410 aa] {ON} YPR1...    35   0.44 
KNAG0C00550 Chr3 (92890..96084) [3195 bp, 1064 aa] {ON} Anc_1.88...    35   0.47 
Kpol_1006.4 s1006 complement(17836..20034) [2199 bp, 732 aa] {ON...    35   0.47 
NDAI0C05130 Chr3 (1193350..1195122) [1773 bp, 590 aa] {ON} Anc_8...    35   0.49 
Ecym_7142 Chr7 complement(287110..289137) [2028 bp, 675 aa] {ON}...    35   0.52 
YGR047C Chr7 complement(586392..589469) [3078 bp, 1025 aa] {ON} ...    35   0.52 
NDAI0C04320 Chr3 complement(983914..986034) [2121 bp, 706 aa] {O...    35   0.57 
Ecym_3459 Chr3 (864878..868225) [3348 bp, 1115 aa] {ON} similar ...    35   0.63 
NDAI0E04040 Chr5 (900685..903036) [2352 bp, 783 aa] {ON} Anc_7.4...    35   0.63 
KLLA0B10197g Chr2 complement(891842..893707) [1866 bp, 621 aa] {...    35   0.70 
TBLA0A05500 Chr1 complement(1358478..1361771) [3294 bp, 1097 aa]...    35   0.76 
CAGL0I02288g Chr9 complement(203605..205524) [1920 bp, 639 aa] {...    35   0.79 
CAGL0K09240g Chr11 complement(914042..914470) [429 bp, 142 aa] {...    33   0.84 
Kpol_1050.82 s1050 complement(185867..187786) [1920 bp, 639 aa] ...    35   0.85 
KNAG0E00680 Chr5 complement(122876..124795) [1920 bp, 639 aa] {O...    35   0.85 
Kpol_339.13 s339 complement(21257..23317) [2061 bp, 686 aa] {ON}...    34   0.92 
NCAS0B08010 Chr2 complement(1517575..1520772) [3198 bp, 1065 aa]...    34   1.0  
ZYRO0C03564g Chr3 (281661..284951) [3291 bp, 1096 aa] {ON} simil...    34   1.0  
SAKL0H02244g Chr8 (216327..218213) [1887 bp, 628 aa] {ON} simila...    34   1.0  
TPHA0B04430 Chr2 (1036315..1039527) [3213 bp, 1070 aa] {ON} Anc_...    34   1.2  
TPHA0M00270 Chr13 complement(53640..54773) [1134 bp, 377 aa] {ON...    34   1.2  
KAFR0B00250 Chr2 complement(58608..62870) [4263 bp, 1420 aa] {ON...    34   1.2  
KLLA0E20857g Chr5 (1860517..1862649) [2133 bp, 710 aa] {ON} simi...    34   1.3  
KLTH0F02508g Chr6 complement(214785..217952) [3168 bp, 1055 aa] ...    34   1.3  
TBLA0D00460 Chr4 complement(113831..116338) [2508 bp, 835 aa] {O...    34   1.4  
KLTH0H00704g Chr8 (70712..72577) [1866 bp, 621 aa] {ON} similar ...    34   1.4  
Kpol_1050.112 s1050 (249717..252797,252855..252863,252906..25389...    33   1.8  
KLLA0C02453g Chr3 complement(216740..219826) [3087 bp, 1028 aa] ...    33   1.9  
TPHA0L01210 Chr12 (252106..253872) [1767 bp, 588 aa] {ON} Anc_8....    33   1.9  
CAGL0B01375g Chr2 complement(123330..126662) [3333 bp, 1110 aa] ...    33   2.0  
NDAI0G03710 Chr7 complement(894337..897702) [3366 bp, 1121 aa] {...    33   2.1  
KLTH0G04620g Chr7 complement(367028..368365) [1338 bp, 445 aa] {...    33   2.3  
KLTH0H14872g Chr8 complement(1289638..1291509) [1872 bp, 623 aa]...    33   2.4  
KAFR0C03820 Chr3 complement(774134..776248) [2115 bp, 704 aa] {O...    33   2.6  
Kwal_47.18464 s47 (834937..836274) [1338 bp, 445 aa] {ON} YDR449...    33   2.6  
ZYRO0C11594g Chr3 complement(907459..909345) [1887 bp, 628 aa] {...    33   3.0  
NDAI0B05320 Chr2 (1299911..1303027) [3117 bp, 1038 aa] {ON} Anc_...    33   3.0  
AGL294W Chr7 (154711..156681) [1971 bp, 656 aa] {ON} Syntenic ho...    33   3.1  
TPHA0O01870 Chr15 complement(371225..372526) [1302 bp, 433 aa] {...    32   3.6  
NCAS0D02670 Chr4 complement(512529..513584) [1056 bp, 351 aa] {O...    32   3.7  
KAFR0C01850 Chr3 (369596..371536) [1941 bp, 646 aa] {ON} Anc_5.3...    32   3.9  
TBLA0B07970 Chr2 (1887119..1889182) [2064 bp, 687 aa] {ON} Anc_5...    32   4.4  
TBLA0B04990 Chr2 (1171599..1175831) [4233 bp, 1410 aa] {ON} Anc_...    32   4.4  
Suva_12.114 Chr12 (164933..166042) [1110 bp, 370 aa] {ON} YJR032...    32   4.6  
ZYRO0A10120g Chr1 (817803..819386) [1584 bp, 527 aa] {ON} simila...    32   4.8  
ZYRO0D10186g Chr4 complement(856401..858308) [1908 bp, 635 aa] {...    32   4.8  
TDEL0G00960 Chr7 (191061..192929) [1869 bp, 622 aa] {ON} Anc_5.7...    32   4.9  
YOL145C Chr15 complement(49555..52788) [3234 bp, 1077 aa] {ON}  ...    32   5.2  
NDAI0C03350 Chr3 complement(769764..771713) [1950 bp, 649 aa] {O...    32   5.5  
Skud_14.198 Chr14 complement(364246..364770) [525 bp, 174 aa] {O...    31   5.8  
KNAG0C05500 Chr3 (1069670..1071427) [1758 bp, 585 aa] {ON} Anc_5...    32   5.9  
Kwal_56.24750 s56 complement(1132221..1134080) [1860 bp, 619 aa]...    32   6.3  
TPHA0A05290 Chr1 complement(1198497..1200497) [2001 bp, 666 aa] ...    32   7.4  
Suva_16.521 Chr16 (895057..899331) [4275 bp, 1424 aa] {ON} YPR18...    32   8.0  
KAFR0D02340 Chr4 complement(473431..475524) [2094 bp, 697 aa] {O...    31   8.6  
Kwal_47.16725 s47 complement(80437..85377) [4941 bp, 1646 aa] {O...    31   8.9  

>CAGL0L04048g Chr12 (476407..478170) [1764 bp, 587 aa] {ON} similar
           to uniprot|P07213 Saccharomyces cerevisiae YNL121c TOM70
           or uniprot|P38825 Saccharomyces cerevisiae YHR117w TOM7
          Length = 587

 Score = 1169 bits (3025), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 572/587 (97%), Positives = 572/587 (97%)

Query: 1   MSSDSNTVGFWVKNKKXXXXXXXXXXXXXXXYFYYKQVQELKKSLDDGNDVGTASSKVEY 60
           MSSDSNTVGFWVKNKK               YFYYKQVQELKKSLDDGNDVGTASSKVEY
Sbjct: 1   MSSDSNTVGFWVKNKKAVVASVATVSAVVAAYFYYKQVQELKKSLDDGNDVGTASSKVEY 60

Query: 61  KYLMINDEPDIELMKLAETAEKNEYASELKKRGNAYFKVKDYENAINYYKFALQLKNDPV 120
           KYLMINDEPDIELMKLAETAEKNEYASELKKRGNAYFKVKDYENAINYYKFALQLKNDPV
Sbjct: 61  KYLMINDEPDIELMKLAETAEKNEYASELKKRGNAYFKVKDYENAINYYKFALQLKNDPV 120

Query: 121 FYSNMAACYISLEHNKEAIEACSKALELNPDYSKVLLKRAAVYENIGKFADALLDLTAVS 180
           FYSNMAACYISLEHNKEAIEACSKALELNPDYSKVLLKRAAVYENIGKFADALLDLTAVS
Sbjct: 121 FYSNMAACYISLEHNKEAIEACSKALELNPDYSKVLLKRAAVYENIGKFADALLDLTAVS 180

Query: 181 LNGDYNDATIQPIVERVLNKQAMMALKDHLEASEKNKVLPSYTSMAAFFGVFDAETDIPG 240
           LNGDYNDATIQPIVERVLNKQAMMALKDHLEASEKNKVLPSYTSMAAFFGVFDAETDIPG
Sbjct: 181 LNGDYNDATIQPIVERVLNKQAMMALKDHLEASEKNKVLPSYTSMAAFFGVFDAETDIPG 240

Query: 241 HDATEESDKILSDALTHLYSQTKEGYDRCDSEFTKATELYKAKLENDRTNSVTNEKAAIA 300
           HDATEESDKILSDALTHLYSQTKEGYDRCDSEFTKATELYKAKLENDRTNSVTNEKAAIA
Sbjct: 241 HDATEESDKILSDALTHLYSQTKEGYDRCDSEFTKATELYKAKLENDRTNSVTNEKAAIA 300

Query: 301 FEHTAILSFLKNDPLTARELVDEAIKLHPRPKSYIYLGLLMADKGLDEEYYSNFQKAIDL 360
           FEHTAILSFLKNDPLTARELVDEAIKLHPRPKSYIYLGLLMADKGLDEEYYSNFQKAIDL
Sbjct: 301 FEHTAILSFLKNDPLTARELVDEAIKLHPRPKSYIYLGLLMADKGLDEEYYSNFQKAIDL 360

Query: 361 DPNMAAIYYHRGQMNFIIQKYEKAGEDFDKAKECDPTNIFPYIQLACMSYREGHFDDCET 420
           DPNMAAIYYHRGQMNFIIQKYEKAGEDFDKAKECDPTNIFPYIQLACMSYREGHFDDCET
Sbjct: 361 DPNMAAIYYHRGQMNFIIQKYEKAGEDFDKAKECDPTNIFPYIQLACMSYREGHFDDCET 420

Query: 421 LFSEARRKFPDAPEVPNFFAEILSDKGEIEKAAAEYDKAIELESKSENIHVGIAPLVGKA 480
           LFSEARRKFPDAPEVPNFFAEILSDKGEIEKAAAEYDKAIELESKSENIHVGIAPLVGKA
Sbjct: 421 LFSEARRKFPDAPEVPNFFAEILSDKGEIEKAAAEYDKAIELESKSENIHVGIAPLVGKA 480

Query: 481 TTLLKYPTVENFIEADDLFEQANNEDPRSEKAKMGLAQCKLQQEDLDDAIRLFEEAAILC 540
           TTLLKYPTVENFIEADDLFEQANNEDPRSEKAKMGLAQCKLQQEDLDDAIRLFEEAAILC
Sbjct: 481 TTLLKYPTVENFIEADDLFEQANNEDPRSEKAKMGLAQCKLQQEDLDDAIRLFEEAAILC 540

Query: 541 RTLDEKLQATTFAEATKVQMRVRADERLQAKTMKALDEIRRNGGQGF 587
           RTLDEKLQATTFAEATKVQMRVRADERLQAKTMKALDEIRRNGGQGF
Sbjct: 541 RTLDEKLQATTFAEATKVQMRVRADERLQAKTMKALDEIRRNGGQGF 587

>Kwal_33.14767 s33 complement(809994..811778) [1785 bp, 594 aa] {ON}
           YHR117W (TOM71) - 71-kDa component of the protein
           translocase of the outer membrane of mitochondria
           [contig 101] FULL
          Length = 594

 Score =  617 bits (1592), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 310/595 (52%), Positives = 420/595 (70%), Gaps = 15/595 (2%)

Query: 1   MSSDSNTVGFWVKNKKXXXXXXXXXXXXXXXYFYYKQVQELKKSLDDGNDVG-------- 52
           MSS+++   F  +NK                Y+YY+Q+Q  KK  +DG +VG        
Sbjct: 1   MSSENSLGQFVARNKTAIVASVAAGATAVGAYYYYQQLQ--KKPFEDGKEVGDEPKPSKK 58

Query: 53  --TASSKVEYKYLMIND--EPDIELMKLAETAEKNEYASELKKRGNAYFKVKDYENAINY 108
                 K +     +++  EPD+  +      EK+++A  LK +GN +FK K +E+A+ Y
Sbjct: 59  KKKGKKKTQGPSFPVDEKGEPDLGKVDELSAEEKDKFAMGLKDKGNEFFKNKQFEDALKY 118

Query: 109 YKFALQLKNDPVFYSNMAACYISLEHNKEAIEACSKALELNPDYSKVLLKRAAVYENIGK 168
           Y  A+++K DPVFYSN +ACY+SL   ++ +E  + AL+L PDYSK LL+RA+  E++GK
Sbjct: 119 YSLAIEVKEDPVFYSNRSACYVSLGQQEKVVEDTTAALKLKPDYSKCLLRRASANESLGK 178

Query: 169 FADALLDLTAVSLNGDYNDATIQPIVERVLNKQAMMALKDHLEASEKNKVLPSYTSMAAF 228
           FADA+ DL+AVSL GD+N ++I+P++ER +NKQAM+ LK+ LE  ++ K LPS TS+A+F
Sbjct: 179 FADAMFDLSAVSLYGDFNGSSIEPLLERNMNKQAMLVLKEKLEKQQEYK-LPSNTSLASF 237

Query: 229 FGVFDAETDIPGHDATEESDKILSDALTHLYSQTKEGYDRCDSEFTKATELYKAKLENDR 288
           FG+F  ET    +D   E+DK L D LT+LY +T  GY+  D+ F+KA + YK  LE++ 
Sbjct: 238 FGIFQPETSFENYDENSEADKALLDGLTNLYKRTSGGYEAADAAFSKARDEYKTLLEHNS 297

Query: 289 TNSVTNEKAAIAFEHTAILSFLKNDPLTARELVDEAIKLHPRPKSYIYLGLLMADKGLDE 348
            ++   +KAAIA EH  I  FLKNDP++A E + +A++  PRP +YIY+ L+MADKG   
Sbjct: 298 EDASLKQKAAIALEHVGIFKFLKNDPISAHEDLKKAVEYFPRPNTYIYMALIMADKGQAT 357

Query: 349 EYYSNFQKAIDLDPNMAAIYYHRGQMNFIIQKYEKAGEDFDKAKECDPTNIFPYIQLACM 408
           EY+ NF+KA++LDPN AA+YYHRGQM+FI Q++E+AG+DF+KAKE + +NIFPYIQLAC+
Sbjct: 358 EYFDNFEKALELDPNCAAVYYHRGQMHFITQQFEQAGKDFEKAKELNESNIFPYIQLACL 417

Query: 409 SYREGHFDDCETLFSEARRKFPDAPEVPNFFAEILSDKGEIEKAAAEYDKAIELESKSEN 468
           +YREG F D ETLFSEARRKFP +PEVPNF+AE LSDKG+I  A  EYD A +LES  + 
Sbjct: 418 TYREGKFSDSETLFSEARRKFPTSPEVPNFYAETLSDKGDIAGAKKEYDIAAKLESALDG 477

Query: 469 IHVGIAPLVGKATTLLKYPTVENFIEADDLFEQANNEDPRSEKAKMGLAQCKLQQEDLDD 528
           IHVG++PL+GKAT L + P+VENFIEA  LFEQA   DPRSE+AK+GLAQ KLQQED+D+
Sbjct: 478 IHVGVSPLIGKATLLSREPSVENFIEATRLFEQACENDPRSEQAKIGLAQLKLQQEDIDE 537

Query: 529 AIRLFEEAAILCRTLDEKLQATTFAEATKVQMRVRADERLQAKTMKALDEIRRNG 583
           AI LFEEAA L R+ DEKLQATTFAEATK+Q ++RAD  + AK  + L   R  G
Sbjct: 538 AIALFEEAADLARSFDEKLQATTFAEATKIQKKIRADPIVSAKIEETLAAYRAQG 592

>Smik_14.207 Chr14 complement(378339..380192) [1854 bp, 617 aa] {ON}
           YNL121C (REAL)
          Length = 617

 Score =  614 bits (1583), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 309/567 (54%), Positives = 405/567 (71%), Gaps = 20/567 (3%)

Query: 36  KQVQELKKSLDDGNDVGTASSKVEYKYLMINDEPDIELMKLAETAEKNEYASELKKRGNA 95
           K+V+  +K   DG++  TA S      +  N +PD          EK+ YA  LK +GN 
Sbjct: 50  KEVKGSQKKTKDGSE-STAESNTPVYPVSSNGDPDFSNKANFTAEEKDRYALALKDKGNQ 108

Query: 96  YFKVKDYENAINYYKFALQLKNDPVFYSNMAACYISLEHNKEAIEACSKALELNPDYSKV 155
           +F+ K Y++AI YY +AL+LK+DPVFYSN++ACY+S+   K+ +E  +KALEL PDYSKV
Sbjct: 109 FFRNKKYDDAIKYYNWALELKDDPVFYSNLSACYVSVGDLKKVVEMSTKALELKPDYSKV 168

Query: 156 LLKRAAVYENIGKFADALLDLTAVSLNGDYNDATIQPIVERVLNKQAMMALKDHL----- 210
           LL+RA+  E +G FADA+ DL+ +SLNGD+NDA+I+P++ER LNKQAM  LK+       
Sbjct: 169 LLRRASANEGLGNFADAMFDLSVLSLNGDFNDASIEPMLERNLNKQAMSKLKEKFGDIDT 228

Query: 211 --------------EASEKNKVLPSYTSMAAFFGVFDAETDIPGHDATEESDKILSDALT 256
                         E  +K + LPS TSMA+FFG+F  E     +D + E+DK L + LT
Sbjct: 229 ATATPTELSTQAPKELKDKTENLPSITSMASFFGIFKPELTFANYDESNEADKDLMNGLT 288

Query: 257 HLYSQTKEGYDRCDSEFTKATELYKAKLENDRTNSVTNEKAAIAFEHTAILSFLKNDPLT 316
           +LY ++ E YD+ D  FTKA +L+  +L+ +  +  + EK AI+ EHT I  FLKNDPL 
Sbjct: 289 NLYKRSPESYDKADESFTKAVKLFDEQLDKNNEDEKSKEKLAISLEHTGIFKFLKNDPLG 348

Query: 317 ARELVDEAIKLHPRPKSYIYLGLLMADKGLDEEYYSNFQKAIDLDPNMAAIYYHRGQMNF 376
           A E + +AI+L PR  SYIY+ L+MAD+    EYY+ F KA+ LD N +++YYHRGQMNF
Sbjct: 349 AHEDIKKAIELFPRVNSYIYMALIMADRNDSTEYYNYFDKALKLDSNNSSVYYHRGQMNF 408

Query: 377 IIQKYEKAGEDFDKAKECDPTNIFPYIQLACMSYREGHFDDCETLFSEARRKFPDAPEVP 436
           I+Q Y++AG+DFDKAKE DP NIFPYIQLAC++YRE  FDDCETLFSEA+RKFP+APEVP
Sbjct: 409 ILQNYDQAGKDFDKAKELDPENIFPYIQLACLAYRENKFDDCETLFSEAKRKFPEAPEVP 468

Query: 437 NFFAEILSDKGEIEKAAAEYDKAIELESKSENIHVGIAPLVGKATTLLKYPTVENFIEAD 496
           NFFAEIL+DK + EKA  +YD AIELE+K + I+VGIAPLVGKAT L + PTVENFIEA 
Sbjct: 469 NFFAEILTDKNDFEKALKQYDLAIELENKLDGIYVGIAPLVGKATLLTRNPTVENFIEAT 528

Query: 497 DLFEQANNEDPRSEKAKMGLAQCKLQQEDLDDAIRLFEEAAILCRTLDEKLQATTFAEAT 556
           +L E+A+  DPRSE+AK+GLAQ KLQQED+D+AI LFEE+A L RT++EKLQA TFAEA 
Sbjct: 529 NLLEEASKLDPRSEQAKIGLAQMKLQQEDIDEAITLFEESADLARTMEEKLQAITFAEAA 588

Query: 557 KVQMRVRADERLQAKTMKALDEIRRNG 583
           KVQ R+R+D  L AK  + L ++R  G
Sbjct: 589 KVQKRIRSDPILAAKIQETLAKLREQG 615

>YNL121C Chr14 complement(398684..400537) [1854 bp, 617 aa] {ON}
           TOM70Component of the TOM (translocase of outer
           membrane) complex responsible for recognition and
           initial import steps for all mitochondrially directed
           proteins; acts as a receptor for incoming precursor
           proteins
          Length = 617

 Score =  607 bits (1566), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 304/556 (54%), Positives = 396/556 (71%), Gaps = 19/556 (3%)

Query: 47  DGNDVGTASSKVEYKYLMINDEPDIELMKLAETAEKNEYASELKKRGNAYFKVKDYENAI 106
           +G    TA S      +  N EPD          EK++YA  LK +GN +F+ K Y++AI
Sbjct: 60  EGAKKSTAPSNPPIYPVSSNGEPDFSNKANFTAEEKDKYALALKDKGNQFFRNKKYDDAI 119

Query: 107 NYYKFALQLKNDPVFYSNMAACYISLEHNKEAIEACSKALELNPDYSKVLLKRAAVYENI 166
            YY +AL+LK DPVFYSN++ACY+S+   K+ +E  +KALEL PDYSKVLL+RA+  E +
Sbjct: 120 KYYNWALELKEDPVFYSNLSACYVSVGDLKKVVEMSTKALELKPDYSKVLLRRASANEGL 179

Query: 167 GKFADALLDLTAVSLNGDYNDATIQPIVERVLNKQAMMALKDHL---------------- 210
           GKFADA+ DL+ +SLNGD+NDA+I+P++ER LNKQAM  LK+                  
Sbjct: 180 GKFADAMFDLSVLSLNGDFNDASIEPMLERNLNKQAMSKLKEKFGDIDTATATPTELSTQ 239

Query: 211 ---EASEKNKVLPSYTSMAAFFGVFDAETDIPGHDATEESDKILSDALTHLYSQTKEGYD 267
              E  +K + LPS TSMA+FFG+F  E     +D + E+DK L + L++LY ++ E YD
Sbjct: 240 PAKERKDKQENLPSVTSMASFFGIFKPELTFANYDESNEADKELMNGLSNLYKRSPESYD 299

Query: 268 RCDSEFTKATELYKAKLENDRTNSVTNEKAAIAFEHTAILSFLKNDPLTARELVDEAIKL 327
           + D  FTKA  L++ +L+ +  +    EK AI+ EHT I  FLKNDPL A E + +AI+L
Sbjct: 300 KADESFTKAARLFEEQLDKNNEDEKLKEKLAISLEHTGIFKFLKNDPLGAHEDIKKAIEL 359

Query: 328 HPRPKSYIYLGLLMADKGLDEEYYSNFQKAIDLDPNMAAIYYHRGQMNFIIQKYEKAGED 387
            PR  SYIY+ L+MAD+    EYY+ F KA+ LD N +++YYHRGQMNFI+Q Y++AG+D
Sbjct: 360 FPRVNSYIYMALIMADRNDSTEYYNYFDKALKLDSNNSSVYYHRGQMNFILQNYDQAGKD 419

Query: 388 FDKAKECDPTNIFPYIQLACMSYREGHFDDCETLFSEARRKFPDAPEVPNFFAEILSDKG 447
           FDKAKE DP NIFPYIQLAC++YRE  FDDCETLFSEA+RKFP+APEVPNFFAEIL+DK 
Sbjct: 420 FDKAKELDPENIFPYIQLACLAYRENKFDDCETLFSEAKRKFPEAPEVPNFFAEILTDKN 479

Query: 448 EIEKAAAEYDKAIELESKSENIHVGIAPLVGKATTLLKYPTVENFIEADDLFEQANNEDP 507
           + +KA  +YD AIELE+K + I+VGIAPLVGKAT L + PTVENFIEA +L E+A+  DP
Sbjct: 480 DFDKALKQYDLAIELENKLDGIYVGIAPLVGKATLLTRNPTVENFIEATNLLEKASKLDP 539

Query: 508 RSEKAKMGLAQCKLQQEDLDDAIRLFEEAAILCRTLDEKLQATTFAEATKVQMRVRADER 567
           RSE+AK+GLAQ KLQQED+D+AI LFEE+A L RT++EKLQA TFAEA KVQ R+R+D  
Sbjct: 540 RSEQAKIGLAQMKLQQEDIDEAITLFEESADLARTMEEKLQAITFAEAAKVQQRIRSDPV 599

Query: 568 LQAKTMKALDEIRRNG 583
           L  K  + L ++R  G
Sbjct: 600 LAKKIQETLAKLREQG 615

>ZYRO0G06512g Chr7 complement(515759..517573) [1815 bp, 604 aa] {ON}
           similar to uniprot|P07213 Saccharomyces cerevisiae
           YNL121C TOM70 Translocase of Outer Mitochondrial
           membrane 70 kDa mitochondrial specialized import
           receptor of the outer membrane
          Length = 604

 Score =  606 bits (1563), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 315/603 (52%), Positives = 412/603 (68%), Gaps = 21/603 (3%)

Query: 1   MSSDSNTVGFWVKNKKXXXXXXXXXXXXXXXYFYYKQVQELKKSLDDGNDV--GTASSKV 58
           MSSD++  GF  +NK                Y YY+Q+Q+   S D   +   GTA+SK 
Sbjct: 1   MSSDNSVAGFISRNKTAIITTAAAGTAAVGAYLYYRQLQDAAGSDDKKGESPDGTAASKK 60

Query: 59  EYKYLM----------------INDEPDIELMKLAETAE--KNEYASELKKRGNAYFKVK 100
           + K                   ++++ + +L  +AE +E  K  +++ LK +GN +FK K
Sbjct: 61  KRKNKKKKQGSSPSPSAAVSYPVDEKGEPKLDNVAEMSEEQKESWSTALKDKGNEFFKQK 120

Query: 101 DYENAINYYKFALQLKNDPVFYSNMAACYISLEHNKEAIEACSKALELNPDYSKVLLKRA 160
           DY+NA+ YY +AL LK DPVFYSN++ACY+S+    + +E  +KALEL PDYSK LL+RA
Sbjct: 121 DYDNALKYYDYALTLKKDPVFYSNISACYVSMNQLDKVVENSTKALELKPDYSKALLRRA 180

Query: 161 AVYENIGKFADALLDLTAVSLNGDYNDATIQPIVERVLNKQAMMALKDHLEASEKNKVLP 220
           +  E++  + DA+ DL+ +SLNGD+  ++I+P++ER LNKQAM  LKD L   +KN++LP
Sbjct: 181 SANESLENYPDAMFDLSVLSLNGDFGGSSIEPMLERNLNKQAMTVLKDKL-GQQKNQLLP 239

Query: 221 SYTSMAAFFGVFDAETDIPGHDATEESDKILSDALTHLYSQTKEGYDRCDSEFTKATELY 280
           S T++A+FFG+F  ET+   +D T E+D+ L   L +LY ++ EGY + D  F++A + Y
Sbjct: 240 SDTALASFFGIFTPETEFANYDETSEADQKLKAGLENLYKRSSEGYQKADEFFSQAVDAY 299

Query: 281 KAKLENDRTNSVTNEKAAIAFEHTAILSFLKNDPLTARELVDEAIKLHPRPKSYIYLGLL 340
               E +  ++   EK AIA EH  I  FLKNDPL A E V +AI LHPR  SYIY+ L+
Sbjct: 300 AKLREGNSDDAALKEKDAIALEHRGIFRFLKNDPLGAHEDVQKAIDLHPRVNSYIYMALI 359

Query: 341 MADKGLDEEYYSNFQKAIDLDPNMAAIYYHRGQMNFIIQKYEKAGEDFDKAKECDPTNIF 400
           MADKG  EEYY  F KAI LDP  AA+YYHRGQM FI  +YEKAG+DFDKAK+ +  NIF
Sbjct: 360 MADKGKAEEYYEFFDKAIKLDPKNAAVYYHRGQMYFITAQYEKAGQDFDKAKQLNEENIF 419

Query: 401 PYIQLACMSYREGHFDDCETLFSEARRKFPDAPEVPNFFAEILSDKGEIEKAAAEYDKAI 460
           PYIQLAC++YRE  FDDCETLFSEA+RKF  APEVPNFFAEIL+DKG++EKA  +YD A 
Sbjct: 420 PYIQLACLAYRENKFDDCETLFSEAKRKFATAPEVPNFFAEILADKGDLEKALKQYDIAK 479

Query: 461 ELESKSENIHVGIAPLVGKATTLLKYPTVENFIEADDLFEQANNEDPRSEKAKMGLAQCK 520
            LE   + IHVGI+PLVGKAT L + P+VENFIEA  L E+A  +DPRSE+ K+GLAQ K
Sbjct: 480 RLEEAVDGIHVGISPLVGKATLLARQPSVENFIEATKLLEEACAKDPRSEQGKVGLAQLK 539

Query: 521 LQQEDLDDAIRLFEEAAILCRTLDEKLQATTFAEATKVQMRVRADERLQAKTMKALDEIR 580
           LQQED+DDAI+LFEEAA L RT+DEKLQATTFAEA KVQ R+RAD  + AK  + L   +
Sbjct: 540 LQQEDIDDAIKLFEEAASLARTVDEKLQATTFAEAAKVQKRIRADPLVSAKIEETLAAYK 599

Query: 581 RNG 583
             G
Sbjct: 600 AQG 602

>Suva_14.219 Chr14 complement(395316..397169) [1854 bp, 617 aa] {ON}
           YNL121C (REAL)
          Length = 617

 Score =  607 bits (1564), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 305/556 (54%), Positives = 393/556 (70%), Gaps = 19/556 (3%)

Query: 47  DGNDVGTASSKVEYKYLMINDEPDIELMKLAETAEKNEYASELKKRGNAYFKVKDYENAI 106
           +G+      SK     +  N EPD          EK++YA  LK +GN YF+ K Y++AI
Sbjct: 60  EGSKKSAGESKPPIYPVAANGEPDFSKKADFTAEEKDKYALALKDKGNQYFRNKKYDDAI 119

Query: 107 NYYKFALQLKNDPVFYSNMAACYISLEHNKEAIEACSKALELNPDYSKVLLKRAAVYENI 166
            YY +AL+LK DPVFYSN++ACY+S+   K+ +E  +KALEL PDYSKVLL+RA+  E +
Sbjct: 120 KYYNWALELKEDPVFYSNLSACYVSVGDLKKVVEMSTKALELKPDYSKVLLRRASANEGL 179

Query: 167 GKFADALLDLTAVSLNGDYNDATIQPIVERVLNKQAMMALKDHL---------------- 210
           G FADA+ DL+ +SLNGD+NDA+I+P++ER LNKQAM  LK+                  
Sbjct: 180 GNFADAMFDLSVLSLNGDFNDASIEPMLERNLNKQAMSRLKEKFGDIDAATATPTELSTQ 239

Query: 211 ---EASEKNKVLPSYTSMAAFFGVFDAETDIPGHDATEESDKILSDALTHLYSQTKEGYD 267
              E  +K + LPS TSMA+FFG+F  E      D + E+DK L + L +LY ++ + YD
Sbjct: 240 PPKERKDKQESLPSVTSMASFFGIFKPELTFANCDESNEADKELMNGLANLYKRSPDSYD 299

Query: 268 RCDSEFTKATELYKAKLENDRTNSVTNEKAAIAFEHTAILSFLKNDPLTARELVDEAIKL 327
           R D  FTKA +L++ +L+ D  +    EK AI+ EHT I  FLKNDPL A E + +AI L
Sbjct: 300 RADESFTKAVKLFEDQLDKDNEDEKVKEKLAISLEHTGIFKFLKNDPLGAHEDITKAIDL 359

Query: 328 HPRPKSYIYLGLLMADKGLDEEYYSNFQKAIDLDPNMAAIYYHRGQMNFIIQKYEKAGED 387
            PR  SYIY+ L+MAD+    EYY+ F KA+ LD N +++YYHRGQMNFI+Q Y++AG+D
Sbjct: 360 FPRVNSYIYMALIMADRNDSTEYYNYFDKALKLDLNNSSVYYHRGQMNFILQNYDQAGKD 419

Query: 388 FDKAKECDPTNIFPYIQLACMSYREGHFDDCETLFSEARRKFPDAPEVPNFFAEILSDKG 447
           FDKAKE DP NIFPYIQLAC++YRE  FDDCETLFSEA+RKFP+APEVPNFFAEIL+DK 
Sbjct: 420 FDKAKELDPENIFPYIQLACLAYRENKFDDCETLFSEAKRKFPEAPEVPNFFAEILTDKN 479

Query: 448 EIEKAAAEYDKAIELESKSENIHVGIAPLVGKATTLLKYPTVENFIEADDLFEQANNEDP 507
           + +KA  +YD AIELE+K E I+VGIAPLVGKAT L + PTVENFIEA +L E+A+  DP
Sbjct: 480 DFDKALKQYDLAIELENKLEGIYVGIAPLVGKATLLTRNPTVENFIEATNLLEKASKLDP 539

Query: 508 RSEKAKMGLAQCKLQQEDLDDAIRLFEEAAILCRTLDEKLQATTFAEATKVQMRVRADER 567
           RSE+AK+GLAQ KLQQED+D+AI LFEE+A L RT++EKLQA TFAEA KVQ R+R+D  
Sbjct: 540 RSEQAKIGLAQMKLQQEDIDEAIALFEESADLARTMEEKLQAITFAEAAKVQQRIRSDPV 599

Query: 568 LQAKTMKALDEIRRNG 583
           L  K  + L ++R  G
Sbjct: 600 LATKIQETLAKLREQG 615

>Skud_14.211 Chr14 complement(388749..390602) [1854 bp, 617 aa] {ON}
           YNL121C (REAL)
          Length = 617

 Score =  607 bits (1564), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 302/556 (54%), Positives = 396/556 (71%), Gaps = 19/556 (3%)

Query: 47  DGNDVGTASSKVEYKYLMINDEPDIELMKLAETAEKNEYASELKKRGNAYFKVKDYENAI 106
           +G+    + SK     +  N EPD          EK++YA  LK +GN YF+ K Y++AI
Sbjct: 60  EGSKKTASESKAPVYPVSSNGEPDFSKKANFTAEEKDKYALALKDKGNQYFRNKKYDDAI 119

Query: 107 NYYKFALQLKNDPVFYSNMAACYISLEHNKEAIEACSKALELNPDYSKVLLKRAAVYENI 166
            YY +AL+LK DPVFYSN++ACY+S+   K+ +E  +KALE+ PDYSKVLL+RA+  E +
Sbjct: 120 KYYNWALELKEDPVFYSNLSACYVSVGDLKKVVEMSTKALEIKPDYSKVLLRRASANEGL 179

Query: 167 GKFADALLDLTAVSLNGDYNDATIQPIVERVLNKQAMMALKDHL---------------- 210
           G FADA+ DL+ +SLNGD+NDA+I+P++ER LNKQAM  LK+                  
Sbjct: 180 GNFADAMFDLSVLSLNGDFNDASIEPMLERNLNKQAMSRLKEKFGDVDAATATPTELSTQ 239

Query: 211 ---EASEKNKVLPSYTSMAAFFGVFDAETDIPGHDATEESDKILSDALTHLYSQTKEGYD 267
              E  +K + LPS TSMA+FFG+F  E     +D   ++DK L D L +LY ++ E YD
Sbjct: 240 PPKERKDKQENLPSITSMASFFGIFKPELTFANYDEFNKADKELMDGLANLYKRSPESYD 299

Query: 268 RCDSEFTKATELYKAKLENDRTNSVTNEKAAIAFEHTAILSFLKNDPLTARELVDEAIKL 327
           R D  FTKA +L++ +L+    +    EK AI+ EHT I  FLKNDPL A E + +AI+L
Sbjct: 300 RADESFTKAAKLFEEQLDKSNEDEKLKEKLAISLEHTGIFKFLKNDPLGAHEDIKKAIEL 359

Query: 328 HPRPKSYIYLGLLMADKGLDEEYYSNFQKAIDLDPNMAAIYYHRGQMNFIIQKYEKAGED 387
            PR  SYIY+ L+MAD+    EYY+ F KA+ L+PN +++YYHRGQMNFI+Q Y++AG+D
Sbjct: 360 FPRVNSYIYMALIMADRNDSTEYYNYFDKALKLNPNNSSVYYHRGQMNFILQNYDQAGKD 419

Query: 388 FDKAKECDPTNIFPYIQLACMSYREGHFDDCETLFSEARRKFPDAPEVPNFFAEILSDKG 447
           FDKAKE DP NIFPYIQLAC++YRE  FDDCETLFSEA+RKFP+APEVPNFFAEIL+DK 
Sbjct: 420 FDKAKELDPENIFPYIQLACLAYRENKFDDCETLFSEAKRKFPEAPEVPNFFAEILTDKN 479

Query: 448 EIEKAAAEYDKAIELESKSENIHVGIAPLVGKATTLLKYPTVENFIEADDLFEQANNEDP 507
           + +KA  +YD AIELE+K + I+VGIAPLVGKAT L + PTVENF+EA +L E+A+  DP
Sbjct: 480 DFDKALKQYDLAIELENKLDRIYVGIAPLVGKATLLTRNPTVENFVEATNLLEKASKLDP 539

Query: 508 RSEKAKMGLAQCKLQQEDLDDAIRLFEEAAILCRTLDEKLQATTFAEATKVQMRVRADER 567
           RSE+AK+GLAQ KLQQED+D+AI LFEE+A L RT++EKLQA TFAEA KVQ ++R+D  
Sbjct: 540 RSEQAKIGLAQMKLQQEDIDEAIMLFEESADLARTMEEKLQAITFAEAAKVQQKIRSDPI 599

Query: 568 LQAKTMKALDEIRRNG 583
           L AK  + L ++R  G
Sbjct: 600 LAAKIQETLAKLREQG 615

>SAKL0E10956g Chr5 (916623..918425) [1803 bp, 600 aa] {ON} similar
           to uniprot|P07213 Saccharomyces cerevisiae YNL121C TOM70
           Translocase of Outer Mitochondrial membrane 70 kDa
           mitochondrial specialized import receptor of the outer
           membrane
          Length = 600

 Score =  600 bits (1547), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 295/518 (56%), Positives = 384/518 (74%), Gaps = 1/518 (0%)

Query: 66  NDEPDIELMKLAETAEKNEYASELKKRGNAYFKVKDYENAINYYKFALQLKNDPVFYSNM 125
           N EP ++ +      +K +YA  LK +GN +FK K +++AI YY  AL+LK DPVFYSN 
Sbjct: 82  NGEPKLDDIDQLTDEQKEKYAMGLKDKGNEFFKEKKFDDAIKYYNLALELKKDPVFYSNR 141

Query: 126 AACYISLEHNKEAIEACSKALELNPDYSKVLLKRAAVYENIGKFADALLDLTAVSLNGDY 185
           +ACY+S+   ++ +E  + AL+L  DYSK LL+RA+  E++G +ADA+ DL+A+SL GD+
Sbjct: 142 SACYVSMGQLEKVVEDTTAALKLKSDYSKCLLRRASANESLGNYADAMFDLSALSLYGDF 201

Query: 186 NDATIQPIVERVLNKQAMMALKDHLEASEKNKVLPSYTSMAAFFGVFDAETDIPGHDATE 245
           N A+I+P++ER +NKQAM+ LK+ LE  +K+  LPS TS+A+FFG+F+ ET    +D + 
Sbjct: 202 NGASIEPMLERNMNKQAMLVLKEKLE-EKKDHRLPSNTSLASFFGIFEPETSFENYDESV 260

Query: 246 ESDKILSDALTHLYSQTKEGYDRCDSEFTKATELYKAKLENDRTNSVTNEKAAIAFEHTA 305
           E+D++L   LT+LY +T EGYD  D  FTKA   YK  LE    N +  +KAAIA EH  
Sbjct: 261 EADRLLLQGLTNLYKRTSEGYDTADESFTKAAAAYKTLLEESPENEILKQKAAIALEHVG 320

Query: 306 ILSFLKNDPLTARELVDEAIKLHPRPKSYIYLGLLMADKGLDEEYYSNFQKAIDLDPNMA 365
           I  FLKNDPL+A + + +A++ HPR  SYIYL L+MADKG   EY+ NF KA++LDPN A
Sbjct: 321 IFKFLKNDPLSAHDDLKQALEYHPRVNSYIYLALIMADKGQATEYFENFDKALELDPNCA 380

Query: 366 AIYYHRGQMNFIIQKYEKAGEDFDKAKECDPTNIFPYIQLACMSYREGHFDDCETLFSEA 425
           A+YYHRGQM FI Q+YE AG+DFDKAKEC+  NIFPYIQLAC++YRE  F+DCETLFSEA
Sbjct: 381 AVYYHRGQMYFITQQYENAGKDFDKAKECNENNIFPYIQLACLAYRENKFEDCETLFSEA 440

Query: 426 RRKFPDAPEVPNFFAEILSDKGEIEKAAAEYDKAIELESKSENIHVGIAPLVGKATTLLK 485
           RRKFP APEVPNF+AEILSDKG++  A  +Y+ A +LE   + IHVGIAPLVGKAT L +
Sbjct: 441 RRKFPTAPEVPNFYAEILSDKGDLANAKKQYEIARKLEDALDGIHVGIAPLVGKATLLAR 500

Query: 486 YPTVENFIEADDLFEQANNEDPRSEKAKMGLAQCKLQQEDLDDAIRLFEEAAILCRTLDE 545
            PTVENF+EA   FE+A  +DPRSE+AK+GLAQ KLQQE++D+AI LFEEAA L R+ DE
Sbjct: 501 EPTVENFVEATQNFEEACEKDPRSEQAKIGLAQLKLQQEEVDEAITLFEEAADLARSFDE 560

Query: 546 KLQATTFAEATKVQMRVRADERLQAKTMKALDEIRRNG 583
           KLQATTFAEATK+Q ++RAD  + AK  + L   R  G
Sbjct: 561 KLQATTFAEATKIQKKIRADPIISAKIEETLAAYRAQG 598

>NCAS0G02480 Chr7 complement(440105..441895) [1791 bp, 596 aa] {ON}
           Anc_2.152
          Length = 596

 Score =  600 bits (1546), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 295/515 (57%), Positives = 374/515 (72%)

Query: 66  NDEPDIELMKLAETAEKNEYASELKKRGNAYFKVKDYENAINYYKFALQLKNDPVFYSNM 125
           N EP +  + L     K E+A  LK++GNA FK KD+ENAI YY FAL LK DPV+YSN+
Sbjct: 75  NGEPVLGDVDLLNDKTKEEWAGALKEKGNALFKKKDFENAIKYYTFALSLKEDPVYYSNI 134

Query: 126 AACYISLEHNKEAIEACSKALELNPDYSKVLLKRAAVYENIGKFADALLDLTAVSLNGDY 185
           +ACY SL + ++ IE  +KAL L PDYSKVL++RA  YE +G F DA+ DL+  SLN D 
Sbjct: 135 SACYSSLLNYEKVIEMATKALALRPDYSKVLVRRANAYEKLGNFGDAMFDLSVCSLNTDM 194

Query: 186 NDATIQPIVERVLNKQAMMALKDHLEASEKNKVLPSYTSMAAFFGVFDAETDIPGHDATE 245
           +DA+I+PI+ER LN+QAM  L   L  ++K   LPS T++ +FFG+F  E     +D T 
Sbjct: 195 SDASIEPILERNLNQQAMFVLNTKLGVTDKKSQLPSNTALTSFFGIFKPELSFANYDDTC 254

Query: 246 ESDKILSDALTHLYSQTKEGYDRCDSEFTKATELYKAKLENDRTNSVTNEKAAIAFEHTA 305
           E DK L + L +LY  T EGY+  D  FTKATE +  +L     +    EK AIA EH  
Sbjct: 255 EGDKELLNGLKNLYRCTAEGYETADLSFTKATEYFLKQLSETPDDETVKEKTAIALEHQG 314

Query: 306 ILSFLKNDPLTARELVDEAIKLHPRPKSYIYLGLLMADKGLDEEYYSNFQKAIDLDPNMA 365
           I  FLKN+PL A E + +A++LHPR  SYIY+ L++ADKG  + Y++N++KA+ LD   A
Sbjct: 315 IFKFLKNNPLEAHEDIKKALELHPRINSYIYMALILADKGDTDNYFANYEKAMKLDDKNA 374

Query: 366 AIYYHRGQMNFIIQKYEKAGEDFDKAKECDPTNIFPYIQLACMSYREGHFDDCETLFSEA 425
           A+YYHRGQM FI Q+YEKAGEDFDKAKE DP NIFPYIQLAC+SYRE  FDDCETLFSEA
Sbjct: 375 ALYYHRGQMYFITQQYEKAGEDFDKAKELDPENIFPYIQLACLSYRENKFDDCETLFSEA 434

Query: 426 RRKFPDAPEVPNFFAEILSDKGEIEKAAAEYDKAIELESKSENIHVGIAPLVGKATTLLK 485
           RRKFP++ EVPNF+AEIL+DKG+ + A  EY++AIELE K + +HVGIAPLVGKAT L++
Sbjct: 435 RRKFPNSSEVPNFYAEILADKGDFDAALKEYERAIELEKKQDAVHVGIAPLVGKATLLVR 494

Query: 486 YPTVENFIEADDLFEQANNEDPRSEKAKMGLAQCKLQQEDLDDAIRLFEEAAILCRTLDE 545
            PTVENF+EA  L E+A  EDPRSE+AK+ L Q KLQQED+D+AI LFE AA L RT +E
Sbjct: 495 TPTVENFVEATSLLEEAVKEDPRSEQAKISLGQLKLQQEDIDEAIELFESAATLARTFEE 554

Query: 546 KLQATTFAEATKVQMRVRADERLQAKTMKALDEIR 580
           KLQATTFAEA K+Q R+RAD ++ AK  + +  +R
Sbjct: 555 KLQATTFAEAAKIQKRIRADPKMSAKIQETIAALR 589

>KLTH0B05170g Chr2 (427608..429389) [1782 bp, 593 aa] {ON} similar
           to uniprot|P07213 Saccharomyces cerevisiae YNL121C TOM70
           Translocase of Outer Mitochondrial membrane 70 kDa
           mitochondrial specialized import receptor of the outer
           membrane
          Length = 593

 Score =  589 bits (1519), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 287/521 (55%), Positives = 388/521 (74%), Gaps = 3/521 (0%)

Query: 65  INDEPDIELMKLAETA--EKNEYASELKKRGNAYFKVKDYENAINYYKFALQLKNDPVFY 122
           +N++ + +L  LAE +  +K++YA  LK +GN +FK K Y+ AI YY +A+++K DPVFY
Sbjct: 72  VNEKGEPDLSNLAELSDEQKDKYAMGLKDKGNEFFKNKKYDEAIQYYSWAIEVKEDPVFY 131

Query: 123 SNMAACYISLEHNKEAIEACSKALELNPDYSKVLLKRAAVYENIGKFADALLDLTAVSLN 182
           SN +ACY+SL   ++ +E  + AL+L PDYSK LL+RA+  E++G FADA+ DL+AVSL 
Sbjct: 132 SNRSACYVSLGQQEKVVEDTTAALKLKPDYSKCLLRRASANESLGNFADAMFDLSAVSLY 191

Query: 183 GDYNDATIQPIVERVLNKQAMMALKDHLEASEKNKVLPSYTSMAAFFGVFDAETDIPGHD 242
           GD++ A+I+P++ER +NKQ+M+ LK+ LE  ++ K LPS TS+A+FFG+F  ET    +D
Sbjct: 192 GDFSGASIEPLLERNMNKQSMLVLKEKLEKQQEYK-LPSNTSLASFFGIFQPETTFENYD 250

Query: 243 ATEESDKILSDALTHLYSQTKEGYDRCDSEFTKATELYKAKLENDRTNSVTNEKAAIAFE 302
              E+DK L + LT+LY +T +GY+  D  F KA + +K  LE +  ++    KAAIA E
Sbjct: 251 DNSEADKYLLEGLTNLYKRTADGYETADLSFAKARDAFKVLLEQNPEDADLKRKAAIALE 310

Query: 303 HTAILSFLKNDPLTARELVDEAIKLHPRPKSYIYLGLLMADKGLDEEYYSNFQKAIDLDP 362
           H  I  FLKNDP++A E + +A++  PRP +YIY+ L+MADKG   EY+ NF+KA+ LDP
Sbjct: 311 HVGIFKFLKNDPISAHEDLKKAVEYFPRPNTYIYMALIMADKGQATEYFDNFEKALKLDP 370

Query: 363 NMAAIYYHRGQMNFIIQKYEKAGEDFDKAKECDPTNIFPYIQLACMSYREGHFDDCETLF 422
           + AA+YYHRGQM FI Q++E+AG+DF+KAKE   +NIFPYIQLAC++YREG FDD ETLF
Sbjct: 371 SCAAVYYHRGQMYFITQQFEQAGKDFEKAKELSESNIFPYIQLACLTYREGKFDDSETLF 430

Query: 423 SEARRKFPDAPEVPNFFAEILSDKGEIEKAAAEYDKAIELESKSENIHVGIAPLVGKATT 482
           SEARRKFP APEVPNF+AE LSDKG++  A  +YD A +LE   + IHVG++PL+GKAT 
Sbjct: 431 SEARRKFPTAPEVPNFYAETLSDKGDLAGARKQYDIAAKLEDALDGIHVGVSPLIGKATL 490

Query: 483 LLKYPTVENFIEADDLFEQANNEDPRSEKAKMGLAQCKLQQEDLDDAIRLFEEAAILCRT 542
           L + P+VENF+EA  LFE+A   DPRSE+AK+GLAQ KLQQED+D+AI LFEEAA L R+
Sbjct: 491 LSREPSVENFVEATQLFEKACQNDPRSEQAKIGLAQLKLQQEDIDEAIALFEEAADLARS 550

Query: 543 LDEKLQATTFAEATKVQMRVRADERLQAKTMKALDEIRRNG 583
            DEKLQATTFAEATK+Q ++RAD  + AK  + L   R  G
Sbjct: 551 FDEKLQATTFAEATKIQKKIRADPVVSAKIEETLAAYRAQG 591

>NDAI0F02810 Chr6 (690977..692806) [1830 bp, 609 aa] {ON} Anc_2.152
           YHR117W
          Length = 609

 Score =  585 bits (1507), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 298/605 (49%), Positives = 408/605 (67%), Gaps = 26/605 (4%)

Query: 1   MSSDSNTVGFWVKNKKXXXXXXXXXXXXXXXYFYYKQVQ-ELKKSLDDGNDVG------- 52
           MSSD++  GF  +N+                Y+YY Q+Q + ++++    D         
Sbjct: 1   MSSDNSIKGFVSRNRTAIIATIAAGTTAVGAYYYYTQLQAQQQENVRPKEDTDKSTATKK 60

Query: 53  ----------------TASSKVEYKYLMINDEPDIELMKLAETAEKNEYASELKKRGNAY 96
                           T ++K     +  N EP++  +       KNE+A  LK +GN  
Sbjct: 61  EKKKSKGKESKKPQEDTPTTKKPIYLVDSNGEPNLSDIDSLTEETKNEWAMALKDKGNEL 120

Query: 97  FKVKDYENAINYYKFALQLKNDPVFYSNMAACYISLEHNKEAIEACSKALELNPDYSKVL 156
           FK   +E+AI YY +AL+LK+DP++YSN++ACY SL   ++ IE  +KAL+L P +SKVL
Sbjct: 121 FKTSKFEDAIKYYHYALKLKDDPIYYSNISACYASLLQYEKVIEYATKALKLRPTFSKVL 180

Query: 157 LKRAAVYENIGKFADALLDLTAVSLNGDYNDATIQPIVERVLNKQAMMALKDHLEASEKN 216
           ++RA  YE +G F DA+ D++A SLNGD NDA+I+PI+ER+LNKQA   LK+ + A+ K 
Sbjct: 181 MRRALAYEAMGNFGDAMFDISACSLNGDMNDASIEPILERILNKQAEFVLKEKISAN-KE 239

Query: 217 KVLPSYTSMAAFFGVFDAETDIPGHDATEESDKILSDALTHLYSQTKEGYDRCDSEFTKA 276
           + LPS T +A+FF VF  ET    ++ + E+D+ L + LT+LY  ++EG+   D  F KA
Sbjct: 240 QNLPSSTPLASFFRVFKPETSFANYEESNEADRELMNGLTNLYKNSEEGFQIADKSFLKA 299

Query: 277 TELYKAKLENDRTNSVTNEKAAIAFEHTAILSFLKNDPLTARELVDEAIKLHPRPKSYIY 336
            EL+K +L  ++ N    EK AIA E++ IL ++KN+ L A + +  AI+LHPR  SYIY
Sbjct: 300 AELFKDQLSQNKDNEAIKEKTAIALEYSGILYYMKNETLKAHDSIKSAIELHPRVNSYIY 359

Query: 337 LGLLMADKGLDEEYYSNFQKAIDLDPNMAAIYYHRGQMNFIIQKYEKAGEDFDKAKECDP 396
             L+ +D     EY  NF KA++L+PN  AIYYHRGQ  FI Q+YEKAG+DFDK KE D 
Sbjct: 360 QSLIGSDSTTTSEYLQNFDKALELEPNNPAIYYHRGQSYFIAQQYEKAGKDFDKVKELDE 419

Query: 397 TNIFPYIQLACMSYREGHFDDCETLFSEARRKFPDAPEVPNFFAEILSDKGEIEKAAAEY 456
            NIF YIQLAC++YRE  FDDCETLFSEARRKFP APEVPNFFAE+L+D+GE EKA  E+
Sbjct: 420 NNIFAYIQLACLAYRESKFDDCETLFSEARRKFPTAPEVPNFFAEVLADRGESEKAMKEF 479

Query: 457 DKAIELESKS-ENIHVGIAPLVGKATTLLKYPTVENFIEADDLFEQANNEDPRSEKAKMG 515
           DKAIELE+K+ E IHVGIAPL+GKAT L+  PTVENF+E   L ++A ++DPRSE+A++G
Sbjct: 480 DKAIELEAKTPEEIHVGIAPLIGKATLLISKPTVENFVEGIQLLQEACDKDPRSEQARLG 539

Query: 516 LAQCKLQQEDLDDAIRLFEEAAILCRTLDEKLQATTFAEATKVQMRVRADERLQAKTMKA 575
           LAQ KLQQED+D+AI+LFEEAA L ++ +EKLQATTFAEA K+Q R+RAD  + AK  + 
Sbjct: 540 LAQLKLQQEDIDEAIQLFEEAAELAKSYEEKLQATTFAEAAKIQKRIRADPAMDAKIRQT 599

Query: 576 LDEIR 580
           ++++R
Sbjct: 600 IEQMR 604

>ABR131W Chr2 (641631..643415) [1785 bp, 594 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YNL121C (TOM70) and
           YHR117W (TOM71)
          Length = 594

 Score =  583 bits (1502), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 288/518 (55%), Positives = 371/518 (71%), Gaps = 1/518 (0%)

Query: 66  NDEPDIELMKLAETAEKNEYASELKKRGNAYFKVKDYENAINYYKFALQLKNDPVFYSNM 125
           N EPD+  M      +K +YA  LK +GN  FK + YE AI +Y  AL+LK DPVFYSN 
Sbjct: 75  NGEPDLSGMATFTEEQKEKYAMALKDKGNECFKDQRYEEAIKFYDCALKLKEDPVFYSNR 134

Query: 126 AACYISLEHNKEAIEACSKALELNPDYSKVLLKRAAVYENIGKFADALLDLTAVSLNGDY 185
           +ACY+ L   ++ +E  + AL+L PDYSK LL+RA   E++G +ADA+LDL+AVSL G Y
Sbjct: 135 SACYVPLNKLEKVVEDTTAALKLKPDYSKCLLRRATANESLGNYADAMLDLSAVSLYGGY 194

Query: 186 NDATIQPIVERVLNKQAMMALKDHLEASEKNKVLPSYTSMAAFFGVFDAETDIPGHDATE 245
           +  TI+P++ER +NKQAM  LK  L   EK++ LPS TS+A+FF +F +ET +  +D T 
Sbjct: 195 SSQTIEPVLERNMNKQAMQVLKQKLSGGEKHE-LPSNTSLASFFRIFPSETSLENYDETS 253

Query: 246 ESDKILSDALTHLYSQTKEGYDRCDSEFTKATELYKAKLENDRTNSVTNEKAAIAFEHTA 305
           E+D+IL   L  L+++    Y+  D  FT A E + A  E +  N+   +K AIA EH  
Sbjct: 254 EADRILLKGLCALHARQAGSYEIADEAFTDAVEKFTAAHEANPDNAALKQKLAIALEHVG 313

Query: 306 ILSFLKNDPLTARELVDEAIKLHPRPKSYIYLGLLMADKGLDEEYYSNFQKAIDLDPNMA 365
           IL FLKN+PL A  L+ +AI L PRP SYIY+GL+MADKG  +EY  NF+KA++LDP  +
Sbjct: 314 ILKFLKNEPLEAHNLLQKAIDLFPRPNSYIYMGLIMADKGQADEYAQNFEKALELDPKSS 373

Query: 366 AIYYHRGQMNFIIQKYEKAGEDFDKAKECDPTNIFPYIQLACMSYREGHFDDCETLFSEA 425
           A YYHR QMNF+IQ++++AG+DFDKAKECDP+ ++PYIQLAC++YRE  FDDCETLFSEA
Sbjct: 374 AAYYHRAQMNFVIQQFDQAGKDFDKAKECDPSRVYPYIQLACLAYREKKFDDCETLFSEA 433

Query: 426 RRKFPDAPEVPNFFAEILSDKGEIEKAAAEYDKAIELESKSENIHVGIAPLVGKATTLLK 485
           RR+FP APEVPNF+AEILSDKG+ E A  EYD A +LE   E IHVG+APLVGKA  L +
Sbjct: 434 RRRFPTAPEVPNFYAEILSDKGDFENALKEYDFARKLEDAQEGIHVGVAPLVGKAALLAR 493

Query: 486 YPTVENFIEADDLFEQANNEDPRSEKAKMGLAQCKLQQEDLDDAIRLFEEAAILCRTLDE 545
            P+  NF EA  LFE A  +DPRSE+AK+GLAQ KLQQE++D+AI+LFE AA L R  +E
Sbjct: 494 QPSASNFAEATKLFELACEKDPRSEQAKIGLAQLKLQQEEVDEAIKLFEAAADLSRAFEE 553

Query: 546 KLQATTFAEATKVQMRVRADERLQAKTMKALDEIRRNG 583
           KLQATTFAEA K+Q R+RAD  + AK  + LD  R  G
Sbjct: 554 KLQATTFAEAAKIQKRIRADPVMSAKIQETLDAYRAQG 591

>TDEL0B05140 Chr2 complement(904626..906425) [1800 bp, 599 aa] {ON}
           Anc_2.152 YHR117W
          Length = 599

 Score =  581 bits (1498), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 305/600 (50%), Positives = 395/600 (65%), Gaps = 20/600 (3%)

Query: 1   MSSDSNTVGFWVKNKKXXXXXXXXXXXXXXXYFYYKQVQELKKSLDDGNDVGTASSKVEY 60
           MSSD++   F  +NK                Y+YY+Q Q  + +LD+       S   + 
Sbjct: 1   MSSDNSVSSFVSRNKTAIIATAAAGSAAIGAYYYYRQAQ--RAALDEDEKGAEGSESSKK 58

Query: 61  KYLMI-----------------NDEPDIELMKLAETAEKNEYASELKKRGNAYFKVKDYE 103
           K                     N EP +E ++      +  YA+ LK RGN +FK KDY+
Sbjct: 59  KKKNKKKKSGENGGTPVYPVGQNGEPLLENIEELSQELRETYATALKDRGNEFFKKKDYD 118

Query: 104 NAINYYKFALQLKNDPVFYSNMAACYISLEHNKEAIEACSKALELNPDYSKVLLKRAAVY 163
           NA+ YY +AL +K DPVFYSN++ACY+SL    + +E  +KALEL PDYSK LL+RA+  
Sbjct: 119 NALKYYNYALVVKKDPVFYSNISACYVSLGQLDKVVENSTKALELKPDYSKALLRRASAN 178

Query: 164 ENIGKFADALLDLTAVSLNGDYNDATIQPIVERVLNKQAMMALKDHLEASEKNKVLPSYT 223
           E++  +ADA+ DL+ +SLNGD+N ++I+P++ER LNKQAM  LKD L  +  ++ LPS T
Sbjct: 179 ESLENYADAMFDLSVLSLNGDFNGSSIEPMLERNLNKQAMFVLKDKL-GNNVSQQLPSNT 237

Query: 224 SMAAFFGVFDAETDIPGHDATEESDKILSDALTHLYSQTKEGYDRCDSEFTKATELYKAK 283
           ++A+FFG+F  ET    ++  +E+D  L + L  LY ++ EGY   D  F K+   +  K
Sbjct: 238 ALASFFGIFPPETTFANYNENDEADVGLKNGLEDLYKRSSEGYKLADEAFVKSASFFTNK 297

Query: 284 LENDRTNSVTNEKAAIAFEHTAILSFLKNDPLTARELVDEAIKLHPRPKSYIYLGLLMAD 343
           L     ++V  EK AIA EH  I  FLKNDPL A + +++AI+LHPR  SYIY+ L+MAD
Sbjct: 298 LSEFPDDAVLKEKTAIALEHNGIFKFLKNDPLEAHDDIEKAIQLHPRLNSYIYMALIMAD 357

Query: 344 KGLDEEYYSNFQKAIDLDPNMAAIYYHRGQMNFIIQKYEKAGEDFDKAKECDPTNIFPYI 403
           KG  EEYY  F KAI LDPN    YYHRGQM +I  +YEKAG+DFDKAKECD  NIFPYI
Sbjct: 358 KGQAEEYYQYFDKAIALDPNYGPAYYHRGQMYYITGQYEKAGKDFDKAKECDENNIFPYI 417

Query: 404 QLACMSYREGHFDDCETLFSEARRKFPDAPEVPNFFAEILSDKGEIEKAAAEYDKAIELE 463
           QLAC++YRE  FDDCETLFSEA+RKFP APEVPNF+AEIL DKG++E A  +Y+ A  LE
Sbjct: 418 QLACLAYREDKFDDCETLFSEAKRKFPTAPEVPNFYAEILGDKGDLEAALKQYEIAKRLE 477

Query: 464 SKSENIHVGIAPLVGKATTLLKYPTVENFIEADDLFEQANNEDPRSEKAKMGLAQCKLQQ 523
              + IHVG+APLVGKAT L + P+VENF EA  L E+A   DP SE+AK+GLAQ KLQQ
Sbjct: 478 EALDGIHVGVAPLVGKATLLARQPSVENFREATLLLEEACRRDPTSEQAKVGLAQLKLQQ 537

Query: 524 EDLDDAIRLFEEAAILCRTLDEKLQATTFAEATKVQMRVRADERLQAKTMKALDEIRRNG 583
           E++D+AI LFEEAA L RT+DEKLQATTFAEA KVQ R++AD  + AK  + L   R  G
Sbjct: 538 EEVDEAINLFEEAANLARTVDEKLQATTFAEAAKVQKRIKADPVVSAKIEETLAAYRAQG 597

>Kpol_1048.21 s1048 complement(67975..69768) [1794 bp, 597 aa] {ON}
           complement(67975..69768) [1794 nt, 598 aa]
          Length = 597

 Score =  565 bits (1457), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 278/518 (53%), Positives = 372/518 (71%), Gaps = 1/518 (0%)

Query: 66  NDEPDIELMKLAETAEKNEYASELKKRGNAYFKVKDYENAINYYKFALQLKNDPVFYSNM 125
           N EPD++        +K  Y+  LK +GN +FK + YE+A+ YY +AL LK DPVFYSN+
Sbjct: 79  NGEPDLKDSANFTEEQKETYSVALKDKGNQFFKEQKYEDALKYYNYALDLKQDPVFYSNI 138

Query: 126 AACYISLEHNKEAIEACSKALELNPDYSKVLLKRAAVYENIGKFADALLDLTAVSLNGDY 185
           +ACY+SL + ++ +E+ +KALEL PDYSK LL+RA+  EN+  FA+A+ DL+ +SLNGD+
Sbjct: 139 SACYVSLGNLEKVVESSTKALELKPDYSKALLRRASANENLENFAEAMFDLSVLSLNGDF 198

Query: 186 NDATIQPIVERVLNKQAMMALKDHLEASEKNKVLPSYTSMAAFFGVFDAETDIPGHDATE 245
           N+A+I+P++ER LNKQAM  LKD + +  K + LPS T +A+FFG+F  ET +   D + 
Sbjct: 199 NEASIEPMLERNLNKQAMRVLKDKMSSDAKQQ-LPSNTFLASFFGIFTPETTLKNFDESN 257

Query: 246 ESDKILSDALTHLYSQTKEGYDRCDSEFTKATELYKAKLENDRTNSVTNEKAAIAFEHTA 305
           E+D  L +AL +LY +  E Y   D  F+KA E Y  +LE +  + V  EK A A E+  
Sbjct: 258 EADVELLNALVNLYKRKSESYLIADESFSKAAESYVKQLEANPDDEVLKEKTATALEYNG 317

Query: 306 ILSFLKNDPLTARELVDEAIKLHPRPKSYIYLGLLMADKGLDEEYYSNFQKAIDLDPNMA 365
           I  FLKNDPL + E +  +I+LHPR  +YIY  L+MADKG  + Y+  F KA+D+DPN A
Sbjct: 318 IFKFLKNDPLGSHEDIQRSIELHPRVNAYIYSALIMADKGESKNYFDFFDKALDVDPNSA 377

Query: 366 AIYYHRGQMNFIIQKYEKAGEDFDKAKECDPTNIFPYIQLACMSYREGHFDDCETLFSEA 425
            +YYHRGQM+F+ Q+YEKA  DF+KAKE D +NIFPYIQLAC++Y EG FDDCETLFSEA
Sbjct: 378 PVYYHRGQMHFLSQQYEKAAADFEKAKESDSSNIFPYIQLACLTYHEGKFDDCETLFSEA 437

Query: 426 RRKFPDAPEVPNFFAEILSDKGEIEKAAAEYDKAIELESKSENIHVGIAPLVGKATTLLK 485
           +RKFP APEVPNF+AE+L+DKG+ + A+ +YD A  LE   + IHVG++PLVGKAT L +
Sbjct: 438 KRKFPTAPEVPNFYAEVLTDKGDFDAASKQYDIAKRLEESLDAIHVGVSPLVGKATLLAR 497

Query: 486 YPTVENFIEADDLFEQANNEDPRSEKAKMGLAQCKLQQEDLDDAIRLFEEAAILCRTLDE 545
            PTVEN +E+  L E+A   D RSE+AK+GLAQ KLQQE++D+AI LFEEA+ L R ++E
Sbjct: 498 QPTVENLLESTTLLEEACKMDSRSEQAKIGLAQLKLQQEEIDEAITLFEEASDLARNMEE 557

Query: 546 KLQATTFAEATKVQMRVRADERLQAKTMKALDEIRRNG 583
           KLQATTFAEA+KVQ ++RAD  + AK    L   R  G
Sbjct: 558 KLQATTFAEASKVQKKIRADPVVNAKIQATLAAYREQG 595

>KLLA0F24046g Chr6 (2240454..2242268) [1815 bp, 604 aa] {ON} similar
           to uniprot|P07213 Saccharomyces cerevisiae YNL121C TOM70
           Translocase of Outer Mitochondrial membrane 70 kDa
           mitochondrial specialized import receptor of the outer
           membrane
          Length = 604

 Score =  561 bits (1446), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 275/519 (52%), Positives = 375/519 (72%), Gaps = 1/519 (0%)

Query: 66  NDEPDIELMKLAETAEKNEYASELKKRGNAYFKVKDYENAINYYKFALQLKNDPVFYSNM 125
           N +PD+         + ++YA  LK +GN +FK KD+E AI YY  A+ LK DPVFYSN 
Sbjct: 84  NGQPDLSKKDEFTPEQVDKYALALKDKGNEFFKAKDFEKAIEYYTLAISLKEDPVFYSNR 143

Query: 126 AACYISLEHNKEAIEACSKALELNPDYSKVLLKRAAVYENIGKFADALLDLTAVSLNGDY 185
           +A Y+S+ + ++ +E  + AL+L PDYSK  L+RA+ YEN+G+F+DA+ DL+AVSL G+Y
Sbjct: 144 SAAYVSINNFEKVVEDTTAALKLKPDYSKCWLRRASAYENLGQFSDAMFDLSAVSLLGEY 203

Query: 186 NDATIQPIVERVLNKQAMMALKDHLEASE-KNKVLPSYTSMAAFFGVFDAETDIPGHDAT 244
           +  +++ ++ER +NKQA   L + L+ ++ K   LPS TS+A+FFG+F+ ET    +D  
Sbjct: 204 SGQSVEQLLERNMNKQATKVLGEKLKENQGKESPLPSNTSLASFFGIFNPETSFDDYDGE 263

Query: 245 EESDKILSDALTHLYSQTKEGYDRCDSEFTKATELYKAKLENDRTNSVTNEKAAIAFEHT 304
            E+D  L   L +LY      Y+  D EFTKA ELYK +LE+   N    +KAAIAFEH 
Sbjct: 264 NEADVELKKGLENLYKCQTGCYELADEEFTKAAELYKKELESSPDNESLKKKAAIAFEHV 323

Query: 305 AILSFLKNDPLTARELVDEAIKLHPRPKSYIYLGLLMADKGLDEEYYSNFQKAIDLDPNM 364
            I  F KNDP+TA   ++E++ L+PRP +YIY+ L+MADKG   +Y   F KA++LDPN 
Sbjct: 324 GIFKFFKNDPITAHINLEESLSLNPRPSTYIYMALIMADKGEANQYKEYFDKALELDPNC 383

Query: 365 AAIYYHRGQMNFIIQKYEKAGEDFDKAKECDPTNIFPYIQLACMSYREGHFDDCETLFSE 424
           +A+YYHRGQM+F+++ +++AG DFDKAKE +P NIF YIQ AC+++R+  FDDCETLFSE
Sbjct: 384 SAVYYHRGQMHFVVENFKEAGADFDKAKELNPENIFAYIQCACLAFRDDRFDDCETLFSE 443

Query: 425 ARRKFPDAPEVPNFFAEILSDKGEIEKAAAEYDKAIELESKSENIHVGIAPLVGKATTLL 484
           ARRKFP APEVPNF+AEIL+ K  ++ A  +YD AI+LE     IHVGIAP++GKAT L+
Sbjct: 444 ARRKFPTAPEVPNFYAEILAAKNSLDAAIKQYDIAIKLEDALPGIHVGIAPMIGKATALI 503

Query: 485 KYPTVENFIEADDLFEQANNEDPRSEKAKMGLAQCKLQQEDLDDAIRLFEEAAILCRTLD 544
           + PTVENF+EA +LFE+A   DPRSE+AK+GLAQ KLQQE++DDAI+LFE+AA L R+ D
Sbjct: 504 RNPTVENFVEASELFEEACKIDPRSEQAKIGLAQLKLQQEEIDDAIQLFEDAADLSRSFD 563

Query: 545 EKLQATTFAEATKVQMRVRADERLQAKTMKALDEIRRNG 583
           EKLQATTFAEATKVQ ++RAD  ++ K  +A+   R  G
Sbjct: 564 EKLQATTFAEATKVQKKIRADPFIKGKIDEAIAAYRAQG 602

>Ecym_8204 Chr8 complement(419900..421693) [1794 bp, 597 aa] {ON}
           similar to Ashbya gossypii ABR131W
          Length = 597

 Score =  560 bits (1444), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 280/518 (54%), Positives = 359/518 (69%), Gaps = 1/518 (0%)

Query: 66  NDEPDIELMKLAETAEKNEYASELKKRGNAYFKVKDYENAINYYKFALQLKNDPVFYSNM 125
           N EPD+  +      +K  Y+  +K +GN  FK K YE AI YY  AL+LK DPVFYSN 
Sbjct: 78  NGEPDLSGVDSFTEEQKERYSMAMKDKGNECFKEKKYEEAIKYYSCALRLKKDPVFYSNR 137

Query: 126 AACYISLEHNKEAIEACSKALELNPDYSKVLLKRAAVYENIGKFADALLDLTAVSLNGDY 185
           +AC++ L   ++ +E  + ALEL PDYSK LL+RA   E++G FADA+LDL+AVSL G Y
Sbjct: 138 SACWVPLNKLEKVVEDTTAALELKPDYSKCLLRRATANESLGNFADAMLDLSAVSLYGGY 197

Query: 186 NDATIQPIVERVLNKQAMMALKDHLEASEKNKVLPSYTSMAAFFGVFDAETDIPGHDATE 245
           N  +I+P++ER +NKQAM  LK  L    K++ LPS TS+A+FFG+F +ET    +D   
Sbjct: 198 NSQSIEPVLERNMNKQAMQVLKRKLADGSKHQ-LPSNTSLASFFGIFPSETSFANYDEQS 256

Query: 246 ESDKILSDALTHLYSQTKEGYDRCDSEFTKATELYKAKLENDRTNSVTNEKAAIAFEHTA 305
           E+D  L   L  L  +    Y+  D  F KA +L     + D  +     K AIA EH  
Sbjct: 257 EADNFLLKGLRCLSERKTGSYEMSDEYFNKAADLLSLSHQADSEDPALRMKLAIALEHVG 316

Query: 306 ILSFLKNDPLTARELVDEAIKLHPRPKSYIYLGLLMADKGLDEEYYSNFQKAIDLDPNMA 365
           I  FLKN+PL A +L+ +A+ LHPRP SYIY+ L+MADKG  +EY   F KA++L PN +
Sbjct: 317 IFKFLKNEPLEAYKLLQKAVDLHPRPNSYIYMALIMADKGQTDEYLQYFDKALELAPNSS 376

Query: 366 AIYYHRGQMNFIIQKYEKAGEDFDKAKECDPTNIFPYIQLACMSYREGHFDDCETLFSEA 425
           A+YYHRGQM F+ Q++EK+G+DFDKAKEC+P NIFPYIQLAC++YRE  F+DCETLFSEA
Sbjct: 377 AVYYHRGQMYFVTQQFEKSGKDFDKAKECNPDNIFPYIQLACLAYRENKFEDCETLFSEA 436

Query: 426 RRKFPDAPEVPNFFAEILSDKGEIEKAAAEYDKAIELESKSENIHVGIAPLVGKATTLLK 485
           RRKFP APEVPNF+AEILSDKG++E A  EY+ A +LE   E IHVG+APLVGKAT L +
Sbjct: 437 RRKFPTAPEVPNFYAEILSDKGDLESALKEYEFARKLEDAQEGIHVGVAPLVGKATVLAR 496

Query: 486 YPTVENFIEADDLFEQANNEDPRSEKAKMGLAQCKLQQEDLDDAIRLFEEAAILCRTLDE 545
                +F EA  LFE+A  +DPRSE+AK+GLAQ KLQQE +D+AI+LFEEA  L R  +E
Sbjct: 497 QSHSGDFAEATALFEEACKKDPRSEQAKIGLAQLKLQQEQVDEAIQLFEEATDLARAFEE 556

Query: 546 KLQATTFAEATKVQMRVRADERLQAKTMKALDEIRRNG 583
           KLQATTFAEA K+Q R+RAD  + AK  + L+  R  G
Sbjct: 557 KLQATTFAEAAKIQKRIRADPIMSAKIQETLEAYRVQG 594

>CAGL0L12936g Chr12 (1382623..1384425) [1803 bp, 600 aa] {ON}
           similar to uniprot|P07213 Saccharomyces cerevisiae
           YNL121c TOM70 or uniprot|P38825 Saccharomyces cerevisiae
           YHR117w TOM7
          Length = 600

 Score =  559 bits (1440), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 280/527 (53%), Positives = 371/527 (70%), Gaps = 13/527 (2%)

Query: 62  YLMIN---DEPDIELMKLAETAEKNEYASELKKRGNAYFKVKDYENAINYYKFALQLKND 118
           YL IN   ++PD+  M  +   +K  YA+ LK +GNA FK K +E+AI +Y  A++L  D
Sbjct: 66  YLTINGDEEKPDMAAMLASSEDQKKVYATALKDKGNALFKEKRFEDAIEFYNHAIKLHED 125

Query: 119 PVFYSNMAACYISLEHNKEAIEACSKALELNPDYSKVLLKRAAVYENIGKFADALLDLTA 178
           PVF+SN++ACY+SL    + +E+ ++ALEL PDYSK LL+RA+ YEN+G++ DA+ D++ 
Sbjct: 126 PVFHSNISACYVSLGDLDKVVESSTRALELKPDYSKALLRRASAYENMGRYQDAMFDISV 185

Query: 179 VSLNGDYNDATIQPIVERVLNKQAMMALKDHL---------EASEKNKVLPSYTSMAAFF 229
           +SLNGD+N ++I+P++ER LNKQA+  LK+ +         E   + + LPS TS+++FF
Sbjct: 186 LSLNGDFNGSSIEPMLERNLNKQALRVLKEDMGIDASVPQAEQPRERQELPSNTSLSSFF 245

Query: 230 GVFDAETDIPGHDATEESDKILSDALTHLYSQTKEGYDRCDSEFTKATELYKAKLENDRT 289
           G+F  ET+IP +D + E+D  L   L  LY  T +GY   D  F KA +LY+ +L N+  
Sbjct: 246 GIFKPETEIPAYDESNEADVTLVRGLKALYGATSDGYQLADECFAKAAKLYREQLANN-N 304

Query: 290 NSVTNEKAAIAFEHTAILSFLKNDPLTARELVDEAIKLHPRPKSYIYLGLLMADKGLDEE 349
           ++   EKAA A E+  I  FLKND   + + + EA+ LHPR  +YIYL L MAD+G  E+
Sbjct: 305 DAAFKEKAATALEYLGIFDFLKNDLDNSEKNLKEALALHPRVNTYIYLALTMADRGQSED 364

Query: 350 YYSNFQKAIDLDPNMAAIYYHRGQMNFIIQKYEKAGEDFDKAKECDPTNIFPYIQLACMS 409
           Y+S F+KAI LDPN AA+YYHRGQM FI Q YEKAGEDF K+KE DP NIFPYIQLAC++
Sbjct: 365 YFSYFEKAIALDPNNAAVYYHRGQMYFITQNYEKAGEDFKKSKESDPKNIFPYIQLACLA 424

Query: 410 YREGHFDDCETLFSEARRKFPDAPEVPNFFAEILSDKGEIEKAAAEYDKAIELESKSENI 469
           YRE    +CE LF EAR+ FP APEVPNF+AEIL+DKG+I++A  +Y+ A  LES  + I
Sbjct: 425 YRENKMAECEKLFEEARKTFPTAPEVPNFYAEILADKGDIDEAVKQYNIAYRLESLQKQI 484

Query: 470 HVGIAPLVGKATTLLKYPTVENFIEADDLFEQANNEDPRSEKAKMGLAQCKLQQEDLDDA 529
           HVGIAPLVGKAT L + PT ENF     L E A   DPRSE+AK+GLAQ +LQQE +D+A
Sbjct: 485 HVGIAPLVGKATILARQPTPENFATISQLLEDACKADPRSEQAKVGLAQLRLQQEKVDEA 544

Query: 530 IRLFEEAAILCRTLDEKLQATTFAEATKVQMRVRADERLQAKTMKAL 576
           I LFEEAA + RT+DEKLQA TFAEATKVQ R+RAD  +  K  + L
Sbjct: 545 IELFEEAAKMARTVDEKLQAITFAEATKVQKRIRADPVVSKKVEETL 591

>TPHA0I01510 Chr9 complement(342661..344472) [1812 bp, 603 aa] {ON}
           Anc_2.152 YHR117W
          Length = 603

 Score =  558 bits (1437), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 294/601 (48%), Positives = 399/601 (66%), Gaps = 21/601 (3%)

Query: 2   SSDSNTVGFWVKNKKXXXXXXXXXXXXXXXYFYYKQVQE-------------------LK 42
           +SD +  GF  +NK                Y+YY Q+Q                      
Sbjct: 3   ASDGSVGGFIARNKTAIIATVAAGSAALGAYYYYTQLQRQIDDSSSSKKKKKKHSKKKKS 62

Query: 43  KSLDDGNDVGTASSKVEYKYLMINDEPDIELMKLAETAEKNEYASELKKRGNAYFKVKDY 102
            S D+ ++    ++KV Y  +  N EPD+          K +YA  LK +GN YFK +D+
Sbjct: 63  TSTDEKSNSKNETAKVIYP-VASNGEPDLSGKDSFSDELKEKYAMALKDKGNDYFKKQDF 121

Query: 103 ENAINYYKFALQLKNDPVFYSNMAACYISLEHNKEAIEACSKALELNPDYSKVLLKRAAV 162
           ENA+ YY +AL LK DPVFYSN++ACY+SL   ++ +E+ ++AL+L  DYSK LL+RA+ 
Sbjct: 122 ENALKYYNYALTLKQDPVFYSNISACYVSLGQLEKVVESSTEALKLKHDYSKALLRRASA 181

Query: 163 YENIGKFADALLDLTAVSLNGDYNDATIQPIVERVLNKQAMMALKDHLEASEKNKVLPSY 222
           YE++  + DA++DL+ +SLNGD+N A+I+P++ER LNKQAM  LK+ + A  K ++LPS 
Sbjct: 182 YESLANYVDAMVDLSVLSLNGDFNGASIEPMLERNLNKQAMQVLKEKI-AENKPQLLPSN 240

Query: 223 TSMAAFFGVFDAETDIPGHDATEESDKILSDALTHLYSQTKEGYDRCDSEFTKATELYKA 282
           TS+A+FFGVF  E  +   +   ES+K L + LT+LYS+T +GY   D  F KA +L + 
Sbjct: 241 TSLASFFGVFKPEVSLNNFNENSESEKELLNGLTNLYSRTNDGYLVADESFQKAVKLLEK 300

Query: 283 KLENDRTNSVTNEKAAIAFEHTAILSFLKNDPLTARELVDEAIKLHPRPKSYIYLGLLMA 342
           + E ++ N+   EK AIA E+  IL FLKNDPL A   + +AI + PR  SYIY  L++A
Sbjct: 301 EYEENKENNDIKEKYAIALEYNGILKFLKNDPLDAHNDIQKAIFIFPRVNSYIYNSLILA 360

Query: 343 DKGLDEEYYSNFQKAIDLDPNMAAIYYHRGQMNFIIQKYEKAGEDFDKAKECDPTNIFPY 402
           DKG  EE   NF  AI+LD   AA YYHRGQ+ F+ Q+YEKAG DFDKAKE D +NI PY
Sbjct: 361 DKGETEESIKNFDAAINLDATNAATYYHRGQLYFLTQQYEKAGIDFDKAKELDESNILPY 420

Query: 403 IQLACMSYREGHFDDCETLFSEARRKFPDAPEVPNFFAEILSDKGEIEKAAAEYDKAIEL 462
           IQLAC++Y+E  F+DCETLFSEARRKFP APEVPNF+A++L ++ E +KA  +YD + +L
Sbjct: 421 IQLACLAYKENKFNDCETLFSEARRKFPTAPEVPNFYADVLLERNEFDKALKQYDISKKL 480

Query: 463 ESKSENIHVGIAPLVGKATTLLKYPTVENFIEADDLFEQANNEDPRSEKAKMGLAQCKLQ 522
           E   E IHVGIAP++GKAT L + P VEN +E+ +LFE+A   DPRSE+AK+GLAQ KLQ
Sbjct: 481 EEAVEGIHVGIAPMIGKATLLARNPIVENLLESTELFEEACKLDPRSEQAKIGLAQLKLQ 540

Query: 523 QEDLDDAIRLFEEAAILCRTLDEKLQATTFAEATKVQMRVRADERLQAKTMKALDEIRRN 582
           QE++D+AI LFEEAA L R +DEKLQATTFAEA+KVQ +VR+D  +  K  + L   ++ 
Sbjct: 541 QEEVDEAIALFEEAAFLARNMDEKLQATTFAEASKVQKKVRSDPVINQKIQETLAAYQQQ 600

Query: 583 G 583
           G
Sbjct: 601 G 601

>TBLA0C05530 Chr3 complement(1338666..1340498) [1833 bp, 610 aa]
           {ON} Anc_2.152 YHR117W
          Length = 610

 Score =  550 bits (1416), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 278/516 (53%), Positives = 367/516 (71%), Gaps = 2/516 (0%)

Query: 66  NDEPDIELMKLAETAEKNEYASELKKRGNAYFKVKDYENAINYYKFALQLKNDPVFYSNM 125
           N EP+++        EK +Y+  LK +GN+ FK   +E AI YY +A++LK +P+FYSN+
Sbjct: 91  NGEPNLDNKDQFTEEEKEKYSIALKDKGNSLFKADKFEEAIKYYNWAIELKENPIFYSNL 150

Query: 126 AACYISLEHNKEAIEACSKALELNPDYSKVLLKRAAVYENIGKFADALLDLTAVSLNGDY 185
           +ACY+SL   +E I+ C+KALEL PDYSKVLL+RA   E +  +ADA+ DL+ +SLNGDY
Sbjct: 151 SACYVSLNKLEEIIKYCNKALELKPDYSKVLLRRANANEKLENYADAMFDLSVLSLNGDY 210

Query: 186 NDATIQPIVERVLNKQAMMALKDHLEASEKNKVLPSYTSMAAFFGVFDAETDIPGHDATE 245
           N A+I+PI+ER LNKQAM  LKD L+ S K+  LPS TS++AFFG+F  E     +D T 
Sbjct: 211 NGASIEPILERNLNKQAMSVLKDKLKNS-KDDQLPSDTSLSAFFGIFKPELSFENYDETN 269

Query: 246 ESDKILSDALTHLYSQTKEGYDRCDSEFTKATELYKAKLENDRTNSVTNEKAAIAFEHTA 305
           ++DK L + LTHL+ +  E Y   D  F  A ELY  +LE    ++    KA+IA+E+  
Sbjct: 270 DADKELLNGLTHLFKRQSESYLIADKSFMNALELYIKQLEETPDDTDLKVKASIAYEYAG 329

Query: 306 ILSFLKNDPLTARELVDEAIKLHPRPKSYIYLGLLMADKGLDEEYYSNFQKAIDLDPNMA 365
           I +FLKND   A E +D++IKL+PR  SYIY  L++ADKG  ++Y   F KA+ LD    
Sbjct: 330 IFNFLKNDLSGATENIDKSIKLNPRINSYIYRALIIADKGESQDYLDYFDKALKLDDKSC 389

Query: 366 AIYYHRGQMNFIIQKYEKAGEDFDKAKECDPTNIFPYIQLACMSYREGHFDDCETLFSEA 425
           A+YYHR Q+NF+ Q + KA  DF+KAKECDPTNIFPYIQLAC++YRE  FDDCETLFSEA
Sbjct: 390 AVYYHRAQLNFVTQDFAKAAVDFEKAKECDPTNIFPYIQLACLTYRENKFDDCETLFSEA 449

Query: 426 RRKFPDAPEVPNFFAEILSDKGEIEKAAAEYDKAIELESKSEN-IHVGIAPLVGKATTLL 484
           +RKFP  PEVPNF+AE+L+DKG+ + A   Y+ A  LE  S++ IHVG+APL+GKAT L 
Sbjct: 450 KRKFPTLPEVPNFYAEVLTDKGDFDNAMKNYETARRLEEASKDGIHVGVAPLIGKATLLA 509

Query: 485 KYPTVENFIEADDLFEQANNEDPRSEKAKMGLAQCKLQQEDLDDAIRLFEEAAILCRTLD 544
           + PT+EN   AD L E+AN  DPRSE+AK+GLAQ KLQ+E++D++IRLFEE+A L RT++
Sbjct: 510 REPTLENLAAADKLLEEANRIDPRSEQAKIGLAQLKLQKEEIDESIRLFEESADLARTME 569

Query: 545 EKLQATTFAEATKVQMRVRADERLQAKTMKALDEIR 580
           EKLQATTFAEA KVQ  +RAD  +  K  + L   R
Sbjct: 570 EKLQATTFAEAAKVQKMIRADPIISKKIEETLAAYR 605

>KNAG0H03530 Chr8 (657450..659294) [1845 bp, 614 aa] {ON} Anc_2.152
           YHR117W
          Length = 614

 Score =  539 bits (1388), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 281/525 (53%), Positives = 361/525 (68%), Gaps = 9/525 (1%)

Query: 68  EPDIELMKLAETAEKNEYASELKKRGNAYFKVKDYENAINYYKFALQLKNDPVFYSNMAA 127
           EPD+  +      ++  YA  LK +GN  FK K  E AI YY++AL+ K DPVFY+N++A
Sbjct: 88  EPDLSQLDSYTPEQRETYALALKDKGNELFKEKAVEEAIKYYQWALEFKKDPVFYANISA 147

Query: 128 CYISLEHNKEAIEACSKALELNPDYSKVLLKRAAVYENIGKFADALLDLTAVSLNGDYND 187
           CY+SL   ++ +E C+KALEL PDYSKVLL+RA  YEN+  FADA+ DL+ +SLN D++ 
Sbjct: 148 CYVSLNDFEKVLENCNKALELKPDYSKVLLRRANTYENMENFADAMFDLSVLSLNNDFSG 207

Query: 188 ATIQPIVERVLNKQAMMALKDHLEASEKN--KVLPSYTSMAAFFGVFDAETDIPGHDATE 245
           A+I+P++ER LNKQAM  LK+ LE ++    + LPS TSMA+FFG+F  ET+  G+D T 
Sbjct: 208 ASIEPMLERNLNKQAMKMLKERLENTQDKFEQPLPSDTSMASFFGIFKPETEFKGYDETC 267

Query: 246 ESDKILSDALTHLYSQTKEGYDRCDSEFTKAT----ELYKAKLENDRTNSVTNEKAAIAF 301
           E+D+ L   L  L++ T  G+ + D+ F +A     EL+    + ++     NEK AIA 
Sbjct: 268 EADRTLQTGLLELFAATHVGFVKADTCFNEAVNQYRELFSKASDEEKLAQNLNEKFAIAL 327

Query: 302 EHTAILSFLKNDPLTARELVDEAIKLHPRPKSYIYLGLLMADKGLDEEYYSNFQKAIDLD 361
           E++ I  FLKND + A+  V+EAIKL PR  SYIYL L  AD G   EY +NF KA++L+
Sbjct: 328 EYSGIFKFLKNDVIGAQAAVNEAIKLFPRVNSYIYLALTSADNGESSEYVTNFDKALELN 387

Query: 362 PNMAAIYYHRGQMNFIIQKYEKAGEDFDKAKECDPTNIFPYIQLACMSYREGHFDDCETL 421
           PN +A YYHRGQ+ FI Q Y+KA  DF KAKE D  NIF YIQLAC+ YREG  D+C+ L
Sbjct: 388 PNSSATYYHRGQLYFITQDYQKAKADFLKAKELDNDNIFAYIQLACLCYREGDMDECKKL 447

Query: 422 FSEARRKFPDAPEVPNFFAEILSDKGEIEKAAAEYDKAIELE---SKSENIHVGIAPLVG 478
           F EAR KFP APEVP F+AEIL+DKG+   AA +YD A  LE   S    I VG+APLVG
Sbjct: 448 FDEAREKFPVAPEVPTFYAEILADKGDFSDAAKQYDMAKRLEEAISAKTGIRVGVAPLVG 507

Query: 479 KATTLLKYPTVENFIEADDLFEQANNEDPRSEKAKMGLAQCKLQQEDLDDAIRLFEEAAI 538
           KAT L + P+ ENF EA  LFE+A   DPRSE+AK+GLAQ  LQQED+D AI++FEEAA 
Sbjct: 508 KATVLARQPSPENFAEATTLFEEACKRDPRSEQAKVGLAQLLLQQEDVDSAIKMFEEAAD 567

Query: 539 LCRTLDEKLQATTFAEATKVQMRVRADERLQAKTMKALDEIRRNG 583
           L RT DEKLQA TFAEA KVQ ++RAD  ++AK  +AL E R  G
Sbjct: 568 LARTTDEKLQAVTFAEAAKVQKKIRADPIIRAKVEEALAEYRAQG 612

>KAFR0F00720 Chr6 complement(141181..143007) [1827 bp, 608 aa] {ON}
           Anc_2.152 YHR117W
          Length = 608

 Score =  523 bits (1347), Expect = e-180,   Method: Compositional matrix adjust.
 Identities = 270/523 (51%), Positives = 355/523 (67%), Gaps = 4/523 (0%)

Query: 66  NDEPDIELMKLAETAEKNEYASELKKRGNAYFKVKDYENAINYYKFALQLKNDPVFYSNM 125
           N EPD   +      +K+++A ELK +GN YFK KDYENA+ +Y FAL LK DPVFYSNM
Sbjct: 88  NGEPDFTGVDNLTADQKDKWAIELKDKGNEYFKEKDYENALKFYDFALILKKDPVFYSNM 147

Query: 126 AACYISLEHNKEAIEACSKALELNPDYSKVLLKRAAVYENIGKFADALLDLTAVSLNGDY 185
           +ACY+SL    + IE  +KALEL PDYSK LL+RA   E +  ++DA+ DL+ +SLN D+
Sbjct: 148 SACYVSLNELDKVIEMSTKALELKPDYSKALLRRATANEQLENYSDAMFDLSVLSLNNDF 207

Query: 186 NDATIQPIVERVLNKQAMMALKDHLEASEKNKV-LPSYTSMAAFFGVFDAETDIPGHDAT 244
           N ATI+P++ER LNKQA+  L    +   KN+  LPS TSMA+FF +F  E     +D  
Sbjct: 208 NGATIEPMLERNLNKQAIKVLDQKSKNPSKNESELPSNTSMASFFSIFTPEISFDSYDEE 267

Query: 245 EESDKILSDALTHLYSQTKEGYDRCDSEFTKATELYKAKLENDRTNSVTNEKAAIAFEHT 304
            ++DK L + L  LYS     Y+  +S F K+ ELYK  LE+       ++K AIA E+ 
Sbjct: 268 SDADKELLNGLKELYSAKTGCYEIAESSFNKSMELYKILLESTEDKETISKKFAIALEYV 327

Query: 305 AILSFLKNDPLTARELVDEAIKLHPRPKSYIYLGLLMADKGLDEEYYSNFQKAIDLDPNM 364
            I +FL+ND +TA++L +++I   PR  SYIYL L+ ADK   +E    F +A+ LDPN 
Sbjct: 328 GIFNFLRNDLVTAQDLFNQSISASPRVNSYIYLALISADKNEKDESNKYFDEALKLDPNC 387

Query: 365 AAIYYHRGQMNFIIQKYEKAGEDFDKAKECDPTNIFPYIQLACMSYREGHFDDCETLFSE 424
           + IYYHRGQ+NF+ Q Y  A  DF KAKE D  NIFPYIQLAC+SYREG F+DC+  F  
Sbjct: 388 SPIYYHRGQLNFVTQDYVNAKNDFLKAKELDENNIFPYIQLACLSYREGDFEDCQNQFEL 447

Query: 425 ARRKFPDAPEVPNFFAEILSDKGEIEKAAAEYDKAIELESKSENIHVGIAPLVGKATTLL 484
           AR+KFP APE+P F  EIL+DKG+++ AA +Y+  I LE+  ++IHVGIAPL+GKAT L 
Sbjct: 448 ARKKFPVAPEIPTFLGEILADKGDLDLAAKQYEFGIRLENTQKSIHVGIAPLIGKATALA 507

Query: 485 KYPTVENFIEADDLFEQANNEDPRSEKAKMGLAQCKLQQEDLDDAIRLFEEAAILCRTLD 544
           + PT ENF EA  L + A  +DPRSE+A +GLAQ KLQ+ED+D AI LFE+A+   R++D
Sbjct: 508 RQPTPENFSEASKLLQDAVEKDPRSEQAIVGLAQLKLQEEDVDTAIELFEKASDYSRSMD 567

Query: 545 EKLQATTFAEATKVQMRVRADERLQAKTMKALDEIRRNGGQGF 587
           EKLQATTFAEA KVQ R+RAD  ++AK  + L +      QGF
Sbjct: 568 EKLQATTFAEAAKVQKRIRADPVIKAKVEETLAQYH---AQGF 607

>NCAS0B07010 Chr2 (1332351..1334228) [1878 bp, 625 aa] {ON}
           Anc_2.152
          Length = 625

 Score =  521 bits (1343), Expect = e-179,   Method: Compositional matrix adjust.
 Identities = 280/624 (44%), Positives = 387/624 (62%), Gaps = 42/624 (6%)

Query: 1   MSSDSNTVG-FWVKNKKXXXXXXXXXXXXXXXYFYYKQVQELKKSLD---DGNDVG---- 52
           MSS+ + VG F  +N+                ++YY  +Q+   SL+   DGN  G    
Sbjct: 1   MSSNDHPVGGFLTRNRTAIVATVAAGSAAIGAFYYYHHLQQTHTSLEGEEDGNSTGRNPV 60

Query: 53  ---------------------------TASSKVEYKYLMINDEPDIELMKLAETA--EKN 83
                                      TA++ V   Y   ND  D +++++      E+ 
Sbjct: 61  NDEAHLSKNQKKKQRKKHKKKATPDQTTATADVLTSY-PTNDSNDPDMIQITSLPLEEQK 119

Query: 84  EYASELKKRGNAYFKVKDYENAINYYKFALQLKNDPVFYSNMAACYISLEHNKEAIEACS 143
           + + +LK +GN YFK KDY NAI YY  AL L  DP+FYSN++ACY+SL    + IE+ +
Sbjct: 120 KISMQLKDKGNKYFKAKDYTNAIKYYNLALDLNKDPIFYSNISACYVSLGQLDKVIESST 179

Query: 144 KALELNPDYSKVLLKRAAVYENIGKFADALLDLTAVSLNGDYNDATIQPIVERVLNKQAM 203
           KALELNP+YSK LL+RA+  E++  ++DAL DL+ +SLNGDY+ A+I+PI+ER LNKQA+
Sbjct: 180 KALELNPNYSKALLRRASANESLENYSDALFDLSVLSLNGDYSGASIEPILERNLNKQAI 239

Query: 204 MALKDHLE----ASEKNKVLPSYTSMAAFFGVFDAETDIPGHDATEESDKILSDALTHLY 259
             L + +     ++++ ++LPS TS+ +FFG+FD E     ++  +++D  L   LT+L+
Sbjct: 240 KVLNERMNKMTGSNKEQQLLPSTTSLVSFFGIFDPELTFQNYNENDQADVELLTGLTNLF 299

Query: 260 SQTKEGYDRCDSEFTKATELYKAKLENDRTNSVTNEKAAIAFEHTAILSFLKNDPLTARE 319
            +T +GY   D  F KA+ L+  +L  +  +    EK AIA E+  I  FLKND L A+ 
Sbjct: 300 KRTDQGYLDADKNFVKASSLFMEELAKNPKDKHLLEKTAIALEYNGIFRFLKNDLLGAQT 359

Query: 320 LVDEAIKLHPRPKSYIYLGLLMADKGLDEEYYSNFQKAIDLDPNMAAIYYHRGQMNFIIQ 379
            +++AI   PR  SY+YL L+ ADK   +EY   F KA++L+P+  ++YYHRGQ+ FI Q
Sbjct: 360 DIEKAIGFFPRVNSYLYLALISADKSTSQEYSKYFDKALELNPDSLSVYYHRGQLYFITQ 419

Query: 380 KYEKAGEDFDKAKECDPTNIFPYIQLACMSYREGHFDDCETLFSEARRKFPDAPEVPNFF 439
            Y KA  +F+KAKE D TNIFPYIQLAC++YRE  FD C+ LF E R+KFP  PEVP F+
Sbjct: 420 DYPKAKVEFEKAKELDETNIFPYIQLACLAYRENDFDRCQKLFDETRQKFPTYPEVPTFY 479

Query: 440 AEILSDKGEIEKAAAEYDKAIELESKSENIHVGIAPLVGKATTLLKYPTVENFIEADDLF 499
           AEIL+DKG+   A  +YD A  LE   +NIHVGIAPLVGKAT L + P + N  EA  L 
Sbjct: 480 AEILADKGDFALAIKQYDIATRLEKAQKNIHVGIAPLVGKATVLARQPNLLNLKEATQLM 539

Query: 500 EQANNEDPRSEKAKMGLAQCKLQQEDLDDAIRLFEEAAILCRTLDEKLQATTFAEATKVQ 559
           E+A   DPRSE+A +GLAQ KLQ E++D AI LFE+AA L RT+DEK+QA TFAEA K+Q
Sbjct: 540 EKACEIDPRSEQAIVGLAQLKLQNEEVDLAIELFEKAADLSRTMDEKIQAMTFAEAAKIQ 599

Query: 560 MRVRADERLQAKTMKALDEIRRNG 583
            R+RAD  + AK  +AL   R  G
Sbjct: 600 KRIRADPVISAKVDEALASYRSQG 623

>Skud_8.178 Chr8 (316128..318044) [1917 bp, 638 aa] {ON} YHR117W
           (REAL)
          Length = 638

 Score =  508 bits (1308), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 261/539 (48%), Positives = 361/539 (66%), Gaps = 15/539 (2%)

Query: 60  YKYLMIND-EPDIELMKLAETAEKNEYASELKKRGNAYFKVKDYENAINYYKFALQL-KN 117
           ++Y +++D EPD+  ++    +++ EYA +LK +GN +F  K++++AI YY+ A++L  N
Sbjct: 98  FEYPLLSDGEPDMAQLRGLPLSQRQEYAVQLKDKGNHFFTSKNFDDAIKYYQHAIELDPN 157

Query: 118 DPVFYSNMAACYISLEHNKEAIEACSKALELNPDYSKVLLKRAAVYENIGKFADALLDLT 177
           DPVFYSNM+ACYIS     + +E  +KALE+ PD+SK LL+RA+  E++G F DA+ DL+
Sbjct: 158 DPVFYSNMSACYISTGDLNKVVEYTTKALEIKPDHSKALLRRASANESLGNFTDAMFDLS 217

Query: 178 AVSLNGDYNDATIQPIVERVLNKQAMMALKDHLEASEKNK---VLPSYTSMAAFFGVFDA 234
            +SLNGD++ A+I+P++ER LNKQAM  L  +L  +  ++   +LPS TS+A+FFG+FD 
Sbjct: 218 VLSLNGDFDGASIEPMLERNLNKQAMKVLNANLSKNSGDRGSEILPSNTSLASFFGIFDP 277

Query: 235 ETDIPGHDATEESDK---ILSDALTHLYSQTKEGYDRCDSEFTKATELYKAKLENDRTNS 291
           + +I    +    D    +L +AL  LYS T EGY   ++ FTKAT+ Y + L   R + 
Sbjct: 278 DLEISRVSSISPPDTAHDMLLEALQRLYSATSEGYLIANALFTKATDAYHSLLSASRVDG 337

Query: 292 VTNEKAAIAFEHTAILSFLKNDPLTARELVDEAIKLHPRPKSYIYLGLLMADKGLDEEYY 351
                AA+AF +  I  FLKND L A+ L+ E+I LHP P SYI++ L +ADK   +E++
Sbjct: 338 AIRGNAALAFCYKGIFQFLKNDLLDAQALLQESINLHPTPNSYIFMALTLADKENSQEFF 397

Query: 352 SNFQKAIDLDPNMAAIYYHRGQMNFIIQKYEKAGEDFDKAKECDPTNIFPYIQLACMSYR 411
           S FQKAIDLDP  +  YYHRGQM FI+Q Y  A  DF KA+  +P NI+PYIQLAC+ Y+
Sbjct: 398 SFFQKAIDLDPEYSPTYYHRGQMYFILQDYVNAKMDFQKAQSLNPGNIYPYIQLACLLYK 457

Query: 412 EGHFDDCETLFSEARRKFPDAPEVPNFFAEILSDKGEIEKAAAEYDKAIELESKSENIHV 471
           +G F + E LF+E + KFP  PEVP FFAEIL+DKG+   A  +YD A  L+     IHV
Sbjct: 458 QGKFSESEKLFNETKLKFPTLPEVPTFFAEILTDKGDYNTAIKQYDIAKRLQEVQRKIHV 517

Query: 472 GIAPLVGKATTLLKYPTV-------ENFIEADDLFEQANNEDPRSEKAKMGLAQCKLQQE 524
           GI PL+GKAT L +  T        E F  A +L  +A + DPRSE+AK+GLAQ KLQ E
Sbjct: 518 GIGPLIGKATILARQSTQDPTQLDEEKFNMAIELLTEACDLDPRSEQAKIGLAQLKLQME 577

Query: 525 DLDDAIRLFEEAAILCRTLDEKLQATTFAEATKVQMRVRADERLQAKTMKALDEIRRNG 583
            +DDAI LF+++A L RT+DEKLQATTFAEA K+Q R+RAD  + AK  + L   R NG
Sbjct: 578 KIDDAIELFQDSATLARTMDEKLQATTFAEAAKIQKRLRADPIISAKMEQTLASYRANG 636

>YHR117W Chr8 (342349..344268) [1920 bp, 639 aa] {ON}
           TOM71Mitochondrial outer membrane protein with
           similarity to Tom70p; probable minor component of the
           TOM (translocase of outer membrane) complex responsible
           for recognition and import of mitochondrially directed
           proteins
          Length = 639

 Score =  506 bits (1303), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 260/531 (48%), Positives = 356/531 (67%), Gaps = 13/531 (2%)

Query: 66  NDEPDIELMKLAETAEKNEYASELKKRGNAYFKVKDYENAINYYKFALQL-KNDPVFYSN 124
           N EPDI  +K    +++  YA +LK RGN +F  K++  AI YY++A++L  N+PVFYSN
Sbjct: 107 NGEPDIAQLKGLSPSQRQAYAVQLKNRGNHFFTAKNFNEAIKYYQYAIELDPNEPVFYSN 166

Query: 125 MAACYISLEHNKEAIEACSKALELNPDYSKVLLKRAAVYENIGKFADALLDLTAVSLNGD 184
           ++ACYIS    ++ IE  +KALE+ PD+SK LL+RA+  E++G F DA+ DL+ +SLNGD
Sbjct: 167 ISACYISTGDLEKVIEFTTKALEIKPDHSKALLRRASANESLGNFTDAMFDLSVLSLNGD 226

Query: 185 YNDATIQPIVERVLNKQAMMALKDHLEASEK--NKVLPSYTSMAAFFGVFDAETDIPGHD 242
           ++ A+I+P++ER LNKQAM  L ++L   E   ++VLPS TS+A+FFG+FD+  ++   +
Sbjct: 227 FDGASIEPMLERNLNKQAMKVLNENLSKDEGRGSQVLPSNTSLASFFGIFDSHLEVSSVN 286

Query: 243 ATEESDK---ILSDALTHLYSQTKEGYDRCDSEFTKATELYKAKLENDRTNSVTNEKAAI 299
            +   D    +LSDAL  LYS T EGY   +   TK+T++Y + L  +  +    E AA+
Sbjct: 287 TSSNYDTAYALLSDALQRLYSATDEGYLVANDLLTKSTDMYHSLLSANTVDDPLRENAAL 346

Query: 300 AFEHTAILSFLKNDPLTARELVDEAIKLHPRPKSYIYLGLLMADKGLDEEYYSNFQKAID 359
           A  +T I  FLKN+ L A+ L+ E+I LHP P SYI+L L +ADK   +E++  FQKA+D
Sbjct: 347 ALCYTGIFHFLKNNLLDAQVLLQESINLHPTPNSYIFLALTLADKENSQEFFKFFQKAVD 406

Query: 360 LDPNMAAIYYHRGQMNFIIQKYEKAGEDFDKAKECDPTNIFPYIQLACMSYREGHFDDCE 419
           L+P     YYHRGQM FI+Q Y+ A EDF KA+  +P N++PYIQLAC+ Y++G F + E
Sbjct: 407 LNPEYPPTYYHRGQMYFILQDYKNAKEDFQKAQSLNPENVYPYIQLACLLYKQGKFTESE 466

Query: 420 TLFSEARRKFPDAPEVPNFFAEILSDKGEIEKAAAEYDKAIELESKSENIHVGIAPLVGK 479
             F+E + KFP  PEVP FFAEIL+D+G+ + A  +YD A  LE   E IHVGI PL+GK
Sbjct: 467 AFFNETKLKFPTLPEVPTFFAEILTDRGDFDTAIKQYDIAKRLEEVQEKIHVGIGPLIGK 526

Query: 480 ATTLLKY----PTV---ENFIEADDLFEQANNEDPRSEKAKMGLAQCKLQQEDLDDAIRL 532
           AT L +     PT    E F  A  L  +A   DPRSE+AK+GLAQ KLQ E +D+AI L
Sbjct: 527 ATILARQSSQDPTQLDEEKFNAAIKLLTKACELDPRSEQAKIGLAQLKLQMEKIDEAIEL 586

Query: 533 FEEAAILCRTLDEKLQATTFAEATKVQMRVRADERLQAKTMKALDEIRRNG 583
           FE++AIL RT+DEKLQATTFAEA K+Q R+RAD  + AK    L   R  G
Sbjct: 587 FEDSAILARTMDEKLQATTFAEAAKIQKRLRADPIISAKMELTLARYRAKG 637

>Smik_8.195 Chr8 (318688..320595) [1908 bp, 635 aa] {ON} YHR117W
           (REAL)
          Length = 635

 Score =  498 bits (1282), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 264/534 (49%), Positives = 351/534 (65%), Gaps = 14/534 (2%)

Query: 63  LMINDEPDIELMKLAETAEKNEYASELKKRGNAYFKVKDYENAINYYKFALQL-KNDPVF 121
            + N EPDI  +K    ++K  YA +LK +GN +F  K++  AI YY+ A++L  NDPVF
Sbjct: 101 FLPNGEPDISQLKGLTLSQKQTYAVQLKNKGNHFFTTKNFTEAIKYYQCAIELDPNDPVF 160

Query: 122 YSNMAACYISLEHNKEAIEACSKALELNPDYSKVLLKRAAVYENIGKFADALLDLTAVSL 181
           YSN++ACYIS     + +E  +KALE+ PD+SK LL+RA+  E++G F DA+ DL+ +SL
Sbjct: 161 YSNISACYISTGDLNKVLEYTTKALEIKPDHSKALLRRASANESLGNFTDAMFDLSVLSL 220

Query: 182 NGDYNDATIQPIVERVLNKQAMMALKDHLEASEK--NKVLPSYTSMAAFFGVFDAETDIP 239
           NGD++ A+I+P++ER LNKQAM  L ++L   +   +++LPS TS+ +FFG+FD + +I 
Sbjct: 221 NGDFDGASIEPMLERNLNKQAMKVLNENLSKGDGRGSQLLPSNTSLTSFFGIFDPDLEIS 280

Query: 240 GHDATEESDK---ILSDALTHLYSQTKEGYDRCDSEFTKATELYKAKLENDRTNSVTNEK 296
             + +   D    +LSDAL  LYS T EGY   D  FT AT+ Y + L + + +    E 
Sbjct: 281 RVNNSSHFDTAYALLSDALQKLYSATNEGYLTADKLFTSATDAYHSLLAS-QVDGPLKEN 339

Query: 297 AAIAFEHTAILSFLKNDPLTARELVDEAIKLHPRPKSYIYLGLLMADKGLDEEYYSNFQK 356
           AA+AF +T I  FLKN+ L A+ L+ E+I LHP P SYI+L L +ADK   +E++  FQK
Sbjct: 340 AALAFCYTGIFHFLKNNLLGAQALLQESINLHPTPNSYIFLALTLADKENSQEFFKYFQK 399

Query: 357 AIDLDPNMAAIYYHRGQMNFIIQKYEKAGEDFDKAKECDPTNIFPYIQLACMSYREGHFD 416
           AIDLD      YYHRGQM FI+Q Y  A  DF KA+   P NI+PYIQLAC+ Y++G F 
Sbjct: 400 AIDLDSEYPPTYYHRGQMYFILQDYVNAKADFQKAQNLYPENIYPYIQLACLLYKQGKFT 459

Query: 417 DCETLFSEARRKFPDAPEVPNFFAEILSDKGEIEKAAAEYDKAIELESKSENIHVGIAPL 476
           + E LF+E + KFP  PEVP FFAEIL+DKG+   A  +YD A  LE   E IHVGI PL
Sbjct: 460 ESEALFNETKLKFPTLPEVPAFFAEILTDKGDFSTAIKQYDIAKRLEEVQEKIHVGIGPL 519

Query: 477 VGKATTLLKY----PTV---ENFIEADDLFEQANNEDPRSEKAKMGLAQCKLQQEDLDDA 529
           +GKAT L +     PT    E F  A  L  +A   DPRSE+AK+GLAQ KLQ E +DDA
Sbjct: 520 IGKATILARQSSQDPTQLDEEKFNTAIALLTKACELDPRSEQAKIGLAQLKLQMEKIDDA 579

Query: 530 IRLFEEAAILCRTLDEKLQATTFAEATKVQMRVRADERLQAKTMKALDEIRRNG 583
           I LF+++AIL RT+DEKLQATTFAEA K+Q R+RAD  + AK    L   R  G
Sbjct: 580 IELFQDSAILARTMDEKLQATTFAEAAKIQKRLRADPIISAKMEMTLASYRAKG 633

>Suva_15.314 Chr15 (544646..546580) [1935 bp, 644 aa] {ON} YHR117W
           (REAL)
          Length = 644

 Score =  488 bits (1255), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 255/540 (47%), Positives = 356/540 (65%), Gaps = 15/540 (2%)

Query: 58  VEYKYLMINDEPDIELMKLAETAEKNEYASELKKRGNAYFKVKDYENAINYYKFALQL-K 116
           VEY  L+ + EPD++ ++     ++  +A +LK +GN +F  K + +AI YY++A++L  
Sbjct: 104 VEYP-LLPHGEPDMDRLRGLSAPQRQAFAVQLKDKGNHFFTAKSFGDAIKYYQYAIELDP 162

Query: 117 NDPVFYSNMAACYISLEHNKEAIEACSKALELNPDYSKVLLKRAAVYENIGKFADALLDL 176
           NDPVFYSN++ACYIS     + +E  +KALE+ PD+SK LL+RA+  E++G F DA+ DL
Sbjct: 163 NDPVFYSNISACYISTGDLDKVVEYTTKALEIKPDHSKALLRRASANESLGNFTDAMFDL 222

Query: 177 TAVSLNGDYNDATIQPIVERVLNKQAMMALKDHLEASEKNK---VLPSYTSMAAFFGVFD 233
           + +SLNGD++  +I+P++ER LNKQAM  L + L  +  +K   +LPS TS+A+FFG+FD
Sbjct: 223 SVLSLNGDFDGTSIEPMLERNLNKQAMKVLNESLLKNGDDKSSQILPSNTSLASFFGIFD 282

Query: 234 AETD---IPGHDATEESDKILSDALTHLYSQTKEGYDRCDSEFTKATELYKAKLENDRTN 290
            + +   +      + +   LS+AL  LYS T EGY   D   TKAT+ Y + L  ++ +
Sbjct: 283 PDLETSRVNTGSLLDSASATLSEALQSLYSATSEGYLIADDLLTKATDEYHSLLRANKED 342

Query: 291 SVTNEKAAIAFEHTAILSFLKNDPLTARELVDEAIKLHPRPKSYIYLGLLMADKGLDEEY 350
            V  E AA+AF +  I  FLKND L A+ L+ E+I LHP P SY+++ L +ADK   +E+
Sbjct: 343 RVIRENAALAFCYAGIFQFLKNDLLDAQALLQESINLHPTPNSYVFMALTVADKENSQEF 402

Query: 351 YSNFQKAIDLDPNMAAIYYHRGQMNFIIQKYEKAGEDFDKAKECDPTNIFPYIQLACMSY 410
           +  FQ AIDLDP     YYHRGQM FI+Q Y  A  DF KA+  +P N++PYIQLAC+ Y
Sbjct: 403 FKFFQNAIDLDPEYPPTYYHRGQMYFILQDYINAKSDFQKAQSLNPGNVYPYIQLACLLY 462

Query: 411 REGHFDDCETLFSEARRKFPDAPEVPNFFAEILSDKGEIEKAAAEYDKAIELESKSENIH 470
           ++  F + E+LF+EA+ KFP  PEVP F+AEIL+DKG+   A  +YD A  LE   + IH
Sbjct: 463 KQDKFSEAESLFNEAKLKFPILPEVPTFYAEILTDKGDFNPAIKQYDIAKRLEEVQKKIH 522

Query: 471 VGIAPLVGKATTLLKY----PTV---ENFIEADDLFEQANNEDPRSEKAKMGLAQCKLQQ 523
           VGI PL+GKAT L +     PT    E F  A +L  +A   DPRSE+AK+GLAQ +LQ 
Sbjct: 523 VGIGPLIGKATILARQSSQDPTQLDEEKFNMAIELLTKACELDPRSEQAKIGLAQLELQM 582

Query: 524 EDLDDAIRLFEEAAILCRTLDEKLQATTFAEATKVQMRVRADERLQAKTMKALDEIRRNG 583
           E +D AI+LF+E+A L RT+DEKLQATTFAEA K+Q R+RAD  + AK  + L   R  G
Sbjct: 583 EKIDVAIKLFQESATLARTMDEKLQATTFAEAAKIQKRLRADPIISAKMEQTLANYRAQG 642

>NDAI0B04340 Chr2 (1087851..1089845) [1995 bp, 664 aa] {ON}
           Anc_2.152 YHR117W
          Length = 664

 Score =  462 bits (1189), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 251/527 (47%), Positives = 345/527 (65%), Gaps = 10/527 (1%)

Query: 67  DEPDI-ELMKLAETAE--KNEYASELKKRGNAYFKVKDYENAINYYKFALQLKNDPVFYS 123
           ++PD  E+ KL    E  K+++A ELK +GN YFK KD ENAI YY++AL+L  DPVFYS
Sbjct: 136 NDPDFNEINKLIANNENLKSKFAKELKNKGNQYFKSKDNENAIKYYEYALRLDQDPVFYS 195

Query: 124 NMAACYISLEHNKEAIEACSKALELNPDYSKVLLKRAAVYENIGKFADALLDLTAVSLNG 183
           N++ACY ++    + IE+ +KALEL PDYSK LL+RA  YE +G   +AL D + +SL G
Sbjct: 196 NISACYFAMNQLDKVIESSNKALELKPDYSKALLRRANAYEALGNNKEALYDFSILSLFG 255

Query: 184 DYNDATIQPIVERVLNKQAMMALKDHLEASEK-NKVLPSYTSMAAFFGVFDAETDIPGHD 242
           +Y+   ++P++ R+L+K +   L+  L+  +  N +L S +++ +FFG+F  ET I  ++
Sbjct: 256 EYSGQYLEPLLNRILDKVSTDVLRAKLDNKKTDNFILLSDSALVSFFGIFPPETTITNYN 315

Query: 243 ATEESDKILSDALTHLYSQTKEGYDRCDSEFTKATELYKAKL---ENDRTNSVTNEKAAI 299
             +E+DK L   L  L  +T EG+   D  F KA EL+  KL   E++  NS   EK AI
Sbjct: 316 PDDEADKELVQGLEALAKKTSEGFLDADKHFIKANELFMEKLLSSEDNDENSGLLEKVAI 375

Query: 300 AFEHTAILSFLKNDPLTARELVDEAIKLHPRPKSYIYLGLLMADKGLDE---EYYSNFQK 356
           A E++ +  FLK D L +   + +AI L+PRP SYIY+ +L+ADK  D+   +Y+  F K
Sbjct: 376 ALEYSGVFKFLKFDLLGSETDLQKAIDLYPRPNSYIYMAMLVADKNNDKNDLDYFKYFDK 435

Query: 357 AIDLDPNMAAIYYHRGQMNFIIQKYEKAGEDFDKAKECDPTNIFPYIQLACMSYREGHFD 416
           A  L+PN A  YYHRGQ+  + QK+++A   F KAKE D +N++PYIQLAC++Y    F 
Sbjct: 436 ATTLNPNFAPTYYHRGQLLLVNQKFDEAETFFLKAKELDDSNVYPYIQLACVAYYNSTFK 495

Query: 417 DCETLFSEARRKFPDAPEVPNFFAEILSDKGEIEKAAAEYDKAIELESKSENIHVGIAPL 476
            C+ LF EAR KFP  PEVP F+AEIL+DKGE+E A  +YD A  LE+  + IHVGIAPL
Sbjct: 496 KCQELFDEARTKFPTLPEVPTFYAEILADKGELEAAMKQYDIAYRLETAYKYIHVGIAPL 555

Query: 477 VGKATTLLKYPTVENFIEADDLFEQANNEDPRSEKAKMGLAQCKLQQEDLDDAIRLFEEA 536
           +GKA  L + PT ENF    +L E+A   DPRSE+AK+ LAQ KLQ ED+D AI LFEE 
Sbjct: 556 IGKAAALARIPTQENFDTMTELLEKACELDPRSEQAKISLAQLKLQTEDIDTAIALFEET 615

Query: 537 AILCRTLDEKLQATTFAEATKVQMRVRADERLQAKTMKALDEIRRNG 583
           A L RT  +KLQATTFAEA K+Q R++ +    AK  + L   R +G
Sbjct: 616 ADLARTYQDKLQATTFAEAAKIQKRIKENPIYAAKIEETLATYRADG 662

>NCAS0G00810 Chr7 complement(138192..139946) [1755 bp, 584 aa] {ON}
           Anc_5.617
          Length = 584

 Score = 68.6 bits (166), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 35/89 (39%), Positives = 52/89 (58%), Gaps = 2/89 (2%)

Query: 86  ASELKKRGNAYFKVKDYENAINYYKFALQLKNDP--VFYSNMAACYISLEHNKEAIEACS 143
           A ELK++GNA F  KD+  AI Y+  A+     P  V YSN +ACY SL+  +EA+    
Sbjct: 4   ADELKQKGNAAFASKDFTGAIEYFTEAIAASTTPNHVLYSNRSACYTSLKQFQEALNDAQ 63

Query: 144 KALELNPDYSKVLLKRAAVYENIGKFADA 172
           + +++NPD+SK   +  A +  +G   DA
Sbjct: 64  QCVKINPDWSKGYNRMGAAHLGLGDLDDA 92

 Score = 48.1 bits (113), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 32/94 (34%), Positives = 45/94 (47%), Gaps = 1/94 (1%)

Query: 84  EYASELKKRGNAYFKVKDYENAIN-YYKFALQLKNDPVFYSNMAACYISLEHNKEAIEAC 142
           E A E +  G  YF   D+ NA+  Y +   +   D   YSN AA    L    EAI+ C
Sbjct: 388 EKAEEARLEGKEYFTKSDWPNAVKAYTEMIKRAPEDARGYSNRAAALAKLMSFPEAIKDC 447

Query: 143 SKALELNPDYSKVLLKRAAVYENIGKFADALLDL 176
            KA+E +P++ +  L++A     I  F  AL  L
Sbjct: 448 EKAIEKDPNFVRAYLRKATAQIAIKDFVKALETL 481

>Ecym_2090 Chr2 complement(163340..163858) [519 bp, 172 aa] {ON}
           similar to Ashbya gossypii AAR054C
          Length = 172

 Score = 63.2 bits (152), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 36/90 (40%), Positives = 53/90 (58%), Gaps = 4/90 (4%)

Query: 58  VEYKYLMINDEPDIELMKLAETAEKNEYASELKKRGNAYFKVKDYENAINYYKFALQL-K 116
           ++Y Y+    E D ++ +       NE A +LK +GN +FK  DYE AI YY+ A  L  
Sbjct: 16  IKYSYIY---EYDAKVGRRIVLESMNETAEDLKVKGNTFFKNGDYETAILYYEKACALDS 72

Query: 117 NDPVFYSNMAACYISLEHNKEAIEACSKAL 146
           ++P+++SNMA   I LE  +EA+ AC K L
Sbjct: 73  SNPIYFSNMATALIKLERWQEAVNACDKGL 102

>CAGL0H08195g Chr8 complement(804418..806169) [1752 bp, 583 aa] {ON}
           highly similar to uniprot|P15705 Saccharomyces
           cerevisiae YOR027w STI1
          Length = 583

 Score = 63.9 bits (154), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 34/89 (38%), Positives = 53/89 (59%), Gaps = 2/89 (2%)

Query: 86  ASELKKRGNAYFKVKDYENAINYYKFALQLKNDP--VFYSNMAACYISLEHNKEAIEACS 143
           A E K++GNA F  KDYE AI+ +  A+++   P  VFYSN +ACY SL+   EA+    
Sbjct: 4   ADEYKQQGNAAFVAKDYEKAIDLFSKAIEVSETPNHVFYSNRSACYASLKKFPEALNDAE 63

Query: 144 KALELNPDYSKVLLKRAAVYENIGKFADA 172
           + +++NP +SK   +  A +  +G   +A
Sbjct: 64  ECVKINPTWSKGYNRLGAAHLGLGDLDEA 92

 Score = 49.7 bits (117), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 32/97 (32%), Positives = 49/97 (50%), Gaps = 1/97 (1%)

Query: 84  EYASELKKRGNAYFKVKDYENAIN-YYKFALQLKNDPVFYSNMAACYISLEHNKEAIEAC 142
           E A E +  G  YF   D+ NA+  Y +   +   D   YSN AA    L    EAIE C
Sbjct: 388 EKAEEARLEGKDYFTKGDWPNAVKAYTEMIKRAPEDARGYSNRAAALSKLMSFPEAIEDC 447

Query: 143 SKALELNPDYSKVLLKRAAVYENIGKFADALLDLTAV 179
           +KA+E +P++ +  +++A     + +FA A+  L A 
Sbjct: 448 NKAIEKDPNFIRAYIRKATAQIAVKEFAAAIETLDAA 484

>Kwal_55.19935 s55 (182767..184548) [1782 bp, 593 aa] {ON} YOR027W
           (STI1) - Heat shock protein also induced by canavanine
           and entry into stationary phase [contig 159] FULL
          Length = 593

 Score = 63.2 bits (152), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 35/89 (39%), Positives = 50/89 (56%), Gaps = 2/89 (2%)

Query: 86  ASELKKRGNAYFKVKDYENAINYYKFALQLKNDP--VFYSNMAACYISLEHNKEAIEACS 143
           A E KK+GNA F  KD+E A   +  A++    P  V YSN +ACY SL+  KEA+E   
Sbjct: 3   AEEFKKQGNAAFVAKDFEKAAELFSKAIESSETPNHVLYSNRSACYTSLKKFKEALEDAE 62

Query: 144 KALELNPDYSKVLLKRAAVYENIGKFADA 172
           + +++NP +SK   +  A    +G   DA
Sbjct: 63  ECVKINPTWSKGYNRVGAAQYGLGNLDDA 91

 Score = 40.8 bits (94), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 26/97 (26%), Positives = 49/97 (50%), Gaps = 1/97 (1%)

Query: 84  EYASELKKRGNAYFKVKDYENAIN-YYKFALQLKNDPVFYSNMAACYISLEHNKEAIEAC 142
           E A E + +G  +F   D+ +A++ Y +   +   D   YSN AA    L    +AI+ C
Sbjct: 399 EKAEEARLQGKEFFTKGDWPSAVSAYTEMIKRAPEDARGYSNRAAVLAKLMSFPDAIKDC 458

Query: 143 SKALELNPDYSKVLLKRAAVYENIGKFADALLDLTAV 179
             A+  +P++ +  +++A+    + +FA A+  L A 
Sbjct: 459 DVAISKDPNFVRAYIRKASAQIAVREFAPAMETLDAA 495

 Score = 33.1 bits (74), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 20/67 (29%), Positives = 32/67 (47%), Gaps = 4/67 (5%)

Query: 90  KKRGNAYFKVKDYENAINYYKFALQLKNDPVFYSNMAACYISLEHNKEAI----EACSKA 145
           K  GN Y+K + ++ AI +Y  A  L  D  + +N +A        ++AI    EA  + 
Sbjct: 271 KAEGNKYYKARKFDEAIEHYNKAWDLHRDVTYLNNRSAAEYEKGDYEQAIKTLTEAVDQG 330

Query: 146 LELNPDY 152
            E+  DY
Sbjct: 331 REMRADY 337

 Score = 32.7 bits (73), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 30/121 (24%), Positives = 51/121 (42%), Gaps = 28/121 (23%)

Query: 93  GNAYFKVKDYENAINYYKFALQLKNDPVFYSNM-----------AACYISLEHNKE---- 137
           GNAY K+ D + AI +Y+ +L     P   + +           A  YI  E  +E    
Sbjct: 348 GNAYLKMDDLKKAIEFYQRSLTEHRTPEILTKLRNTEKELKLREAKSYIDPEKAEEARLQ 407

Query: 138 ------------AIEACSKALELNPDYSKVLLKRAAVYENIGKFADALLDLTAVSLNGDY 185
                       A+ A ++ ++  P+ ++    RAAV   +  F DA+ D   V+++ D 
Sbjct: 408 GKEFFTKGDWPSAVSAYTEMIKRAPEDARGYSNRAAVLAKLMSFPDAIKDCD-VAISKDP 466

Query: 186 N 186
           N
Sbjct: 467 N 467

>KLTH0E02178g Chr5 (194914..196695) [1782 bp, 593 aa] {ON} highly
           similar to uniprot|P15705 Saccharomyces cerevisiae
           YOR027W STI1 Heat shock protein also induced by
           canavanine and entry into stationary phase
          Length = 593

 Score = 61.6 bits (148), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 34/89 (38%), Positives = 51/89 (57%), Gaps = 2/89 (2%)

Query: 86  ASELKKRGNAYFKVKDYENAINYYKFALQLKNDP--VFYSNMAACYISLEHNKEAIEACS 143
           A E KK+GNA F  KDYE A   +  A++    P  V YSN +AC+ SL+   EA+   +
Sbjct: 3   AEEFKKQGNAAFVAKDYEKASELFTKAIEASEAPNHVLYSNRSACFTSLKKFNEALNDAN 62

Query: 144 KALELNPDYSKVLLKRAAVYENIGKFADA 172
           + +++NP +SK   +  A Y  +GK  +A
Sbjct: 63  ECVKINPAWSKGYNRVGAAYFGLGKLDEA 91

 Score = 45.4 bits (106), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 29/97 (29%), Positives = 47/97 (48%), Gaps = 1/97 (1%)

Query: 84  EYASELKKRGNAYFKVKDYENAIN-YYKFALQLKNDPVFYSNMAACYISLEHNKEAIEAC 142
           E A E + +G  YF   D+ NA+  Y +   +   D   YSN AA    L    EAI+ C
Sbjct: 399 EKAEEARLQGKEYFTKGDWPNAVKAYTEMTKRAPEDARGYSNRAAALAKLMSFPEAIKDC 458

Query: 143 SKALELNPDYSKVLLKRAAVYENIGKFADALLDLTAV 179
             A+  +P++ +  +++A     + +FA A+  L A 
Sbjct: 459 DMAISKDPNFIRAYIRKATAQIAVREFASAIETLDAA 495

 Score = 31.2 bits (69), Expect = 7.8,   Method: Compositional matrix adjust.
 Identities = 24/91 (26%), Positives = 40/91 (43%), Gaps = 7/91 (7%)

Query: 90  KKRGNAYFKVKDYENAINYYKFALQLKNDPVFYSNMAACYISLEHNKEAI----EACSKA 145
           K  GN ++K + ++ AI +Y  A  L  D  + +N +A        ++AI    EA  + 
Sbjct: 271 KAEGNKFYKARKFDEAIEHYNKAWDLHKDVTYLNNRSAAEYEKGDYEQAIKTLTEAVEQG 330

Query: 146 LELNPDY---SKVLLKRAAVYENIGKFADAL 173
            E+  DY   SK   +    Y  +  F  A+
Sbjct: 331 REMRADYKLISKSFARIGNAYLKLEDFKKAI 361

>Suva_8.80 Chr8 (142691..144451) [1761 bp, 586 aa] {ON} YOR027W
           (REAL)
          Length = 586

 Score = 61.2 bits (147), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 32/89 (35%), Positives = 52/89 (58%), Gaps = 2/89 (2%)

Query: 86  ASELKKRGNAYFKVKDYENAINYYKFALQLKNDP--VFYSNMAACYISLEHNKEAIEACS 143
           A E K++GNA F  KDY  AI+ +  A+++   P  V YSN +ACY SL+   +A+   +
Sbjct: 5   ADEYKQQGNAAFTAKDYGKAIDLFTKAIEVSEAPNHVLYSNRSACYTSLKKFTDALNDAT 64

Query: 144 KALELNPDYSKVLLKRAAVYENIGKFADA 172
           + +++NP +SK   +  A +  +G   DA
Sbjct: 65  ECVKINPSWSKGYNRLGAAHLGLGDLDDA 93

 Score = 50.8 bits (120), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 42/146 (28%), Positives = 70/146 (47%), Gaps = 2/146 (1%)

Query: 35  YKQVQELKKSLDDGNDVGTASSKVEYKYLMINDEPDIELMKLAETAEKNEYASELKKRGN 94
           Y ++ +LKK++D+     T     +    + N E +++  + AE     E A E +  G 
Sbjct: 343 YHKLGDLKKTIDNYQKSLTEHRTADILTKLRNAEKELKKAE-AEAYINPEKAEEARLEGK 401

Query: 95  AYFKVKDYENAINYYKFALQLK-NDPVFYSNMAACYISLEHNKEAIEACSKALELNPDYS 153
            YF   D+ NA+  Y   ++    D   YSN AA    L    EAI  C+KA+E +P++ 
Sbjct: 402 EYFTKSDWPNAVKAYTEMIKRSPEDARGYSNRAAALAKLMSFPEAIADCNKAIEKDPNFV 461

Query: 154 KVLLKRAAVYENIGKFADALLDLTAV 179
           +  +++A     + +FA AL  L A 
Sbjct: 462 RAYIRKATAQIAVQEFAGALETLDAA 487

 Score = 35.8 bits (81), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 32/111 (28%), Positives = 49/111 (44%), Gaps = 12/111 (10%)

Query: 69  PDIELMKLAETAEKNEYASEL-----KKRGNAYFKVKDYENAINYYKFALQLKNDPVFYS 123
           P  E  K AE  E +E  S++     K  GN ++K + +E AI +Y  A +L  D  + +
Sbjct: 237 PQQEETKEAEPMEVDEDDSKVEADKEKAEGNKFYKARQFEEAIEHYNKAWELHRDITYLN 296

Query: 124 NMAACYISLEHNKEAI----EACSKALELNPDY---SKVLLKRAAVYENIG 167
           N AA        + AI    +A  +  E+  DY   SK   +    Y  +G
Sbjct: 297 NRAAAEYEKGDYETAIATLTDAVEQGREMRADYKVISKSFARIGNAYHKLG 347

>YOR027W Chr15 (381053..382822) [1770 bp, 589 aa] {ON}  STI1Hsp90
           cochaperone, interacts with the Ssa group of the
           cytosolic Hsp70 chaperones and activates Ssa1p ATPase
           activity; interacts with Hsp90 chaperones and inhibits
           their ATPase activity; homolog of mammalian Hop
          Length = 589

 Score = 59.7 bits (143), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 31/89 (34%), Positives = 52/89 (58%), Gaps = 2/89 (2%)

Query: 86  ASELKKRGNAYFKVKDYENAINYYKFALQLKNDP--VFYSNMAACYISLEHNKEAIEACS 143
           A E K++GNA F  KDY+ AI  +  A+++   P  V YSN +ACY SL+   +A+   +
Sbjct: 5   ADEYKQQGNAAFTAKDYDKAIELFTKAIEVSETPNHVLYSNRSACYTSLKKFSDALNDAN 64

Query: 144 KALELNPDYSKVLLKRAAVYENIGKFADA 172
           + +++NP +SK   +  A +  +G   +A
Sbjct: 65  ECVKINPSWSKGYNRLGAAHLGLGDLDEA 93

 Score = 48.1 bits (113), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 31/97 (31%), Positives = 48/97 (49%), Gaps = 1/97 (1%)

Query: 84  EYASELKKRGNAYFKVKDYENAIN-YYKFALQLKNDPVFYSNMAACYISLEHNKEAIEAC 142
           E A E +  G  YF   D+ NA+  Y +   +   D   YSN AA    L    EAI  C
Sbjct: 394 EKAEEARLEGKEYFTKSDWPNAVKAYTEMIKRAPEDARGYSNRAAALAKLMSFPEAIADC 453

Query: 143 SKALELNPDYSKVLLKRAAVYENIGKFADALLDLTAV 179
           +KA+E +P++ +  +++A     + ++A AL  L A 
Sbjct: 454 NKAIEKDPNFVRAYIRKATAQIAVKEYASALETLDAA 490

 Score = 33.1 bits (74), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 23/85 (27%), Positives = 38/85 (44%), Gaps = 7/85 (8%)

Query: 90  KKRGNAYFKVKDYENAINYYKFALQLKNDPVFYSNMAACYISLEHNKEAI----EACSKA 145
           K  GN ++K + ++ AI +Y  A +L  D  + +N AA        + AI    +A  + 
Sbjct: 266 KAEGNKFYKARQFDEAIEHYNKAWELHKDITYLNNRAAAEYEKGEYETAISTLNDAVEQG 325

Query: 146 LELNPDY---SKVLLKRAAVYENIG 167
            E+  DY   SK   +    Y  +G
Sbjct: 326 REMRADYKVISKSFARIGNAYHKLG 350

>KLTH0F14542g Chr6 complement(1191800..1193341) [1542 bp, 513 aa]
           {ON} highly similar to uniprot|P53043 Saccharomyces
           cerevisiae YGR123C
          Length = 513

 Score = 59.3 bits (142), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 36/103 (34%), Positives = 59/103 (57%), Gaps = 4/103 (3%)

Query: 78  ETAEKNEYASELKKRGNAYFKVKDYENAINYYKFALQLKN-DPVFYSNMAACYISLEHNK 136
           E A+K   A E K +GNA+ K K Y  A+ YY  A++L +   +F+SN A   + L++  
Sbjct: 7   EAAQK---ALEFKNQGNAFIKEKKYPEAVEYYSKAIELDDTQSIFFSNRAFSRLKLDNFL 63

Query: 137 EAIEACSKALELNPDYSKVLLKRAAVYENIGKFADALLDLTAV 179
            A+E C+K++EL+P   K + +R   Y  + +F+ A  DL  +
Sbjct: 64  TALEDCNKSIELDPKNIKAIHRRGLSYVGLLEFSKARKDLKTI 106

 Score = 31.2 bits (69), Expect = 9.3,   Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 27/51 (52%), Gaps = 3/51 (5%)

Query: 349 EYYSNFQKAIDLDPNMAAIYYHRGQMNFIIQKYEKAGEDFDKAKECDPTNI 399
           EYYS   KAI+LD   +  + +R      +  +  A ED +K+ E DP NI
Sbjct: 33  EYYS---KAIELDDTQSIFFSNRAFSRLKLDNFLTALEDCNKSIELDPKNI 80

>CAGL0D05060g Chr4 complement(486065..487597) [1533 bp, 510 aa] {ON}
           highly similar to uniprot|P53043 Saccharomyces
           cerevisiae YGR123c PPT1 protein ser/thr phosphatase
          Length = 510

 Score = 59.3 bits (142), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 49/162 (30%), Positives = 78/162 (48%), Gaps = 10/162 (6%)

Query: 86  ASELKKRGNAYFKVKDYENAINYYKFALQLKN-DPVFYSNMAACYISLEHNKEAIEACSK 144
           A E K  GNA  KV+DY  AI  Y  A++L +   V++SN A C++ L++ + A + C K
Sbjct: 9   ALEYKNEGNACVKVQDYAKAIEKYDKAIELDDTQSVYFSNRALCHLKLDNFQCASQDCDK 68

Query: 145 ALELNPDYSKVLLKRAAVYENIGKFADALLDLTAVSLNGDYNDATIQ---PIVERVLNKQ 201
           AL L+P   K   +R      + +F  A  DLT V L    +DA  +    I E+V+ ++
Sbjct: 69  ALALDPKNVKAYHRRGLACVGLLEFKKARADLTVV-LKAKPSDAAAKRALDICEKVIREE 127

Query: 202 AMMALKDHLEASEKNKVLPSYTSMAAFFGVFDAETDIPGHDA 243
                    ++  K K+  +          FDA +D+  +D 
Sbjct: 128 RFRKAIGGGDSDSKPKLCSTLN-----LSSFDANSDLAKYDG 164

 Score = 33.9 bits (76), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 19/61 (31%), Positives = 32/61 (52%), Gaps = 2/61 (3%)

Query: 354 FQKAIDLDPNMAAIYYHRGQMNFIIQKYEKAGEDFDKAKECDPTNIFPYIQ--LACMSYR 411
           + KAI+LD   +  + +R   +  +  ++ A +D DKA   DP N+  Y +  LAC+   
Sbjct: 32  YDKAIELDDTQSVYFSNRALCHLKLDNFQCASQDCDKALALDPKNVKAYHRRGLACVGLL 91

Query: 412 E 412
           E
Sbjct: 92  E 92

>AEL224W Chr5 (207712..209454) [1743 bp, 580 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOR027W (STI1)
          Length = 580

 Score = 59.3 bits (142), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 31/89 (34%), Positives = 49/89 (55%), Gaps = 2/89 (2%)

Query: 86  ASELKKRGNAYFKVKDYENAINYYKFALQLKNDP--VFYSNMAACYISLEHNKEAIEACS 143
           A E KK GN+ F  KD+E AI  +  A+++   P  V YSN +ACY S+   +EA+    
Sbjct: 4   AEEYKKEGNSAFAAKDFEKAIELFGKAIEVSEQPNHVLYSNRSACYASMRKFREALADAQ 63

Query: 144 KALELNPDYSKVLLKRAAVYENIGKFADA 172
           + + + PD+SK   +  A +  +G   +A
Sbjct: 64  ECVRIKPDWSKGHNRLGAAHYGLGDLDEA 92

 Score = 42.0 bits (97), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 29/108 (26%), Positives = 54/108 (50%), Gaps = 2/108 (1%)

Query: 84  EYASELKKRGNAYFKVKDYENAIN-YYKFALQLKNDPVFYSNMAACYISLEHNKEAIEAC 142
           E A E + +G  YF   D+ NA+  Y +   +   D   YSN AA    L    +AI+ C
Sbjct: 386 EKAEEARLQGKEYFTNADWPNAVKAYTEMIKRAPEDARGYSNRAAALAKLMSFPDAIKDC 445

Query: 143 SKALELNPDYSKVLLKRAAVYENIGKFADALLDL-TAVSLNGDYNDAT 189
             A++ +P++ +  +++A     + ++A A+  L TA   + + N+ +
Sbjct: 446 DMAIQKDPNFVRAYIRKATAQIAVQEYAAAIETLDTAREKDAEVNNGS 493

 Score = 32.7 bits (73), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 33/126 (26%), Positives = 54/126 (42%), Gaps = 11/126 (8%)

Query: 368 YYHRGQMNFIIQKYEKAGEDFDKAKECD--PTNIFPYIQLACMS----YREGHFDDCETL 421
           Y   G   F  + +EKA E F KA E    P ++    + AC +    +RE   D  E +
Sbjct: 7   YKKEGNSAFAAKDFEKAIELFGKAIEVSEQPNHVLYSNRSACYASMRKFREALADAQECV 66

Query: 422 FSEARRKFPDAPEVPNFFAEILSDKGEIEKAAAEYDKAIELESKSENIHVGIAPLVGKAT 481
                R  PD  +  N         G++++A   Y KA+EL+S ++    G+A +     
Sbjct: 67  -----RIKPDWSKGHNRLGAAHYGLGDLDEAEESYKKALELDSSNKAAQDGLAQVQATQQ 121

Query: 482 TLLKYP 487
             ++ P
Sbjct: 122 QRMEQP 127

>SAKL0G07084g Chr7 (580004..581761) [1758 bp, 585 aa] {ON} highly
           similar to uniprot|P15705 Saccharomyces cerevisiae
           YOR027W STI1 Heat shock protein also induced by
           canavanine and entry into stationary phase
          Length = 585

 Score = 58.5 bits (140), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 31/89 (34%), Positives = 50/89 (56%), Gaps = 2/89 (2%)

Query: 86  ASELKKRGNAYFKVKDYENAINYYKFALQLKNDP--VFYSNMAACYISLEHNKEAIEACS 143
           A E K++GNA F  KD+E AI  +  A+++   P  V YSN +ACY S +   +A+E   
Sbjct: 3   ADEYKQQGNAAFAAKDFEKAIELFTKAIEVSEKPNHVLYSNRSACYTSTKQFNKALEDAK 62

Query: 144 KALELNPDYSKVLLKRAAVYENIGKFADA 172
           + + +NP +SK   +  A +  +G   +A
Sbjct: 63  QCVNINPAWSKGYNRVGAAHFGLGDLDEA 91

 Score = 40.4 bits (93), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 26/94 (27%), Positives = 46/94 (48%), Gaps = 1/94 (1%)

Query: 84  EYASELKKRGNAYFKVKDYENAI-NYYKFALQLKNDPVFYSNMAACYISLEHNKEAIEAC 142
           E A E + +G  YF   D+ NA+ +Y +   +   D   YSN AA    L    EAI+ C
Sbjct: 391 EKAEEARLQGKEYFTKGDWPNAVKSYTEMIKRAPEDARGYSNRAAALSKLMSFPEAIKDC 450

Query: 143 SKALELNPDYSKVLLKRAAVYENIGKFADALLDL 176
           + A+  +P++ +  +++A     + +F   +  L
Sbjct: 451 NVAISKDPNFIRAYIRKATAQIAVREFVSVIETL 484

 Score = 33.9 bits (76), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 25/73 (34%), Positives = 37/73 (50%), Gaps = 5/73 (6%)

Query: 90  KKRGNAYFKVKDYENAINYYKFALQLKNDPVFYSNMAAC-YISLEHN---KEAIEACSKA 145
           K  GN ++K + ++ AI +Y  A +L  D  + +N AA  Y   E+    K   EA  + 
Sbjct: 263 KAEGNKFYKARKFDEAIEHYSKAWELHKDITYLNNRAAAEYEKGEYETAIKTLTEAVEQG 322

Query: 146 LELNPDYSKVLLK 158
            EL  DY KV+ K
Sbjct: 323 RELRADY-KVISK 334

>Smik_15.205 Chr15 (346899..348668) [1770 bp, 589 aa] {ON} YOR027W
           (REAL)
          Length = 589

 Score = 57.8 bits (138), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 30/89 (33%), Positives = 50/89 (56%), Gaps = 2/89 (2%)

Query: 86  ASELKKRGNAYFKVKDYENAINYYKFALQLKNDP--VFYSNMAACYISLEHNKEAIEACS 143
           A E K++GN+ F  KDY+ AI  +  A+++   P  V YSN +ACY SL+   +A+    
Sbjct: 5   ADEYKQQGNSAFTAKDYDKAIELFTKAIEVSKTPNHVLYSNRSACYASLKKFSDALNDAK 64

Query: 144 KALELNPDYSKVLLKRAAVYENIGKFADA 172
           + + +NP +SK   +  A +  +G   +A
Sbjct: 65  ECININPSWSKGYNRLGAAHLGLGDLDEA 93

 Score = 47.0 bits (110), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 31/97 (31%), Positives = 48/97 (49%), Gaps = 1/97 (1%)

Query: 84  EYASELKKRGNAYFKVKDYENAIN-YYKFALQLKNDPVFYSNMAACYISLEHNKEAIEAC 142
           E A E +  G  YF   D+ NA+  Y +   +   D   YSN AA    L    EAI  C
Sbjct: 394 EKAEEARLEGKDYFTKSDWPNAVKAYTEMIKRAPEDARGYSNRAAALAKLMSFPEAIADC 453

Query: 143 SKALELNPDYSKVLLKRAAVYENIGKFADALLDLTAV 179
           +KA+E +P++ +  +++A     + ++A AL  L A 
Sbjct: 454 NKAIEKDPNFVRAYIRKATAQIAVQEYAAALETLDAA 490

 Score = 33.9 bits (76), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 24/89 (26%), Positives = 40/89 (44%), Gaps = 7/89 (7%)

Query: 86  ASELKKRGNAYFKVKDYENAINYYKFALQLKNDPVFYSNMAACYISLEHNKEAI----EA 141
           A + K  GN ++K + ++ AI +Y  A +L  D  + +N AA        K AI    +A
Sbjct: 262 ADKEKAEGNKFYKARQFDEAIEHYNKAWELHRDITYLNNRAAAEYEKGEYKTAIATLNDA 321

Query: 142 CSKALELNPDY---SKVLLKRAAVYENIG 167
             +  E+  DY   S+   +    Y  +G
Sbjct: 322 VEQGREMRADYKVISRSFARIGNAYHKLG 350

>Ecym_3025 Chr3 complement(50289..51245) [957 bp, 318 aa] {ON}
           similar to Ashbya gossypii ACR005W
          Length = 318

 Score = 56.6 bits (135), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 35/98 (35%), Positives = 50/98 (51%), Gaps = 1/98 (1%)

Query: 77  AETAEKNEYASELKKRGNAYFKVKDYENAINYYKFALQL-KNDPVFYSNMAACYISLEHN 135
           A   E  E A  LK  GN  F  KD+E A+  Y  A++L  N+ VFY N AA Y S +  
Sbjct: 87  AHAPEVAERAENLKLEGNKAFAAKDFEGAVKKYTEAIELMPNNAVFYGNRAAAYSSFKKF 146

Query: 136 KEAIEACSKALELNPDYSKVLLKRAAVYENIGKFADAL 173
           +EA+     A+ +NP YS+   +       +GK  +A+
Sbjct: 147 EEAVRDAESAVRINPSYSRGYSRLGLAKYALGKPEEAM 184

>Kwal_55.21175 s55 complement(716457..717992) [1536 bp, 511 aa] {ON}
           YGR123C (PPT1) - serine/threonine phosphatase [contig
           295] FULL
          Length = 511

 Score = 57.4 bits (137), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 36/102 (35%), Positives = 55/102 (53%), Gaps = 1/102 (0%)

Query: 79  TAEKNEYASELKKRGNAYFKVKDYENAINYYKFALQLKN-DPVFYSNMAACYISLEHNKE 137
           T E  + A E K +GNAY K K Y+ A+ YY  A++L +   +++SN A   + L++   
Sbjct: 3   TQEAAQQALEFKNQGNAYVKEKKYQEAVEYYSKAIELDDTQSIYFSNRAFSRLRLDNFLT 62

Query: 138 AIEACSKALELNPDYSKVLLKRAAVYENIGKFADALLDLTAV 179
           A E C KA+ L+P   K + +R   Y  + +F  A  DL  V
Sbjct: 63  AQEDCDKAIALDPKNIKAIHRRGLSYVGLLEFFKARKDLRVV 104

 Score = 31.2 bits (69), Expect = 7.9,   Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 26/51 (50%), Gaps = 3/51 (5%)

Query: 349 EYYSNFQKAIDLDPNMAAIYYHRGQMNFIIQKYEKAGEDFDKAKECDPTNI 399
           EYYS   KAI+LD   +  + +R      +  +  A ED DKA   DP NI
Sbjct: 31  EYYS---KAIELDDTQSIYFSNRAFSRLRLDNFLTAQEDCDKAIALDPKNI 78

>Kpol_1018.69 s1018 (197149..198921) [1773 bp, 590 aa] {ON}
           (197149..198921) [1773 nt, 591 aa]
          Length = 590

 Score = 57.4 bits (137), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 31/89 (34%), Positives = 51/89 (57%), Gaps = 2/89 (2%)

Query: 86  ASELKKRGNAYFKVKDYENAINYYKFALQLKNDP--VFYSNMAACYISLEHNKEAIEACS 143
           A E K++GNA F  KDY+ AI+ +  A+ +   P  V YSN +ACY SL+    A++   
Sbjct: 5   ADEYKQQGNAAFVAKDYDKAIDLFSKAIDVSEQPNHVLYSNRSACYTSLKKFVNALKDAE 64

Query: 144 KALELNPDYSKVLLKRAAVYENIGKFADA 172
           + +++NP +SK   +  A +  +G   +A
Sbjct: 65  ECVKINPSWSKGYNRVGAAHFGMGDLDEA 93

 Score = 48.5 bits (114), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 31/97 (31%), Positives = 49/97 (50%), Gaps = 1/97 (1%)

Query: 84  EYASELKKRGNAYFKVKDYENAIN-YYKFALQLKNDPVFYSNMAACYISLEHNKEAIEAC 142
           E A E +  G  YF   D+ NA+  Y +   +   D   YSN AA    L    EAI+ C
Sbjct: 395 EKAEEARLEGKDYFTKGDWPNAVKAYTEMIKRAPEDARGYSNRAAVLSKLMSFPEAIDDC 454

Query: 143 SKALELNPDYSKVLLKRAAVYENIGKFADALLDLTAV 179
           +KA+E +P++ +  +++A     + +F+ AL  L A 
Sbjct: 455 NKAIEKDPNFVRAYIRKATAQIAVREFSSALETLDAA 491

>TPHA0D02880 Chr4 (599288..601045) [1758 bp, 585 aa] {ON} Anc_5.617
           YOR027W
          Length = 585

 Score = 57.4 bits (137), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 29/89 (32%), Positives = 52/89 (58%), Gaps = 2/89 (2%)

Query: 86  ASELKKRGNAYFKVKDYENAINYYKFALQLKNDP--VFYSNMAACYISLEHNKEAIEACS 143
           A E K++GN  F  K+YE A++ +  A+++  +P  V YSN +ACY SL+   +A+   +
Sbjct: 5   ADEYKQQGNTAFSAKEYEKAVDLFSKAIEVSPEPNHVLYSNRSACYTSLKKFTDALNDAN 64

Query: 144 KALELNPDYSKVLLKRAAVYENIGKFADA 172
           +  ++NP +SK   +  A +  +G   +A
Sbjct: 65  ECTKINPTWSKGYNRVGAAHYGLGDLDEA 93

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 29/94 (30%), Positives = 47/94 (50%), Gaps = 1/94 (1%)

Query: 84  EYASELKKRGNAYFKVKDYENAIN-YYKFALQLKNDPVFYSNMAACYISLEHNKEAIEAC 142
           E A E + +G  +F    + +A+  Y +   +  +D   YSN AA    L    EAI  C
Sbjct: 390 EKAEEARIQGKDFFNKGQWPDAVKAYTEMIARAPDDARAYSNRAAALSKLMSFPEAISDC 449

Query: 143 SKALELNPDYSKVLLKRAAVYENIGKFADALLDL 176
            KALE +P++ K  +++A     I +++ AL  L
Sbjct: 450 EKALEKDPNFVKAYIRKATAQIAIKEYSSALETL 483

 Score = 31.2 bits (69), Expect = 8.5,   Method: Compositional matrix adjust.
 Identities = 26/93 (27%), Positives = 41/93 (44%), Gaps = 13/93 (13%)

Query: 90  KKRGNAYFKVKDYENAINYYKFALQLKNDPVFYSNMAACY-------ISLEHNKEAIEAC 142
           K  GN  +K   ++ AI +Y  A +L ND  + +N AA          +++  ++AIE  
Sbjct: 262 KDEGNKLYKAHKFDEAIEHYDKAWELHNDITYLNNKAAAQYEKGDYETTIKTLEDAIE-- 319

Query: 143 SKALELNPDY---SKVLLKRAAVYENIGKFADA 172
            K  EL  DY   +K   +    YE +     A
Sbjct: 320 -KGRELRADYKIIAKAFTRMGNAYEKLNDLKKA 351

>TBLA0C03950 Chr3 complement(950339..951877) [1539 bp, 512 aa] {ON}
           Anc_3.481 YGR123C
          Length = 512

 Score = 57.0 bits (136), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 37/105 (35%), Positives = 56/105 (53%), Gaps = 2/105 (1%)

Query: 86  ASELKKRGNAYFKVKDYENAINYYKFALQLKND-PVFYSNMAACYISLEHNKEAIEACSK 144
           A E K RGN   K +DY  AI  Y  A++L +   +++SN A  ++ +++ +  I  C K
Sbjct: 12  ALEFKNRGNDAIKTQDYPGAIELYTEAIKLDDTVSIYFSNRAMGHLKMDNFQSGINDCDK 71

Query: 145 ALELNPDYSKVLLKRAAVYENIGKFADALLDLTAVSLNGDYNDAT 189
           ALE++P   K   +R   Y  + +F +A  DL  V L    NDAT
Sbjct: 72  ALEIDPKNIKAYHRRGMSYIGLLEFKNAQKDLKIV-LASKPNDAT 115

>Skud_15.192 Chr15 (340847..342616) [1770 bp, 589 aa] {ON} YOR027W
           (REAL)
          Length = 589

 Score = 57.4 bits (137), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 39/126 (30%), Positives = 68/126 (53%), Gaps = 4/126 (3%)

Query: 86  ASELKKRGNAYFKVKDYENAINYYKFALQLKNDP--VFYSNMAACYISLEHNKEAIEACS 143
           A E K++GNA F  K+Y+ AI  +  A+++   P  V +SN +ACY SL+   +A+   +
Sbjct: 5   ADEYKQQGNAAFTAKNYDGAIELFTKAIEVSETPSHVLFSNRSACYTSLKKFSDALNDAN 64

Query: 144 KALELNPDYSKVLLKRAAVYENIGKFADALLDLTAVSLNGDYNDATIQPIVERV-LNKQA 202
           + +++NP +SK   +  A +  +G   +A  D    +L  D N+   +  +E+V   +QA
Sbjct: 65  ECVKINPSWSKGYNRLGAAHLGLGDLDEAESDYKK-ALELDANNKAAKDGLEQVHRTQQA 123

Query: 203 MMALKD 208
             A  D
Sbjct: 124 RQAQPD 129

 Score = 47.4 bits (111), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 31/92 (33%), Positives = 46/92 (50%), Gaps = 1/92 (1%)

Query: 86  ASELKKRGNAYFKVKDYENAIN-YYKFALQLKNDPVFYSNMAACYISLEHNKEAIEACSK 144
           A E +  G  YF   D+ NA+  Y +   +   D   YSN AA    L    EAI  C+K
Sbjct: 396 AEEARLEGKEYFTKSDWPNAVKAYTEMIKRAPEDARGYSNRAAALAKLMSFPEAIADCNK 455

Query: 145 ALELNPDYSKVLLKRAAVYENIGKFADALLDL 176
           A+E +P++ +  ++ AA    + +FA AL  L
Sbjct: 456 AIEKDPNFVRAYIRMAAAQIAVKEFAAALETL 487

>NDAI0B05790 Chr2 complement(1406039..1407610) [1572 bp, 523 aa]
           {ON} Anc_3.481
          Length = 523

 Score = 57.0 bits (136), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 48/169 (28%), Positives = 79/169 (46%), Gaps = 11/169 (6%)

Query: 74  MKLAETAEKNEYASELKKRGNAYFKVKDYENAINYYKFALQL-KNDPVFYSNMAACYISL 132
           M    T E  + A +LK  GN Y K K Y  A+ YY  A++L     +F+SN A   + L
Sbjct: 1   MSTTPTTEAAQQAIDLKNEGNKYIKEKKYTKAVEYYTKAIELDSTQSIFFSNRALAQLKL 60

Query: 133 EHNKEAIEACSKALELNPDYSKVLLKRAAVYENIGKFADALLDLTAVSLNGDYNDATIQ- 191
           ++ +  ++ C+ ALEL+P   K   +R      +  F  A  DL+ V L    +DAT + 
Sbjct: 61  DNFQSCLDDCNSALELDPKNIKAYHRRGLSQLGLLHFKKAKNDLSIV-LKAKPSDATAKR 119

Query: 192 --PIVERVLNKQAMMALKDHLEASEKNKVLPSYTSMAAFFGVFDAETDI 238
              + E+V+ ++     K  +   + ++V P           FDA +D+
Sbjct: 120 ALDMCEKVIREE---RFKKAIGGDDTDRVNP---CQVLNLSSFDANSDL 162

>KLLA0B09966g Chr2 complement(872760..873872) [1113 bp, 370 aa] {ON}
           similar to uniprot|P33313 Saccharomyces cerevisiae
           YBR155W CNS1 cyclophilin seven suppressor component of
           Hsp90p chaperone machinery
          Length = 370

 Score = 56.6 bits (135), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 42/142 (29%), Positives = 70/142 (49%), Gaps = 9/142 (6%)

Query: 67  DEPDIELMKLAETA---EKNEYASELKKRGNAYFKVKDYENAINYYKFALQLKNDPV--- 120
           DE ++EL  L   A   E +E A+  K +GN  +K K +++A   Y  AL +K D +   
Sbjct: 48  DESNVELEALKAMAYEGEPHEIATNFKNQGNDLYKGKRFKDARAMYLKALDVKCDVLSIN 107

Query: 121 --FYSNMAACYISLEHNKEAIEACSKALELNPDYSKVLLKRAAVYENIGKFADALLDLTA 178
              Y N+AAC + +++ +  I  C +AL+LN    K   +    Y  +G+F D+ L+   
Sbjct: 108 ESLYLNLAACELEIKNYRSCINYCREALKLNAKNVKAFFRIGKAYLELGRFEDS-LEAVQ 166

Query: 179 VSLNGDYNDATIQPIVERVLNK 200
           V L  D  +  ++ I  +   K
Sbjct: 167 VGLAVDPENGALKSIQSKATEK 188

>SAKL0A01672g Chr1 complement(154932..155318) [387 bp, 128 aa] {ON}
           similar to uniprot|P25638 Saccharomyces cerevisiae
           YCR060W TAH1 HSP90
          Length = 128

 Score = 52.8 bits (125), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 27/61 (44%), Positives = 40/61 (65%), Gaps = 1/61 (1%)

Query: 89  LKKRGNAYFKVKDYENAINYYKFALQL-KNDPVFYSNMAACYISLEHNKEAIEACSKALE 147
           LK +GN +FK  DYE A+ YY+ A+    ++P+ YSN A   I LE   EA++AC+K L+
Sbjct: 7   LKAKGNVFFKKCDYETAVLYYQKAITADPSNPIGYSNNAMGLIKLEKWSEAVDACNKGLK 66

Query: 148 L 148
           +
Sbjct: 67  M 67

>Kwal_27.11890 s27 (990685..991689) [1005 bp, 334 aa] {ON} YBR155W
           (CNS1) - component of Hsp90p chaperone machinery [contig
           27] FULL
          Length = 334

 Score = 55.8 bits (133), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 37/134 (27%), Positives = 66/134 (49%), Gaps = 6/134 (4%)

Query: 73  LMKLAETAEKNEYASELKKRGNAYFKVKDYENAINYYKFALQLKNDP-----VFYSNMAA 127
           L  LA   E +E A   K +GN  +KVK Y++A   Y   +++K D        +SN AA
Sbjct: 65  LKALAYDGEPHEVAENFKNQGNELYKVKRYKDAREIYNKGIEIKCDSNKINESLFSNRAA 124

Query: 128 CYISLEHNKEAIEACSKALELNPDYSKVLLKRAAVYENIGKFADALLDLTAVSLNGDYND 187
           C + L++ +  +  C +AL+ NP   K   + A  +  + K  DA  +     L  D   
Sbjct: 125 CELELKNYRRCVNDCRQALQFNPTNIKCFYRIARAFFLLDKCEDA-KEAIEFGLKLDSES 183

Query: 188 ATIQPIVERVLNKQ 201
           A ++ ++++V+ ++
Sbjct: 184 AALKALLQKVIKRE 197

>NCAS0A00490 Chr1 complement(76652..78514) [1863 bp, 620 aa] {ON} 
          Length = 620

 Score = 55.8 bits (133), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 32/89 (35%), Positives = 48/89 (53%), Gaps = 2/89 (2%)

Query: 86  ASELKKRGNAYFKVKDYENAINYYKFALQL--KNDPVFYSNMAACYISLEHNKEAIEACS 143
           + ELK+ GN  +K K YE A++Y+  AL     N  + YSN AA +I L+H  EA+E   
Sbjct: 8   SQELKELGNKTYKEKGYEQAVHYFTSALSQPSTNKHILYSNRAAAHIGLKHYAEALEDGK 67

Query: 144 KALELNPDYSKVLLKRAAVYENIGKFADA 172
             +EL P++ K   +    Y  + K  +A
Sbjct: 68  NCVELAPNWDKGYSRVGVAYLGLQKLDEA 96

 Score = 34.7 bits (78), Expect = 0.71,   Method: Compositional matrix adjust.
 Identities = 40/175 (22%), Positives = 73/175 (41%), Gaps = 37/175 (21%)

Query: 91  KRGNAYFKVKDYENAINYYKFALQLKNDPVFYSNMAACYISLEH---------------- 134
           + GNAY ++ D+E+AI  Y++ L L  +      +A+  +  E                 
Sbjct: 374 RMGNAYHRIWDHEHAITAYEYGLMLNGNEEHKKKLASLRVEFEKVKKGEFIDLQKFEEAR 433

Query: 135 --------NKE---AIEACSKALELNPDYSKVLLKRAAVYENIGKFADALLDL-TAVSLN 182
                   N+E   A++  ++ ++ NP        RAAV+E +      + D   A+S++
Sbjct: 434 IEGKQHFLNREYFKAMKCYTEMIKTNPTSPVGWCNRAAVFEKLLTCPQVIDDCDKAISVD 493

Query: 183 GDYNDATIQP----IVERVLNK-----QAMMALKDHLEASEKNKVLPSYTSMAAF 228
             Y  A ++     I ER L++     ++  A       +EKN++L S  S   F
Sbjct: 494 PSYIKAYVRKGFAQITERDLDEALETWESGDAANKKYHGNEKNELLESLHSKVLF 548

>Kpol_513.2 s513 (1962..3086) [1125 bp, 374 aa] {ON} (1962..3086)
           [1125 nt, 375 aa]
          Length = 374

 Score = 55.1 bits (131), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 36/105 (34%), Positives = 50/105 (47%), Gaps = 5/105 (4%)

Query: 73  LMKLAETAEKNEYASELKKRGNAYFKVKDYENAINYYKFALQLKND-----PVFYSNMAA 127
           L  LA   E +E A   K +GN  +KVK + +A   Y  A+ +K D        Y+N AA
Sbjct: 61  LKALAYEGEPHEIAGNFKNQGNDLYKVKRFRDARELYNKAIDVKCDDDKINESLYANRAA 120

Query: 128 CYISLEHNKEAIEACSKALELNPDYSKVLLKRAAVYENIGKFADA 172
           C + L++ +  I  C  AL LNP   K   + A  +  I KF D 
Sbjct: 121 CELELKNYRRCINDCKMALSLNPKNIKCYFRMAKAFLAIEKFDDC 165

>KNAG0A07900 Chr1 complement(1258164..1259702) [1539 bp, 512 aa]
           {ON} Anc_3.481 YGR123C
          Length = 512

 Score = 55.5 bits (132), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 38/113 (33%), Positives = 61/113 (53%), Gaps = 2/113 (1%)

Query: 84  EYASELKKRGNAYFKVKDYENAINYYKFALQL-KNDPVFYSNMAACYISLEHNKEAIEAC 142
           E A + K  GN Y K +DY+ AI  Y  A++L     +FYSN A  ++ L++ + A+  C
Sbjct: 10  EAALKFKDEGNVYIKSQDYQKAIELYTKAIELDSTSSIFYSNRALAHLKLDNFQSALHDC 69

Query: 143 SKALELNPDYSKVLLKRAAVYENIGKFADALLDLTAVSLNGDYNDATIQPIVE 195
           + A++L+ +  K   +R   Y  + +F  A  DLT + L    NDAT +  +E
Sbjct: 70  NDAIKLDNNNIKAYHRRGLAYVGLLEFRKAKNDLT-ILLKYKPNDATAKRGLE 121

>SAKL0E01210g Chr5 complement(93267..94238) [972 bp, 323 aa] {ON}
           similar to uniprot|Q12118 Saccharomyces cerevisiae
           YOR007C SGT2 Glutamine-rich cytoplasmic protein of
           unknown function contains tetratricopeptide (TPR)
           repeats which often mediate protein-protein interactions
           conserved in human and C. elegans
          Length = 323

 Score = 54.3 bits (129), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 35/98 (35%), Positives = 55/98 (56%), Gaps = 1/98 (1%)

Query: 77  AETAEKNEYASELKKRGNAYFKVKDYENAINYYKFALQ-LKNDPVFYSNMAACYISLEHN 135
           AE A     A +LK +GN     KD+E AI  Y  A++ L ++ V+Y+N AA Y SL+  
Sbjct: 88  AEDANTKAKAEDLKLQGNKAMASKDFETAIKKYTEAIEVLPSNAVYYANRAAAYSSLKKY 147

Query: 136 KEAIEACSKALELNPDYSKVLLKRAAVYENIGKFADAL 173
           +E+++    A+++NP YSK   +       +GK  +AL
Sbjct: 148 EESVQDAESAIKVNPSYSKGYSRLGFAKYALGKPEEAL 185

>Kwal_56.22433 s56 complement(124778..125746) [969 bp, 322 aa] {ON}
           YOR007C (SGT2) - small glutamine-rich tetratricopeptide
           repeat containing protein [contig 185] FULL
          Length = 322

 Score = 54.3 bits (129), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 51/161 (31%), Positives = 79/161 (49%), Gaps = 15/161 (9%)

Query: 78  ETAEKNEYASELKKRGNAYFKVKDYENAINYYKFALQ-LKNDPVFYSNMAACYISLEHNK 136
           E AE    A  LK  GN     KD+E A+  Y  A+Q L  + V+Y+N AA + SL+  +
Sbjct: 89  EDAETKAKAESLKLEGNKAMAAKDFEQAVLKYSEAIQVLPTNAVYYANRAAAHSSLKKYE 148

Query: 137 EAIEACSKALELNPDYSKVLLKRAAVYENIGKFADAL------LDLTAV----SLNGDYN 186
           EA++    A+++NP YSK   +       +GK  +AL      LD+       ++  DY+
Sbjct: 149 EAVKDAEDAIKVNPSYSKGYSRLGFAQYALGKPEEALDAYKKVLDIEGEAATDAMKRDYD 208

Query: 187 DATIQPIVERVLN--KQAMMALKDHLEASEKNKVLPSYTSM 225
            A  +  V + LN  K A  A +D   ++  +  LP  +SM
Sbjct: 209 TAMKK--VGQSLNVEKSAPAATRDGAGSATGSGGLPDISSM 247

>ACR005W Chr3 (363355..364338) [984 bp, 327 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOR007C (SGT2)
          Length = 327

 Score = 53.9 bits (128), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 33/89 (37%), Positives = 48/89 (53%), Gaps = 1/89 (1%)

Query: 86  ASELKKRGNAYFKVKDYENAINYYKFALQ-LKNDPVFYSNMAACYISLEHNKEAIEACSK 144
           A  LK  GN     KDYE AI  Y  A++ L  D V+Y+N AA Y SL+  ++A+E   K
Sbjct: 90  AEALKLEGNRAMAAKDYETAIQKYTAAIEVLPTDAVYYANRAAAYSSLQQYEKAVEDAEK 149

Query: 145 ALELNPDYSKVLLKRAAVYENIGKFADAL 173
           A +++  YSK   +       +G+  +AL
Sbjct: 150 ATKVDSSYSKGFSRLGYAKYALGRHEEAL 178

 Score = 31.6 bits (70), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 22/73 (30%), Positives = 36/73 (49%), Gaps = 3/73 (4%)

Query: 349 EYYSNFQK---AIDLDPNMAAIYYHRGQMNFIIQKYEKAGEDFDKAKECDPTNIFPYIQL 405
           +Y +  QK   AI++ P  A  Y +R      +Q+YEKA ED +KA + D +    + +L
Sbjct: 105 DYETAIQKYTAAIEVLPTDAVYYANRAAAYSSLQQYEKAVEDAEKATKVDSSYSKGFSRL 164

Query: 406 ACMSYREGHFDDC 418
               Y  G  ++ 
Sbjct: 165 GYAKYALGRHEEA 177

>TDEL0A04840 Chr1 (851520..853250) [1731 bp, 576 aa] {ON} Anc_5.617
           YOR027W
          Length = 576

 Score = 54.7 bits (130), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 31/89 (34%), Positives = 47/89 (52%), Gaps = 2/89 (2%)

Query: 86  ASELKKRGNAYFKVKDYENAINYYKFALQLKNDP--VFYSNMAACYISLEHNKEAIEACS 143
           A E K++GNA F  KDYE A   +  A+ +   P  V YSN +ACY SL+   E ++   
Sbjct: 4   ADEYKQQGNAAFVAKDYEKAAELFGKAIDVSEQPNHVLYSNRSACYTSLKKFAEGLKDAE 63

Query: 144 KALELNPDYSKVLLKRAAVYENIGKFADA 172
           + +++NP +SK   +  A    +    DA
Sbjct: 64  ECVKINPGWSKGYNRVGAAQFGLNNLEDA 92

 Score = 46.6 bits (109), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 30/97 (30%), Positives = 48/97 (49%), Gaps = 1/97 (1%)

Query: 84  EYASELKKRGNAYFKVKDYENAINYYKFALQLK-NDPVFYSNMAACYISLEHNKEAIEAC 142
           E A E +  G  YF   D+ NA+  Y   ++    D   YSN AA    L    EAI  C
Sbjct: 380 EKAEEARLEGKEYFSKADWPNAVKAYTEMIKRSPQDARGYSNRAAALAKLMSFPEAIADC 439

Query: 143 SKALELNPDYSKVLLKRAAVYENIGKFADALLDLTAV 179
            +A+E +P++ +  +++A+    + +FA A+  L  V
Sbjct: 440 DRAIEKDPNFIRAYIRKASAQIAVKEFAAAVETLDTV 476

 Score = 33.9 bits (76), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 29/95 (30%), Positives = 44/95 (46%), Gaps = 8/95 (8%)

Query: 86  ASELKKRGNAYFKVKDYENAINYYKFALQLKNDPVFYSNMAACYISLEHNKEAIEACSKA 145
           A E K  GN ++K + ++ AI +Y  A +L  D  + +N AA        + AI   + A
Sbjct: 248 AEEEKAEGNKFYKARKFDEAIEHYNKAWELHKDITYLNNRAAAEYEKGDYETAIATLTNA 307

Query: 146 L----ELNPDYSKVLLKRAAVYENIGKFADALLDL 176
           +    E+  DY KV+ K    +  IG     L DL
Sbjct: 308 VDEGREMRADY-KVIAKS---FARIGNAYHKLGDL 338

>TPHA0L01420 Chr12 (293980..295104) [1125 bp, 374 aa] {ON} Anc_8.506
           YBR155W
          Length = 374

 Score = 53.9 bits (128), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 38/134 (28%), Positives = 66/134 (49%), Gaps = 6/134 (4%)

Query: 73  LMKLAETAEKNEYASELKKRGNAYFKVKDYENAINYYKFALQLK--NDPV---FYSNMAA 127
           L  LA   E +E A   KK+GN  +K+K Y NA   Y+  +++   ND +    + N AA
Sbjct: 61  LKALAYEGEPHEIAENFKKQGNEAYKLKQYRNARVLYERGIEVNCNNDKINELLFVNKAA 120

Query: 128 CYISLEHNKEAIEACSKALELNPDYSKVLLKRAAVYENIGKFADALLDLTAVSLNGDYND 187
           C + +++ +  I  C KAL  NP   K   + A  +  I K+ D   +     L  D  +
Sbjct: 121 CELEMKNYRSCINDCKKALSFNPLNVKCYFRMAKAFSAIEKY-DESRESIEFGLKVDSRN 179

Query: 188 ATIQPIVERVLNKQ 201
           +++  +++ ++ KQ
Sbjct: 180 SSLLNLLKTIIKKQ 193

>KAFR0C05890 Chr3 (1165932..1167659) [1728 bp, 575 aa] {ON}
           Anc_5.617 YOR027W
          Length = 575

 Score = 54.7 bits (130), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 27/89 (30%), Positives = 51/89 (57%), Gaps = 2/89 (2%)

Query: 86  ASELKKRGNAYFKVKDYENAINYYKFALQLKNDP--VFYSNMAACYISLEHNKEAIEACS 143
           A E K+ GN  F  KDY+ AI+ +  A+++   P  V YSN +A Y S +  ++A+    
Sbjct: 5   ADEYKQEGNTAFVAKDYQKAIDAFTKAIEVSETPNHVLYSNRSAAYTSSKQYEQALSDAD 64

Query: 144 KALELNPDYSKVLLKRAAVYENIGKFADA 172
           + +++NP ++K   ++ A  + + K+ +A
Sbjct: 65  ECIKINPSWAKGYTRKGAALQGLHKYEEA 93

 Score = 48.1 bits (113), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 32/96 (33%), Positives = 50/96 (52%), Gaps = 3/96 (3%)

Query: 84  EYASELKKRGNAYFKVKDYENAI-NYYKFALQLKNDPVFYSNMAACYISLEHNKEAIEAC 142
           E A E +  G  YF   D+ NA+ +Y +   +  +D   YSN AA    L    +AI  C
Sbjct: 383 EKAEEARLEGKEYFTKADWPNAVKSYTEMIKRAPDDARGYSNRAAALAKLMSFPDAISDC 442

Query: 143 SKALELNPDYSKVLLKRAAVYENIGKFADAL--LDL 176
           +KA+E +P + +  L++A     + +FA A+  LDL
Sbjct: 443 NKAIEKDPSFIRAYLRKATCQIAVKEFAGAIETLDL 478

 Score = 32.3 bits (72), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 29/117 (24%), Positives = 48/117 (41%), Gaps = 27/117 (23%)

Query: 86  ASELKKRGNAYFKVKDYENAINYYKFALQLKNDPVFYSNM-----------AACYISLEH 134
           A    + GNAY K+ D + AI YY+ +L     P   S +           A  Y+S E 
Sbjct: 325 AKSFARMGNAYAKLDDLKKAIEYYQKSLTEHRTPDILSKLRKAEKDLKQQEAEAYLSPEK 384

Query: 135 NKE----------------AIEACSKALELNPDYSKVLLKRAAVYENIGKFADALLD 175
            +E                A+++ ++ ++  PD ++    RAA    +  F DA+ D
Sbjct: 385 AEEARLEGKEYFTKADWPNAVKSYTEMIKRAPDDARGYSNRAAALAKLMSFPDAISD 441

>Kpol_1037.26 s1037 complement(59590..60618) [1029 bp, 342 aa] {ON}
           complement(59590..60618) [1029 nt, 343 aa]
          Length = 342

 Score = 53.9 bits (128), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 37/94 (39%), Positives = 50/94 (53%), Gaps = 1/94 (1%)

Query: 81  EKNEYASELKKRGNAYFKVKDYENAINYYKFAL-QLKNDPVFYSNMAACYISLEHNKEAI 139
           E +E A  LK  GN     KDYE AI  Y  A+  L  + V+++N AA Y SL+   EA+
Sbjct: 95  EASEAAEALKLEGNKAMAGKDYELAIKKYTEAIATLPTNAVYFANRAAAYSSLKKYDEAV 154

Query: 140 EACSKALELNPDYSKVLLKRAAVYENIGKFADAL 173
           E  + A+++NP YSK   +        GK  DAL
Sbjct: 155 EDANSAIKINPTYSKGYSRLGFAKFAQGKAEDAL 188

>Skud_2.282 Chr2 (517201..518358) [1158 bp, 385 aa] {ON} YBR155W
           (REAL)
          Length = 385

 Score = 53.9 bits (128), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 33/105 (31%), Positives = 55/105 (52%), Gaps = 5/105 (4%)

Query: 73  LMKLAETAEKNEYASELKKRGNAYFKVKDYENAINYYKFALQLKNDPVF-----YSNMAA 127
           L  LA   E +E A   KK+GN  +K K +++A   Y   L ++ +  F     ++N AA
Sbjct: 70  LKALAYEGEPHEIAGGFKKQGNELYKAKRFKDARELYIKGLNVECEDKFINESLFANKAA 129

Query: 128 CYISLEHNKEAIEACSKALELNPDYSKVLLKRAAVYENIGKFADA 172
           C + L++ +  IE CSKAL +NP  +K   + +  +  + K  +A
Sbjct: 130 CELELKNYRRCIEDCSKALSINPKNTKCYYRTSKAFFQLNKLEEA 174

>TBLA0H03380 Chr8 (829314..830441) [1128 bp, 375 aa] {ON} Anc_8.506
           YBR155W
          Length = 375

 Score = 53.5 bits (127), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 35/114 (30%), Positives = 59/114 (51%), Gaps = 8/114 (7%)

Query: 65  INDEPDIELMK-LAETAEKNEYASELKKRGNAYFKVKDYENAINYYKFALQLKND----- 118
           +ND  ++E +K LA   E +E A   K RGN ++K+K Y +A   Y   + +K D     
Sbjct: 54  VND--NLEALKALAYEGEPHEIAGNFKNRGNEFYKLKQYRDAREVYTKGIDVKCDDDKIN 111

Query: 119 PVFYSNMAACYISLEHNKEAIEACSKALELNPDYSKVLLKRAAVYENIGKFADA 172
              Y+N AAC + L++ ++ IE C KAL  N    K   +    + ++ +F ++
Sbjct: 112 ESLYANRAACELELKNFRKCIEDCKKALSFNVKNIKCYYRMGKAFLSVDRFDES 165

>YBR155W Chr2 (549771..550928) [1158 bp, 385 aa] {ON}
           CNS1TPR-containing co-chaperone; binds both Hsp82p
           (Hsp90) and Ssa1p (Hsp70) and stimulates the ATPase
           activity of SSA1, ts mutants reduce Hsp82p function
           while over expression suppresses the phenotypes of an
           HSP82 ts allele and a cpr7 deletion
          Length = 385

 Score = 53.1 bits (126), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 33/105 (31%), Positives = 55/105 (52%), Gaps = 5/105 (4%)

Query: 73  LMKLAETAEKNEYASELKKRGNAYFKVKDYENAINYYK--FALQLKNDPV---FYSNMAA 127
           L  LA   E +E A   KK+GN  +K K +++A   Y    A++ ++  +    Y+N AA
Sbjct: 70  LKALAYEGEPHEIAENFKKQGNELYKAKRFKDARELYSKGLAVECEDKSINESLYANRAA 129

Query: 128 CYISLEHNKEAIEACSKALELNPDYSKVLLKRAAVYENIGKFADA 172
           C + L++ +  IE CSKAL +NP   K   + +  +  + K  +A
Sbjct: 130 CELELKNYRRCIEDCSKALTINPKNVKCYYRTSKAFFQLNKLEEA 174

>TPHA0J00340 Chr10 complement(76166..77182) [1017 bp, 338 aa] {ON}
           Anc_6.21 YOR007C
          Length = 338

 Score = 52.8 bits (125), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 35/94 (37%), Positives = 49/94 (52%), Gaps = 1/94 (1%)

Query: 81  EKNEYASELKKRGNAYFKVKDYENAINYYKFALQ-LKNDPVFYSNMAACYISLEHNKEAI 139
           E+   A  LK  GN     KDYE+AI  Y  A++ L  + V+Y+N AA Y SL+   +A+
Sbjct: 88  EQKATAEGLKLEGNKAMATKDYESAIKKYSEAIEVLPTNAVYYANRAAAYSSLKKYDDAV 147

Query: 140 EACSKALELNPDYSKVLLKRAAVYENIGKFADAL 173
                A+++NP YSK   +        GK  DAL
Sbjct: 148 NDAESAIKVNPTYSKGYSRLGFAKFAQGKVEDAL 181

>KAFR0E02980 Chr5 (596891..598033) [1143 bp, 380 aa] {ON} Anc_8.506
           YBR155W
          Length = 380

 Score = 52.8 bits (125), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 33/105 (31%), Positives = 48/105 (45%), Gaps = 5/105 (4%)

Query: 73  LMKLAETAEKNEYASELKKRGNAYFKVKDYENAINYYKFALQLKNDPV-----FYSNMAA 127
           L  LA   E +E A   K +GN  +KVK + +A   Y   +++K D        Y+N AA
Sbjct: 65  LKALAYEGEPHEIAENFKNQGNDLYKVKRFRDAREIYTKGIEMKCDVAKINESLYANRAA 124

Query: 128 CYISLEHNKEAIEACSKALELNPDYSKVLLKRAAVYENIGKFADA 172
           C + L++ +  I  C  AL  NP   K   +    +  I KF  A
Sbjct: 125 CQLELKNFRSCISDCKTALTYNPKNIKCYFRMGKAFTAINKFESA 169

>TDEL0D05500 Chr4 complement(991567..993105) [1539 bp, 512 aa] {ON}
           Anc_3.481 YGR123C
          Length = 512

 Score = 53.1 bits (126), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 35/112 (31%), Positives = 61/112 (54%), Gaps = 2/112 (1%)

Query: 79  TAEKNEYASELKKRGNAYFKVKDYENAINYYKFALQL-KNDPVFYSNMAACYISLEHNKE 137
           T+E++  A +LK  GN + K +D+  AI+ Y  A+ L     +++SN A  ++ L++ + 
Sbjct: 5   TSEQSAEALKLKNEGNIFIKKQDFTKAIDLYTKAIGLDSTQSIYFSNRALAHLKLDNFQS 64

Query: 138 AIEACSKALELNPDYSKVLLKRAAVYENIGKFADALLDLTAVSLNGDYNDAT 189
           ++  C +AL+L+P  +K   +R   Y  + +F  A  DL  V L     DAT
Sbjct: 65  SLNDCDEALKLDPKNAKAYHRRGLSYIGLLEFKKAKNDLQIV-LKAKPGDAT 115

>TBLA0E03300 Chr5 complement(827677..829425) [1749 bp, 582 aa] {ON}
           Anc_5.617 YOR027W
          Length = 582

 Score = 52.8 bits (125), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 29/89 (32%), Positives = 50/89 (56%), Gaps = 2/89 (2%)

Query: 86  ASELKKRGNAYFKVKDYENAINYYKFALQLKNDP--VFYSNMAACYISLEHNKEAIEACS 143
           A E K +GNA F  K+Y+ AI  +  A+++   P  V YSN +ACY S +   + +E  +
Sbjct: 5   AQEYKDQGNAAFVAKNYDEAIEKFTKAIEVSETPNHVLYSNRSACYTSKKQFVKGLEDAN 64

Query: 144 KALELNPDYSKVLLKRAAVYENIGKFADA 172
           + +++NP +SK   +  A +  +G   +A
Sbjct: 65  ECVKINPTWSKGYNRVGAAHFGMGDLDEA 93

 Score = 43.9 bits (102), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 30/97 (30%), Positives = 46/97 (47%), Gaps = 1/97 (1%)

Query: 84  EYASELKKRGNAYFKVKDYENAIN-YYKFALQLKNDPVFYSNMAACYISLEHNKEAIEAC 142
           E A E +  G  YF   D+ NA+  Y +   +  +D   YSN AA    L    EAI  C
Sbjct: 387 EKAEEARLEGKEYFTKGDWPNAVKAYTEMIARDPSDARGYSNRAAALSKLMSFPEAITDC 446

Query: 143 SKALELNPDYSKVLLKRAAVYENIGKFADALLDLTAV 179
           + A+E +P++ +  +++A     I  F  A+  L A 
Sbjct: 447 NTAIEKDPNFIRAYIRKATAQIAIKDFVPAIETLDAA 483

 Score = 33.1 bits (74), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 27/85 (31%), Positives = 38/85 (44%), Gaps = 12/85 (14%)

Query: 75  KLAETAEKNEYASELKKRGNAYFKVKDYENAINYYKFALQLKNDPVFYSNMAACYISLEH 134
           K+A  AEK E        GN  +K   ++ AI +Y  A +L ND  + +N +A       
Sbjct: 252 KIAADAEKAE--------GNKLYKAHKFDEAIEHYNKAWELHNDITYLNNRSAAEFEKGD 303

Query: 135 NKEAI----EACSKALELNPDYSKV 155
            + AI    EA  K  E+  DY  V
Sbjct: 304 YQTAIETLHEAVEKGREMRADYKLV 328

>ZYRO0A05676g Chr1 (459999..461717) [1719 bp, 572 aa] {ON} highly
           similar to uniprot|P15705 Saccharomyces cerevisiae
           YOR027W STI1 Heat shock protein also induced by
           canavanine and entry into stationary phase
          Length = 572

 Score = 52.4 bits (124), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 27/71 (38%), Positives = 45/71 (63%), Gaps = 2/71 (2%)

Query: 86  ASELKKRGNAYFKVKDYENAINYYKFALQLKNDP--VFYSNMAACYISLEHNKEAIEACS 143
           A E K++GNA F  KDY  AI+ +  A+++   P  V YSN +ACY S +  +EA++   
Sbjct: 3   ADEFKQQGNAAFLAKDYVKAIDLFTKAIEVSETPNHVLYSNRSACYASNKKFEEALKDAE 62

Query: 144 KALELNPDYSK 154
           + ++++P +SK
Sbjct: 63  ECVKISPSWSK 73

 Score = 47.4 bits (111), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 42/145 (28%), Positives = 72/145 (49%), Gaps = 5/145 (3%)

Query: 34  YYKQVQELKKSLDDGNDVGTASSKVEYKYLMINDEPDIELMKLAETAEKN-EYASELKKR 92
           YYK +++L+K+++  N   T     E    + + E   EL K    A  N E A E + +
Sbjct: 330 YYK-LKDLRKAIEHYNRSLTEHRTAEVLNKLRSTEK--ELKKAESEAYVNPEKAEEARLQ 386

Query: 93  GNAYFKVKDYENAIN-YYKFALQLKNDPVFYSNMAACYISLEHNKEAIEACSKALELNPD 151
           G  +F   D+ NA+  Y +   +   D   +SN AA    L    EAIE C+KA+ ++P+
Sbjct: 387 GKEFFTKGDWPNAVKAYTEMVKRAPQDARGFSNRAAALAKLMSFPEAIEDCNKAVSIDPN 446

Query: 152 YSKVLLKRAAVYENIGKFADALLDL 176
           + +  +++A     + +FA A+  L
Sbjct: 447 FVRAYIRKATAQIAVKEFAAAIETL 471

>CAGL0E02739g Chr5 complement(259023..260054) [1032 bp, 343 aa] {ON}
           similar to uniprot|Q12118 Saccharomyces cerevisiae
           YOR007c SGT2
          Length = 343

 Score = 52.0 bits (123), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 33/86 (38%), Positives = 49/86 (56%), Gaps = 1/86 (1%)

Query: 70  DIELMKLAETAEKNEYASELKKRGNAYFKVKDYENAINYYKFALQ-LKNDPVFYSNMAAC 128
           D+++   AE AE    A  LK  GN     KD+E AI  Y  A++ L  + ++Y+N AA 
Sbjct: 77  DVKVNIPAEDAETKAKAEALKLEGNKAMAGKDFELAIAKYSEAIEVLPTNAIYYANRAAA 136

Query: 129 YISLEHNKEAIEACSKALELNPDYSK 154
           + SL+   EA+    KA+E++P YSK
Sbjct: 137 HSSLKQYDEAVVDAEKAIEIDPAYSK 162

>Smik_2.295 Chr2 (535786..536943) [1158 bp, 385 aa] {ON} YBR155W
           (REAL)
          Length = 385

 Score = 52.0 bits (123), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 38/142 (26%), Positives = 73/142 (51%), Gaps = 12/142 (8%)

Query: 73  LMKLAETAEKNEYASELKKRGNAYFKVKDYENAINYYK--FALQLKNDPV---FYSNMAA 127
           L  LA   E +E A   KK+GN  +K K +++A   Y    A++ ++  +    ++N AA
Sbjct: 70  LKALAYEGEPHEIAENFKKQGNELYKAKRFKDARELYTKGIAVECEDKSINESLFANRAA 129

Query: 128 CYISLEHNKEAIEACSKALELNPDYSKVLLKRAAVYENIGKFADALLDLTAVSLNGDYND 187
           C + L++ +  IE CSKAL +NP   K   + +  + ++ K  +A     A+     + +
Sbjct: 130 CELELKNYRRCIEDCSKALTINPKNIKCYYRTSKAFFSLSKLEEA--KSAAI-----FAN 182

Query: 188 ATIQPIVERVLNKQAMMALKDH 209
            +I+P  + +LN  +++  K+ 
Sbjct: 183 QSIEPENKSILNMLSVIERKEQ 204

>CAGL0C01903g Chr3 complement(199487..201796) [2310 bp, 769 aa] {ON}
           similar to uniprot|P38042 Saccharomyces cerevisiae
           YBL084c CDC27 subunit of anaphase-promoting complex
          Length = 769

 Score = 52.4 bits (124), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 32/112 (28%), Positives = 56/112 (50%), Gaps = 1/112 (0%)

Query: 320 LVDEAIKLHP-RPKSYIYLGLLMADKGLDEEYYSNFQKAIDLDPNMAAIYYHRGQMNFII 378
           LVD  +  +P +P+++  +G  ++ K   E+    F+KA  +DP  A  Y  +G      
Sbjct: 539 LVDYLLTYYPNKPETWCCVGNYLSLKKDHEDAIEAFEKATKIDPKFAYAYTLQGHECSSN 598

Query: 379 QKYEKAGEDFDKAKECDPTNIFPYIQLACMSYREGHFDDCETLFSEARRKFP 430
             ++ A + F KA  CDP +   Y  +   S + GH+D+    F +AR+ +P
Sbjct: 599 DSFDAAKKCFRKAIACDPRHYNAYYGMGIYSMKLGHYDEALLYFEKARQIYP 650

 Score = 35.0 bits (79), Expect = 0.65,   Method: Compositional matrix adjust.
 Identities = 41/176 (23%), Positives = 67/176 (38%), Gaps = 13/176 (7%)

Query: 363 NMAAIYYHRGQMNFIIQKYEKAGEDFDKAKECDPTNIFPYIQLACMSYREGHFDDCETLF 422
           NM       G++++ I  YE A   F +  E  P  I      + + +    +    +L 
Sbjct: 481 NMPWCLAQLGKLHYEIVNYEMASIYFMQLFELQPYRISDTEIFSTLLWHLQDYKRLASLV 540

Query: 423 SEARRKFPDAPEVPNFFAEILSDKGEIEKAAAEYDKAIELESKSENIHVGIAPLVGKATT 482
                 +P+ PE        LS K + E A   ++KA +++           P    A T
Sbjct: 541 DYLLTYYPNKPETWCCVGNYLSLKKDHEDAIEAFEKATKID-----------PKFAYAYT 589

Query: 483 LLKYPTVEN--FIEADDLFEQANNEDPRSEKAKMGLAQCKLQQEDLDDAIRLFEEA 536
           L  +    N  F  A   F +A   DPR   A  G+    ++    D+A+  FE+A
Sbjct: 590 LQGHECSSNDSFDAAKKCFRKAIACDPRHYNAYYGMGIYSMKLGHYDEALLYFEKA 645

 Score = 33.9 bits (76), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 33/150 (22%), Positives = 54/150 (36%), Gaps = 34/150 (22%)

Query: 354 FQKAIDLDPNMAAIYYHRGQMNFIIQKYEKAGEDFDKAKECDPTNI-------------- 399
           F+KAI  DP     YY  G  +  +  Y++A   F+KA++  P N               
Sbjct: 608 FRKAIACDPRHYNAYYGMGIYSMKLGHYDEALLYFEKARQIYPINAVLICCCGVALEKLE 667

Query: 400 -----FPYIQLAC---------------MSYREGHFDDCETLFSEARRKFPDAPEVPNFF 439
                  Y +LAC               + Y  G ++     F E  +  P+ P V    
Sbjct: 668 YQDKALEYYELACTLQPNSNLARFKRANLLYAMGRYNLALQSFEELSKLTPEEPTVHFVL 727

Query: 440 AEILSDKGEIEKAAAEYDKAIELESKSENI 469
            ++    G   +A  E+  A+ L+ K   +
Sbjct: 728 GQLYQIMGRKNEAIREFTVAMNLDPKGNQL 757

>NDAI0F00910 Chr6 complement(223205..224956) [1752 bp, 583 aa] {ON}
          Length = 583

 Score = 51.6 bits (122), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 29/89 (32%), Positives = 49/89 (55%), Gaps = 2/89 (2%)

Query: 86  ASELKKRGNAYFKVKDYENAINYYKFALQLKNDP--VFYSNMAACYISLEHNKEAIEACS 143
           A E K++GNA F  KD+  AI  +  A+++   P  V YSN +A Y S +  +EA+   +
Sbjct: 5   ADEYKQQGNAAFTSKDFNKAIELFTKAIEVSPTPNHVLYSNRSAAYTSAKQFQEALNDAT 64

Query: 144 KALELNPDYSKVLLKRAAVYENIGKFADA 172
           + +++NP +SK   +  A    +G   +A
Sbjct: 65  ECVKINPTWSKGYNRLGAAEFGLGNLEEA 93

 Score = 44.3 bits (103), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 28/91 (30%), Positives = 46/91 (50%), Gaps = 1/91 (1%)

Query: 84  EYASELKKRGNAYFKVKDYENAINYYKFAL-QLKNDPVFYSNMAACYISLEHNKEAIEAC 142
           E A E +  G  YF   D+ NA+  Y   + +   D   YSN AA    L    EAI+ C
Sbjct: 387 EKAEEARLEGKEYFTKGDWPNAVKAYSEMIKRAPEDARGYSNRAAALSKLMSFPEAIKDC 446

Query: 143 SKALELNPDYSKVLLKRAAVYENIGKFADAL 173
             A++ +P++ +  +++A     I ++A+AL
Sbjct: 447 DNAIKKDPNFVRAYIRKATAQIAIKEYANAL 477

>Smik_15.176 Chr15 complement(306259..307296) [1038 bp, 345 aa] {ON}
           YOR007C (REAL)
          Length = 345

 Score = 51.2 bits (121), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 31/88 (35%), Positives = 49/88 (55%), Gaps = 1/88 (1%)

Query: 66  NDEPDIELMKLAETAEKNEYASELKKRGNAYFKVKDYENAINYYKFALQ-LKNDPVFYSN 124
           +D  ++E+    E AE    A +LK +GN     KDYE AIN Y  A+Q L  + ++Y+N
Sbjct: 82  DDAQNVEVNIPEEDAETKAKAEDLKMQGNKAMANKDYELAINKYTEAIQVLPTNAIYYAN 141

Query: 125 MAACYISLEHNKEAIEACSKALELNPDY 152
            AA + SL    EA++    ++ ++P Y
Sbjct: 142 RAAAHSSLREYDEAVKDAESSISIDPSY 169

>CAGL0H07425g Chr8 (725307..726449) [1143 bp, 380 aa] {ON} highly
           similar to uniprot|P33313 Saccharomyces cerevisiae
           YBR155w CNS1
          Length = 380

 Score = 51.2 bits (121), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 32/106 (30%), Positives = 53/106 (50%), Gaps = 5/106 (4%)

Query: 73  LMKLAETAEKNEYASELKKRGNAYFKVKDYENAINYYKFALQLKN-----DPVFYSNMAA 127
           L  LA   E +E A   KK+GN  +KVK + +A   Y   + +K      +   Y+N AA
Sbjct: 68  LKALAYEGEPHEIAENFKKQGNDLYKVKRFRDARELYSKGIDVKCQVNTINESLYANRAA 127

Query: 128 CYISLEHNKEAIEACSKALELNPDYSKVLLKRAAVYENIGKFADAL 173
           C + +++ +  I  C +AL+LNP   K   + A  +  + +  +AL
Sbjct: 128 CELEIKNYRRCINDCKQALQLNPKNIKCYYRIAKAFTALERLDEAL 173

>Skud_15.168 Chr15 complement(298955..300001) [1047 bp, 348 aa] {ON}
           YOR007C (REAL)
          Length = 348

 Score = 50.8 bits (120), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 32/88 (36%), Positives = 50/88 (56%), Gaps = 1/88 (1%)

Query: 66  NDEPDIELMKLAETAEKNEYASELKKRGNAYFKVKDYENAINYYKFALQ-LKNDPVFYSN 124
           +D  ++E+    E AE    A +LK +GN     KDYE AIN Y  A++ L  + ++Y+N
Sbjct: 82  DDAQNVEVNIPEEDAEIKAKAEDLKMQGNKAMANKDYELAINKYTEAIKVLPTNAIYYAN 141

Query: 125 MAACYISLEHNKEAIEACSKALELNPDY 152
            AA + SL+   EA+E    A+ ++P Y
Sbjct: 142 RAAAHSSLKGYDEAVEDAESAISIDPTY 169

>TPHA0D03220 Chr4 complement(662868..664409) [1542 bp, 513 aa] {ON}
           Anc_3.481 YGR123C
          Length = 513

 Score = 51.2 bits (121), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 35/105 (33%), Positives = 53/105 (50%), Gaps = 2/105 (1%)

Query: 86  ASELKKRGNAYFKVKDYENAINYYKFALQL-KNDPVFYSNMAACYISLEHNKEAIEACSK 144
           A + K +GN Y K  DY++AI +Y  A+ L     +++SN A  ++  ++   A+  C  
Sbjct: 12  ALDFKNKGNEYIKKSDYDSAIEFYSKAIALDSTQSIYFSNRALAHLKQDNFYSAVVDCDN 71

Query: 145 ALELNPDYSKVLLKRAAVYENIGKFADALLDLTAVSLNGDYNDAT 189
           AL+L+P   K   +R   Y  I +F  A  DL  V L    ND T
Sbjct: 72  ALKLDPKNIKAYHRRGLSYVGILEFRKAKNDLNVV-LKAKPNDIT 115

>SAKL0F03102g Chr6 (258266..259807) [1542 bp, 513 aa] {ON} highly
           similar to uniprot|P53043 Saccharomyces cerevisiae
           YGR123C
          Length = 513

 Score = 50.8 bits (120), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 30/95 (31%), Positives = 51/95 (53%), Gaps = 1/95 (1%)

Query: 86  ASELKKRGNAYFKVKDYENAINYYKFALQL-KNDPVFYSNMAACYISLEHNKEAIEACSK 144
           A E K +GN + K K++  A   Y  A++L     +++SN A  ++ L++ + A+  C+K
Sbjct: 12  ALEFKNQGNVFIKGKNFSKAAELYSKAIELDGTQSIYFSNRAFAHLKLDNFQTALNDCNK 71

Query: 145 ALELNPDYSKVLLKRAAVYENIGKFADALLDLTAV 179
           A+EL+P   K   +R   Y  + +F  A  DL  V
Sbjct: 72  AIELDPKNVKAYHRRGLSYIGLLEFNKARKDLKIV 106

>KNAG0B03200 Chr2 complement(619530..621269) [1740 bp, 579 aa] {ON}
           Anc_5.617 YOR027W
          Length = 579

 Score = 50.4 bits (119), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 27/89 (30%), Positives = 49/89 (55%), Gaps = 2/89 (2%)

Query: 86  ASELKKRGNAYFKVKDYENAINYYKFALQLKNDP--VFYSNMAACYISLEHNKEAIEACS 143
           A E K++GN+ F  K Y+ A++ +  A+++   P  V YSN +A Y S +   EA++   
Sbjct: 5   ADEYKQQGNSAFAAKKYDEAVDLFTKAIEVSETPNHVLYSNRSASYASEQKFNEALKDAL 64

Query: 144 KALELNPDYSKVLLKRAAVYENIGKFADA 172
           +  ++NP ++K   +  A +  +G   DA
Sbjct: 65  ECTKINPSWAKGYTREGAAHFGMGNLDDA 93

 Score = 42.0 bits (97), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 31/109 (28%), Positives = 51/109 (46%), Gaps = 6/109 (5%)

Query: 84  EYASELKKRGNAYFKVKDYENAIN-YYKFALQLKNDPVFYSNMAACYISLEHNKEAIEAC 142
           E A E +  G  YF   D+ +A+  Y +   +   D   YSN AA    L    +AI  C
Sbjct: 383 EKAEEARLEGKEYFTKGDWPSAVKAYTEMIKRAPEDARGYSNRAAALSKLMSFPDAISDC 442

Query: 143 SKALELNPDYSKVLLKRAAVYENIGKFADALLDLTA-----VSLNGDYN 186
           +KA+E +P++ +  +++A     +  F+ A+  L A       +NG  N
Sbjct: 443 NKAIEKDPNFVRAYIRKATAQIAVKDFSYAIETLDAARTKDAEVNGGAN 491

>Ecym_5582 Chr5 complement(1195544..1197298) [1755 bp, 584 aa] {ON}
           similar to Ashbya gossypii AEL224W
          Length = 584

 Score = 50.1 bits (118), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 29/89 (32%), Positives = 48/89 (53%), Gaps = 2/89 (2%)

Query: 86  ASELKKRGNAYFKVKDYENAINYYKFALQLKNDP--VFYSNMAACYISLEHNKEAIEACS 143
           A E KK GNA F  KD++ A+  +  A+Q   +P  V YSN +  Y SL+   EA+   +
Sbjct: 4   AEEYKKEGNAAFVAKDFKRAVELFTNAIQESEEPNHVLYSNRSGAYASLKKFDEALSDAT 63

Query: 144 KALELNPDYSKVLLKRAAVYENIGKFADA 172
           + +++  D+SK   +  A +  +G   +A
Sbjct: 64  ECVKIKADWSKGHNRLGAAHFGLGNLDEA 92

 Score = 42.0 bits (97), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 25/94 (26%), Positives = 49/94 (52%), Gaps = 1/94 (1%)

Query: 84  EYASELKKRGNAYFKVKDYENAIN-YYKFALQLKNDPVFYSNMAACYISLEHNKEAIEAC 142
           E A + +  G  YF   D+ +A+  Y +  ++  +D   YSN AA    L    +AI+ C
Sbjct: 390 EKAEKARLDGKEYFTKGDWPSAVKAYSEMIMRAPHDARGYSNRAAALSKLMSFPDAIKDC 449

Query: 143 SKALELNPDYSKVLLKRAAVYENIGKFADALLDL 176
            KA+E++P + +  +++A     + +++ A+  L
Sbjct: 450 DKAIEIDPSFVRAYIRKATAQIAVQEYSAAIETL 483

>ZYRO0F08624g Chr6 (691992..693131) [1140 bp, 379 aa] {ON} similar
           to uniprot|P33313 Saccharomyces cerevisiae YBR155W CNS1
           cyclophilin seven suppressor component of Hsp90p
           chaperone machinery
          Length = 379

 Score = 49.7 bits (117), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 31/105 (29%), Positives = 53/105 (50%), Gaps = 5/105 (4%)

Query: 73  LMKLAETAEKNEYASELKKRGNAYFKVKDYENAINYYKFALQLK--NDPV---FYSNMAA 127
           L  LA   E +E A   K + N  +K K ++ A   YK  +++K  +D V    ++N+AA
Sbjct: 65  LKALAYDGEPHEVAENFKNQANDLYKAKRFKEAREVYKKGIEIKCNDDKVNESLFANLAA 124

Query: 128 CYISLEHNKEAIEACSKALELNPDYSKVLLKRAAVYENIGKFADA 172
           C + +++ +  I  C KAL+ NP   K   + A  +  + K  +A
Sbjct: 125 CELEIKNFRRCINLCQKALQFNPKNMKCYYRIAKAFYQLNKLDEA 169

>Ecym_4413 Chr4 complement(856330..857862) [1533 bp, 510 aa] {ON}
           similar to Ashbya gossypii AAR083C
          Length = 510

 Score = 49.7 bits (117), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 33/95 (34%), Positives = 47/95 (49%), Gaps = 1/95 (1%)

Query: 86  ASELKKRGNAYFKVKDYENAINYYKFALQLKN-DPVFYSNMAACYISLEHNKEAIEACSK 144
           A E K +GN +   KDY  AI  Y  A++L     +F+SN A   + L+  + A+E  SK
Sbjct: 9   ALEYKDQGNKFVASKDYGQAIEAYTKAIELDGCQSIFFSNRALANLKLDRFQSALEDSSK 68

Query: 145 ALELNPDYSKVLLKRAAVYENIGKFADALLDLTAV 179
           A+EL+    K   +R   Y  +  F  A  DL  V
Sbjct: 69  AIELDSSNVKGYHRRGMAYAGLQDFISAKRDLEVV 103

 Score = 31.6 bits (70), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 16/49 (32%), Positives = 27/49 (55%)

Query: 354 FQKAIDLDPNMAAIYYHRGQMNFIIQKYEKAGEDFDKAKECDPTNIFPY 402
           + KAI+LD   +  + +R   N  + +++ A ED  KA E D +N+  Y
Sbjct: 32  YTKAIELDGCQSIFFSNRALANLKLDRFQSALEDSSKAIELDSSNVKGY 80

>Kpol_505.41 s505 complement(91130..92671) [1542 bp, 513 aa] {ON}
           complement(91130..92671) [1542 nt, 514 aa]
          Length = 513

 Score = 49.7 bits (117), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 38/114 (33%), Positives = 56/114 (49%), Gaps = 2/114 (1%)

Query: 77  AETAEKNEYASELKKRGNAYFKVKDYENAINYYKFALQL-KNDPVFYSNMAACYISLEHN 135
           + TAE    A E K  GN + K ++Y  AI  Y  A++L  N  +FYSN A   + L++ 
Sbjct: 3   SPTAEDIAKAVEFKNEGNVFIKEQNYSKAIELYTKAIELDPNQSIFYSNRALAQLKLDNF 62

Query: 136 KEAIEACSKALELNPDYSKVLLKRAAVYENIGKFADALLDLTAVSLNGDYNDAT 189
           + A   C++AL L+    K   +R      + +F  A  DL  V L    +DAT
Sbjct: 63  QSAYNDCNEALTLDSKNVKAYHRRGLANVGLLEFKRARNDLNVV-LKAKPSDAT 115

>NDAI0D00810 Chr4 complement(181659..182708) [1050 bp, 349 aa] {ON}
           Anc_6.21 YOR007C
          Length = 349

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 35/110 (31%), Positives = 57/110 (51%), Gaps = 1/110 (0%)

Query: 65  INDEPDIELMKLAETAEKNEYASELKKRGNAYFKVKDYENAINYYKFALQ-LKNDPVFYS 123
           I  E  +E+    E AE    A   K  GN    +KD+  A+  Y  A++ L  + ++Y+
Sbjct: 80  IEKEESVEVNIPVEDAEIKANAEAFKLEGNKAMAMKDFHLAVEKYTEAIKILPTNAIYYA 139

Query: 124 NMAACYISLEHNKEAIEACSKALELNPDYSKVLLKRAAVYENIGKFADAL 173
           N AA + SL+  +EAI+    A++++P YSK   + A     +GK  +AL
Sbjct: 140 NRAAAHSSLKEFEEAIKDAESAIKIDPSYSKGYSRLAFAKYGLGKHEEAL 189

>AGL268C Chr7 complement(205872..207011) [1140 bp, 379 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YBR155W
           (CNS1)
          Length = 379

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 32/105 (30%), Positives = 50/105 (47%), Gaps = 5/105 (4%)

Query: 73  LMKLAETAEKNEYASELKKRGNAYFKVKDYENAINYYKFALQLKNDPVFYS-----NMAA 127
           L  LA   E +E A   K +GN  +KVK + +A   Y   +++K D    S     N AA
Sbjct: 64  LKALAYDGEPHEVAENFKNQGNDLYKVKRFRDARVMYNKGIEVKCDDAGISELLLLNRAA 123

Query: 128 CYISLEHNKEAIEACSKALELNPDYSKVLLKRAAVYENIGKFADA 172
           C + L++ +  I  C +AL+LNP   K   +    +  + K  +A
Sbjct: 124 CELELKNYRRCINDCREALKLNPKNPKAFFRIGKAFLQLDKLEEA 168

>NDAI0C05290 Chr3 (1224979..1226118) [1140 bp, 379 aa] {ON}
           Anc_8.506 YBR155W
          Length = 379

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 30/106 (28%), Positives = 52/106 (49%), Gaps = 6/106 (5%)

Query: 73  LMKLAETAEKNEYASELKKRGNAYFKVKDYENAINYYKFALQLKNDP------VFYSNMA 126
           L  LA   E +E A   K +GN  +K K +++A + Y   +Q++N+         ++N A
Sbjct: 63  LKALAYEGEPHEIAENFKNQGNDLYKAKRFKDARDVYLKGIQIENNKDVKIKESLFANKA 122

Query: 127 ACYISLEHNKEAIEACSKALELNPDYSKVLLKRAAVYENIGKFADA 172
           AC + L++ +  I  C  AL+LNP   K   +    +  + K  +A
Sbjct: 123 ACELELKNFRRCINDCKNALQLNPKNVKCYFRMTRAFFALDKLEEA 168

>SAKL0H10934g Chr8 complement(945834..946976) [1143 bp, 380 aa] {ON}
           similar to uniprot|P33313 Saccharomyces cerevisiae
           YBR155W CNS1 cyclophilin seven suppressor component of
           Hsp90p chaperone machinery
          Length = 380

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 32/133 (24%), Positives = 63/133 (47%), Gaps = 6/133 (4%)

Query: 73  LMKLAETAEKNEYASELKKRGNAYFKVKDYENAINYYKFALQLKND-----PVFYSNMAA 127
           L  LA   E +E A   K +GN  ++ + Y++A   Y   +++  D        + N AA
Sbjct: 67  LKALAYEGEPHEIAENFKNQGNDLYRARRYKDARELYNKGVEVHCDDDAINESLFLNRAA 126

Query: 128 CYISLEHNKEAIEACSKALELNPDYSKVLLKRAAVYENIGKFADALLDLTAVSLNGDYND 187
           C + L++++  I  C +AL  NP   K   +    + ++ K  +A  +     L  D N+
Sbjct: 127 CELELKNHRRCINDCKEALRYNPKNVKCFYRMGRAFFSLNKLEEA-KEAIEFGLRFDSNN 185

Query: 188 ATIQPIVERVLNK 200
           A +  ++++++ K
Sbjct: 186 AALGALLDKIVKK 198

>Ecym_2559 Chr2 (1089202..1090314) [1113 bp, 370 aa] {ON} similar to
           Ashbya gossypii AGL268C
          Length = 370

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 33/105 (31%), Positives = 50/105 (47%), Gaps = 5/105 (4%)

Query: 73  LMKLAETAEKNEYASELKKRGNAYFKVKDYENAINYYKFALQLK--NDPV---FYSNMAA 127
           L  LA   E +E A+  K +GN  +KVK Y++A   Y   +++K  +D +    Y N AA
Sbjct: 66  LKALAYEGEPHEVAANFKNQGNDLYKVKRYKDARTMYSKGIEVKCEDDSINGSLYLNRAA 125

Query: 128 CYISLEHNKEAIEACSKALELNPDYSKVLLKRAAVYENIGKFADA 172
           C + L + +  I  C KAL  N    K   +    Y  + K  +A
Sbjct: 126 CELELRNFRSCINDCKKALNFNAKCVKAFYRMGQAYFKLKKLEEA 170

>AAR054C Chr1 complement(440706..441107) [402 bp, 133 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YCR060W
          Length = 133

 Score = 45.8 bits (107), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 23/61 (37%), Positives = 38/61 (62%), Gaps = 1/61 (1%)

Query: 89  LKKRGNAYFKVKDYENAINYYKFA-LQLKNDPVFYSNMAACYISLEHNKEAIEACSKALE 147
           L+ +GN  +   +YE A+ YYK A L   ++PV  +NM+   + LE  ++A+ AC +ALE
Sbjct: 11  LRSKGNDLYSKGEYETAVLYYKNASLAEPSNPVHLANMSMALLKLERWEDALSACDRALE 70

Query: 148 L 148
           +
Sbjct: 71  I 71

>YOR007C Chr15 complement(338938..339978) [1041 bp, 346 aa] {ON}
           SGT2Glutamine-rich cytoplasmic protein that serves as a
           scaffold for binding Get4/5p and other proteins required
           to mediate posttranslational insertion of tail-anchored
           proteins into the ER membrane; has similarity to human
           cochaperone SGT
          Length = 346

 Score = 48.1 bits (113), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 29/88 (32%), Positives = 50/88 (56%), Gaps = 1/88 (1%)

Query: 66  NDEPDIELMKLAETAEKNEYASELKKRGNAYFKVKDYENAINYYKFALQ-LKNDPVFYSN 124
           +D  ++E+    + AE    A +LK +GN     KDYE AIN Y  A++ L  + ++Y+N
Sbjct: 82  DDAENVEINIPEDDAETKAKAEDLKMQGNKAMANKDYELAINKYTEAIKVLPTNAIYYAN 141

Query: 125 MAACYISLEHNKEAIEACSKALELNPDY 152
            AA + SL+   +A++    A+ ++P Y
Sbjct: 142 RAAAHSSLKEYDQAVKDAESAISIDPSY 169

>AAR083C Chr1 complement(492375..493991) [1617 bp, 538 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YGR123C
           (PPT1)
          Length = 538

 Score = 48.9 bits (115), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 45/168 (26%), Positives = 80/168 (47%), Gaps = 7/168 (4%)

Query: 86  ASELKKRGNAYFKVKDYENAINYYKFALQL-KNDPVFYSNMAACYISLEHNKEAIEACSK 144
           A + K  GN + K KDY  A+  Y  A++      +F+SN A   + L+  + A+E  ++
Sbjct: 38  ALDYKNEGNEWVKAKDYARAVEAYTRAIEADGTQSIFFSNRALANLKLDRFQSALEDSAR 97

Query: 145 ALELNPDYSKVLLKRAAVYENIGKFADALLDLTAV--SLNGDYNDATIQPIVERVLNKQA 202
           A+EL+    K   +R   +  + ++  A  DL  V  +  GD        + ER+L ++ 
Sbjct: 98  AIELDAGNVKAYHRRGLAHCGLLEWGPAKRDLEVVVRAKPGDEAVRRALEVCERMLRRER 157

Query: 203 M-MALKDHLEASEKNKVLPSYTSMAAFFGVFD-AETDIPGHDATEESD 248
              A++   +  E+ + L    S+A+F G  D A  D P  +  +E+D
Sbjct: 158 FERAIR--ADGDEEQRRLCKTLSLASFAGNADLASYDGPALELEQETD 203

>KNAG0A03950 Chr1 complement(529620..530780) [1161 bp, 386 aa] {ON}
           Anc_8.506 YBR155W
          Length = 386

 Score = 48.1 bits (113), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 31/106 (29%), Positives = 53/106 (50%), Gaps = 7/106 (6%)

Query: 73  LMKLAETAEKNEYASELKKRGNAYFKVKDYENAINYYKFALQL------KNDPVFYSNMA 126
           L  LA   E +E A   K + N  +KVK + +A   Y   +++       N+ +F +N A
Sbjct: 72  LKALAYEGEPHEIAENFKNQANDLYKVKRFRDARELYTKGIKVFCEDKSINESLF-ANRA 130

Query: 127 ACYISLEHNKEAIEACSKALELNPDYSKVLLKRAAVYENIGKFADA 172
           AC + L++ +  +  C KA+E+NP   K   +    +  +GKF +A
Sbjct: 131 ACELELKNYRSCVADCQKAMEINPMNLKCFYRMGKAFLALGKFKEA 176

>TDEL0G04480 Chr7 (813648..814679) [1032 bp, 343 aa] {ON} Anc_6.21
           YOR007C
          Length = 343

 Score = 48.1 bits (113), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 34/98 (34%), Positives = 52/98 (53%), Gaps = 1/98 (1%)

Query: 77  AETAEKNEYASELKKRGNAYFKVKDYENAINYYKFALQ-LKNDPVFYSNMAACYISLEHN 135
           AE AE    A  LK  GN     KD++ AI  Y  A++ L  + V+Y+N AA + S++  
Sbjct: 88  AEDAETKAKAETLKLEGNKAMACKDFDLAIKKYSDAIEVLPTNAVYYANRAAAHSSMKAY 147

Query: 136 KEAIEACSKALELNPDYSKVLLKRAAVYENIGKFADAL 173
           +EAI+    A++ +P YSK   +       +G+  DAL
Sbjct: 148 EEAIKDAESAIKTDPTYSKGYSRLGYAKFALGQAEDAL 185

>KAFR0J02570 Chr10 (488372..488737) [366 bp, 121 aa] {ON} Anc_6.328
           YCR060W
          Length = 121

 Score = 45.1 bits (105), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 31/95 (32%), Positives = 46/95 (48%), Gaps = 8/95 (8%)

Query: 89  LKKRGNAYFKVKDYENAINYYKFALQLK-NDPVFYSNMAACYISLEHNKEAIEACSKALE 147
            K  GN YFK  +Y +AI  Y+  +++   +P+ YSN A   I    N+EA+  C   L 
Sbjct: 6   FKTEGNQYFKEGNYASAIKSYEKCIEINPENPIGYSNKAMALIKANKNQEAVRTCQDGL- 64

Query: 148 LNPDYSKVLLKRAAVYENIGKFADALLDLTAVSLN 182
                 K + K  A +E I K  +  L+L   +LN
Sbjct: 65  ------KRVSKNDATHETIQKKLEYRLELAEKALN 93

>KLLA0A07062g Chr1 complement(636546..638291) [1746 bp, 581 aa] {ON}
           highly similar to uniprot|P15705 Saccharomyces
           cerevisiae YOR027W STI1 Heat shock protein also induced
           by canavanine and entry into stationary phase
          Length = 581

 Score = 48.5 bits (114), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 26/89 (29%), Positives = 49/89 (55%), Gaps = 2/89 (2%)

Query: 86  ASELKKRGNAYFKVKDYENAINYYKFALQLKNDP--VFYSNMAACYISLEHNKEAIEACS 143
           A + K+ GN  F  KDY  AI  +  A+++   P  V +SN +ACY S +   +A++  +
Sbjct: 3   ADQFKQEGNQAFASKDYAKAIELFTKAIEVSEQPNHVLFSNRSACYASNKDFVKALDDAN 62

Query: 144 KALELNPDYSKVLLKRAAVYENIGKFADA 172
           + +++NP ++K   +  A +  +G   +A
Sbjct: 63  ECVKINPSWAKGYNRLGAAHYGLGDLDEA 91

 Score = 44.3 bits (103), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 40/143 (27%), Positives = 68/143 (47%), Gaps = 2/143 (1%)

Query: 35  YKQVQELKKSLDDGNDVGTASSKVEYKYLMINDEPDIELMKLAETAEKNEYASELKKRGN 94
           Y ++ +LKK++D      T     +    + N E +++  K AE+    E A E + +G 
Sbjct: 339 YHKLGDLKKAIDYYEKSLTEHRTPDILTKLRNTEKELK-QKEAESYMDPEKAEEARLQGK 397

Query: 95  AYFKVKDYENAINYYKFALQLK-NDPVFYSNMAACYISLEHNKEAIEACSKALELNPDYS 153
            YF   D+  A+  Y   ++   ND   YSN AA    L    +AI  C KA+E +P++ 
Sbjct: 398 EYFTKADWPKAVEAYTEMIKRNPNDARGYSNRAAALSKLMSFADAIRDCDKAIEKDPNFV 457

Query: 154 KVLLKRAAVYENIGKFADALLDL 176
           +  +++A     I  +A A+  L
Sbjct: 458 RAYIRKATGQIAIKDYAGAIETL 480

 Score = 37.4 bits (85), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 38/127 (29%), Positives = 56/127 (44%), Gaps = 16/127 (12%)

Query: 54  ASSKVEYKYLMINDEPDIELMKLAETAEKNEYASELKKRGNAYFKVKDYENAINYYKFAL 113
           A  KVE K      +P+ E M++ +   K E A   K  GN  +K + ++ AI  Y  A 
Sbjct: 232 AEPKVETK------KPEPEPMEVDDDKSKAEAA---KAEGNKLYKQRKFDEAIEKYNEAW 282

Query: 114 QLKNDPVFYSNMAACYISLEHNKEAIEACSKAL----ELNPDY---SKVLLKRAAVYENI 166
           +  ND  + +N AA        + AIE  +KA+    EL  DY   SK   +    Y  +
Sbjct: 283 ETHNDITYLNNRAAAEYEKGDYEAAIETLTKAVEQGRELRADYKVISKSFARMGNSYHKL 342

Query: 167 GKFADAL 173
           G    A+
Sbjct: 343 GDLKKAI 349

 Score = 35.0 bits (79), Expect = 0.62,   Method: Compositional matrix adjust.
 Identities = 28/112 (25%), Positives = 49/112 (43%), Gaps = 27/112 (24%)

Query: 91  KRGNAYFKVKDYENAINYYKFALQLKNDPVFYSNM-----------AACYISLEHNKEA- 138
           + GN+Y K+ D + AI+YY+ +L     P   + +           A  Y+  E  +EA 
Sbjct: 334 RMGNSYHKLGDLKKAIDYYEKSLTEHRTPDILTKLRNTEKELKQKEAESYMDPEKAEEAR 393

Query: 139 ---------------IEACSKALELNPDYSKVLLKRAAVYENIGKFADALLD 175
                          +EA ++ ++ NP+ ++    RAA    +  FADA+ D
Sbjct: 394 LQGKEYFTKADWPKAVEAYTEMIKRNPNDARGYSNRAAALSKLMSFADAIRD 445

>TDEL0B01310 Chr2 complement(234307..235449) [1143 bp, 380 aa] {ON}
           Anc_8.506 YBR155W
          Length = 380

 Score = 47.8 bits (112), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 40/140 (28%), Positives = 65/140 (46%), Gaps = 18/140 (12%)

Query: 73  LMKLAETAEKNEYASELKKRGNAYFKVKDYENAINYYKFALQLKNDPV-----FYSNMAA 127
           L  LA   E +E A   K +GN  +K K +++A   Y   +++K D        Y+N AA
Sbjct: 65  LKALAYEGEPHEIAGNFKNQGNDLYKAKRFKDARELYNKGIEIKCDDTSINESLYANRAA 124

Query: 128 CYISLEHNKEAIEACSKALELNPDYSKVLLKRAAVYENIGK--FADALLDLTAVS----L 181
           C + +++ +  +  C  AL+ NP       K    Y  +GK   A  LL+    S    L
Sbjct: 125 CELEIKNYRRCLNDCKTALQYNP-------KNLKCYYRMGKAFLALELLEEAQKSVEFGL 177

Query: 182 NGDYNDATIQPIVERVLNKQ 201
             D ++  +Q +++ VL KQ
Sbjct: 178 QVDSSNKPLQSLLDIVLKKQ 197

>Kpol_1032.8 s1032 complement(15762..16793) [1032 bp, 343 aa] {ON}
           complement(15762..16793) [1032 nt, 344 aa]
          Length = 343

 Score = 47.8 bits (112), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 33/110 (30%), Positives = 60/110 (54%), Gaps = 1/110 (0%)

Query: 65  INDEPDIELMKLAETAEKNEYASELKKRGNAYFKVKDYENAINYYKFALQL-KNDPVFYS 123
           ++D  ++E+     + +K + A  LK  GN    +K+Y++AI+ Y  A+++  ++P +YS
Sbjct: 77  VSDVVELEVKNEEISEDKKKEAEALKLEGNKQMSLKNYKSAIDKYSKAIEIYPSNPFYYS 136

Query: 124 NMAACYISLEHNKEAIEACSKALELNPDYSKVLLKRAAVYENIGKFADAL 173
           N AA Y  +E    A+   + A++L+P YSK   +  A     G   DA+
Sbjct: 137 NRAAAYQMIEDFTNAVLDANTAIKLDPTYSKAYSRLGAAKLAEGNNEDAV 186

 Score = 35.4 bits (80), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 24/60 (40%), Positives = 36/60 (60%), Gaps = 1/60 (1%)

Query: 130 ISLEHNKEAIEACSKALELNPDYSKVLLKRAAVYENIGKFADALLDL-TAVSLNGDYNDA 188
           +SL++ K AI+  SKA+E+ P        RAA Y+ I  F +A+LD  TA+ L+  Y+ A
Sbjct: 109 MSLKNYKSAIDKYSKAIEIYPSNPFYYSNRAAAYQMIEDFTNAVLDANTAIKLDPTYSKA 168

>NCAS0B02400 Chr2 complement(402763..403905) [1143 bp, 380 aa] {ON}
           Anc_8.506 YBR155W
          Length = 380

 Score = 47.8 bits (112), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 29/83 (34%), Positives = 43/83 (51%), Gaps = 5/83 (6%)

Query: 73  LMKLAETAEKNEYASELKKRGNAYFKVKDYENAINYYKFALQLK--NDPV---FYSNMAA 127
           L  LA   E +E A   K +GN  F VK +  A + Y   +++K  ND +    ++N AA
Sbjct: 67  LKALAYEGEPHEVAENFKNQGNDLFTVKRFREARDIYNKGIEIKCENDKINEALFANRAA 126

Query: 128 CYISLEHNKEAIEACSKALELNP 150
           C + L++ +  I  C  AL LNP
Sbjct: 127 CQLELKNYRSCINDCKHALTLNP 149

>Kpol_1028.51 s1028 complement(123535..123888) [354 bp, 117 aa] {ON}
           complement(123535..123888) [354 nt, 118 aa]
          Length = 117

 Score = 44.7 bits (104), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 24/61 (39%), Positives = 35/61 (57%), Gaps = 1/61 (1%)

Query: 88  ELKKRGNAYFKVKDYENAINYYKFALQLK-NDPVFYSNMAACYISLEHNKEAIEACSKAL 146
           E K  GN YFK  +Y  A+ YYK  ++++  +P+ YSN A   I L    EA+E+C   L
Sbjct: 5   EYKTTGNTYFKDGNYLKAVEYYKKCIEVEPENPIGYSNSAMSLIKLTKYTEALESCGTGL 64

Query: 147 E 147
           +
Sbjct: 65  K 65

>TPHA0E00740 Chr5 complement(142456..144696) [2241 bp, 746 aa] {ON}
           Anc_7.412 YBL084C
          Length = 746

 Score = 47.8 bits (112), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 48/179 (26%), Positives = 74/179 (41%), Gaps = 4/179 (2%)

Query: 312 NDPLTARELVDEAIKLHPR-PKSYIYLGLLMADKGLDEEYYSNFQKAIDLDPNMAAIYYH 370
           ND      L  E I  +PR P+++  LG  ++ +    E    F+KA  +DP  A  Y  
Sbjct: 508 NDKSKLSILSSELITSNPRIPETWCCLGNFLSLQKNHHEAIKAFEKATQVDPKFAYAYTL 567

Query: 371 RGQMNFIIQKYEKAGEDFDKAKECDPTNIFPYIQLACMSYREGHFDDCETLFSEARRKFP 430
           +G        ++ A   + KA  CDP +   Y  L  +S + G +++    F +AR   P
Sbjct: 568 QGHEYTSSDSFDVAKRCYRKAIACDPGHYNAYYGLGMVSMKLGQYEEALLFFEKARSINP 627

Query: 431 DAPEVPNFFAEILSDKGEIEKAAAEYDKAIELESKSENIHVGIAPLV---GKATTLLKY 486
               +       L      EKA   Y+ A EL+  S       A L+   G+ T  LK+
Sbjct: 628 INVVLVCCGGVALEKLSYQEKALQYYELACELQPSSSLATFKRAHLLYSMGRYTLALKF 686

 Score = 44.3 bits (103), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 36/150 (24%), Positives = 56/150 (37%), Gaps = 34/150 (22%)

Query: 354 FQKAIDLDPNMAAIYYHRGQMNFIIQKYEKAGEDFDKAKECDPTNI-------------- 399
           ++KAI  DP     YY  G ++  + +YE+A   F+KA+  +P N+              
Sbjct: 585 YRKAIACDPGHYNAYYGLGMVSMKLGQYEEALLFFEKARSINPINVVLVCCGGVALEKLS 644

Query: 400 -----FPYIQLAC---------------MSYREGHFDDCETLFSEARRKFPDAPEVPNFF 439
                  Y +LAC               + Y  G +      F E +   PD   V    
Sbjct: 645 YQEKALQYYELACELQPSSSLATFKRAHLLYSMGRYTLALKFFEELKHVAPDEATVHFLL 704

Query: 440 AEILSDKGEIEKAAAEYDKAIELESKSENI 469
            +I S  G  + A  EY  A+ L+ K   +
Sbjct: 705 GQIYSILGRKKDAIKEYTIALNLDPKGRQL 734

>TBLA0G01050 Chr7 complement(262407..263459) [1053 bp, 350 aa] {ON}
           Anc_6.21 YOR007C
          Length = 350

 Score = 47.0 bits (110), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 42/123 (34%), Positives = 60/123 (48%), Gaps = 10/123 (8%)

Query: 33  FYYKQVQELKKSLDDGNDVGTASSKVEYKYLMINDEPDIELMKLAETAEKNEYASELKKR 92
           F  K + EL   LD   +    SS  E   + I+D+ + E  +LA  AE       LK  
Sbjct: 59  FGGKSLTEL---LDAATNAKGRSSSPEDIKVSISDKDEEEDKELAAKAEA------LKLE 109

Query: 93  GNAYFKVKDYENAINYYKFALQL-KNDPVFYSNMAACYISLEHNKEAIEACSKALELNPD 151
           GN     KDY  A+  Y  A++L     V+Y+N AA Y S E   EAI+    A+++ P+
Sbjct: 110 GNKAMAAKDYNLAVEKYNAAIKLVPTKAVYYANRAAAYSSQEKYDEAIKDAESAIKVEPN 169

Query: 152 YSK 154
           +SK
Sbjct: 170 WSK 172

>Suva_4.405 Chr4 (719015..720172) [1158 bp, 385 aa] {ON} YBR155W
           (REAL)
          Length = 385

 Score = 47.4 bits (111), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 30/105 (28%), Positives = 55/105 (52%), Gaps = 5/105 (4%)

Query: 73  LMKLAETAEKNEYASELKKRGNAYFKVKDYENAINYYK--FALQLKNDPV---FYSNMAA 127
           L  LA   E +E A   KK+GN  +K K +++A   Y    A++ ++  +    ++N AA
Sbjct: 70  LKALAYEGEPHEIAENFKKQGNELYKAKRFKDARELYTKGVAVECEDKSINESLFANRAA 129

Query: 128 CYISLEHNKEAIEACSKALELNPDYSKVLLKRAAVYENIGKFADA 172
           C + L++ ++ +E C KAL +NP   K   + +  +  + K  +A
Sbjct: 130 CELELKNYRKCVEDCGKALTINPKNIKCYYRISKSFFQLRKLEEA 174

>Suva_15.182 Chr15 complement(313413..314453) [1041 bp, 346 aa] {ON}
           YOR007C (REAL)
          Length = 346

 Score = 47.0 bits (110), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 31/88 (35%), Positives = 48/88 (54%), Gaps = 1/88 (1%)

Query: 66  NDEPDIELMKLAETAEKNEYASELKKRGNAYFKVKDYENAINYYKFALQ-LKNDPVFYSN 124
           +D  ++E+    E AE    A ELK +GN     K+YE AI  Y  A+  L  + ++Y+N
Sbjct: 82  DDAQNVEVNIPEEDAETKAKAEELKIQGNKAMANKEYELAIKKYTEAIDVLPTNAIYYAN 141

Query: 125 MAACYISLEHNKEAIEACSKALELNPDY 152
            AA + SL+   EAI+    A+ ++P Y
Sbjct: 142 RAAAHSSLKEYDEAIKDAESAISVDPSY 169

 Score = 31.6 bits (70), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 17/60 (28%), Positives = 32/60 (53%)

Query: 354 FQKAIDLDPNMAAIYYHRGQMNFIIQKYEKAGEDFDKAKECDPTNIFPYIQLACMSYREG 413
           + +AID+ P  A  Y +R   +  +++Y++A +D + A   DP+    Y +L    Y +G
Sbjct: 125 YTEAIDVLPTNAIYYANRAAAHSSLKEYDEAIKDAESAISVDPSYFRGYSRLGFAKYAQG 184

>NCAS0H00830 Chr8 complement(151809..152825) [1017 bp, 338 aa] {ON}
           Anc_6.21 YOR007C
          Length = 338

 Score = 46.6 bits (109), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 30/78 (38%), Positives = 42/78 (53%), Gaps = 1/78 (1%)

Query: 78  ETAEKNEYASELKKRGNAYFKVKDYENAINYYKFALQ-LKNDPVFYSNMAACYISLEHNK 136
           E AE    A   K  GN     KDY  AI  Y  A++ L  + ++Y+N AA Y S++   
Sbjct: 91  EDAEIKATAESFKLEGNKAMAAKDYRLAIEKYSEAIKTLPTNVIYYANRAAAYSSVKEYD 150

Query: 137 EAIEACSKALELNPDYSK 154
            AI+   KA+E++P YSK
Sbjct: 151 NAIKDAEKAIEIDPAYSK 168

 Score = 34.7 bits (78), Expect = 0.63,   Method: Compositional matrix adjust.
 Identities = 24/71 (33%), Positives = 39/71 (54%), Gaps = 5/71 (7%)

Query: 92  RGNAYFKVKDYENAINYYKFALQLKNDPVF---YSNMAACYISLEHNKEAIEACSKALEL 148
           R  AY  VK+Y+NAI   + A+++  DP +   YS +A    +L   +EA+E   K L++
Sbjct: 139 RAAAYSSVKEYDNAIKDAEKAIEI--DPAYSKGYSRLAFAKYALNKPEEALEYYKKVLDM 196

Query: 149 NPDYSKVLLKR 159
             D +   +KR
Sbjct: 197 EGDKATPAMKR 207

>TDEL0A07430 Chr1 (1296631..1297005) [375 bp, 124 aa] {ON} Anc_6.328
           YCR060W
          Length = 124

 Score = 43.9 bits (102), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 22/61 (36%), Positives = 36/61 (59%), Gaps = 1/61 (1%)

Query: 89  LKKRGNAYFKVKDYENAINYYKFALQLK-NDPVFYSNMAACYISLEHNKEAIEACSKALE 147
           LK +GN+ ++ +DY  A+ +Y   L+    +P+ +SN A C I L  ++EA +AC   L 
Sbjct: 7   LKAQGNSCYQQQDYAGALRWYDQCLEADATNPIAHSNRAMCLIKLNRSQEAQKACQAGLA 66

Query: 148 L 148
           L
Sbjct: 67  L 67

>KAFR0L00410 Chr12 complement(75459..76454) [996 bp, 331 aa] {ON}
           Anc_6.21 YOR007C
          Length = 331

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 26/70 (37%), Positives = 43/70 (61%), Gaps = 1/70 (1%)

Query: 86  ASELKKRGNAYFKVKDYENAINYYKFALQLK-NDPVFYSNMAACYISLEHNKEAIEACSK 144
           A +LK  GN    +KD++ AI  Y  A+ +  N+ ++Y+N AA Y SL+  ++A E    
Sbjct: 99  AEKLKLEGNKAMAMKDFDLAIAKYSEAISISPNNAIYYANRAAAYSSLKDFEKATEDAES 158

Query: 145 ALELNPDYSK 154
           A+ ++P+YSK
Sbjct: 159 AIRVDPNYSK 168

 Score = 31.6 bits (70), Expect = 6.2,   Method: Compositional matrix adjust.
 Identities = 18/57 (31%), Positives = 27/57 (47%)

Query: 354 FQKAIDLDPNMAAIYYHRGQMNFIIQKYEKAGEDFDKAKECDPTNIFPYIQLACMSY 410
           + +AI + PN A  Y +R      ++ +EKA ED + A   DP     Y +L    Y
Sbjct: 122 YSEAISISPNNAIYYANRAAAYSSLKDFEKATEDAESAIRVDPNYSKGYSRLGFAKY 178

>ZYRO0C07788g Chr3 (589880..590884) [1005 bp, 334 aa] {ON} similar
           to uniprot|Q12118 Saccharomyces cerevisiae YOR007C SGT2
           Glutamine-rich cytoplasmic protein of unknown function
           contains tetratricopeptide (TPR) repeats which often
           mediate protein-protein interactions conserved in human
           and C. elegans
          Length = 334

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 31/79 (39%), Positives = 44/79 (55%), Gaps = 1/79 (1%)

Query: 77  AETAEKNEYASELKKRGNAYFKVKDYENAINYYKFALQL-KNDPVFYSNMAACYISLEHN 135
           AE AE    A  LK  GN     KDYE AI  Y  A+ +   + V+Y+N AA + SL++ 
Sbjct: 84  AEDAELKSKAESLKLEGNKAMAGKDYELAIKKYSEAISVVPTNAVYYANRAAAHSSLKNY 143

Query: 136 KEAIEACSKALELNPDYSK 154
            EAI+    A++++  YSK
Sbjct: 144 DEAIKDAESAVKVDSSYSK 162

>KLLA0D01155g Chr4 complement(104847..105854) [1008 bp, 335 aa] {ON}
           similar to uniprot|Q12118 Saccharomyces cerevisiae
           YOR007C SGT2 Glutamine-rich cytoplasmic protein of
           unknown function contains tetratricopeptide (TPR)
           repeats which often mediate protein-protein interactions
           conserved in human and C. elegans
          Length = 335

 Score = 46.2 bits (108), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 23/64 (35%), Positives = 41/64 (64%), Gaps = 1/64 (1%)

Query: 92  RGNAYFKVKDYENAINYYKFALQLK-NDPVFYSNMAACYISLEHNKEAIEACSKALELNP 150
           +GN     K ++ AI  Y  A+++  ++ V+YSN AA Y SL+  ++A++   +A+E++P
Sbjct: 101 QGNKAMAAKKFDEAIEKYTAAIEVSPSNAVYYSNRAAAYSSLKQYEQAVKDAEQAIEVDP 160

Query: 151 DYSK 154
            YSK
Sbjct: 161 TYSK 164

 Score = 32.7 bits (73), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 20/57 (35%), Positives = 32/57 (56%), Gaps = 1/57 (1%)

Query: 341 MADKGLDEEYYSNFQKAIDLDPNMAAIYYHRGQMNFIIQKYEKAGEDFDKAKECDPT 397
           MA K  DE     +  AI++ P+ A  Y +R      +++YE+A +D ++A E DPT
Sbjct: 106 MAAKKFDEAI-EKYTAAIEVSPSNAVYYSNRAAAYSSLKQYEQAVKDAEQAIEVDPT 161

>TBLA0I02310 Chr9 (528067..528417) [351 bp, 116 aa] {ON} Anc_6.328
           YCR060W
          Length = 116

 Score = 43.1 bits (100), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 23/62 (37%), Positives = 34/62 (54%), Gaps = 1/62 (1%)

Query: 88  ELKKRGNAYFKVKDYENAINYYKFALQL-KNDPVFYSNMAACYISLEHNKEAIEACSKAL 146
           ELK +GN  FK   Y  AI++Y   + +  ++P+ YSN A   +  +   EAI  C K L
Sbjct: 5   ELKAKGNISFKNGSYSEAISWYNRCISIDPSNPIGYSNKAMALLKADRFDEAITTCEKGL 64

Query: 147 EL 148
           +L
Sbjct: 65  QL 66

>NCAS0F03490 Chr6 complement(698757..700295) [1539 bp, 512 aa] {ON}
           Anc_3.142 YDL047W
          Length = 512

 Score = 46.2 bits (108), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 36/113 (31%), Positives = 53/113 (46%), Gaps = 6/113 (5%)

Query: 80  AEKNEYASELKKRGNAYFKVKDYENAINYYKFALQLKNDP---VFYSNMAACYISLEHNK 136
           A+  E A   K  GN Y K ++Y  AI  Y  A++L  DP   +F+SN A   + L++ +
Sbjct: 6   ADAKEQAVAFKNEGNTYIKEQNYMKAIELYSQAIEL--DPTQSIFFSNRALAQLKLDNFQ 63

Query: 137 EAIEACSKALELNPDYSKVLLKRAAVYENIGKFADALLDLTAVSLNGDYNDAT 189
             +  C  AL L+P   K   +R   +  + +   A  DL  V L     DAT
Sbjct: 64  SCMNDCDVALRLDPKNIKAYHRRGLSHLGLLQCKKARNDLQVV-LKAKPTDAT 115

>Skud_3.135 Chr3 (208664..209020) [357 bp, 118 aa] {ON} YCR060W
           (REAL)
          Length = 118

 Score = 42.7 bits (99), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 28/76 (36%), Positives = 40/76 (52%), Gaps = 8/76 (10%)

Query: 90  KKRGNAYFKVKDYENAINYYK--FALQLKNDPVFYSNMAACYISLEHNKEAIEACSKALE 147
           K++GNA FK   Y  A++ Y    A Q +N PV YSN A   I L  + +AI+AC + L+
Sbjct: 12  KQQGNALFKQGLYLEAVDSYDRLIAAQPQN-PVGYSNKAMALIKLGEHAQAIQACQQGLQ 70

Query: 148 -----LNPDYSKVLLK 158
                  PD+  +  K
Sbjct: 71  HASTTTTPDHVTIRAK 86

>KNAG0M01170 Chr13 complement(211476..212495) [1020 bp, 339 aa] {ON}
           Anc_6.21 YOR007C
          Length = 339

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 32/92 (34%), Positives = 51/92 (55%), Gaps = 4/92 (4%)

Query: 67  DEPDIELMKL---AETAEKNEYASELKKRGNAYFKVKDYENAINYYKFALQ-LKNDPVFY 122
           DE   E +K+    E AE    A  LK  GN     KDY+ A+  Y  A++ L  + V++
Sbjct: 79  DECKTETVKINIPQEDAETKAKAEALKLEGNKAVASKDYDLAVEKYTEAIKILPTNAVYF 138

Query: 123 SNMAACYISLEHNKEAIEACSKALELNPDYSK 154
           +N AA Y + ++  EA++   +A++L+P YSK
Sbjct: 139 ANRAAAYTNSQNYDEAVKDAEEAIKLDPAYSK 170

 Score = 31.2 bits (69), Expect = 7.4,   Method: Compositional matrix adjust.
 Identities = 27/88 (30%), Positives = 45/88 (51%), Gaps = 7/88 (7%)

Query: 92  RGNAYFKVKDYENAINYYKFALQLKNDPVF---YSNMAACYISLEHNKEAIEACSKALEL 148
           R  AY   ++Y+ A+   + A++L  DP +   YS +A      E+ +E++EA  K LE+
Sbjct: 141 RAAAYTNSQNYDEAVKDAEEAIKL--DPAYSKGYSRLAYAKYVQENFEESLEAYKKVLEI 198

Query: 149 NPDYSKVLLKRAAVYENIGKFADALLDL 176
             D +  + KR   YE   K  +  L+L
Sbjct: 199 EGDSATEVTKRG--YETAKKRVEESLNL 224

>KLTH0C11220g Chr3 (920972..921955) [984 bp, 327 aa] {ON} similar to
           uniprot|Q12118 Saccharomyces cerevisiae YOR007C SGT2
           Glutamine-rich cytoplasmic protein of unknown function
           contains tetratricopeptide (TPR) repeats which often
           mediate protein-protein interactions conserved in human
           and C. elegans
          Length = 327

 Score = 45.4 bits (106), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 32/78 (41%), Positives = 47/78 (60%), Gaps = 1/78 (1%)

Query: 78  ETAEKNEYASELKKRGNAYFKVKDYENAINYYKFALQ-LKNDPVFYSNMAACYISLEHNK 136
           E AE    A  LK  GN     KD+E+AI+ Y  A++ L ++ V+++N AA Y SL+   
Sbjct: 90  EDAEIKAKAEALKLEGNKAMATKDFEHAISKYSEAIRTLPSNAVYFANRAAAYSSLKKYA 149

Query: 137 EAIEACSKALELNPDYSK 154
           EA+E    A+++NP YSK
Sbjct: 150 EAVEDAEAAIKVNPSYSK 167

>Kpol_1018.106 s1018 (280224..282485) [2262 bp, 753 aa] {ON}
           (280224..282485) [2262 nt, 754 aa]
          Length = 753

 Score = 45.4 bits (106), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 40/159 (25%), Positives = 69/159 (43%), Gaps = 3/159 (1%)

Query: 331 PKSYIYLGLLMADKGLDEEYYSNFQKAIDLDPNMAAIYYHRGQMNFIIQKYEKAGEDFDK 390
           P+++  +G  ++ +   E+    F+KA  +DPN A  Y  +G  +     ++ A   + K
Sbjct: 535 PQTWCCMGNFLSLQKDHEDAIKAFEKATQVDPNFAYAYTLQGHEHSSNDSFDTAKNCYRK 594

Query: 391 AKECDPTNIFPYIQLACMSYREGHFDDCETLFSEARRKFPDAPEVPNFFAEILSDKGEIE 450
           A  CDP +   Y  L     + G +D+    F +AR   P    +       L      E
Sbjct: 595 ALACDPQHYNAYYGLGMSCMKLGQYDEALLHFEKARSINPINVILICCCGVALEKLQYQE 654

Query: 451 KAAAEYDKAIELESKSENIHVGIAPLV---GKATTLLKY 486
           KA + Y+ A EL+  S   +   A L+   G+ +  L+Y
Sbjct: 655 KALSYYELACELQPSSSLANFKRAHLLYSMGRYSVALQY 693

 Score = 35.8 bits (81), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 49/213 (23%), Positives = 81/213 (38%), Gaps = 26/213 (12%)

Query: 334 YIYLGLLMADKGLDEEYYSNFQKAIDLDPN-----MAAIYYHRGQMNFIIQKYEKAGEDF 388
           YI+  +L A    D   Y   +    L PN     M       G+++F +  Y+ +   F
Sbjct: 433 YIFARILKASSSFDS--YKAIRLINSLVPNHIKDSMPWCQAQLGKLHFELVNYDVSLHYF 490

Query: 389 DKAKECDPTNIFPYIQLACMSYREGHFDD---CETLFSEARRKFPDAPEVPNFFAEILSD 445
              ++  PT +     L   S    H  D      L +E     P+AP+        LS 
Sbjct: 491 TNLRKLQPTRVS---DLEIYSTLLWHLHDKVKLSILANELVMNIPNAPQTWCCMGNFLSL 547

Query: 446 KGEIEKAAAEYDKAIELESKSENIHVGIAPLVGKATTLLKYPTVEN--FIEADDLFEQAN 503
           + + E A   ++KA +++           P    A TL  +    N  F  A + + +A 
Sbjct: 548 QKDHEDAIKAFEKATQVD-----------PNFAYAYTLQGHEHSSNDSFDTAKNCYRKAL 596

Query: 504 NEDPRSEKAKMGLAQCKLQQEDLDDAIRLFEEA 536
             DP+   A  GL    ++    D+A+  FE+A
Sbjct: 597 ACDPQHYNAYYGLGMSCMKLGQYDEALLHFEKA 629

 Score = 35.4 bits (80), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 31/150 (20%), Positives = 53/150 (35%), Gaps = 34/150 (22%)

Query: 354 FQKAIDLDPNMAAIYYHRGQMNFIIQKYEKAGEDFDKAKECDPTNI-------------- 399
           ++KA+  DP     YY  G     + +Y++A   F+KA+  +P N+              
Sbjct: 592 YRKALACDPQHYNAYYGLGMSCMKLGQYDEALLHFEKARSINPINVILICCCGVALEKLQ 651

Query: 400 -----FPYIQLAC---------------MSYREGHFDDCETLFSEARRKFPDAPEVPNFF 439
                  Y +LAC               + Y  G +      F E  +  PD   V    
Sbjct: 652 YQEKALSYYELACELQPSSSLANFKRAHLLYSMGRYSVALQYFEELTKLAPDEATVHFLL 711

Query: 440 AEILSDKGEIEKAAAEYDKAIELESKSENI 469
            ++    G  + A  E+  A+ L+ K   +
Sbjct: 712 GQLYQILGRKKDAVKEFTIAMNLDPKGNQL 741

>NCAS0D04500 Chr4 (855490..855855) [366 bp, 121 aa] {ON} Anc_6.328
           YCR060W
          Length = 121

 Score = 42.4 bits (98), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 26/77 (33%), Positives = 36/77 (46%), Gaps = 1/77 (1%)

Query: 88  ELKKRGNAYFKVKDYENAINYYKFA-LQLKNDPVFYSNMAACYISLEHNKEAIEACSKAL 146
           E K  GN  FK+ DY  A  +Y    ++   +P+ YSN A   I  EH  +AI  C+  L
Sbjct: 5   ENKTEGNRLFKLGDYTAANKFYDLCIMEEPTNPIGYSNKAMSLIKQEHFDQAIRTCNTGL 64

Query: 147 ELNPDYSKVLLKRAAVY 163
             + D     +KR   Y
Sbjct: 65  LYSSDPEHEAIKRKLQY 81

>KLTH0E11748g Chr5 (1043203..1044339) [1137 bp, 378 aa] {ON} similar
           to uniprot|P33313 Saccharomyces cerevisiae YBR155W CNS1
           cyclophilin seven suppressor component of Hsp90p
           chaperone machinery
          Length = 378

 Score = 45.1 bits (105), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 30/105 (28%), Positives = 49/105 (46%), Gaps = 5/105 (4%)

Query: 73  LMKLAETAEKNEYASELKKRGNAYFKVKDYENAINYYKFALQLKND-----PVFYSNMAA 127
           L  LA   E +E A   K +GN  ++ K Y++A   Y   + +K D        +SN AA
Sbjct: 65  LKALAYEGEPHEVAENFKNQGNDLYRAKRYKDAREIYNRGIDIKCDDSKVNESLFSNRAA 124

Query: 128 CYISLEHNKEAIEACSKALELNPDYSKVLLKRAAVYENIGKFADA 172
           C + L++ +  +  C +AL+ N    K   + A  +  + K  DA
Sbjct: 125 CELELKNYRRCVNDCKRALQYNVKNIKCYYRIAKAFLLLNKLEDA 169

>KNAG0F04010 Chr6 (757749..762005) [4257 bp, 1418 aa] {ON} Anc_7.546
           YPR189W
          Length = 1418

 Score = 45.4 bits (106), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 41/158 (25%), Positives = 70/158 (44%), Gaps = 17/158 (10%)

Query: 318 RELVDEAIKLHPRPKSYIY--LGLLMADKGLDEEYYSNFQKAIDLDPNMAAIYYHRGQMN 375
           R +  EAIK+  R  ++ Y  +G+   ++  + E    F  A+ +DPN    +   GQ  
Sbjct: 670 RLVKTEAIKMELRSTNWPYRVIGIAYLERQQESESVEWFHSALRVDPNDVESWVALGQAY 729

Query: 376 FIIQKYEKAGEDFDKAKECDPTNI----FPYIQLACMSYREGHFDDCETLFSEARRKFPD 431
           F   + E + + F+KA E DP ++    F  + LA M    G F++C  +     +  P+
Sbjct: 730 FACGRVEASTKVFEKAIEIDPLHLYAQYFNSLSLAEM----GCFEECIEILKNITQLNPE 785

Query: 432 APEVPNFFAEILSD-------KGEIEKAAAEYDKAIEL 462
                  ++ IL         +G + K  A   +AIEL
Sbjct: 786 ELAFQVSYSSILVSYAFDLYQQGFLMKGTASAIQAIEL 823

>NDAI0I02240 Chr9 (512140..513192) [1053 bp, 350 aa] {ON} Anc_6.21
           YOR007C
          Length = 350

 Score = 44.3 bits (103), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 25/73 (34%), Positives = 37/73 (50%)

Query: 83  NEYASELKKRGNAYFKVKDYENAINYYKFALQLKNDPVFYSNMAACYISLEHNKEAIEAC 142
           NE A  LKK GN       YE AI  Y  A+Q   +  +YSN +  Y  L   ++A+   
Sbjct: 79  NEEAEALKKEGNEAMIEGQYEEAIKKYTEAIQFSKNVAYYSNRSLAYSKLGRYEDAVNDA 138

Query: 143 SKALELNPDYSKV 155
           + A+ ++P +SK 
Sbjct: 139 TLAINIDPSFSKA 151

>NDAI0I00440 Chr9 complement(89650..90036) [387 bp, 128 aa] {ON}
           Anc_6.328 YCR060W
          Length = 128

 Score = 41.6 bits (96), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 25/80 (31%), Positives = 42/80 (52%), Gaps = 3/80 (3%)

Query: 87  SELKKRGNAYFKVKDYENAINYYKFALQLK-NDPVFYSNMAACYISLEHNKEAIEACSKA 145
           ++LK+ GN +F+  DY  A  YY   ++L+  +P+ YSN A   I   ++  A+E C + 
Sbjct: 4   NDLKQEGNTFFQKGDYAQANGYYDQCIKLEPTNPIGYSNKAMSLIKQGNHGLAVETCQEG 63

Query: 146 LELNPDYSK--VLLKRAAVY 163
           L+     +K    +KR   Y
Sbjct: 64  LKYTSSSTKEATTIKRKLEY 83

>Smik_2.36 Chr2 complement(61159..63414) [2256 bp, 751 aa] {ON}
           YBL084C (REAL)
          Length = 751

 Score = 44.3 bits (103), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 36/138 (26%), Positives = 59/138 (42%)

Query: 330 RPKSYIYLGLLMADKGLDEEYYSNFQKAIDLDPNMAAIYYHRGQMNFIIQKYEKAGEDFD 389
           +P+++  +G L++ +   +     F+KA  LDPN A  Y  +G  +      + A   + 
Sbjct: 532 KPETWCCVGNLLSLQKDHDAAIKAFEKATQLDPNFAYAYTLQGHEHSSNDSSDSAKTCYR 591

Query: 390 KAKECDPTNIFPYIQLACMSYREGHFDDCETLFSEARRKFPDAPEVPNFFAEILSDKGEI 449
           KA  CDP +   Y  L   S + G +++    F +AR   P    +       L   G  
Sbjct: 592 KALACDPQHYNAYYGLGTSSMKLGQYEEALLYFEKARSINPVNVVLICCCGGSLEKLGYK 651

Query: 450 EKAAAEYDKAIELESKSE 467
           EKA   Y+ A  L+  S 
Sbjct: 652 EKALQYYELACHLQPTSS 669

>Suva_2.34 Chr2 complement(63832..65304,65365..66183) [2292 bp, 763
           aa] {ON} YBL084C (REAL)
          Length = 763

 Score = 43.9 bits (102), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 35/138 (25%), Positives = 59/138 (42%)

Query: 330 RPKSYIYLGLLMADKGLDEEYYSNFQKAIDLDPNMAAIYYHRGQMNFIIQKYEKAGEDFD 389
           +P+++  +G L++ +   +     F+KA  LDPN A  Y  +G  +      + A   + 
Sbjct: 544 KPETWCCIGNLLSLQKDHDAAIKAFEKATQLDPNFAYAYTLQGHEHSSNDSSDSAKTCYR 603

Query: 390 KAKECDPTNIFPYIQLACMSYREGHFDDCETLFSEARRKFPDAPEVPNFFAEILSDKGEI 449
           KA  CDP +   Y  L   S + G +++    F +AR   P    +       L   G  
Sbjct: 604 KALACDPQHYNAYYGLGTSSMKLGQYEEALLYFEKARSINPVNVVLICCCGGSLEKLGYK 663

Query: 450 EKAAAEYDKAIELESKSE 467
           EK    Y+ A +L+  S 
Sbjct: 664 EKVLQYYELACQLQPTSS 681

>KLLA0B10912g Chr2 (955948..957486) [1539 bp, 512 aa] {ON} similar
           to uniprot|P53043 Saccharomyces cerevisiae YGR123C
          Length = 512

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 33/99 (33%), Positives = 52/99 (52%), Gaps = 5/99 (5%)

Query: 84  EYASELKKRGNAYFKVKDYENAINYYKFALQLKNDP---VFYSNMAACYISLEHNKEAIE 140
           E A ELK  GN + K K Y  A  YY  A++  +DP   + YSN A   + L++ + +++
Sbjct: 11  EKALELKNEGNKFVKEKLYAKAAEYYTKAIE--HDPENTILYSNRAFTNLKLDNFQSSLD 68

Query: 141 ACSKALELNPDYSKVLLKRAAVYENIGKFADALLDLTAV 179
              +A+EL+ +  K   +RA  Y  + +F  A  DL  V
Sbjct: 69  DAKRAIELDNNNLKAYHRRAMSYIGLLEFRKARKDLIIV 107

>YBL084C Chr2 complement(67169..69445) [2277 bp, 758 aa] {ON}
           CDC27Subunit of the Anaphase-Promoting Complex/Cyclosome
           (APC/C), which is a ubiquitin-protein ligase required
           for degradation of anaphase inhibitors, including
           mitotic cyclins, during the metaphase/anaphase
           transition
          Length = 758

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 35/138 (25%), Positives = 59/138 (42%)

Query: 330 RPKSYIYLGLLMADKGLDEEYYSNFQKAIDLDPNMAAIYYHRGQMNFIIQKYEKAGEDFD 389
           +P+++  +G L++ +   +     F+KA  LDPN A  Y  +G  +      + A   + 
Sbjct: 539 KPETWCCIGNLLSLQKDHDAAIKAFEKATQLDPNFAYAYTLQGHEHSSNDSSDSAKTCYR 598

Query: 390 KAKECDPTNIFPYIQLACMSYREGHFDDCETLFSEARRKFPDAPEVPNFFAEILSDKGEI 449
           KA  CDP +   Y  L   + + G +++    F +AR   P    +       L   G  
Sbjct: 599 KALACDPQHYNAYYGLGTSAMKLGQYEEALLYFEKARSINPVNVVLICCCGGSLEKLGYK 658

Query: 450 EKAAAEYDKAIELESKSE 467
           EKA   Y+ A  L+  S 
Sbjct: 659 EKALQYYELACHLQPTSS 676

>NCAS0A11200 Chr1 complement(2220419..2223142) [2724 bp, 907 aa]
           {ON} Anc_3.367
          Length = 907

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 29/124 (23%), Positives = 56/124 (45%), Gaps = 17/124 (13%)

Query: 356 KAIDLDPNMAAIYYHRGQMNFIIQKYEKAGEDFDKAKECDPTNIFPYIQLACMSYREGHF 415
           K++++DPN +  +YH G+++ I   Y  A + F +A   D  N   +  +  + Y+   +
Sbjct: 297 KSLEVDPNDSTTWYHLGRVHMIRNDYTAAYDAFQQAVNRDSRNPIFWCSIGVLYYQISQY 356

Query: 416 DDCETLFSEARRKFPDAPEVPNFFAEILSDKG--------EIEKAAAEYDKAIELESKSE 467
            D    ++ A R  P       + +E+  D G        ++  A   Y +A  L+   E
Sbjct: 357 RDALDAYTRAIRLNP-------YISEVWYDLGTLYETCNNQLNDALDAYKQAARLD--PE 407

Query: 468 NIHV 471
           N+H+
Sbjct: 408 NVHI 411

 Score = 37.4 bits (85), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 21/83 (25%), Positives = 42/83 (50%), Gaps = 2/83 (2%)

Query: 93  GNAYFKVKDYENAINYYKFALQL-KNDPVFYSNMAACYISLEHNKEAIEACSKALELNPD 151
           G  +    DY  A + ++ A+     +P+F+ ++   Y  +   ++A++A ++A+ LNP 
Sbjct: 313 GRVHMIRNDYTAAYDAFQQAVNRDSRNPIFWCSIGVLYYQISQYRDALDAYTRAIRLNPY 372

Query: 152 YSKVLLKRAAVYENI-GKFADAL 173
            S+V      +YE    +  DAL
Sbjct: 373 ISEVWYDLGTLYETCNNQLNDAL 395

>ZYRO0B04224g Chr2 (350069..351610) [1542 bp, 513 aa] {ON} highly
           similar to uniprot|P53043 Saccharomyces cerevisiae
           YGR123C
          Length = 513

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 29/95 (30%), Positives = 49/95 (51%), Gaps = 1/95 (1%)

Query: 86  ASELKKRGNAYFKVKDYENAINYYKFALQLKND-PVFYSNMAACYISLEHNKEAIEACSK 144
           A E K +GN + K +D+  A   Y  A++L +   +F+SN A  ++  ++ + ++  C K
Sbjct: 12  ALEYKDQGNDFVKKQDFIKAAELYTKAIELDDTKSIFFSNRALAHLKQDNFQLSLNDCDK 71

Query: 145 ALELNPDYSKVLLKRAAVYENIGKFADALLDLTAV 179
           ALEL+    K   +R   Y  + +F  A  DL  V
Sbjct: 72  ALELDSKNIKAYHRRGLSYVGLLEFKKARTDLKTV 106

>KLLA0C08910g Chr3 complement(781726..782073) [348 bp, 115 aa] {ON}
           similar to uniprot|P25638 Saccharomyces cerevisiae
           YCR060W TAH1 HSP90 cofactor interacts with Hsp82p Pih1p
           Rvb1 and Rvb2 contains a single TPR domain with at least
           two TPR motifs
          Length = 115

 Score = 40.0 bits (92), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 21/60 (35%), Positives = 34/60 (56%), Gaps = 1/60 (1%)

Query: 88  ELKKRGNAYFKVKDYENAINYYKFALQL-KNDPVFYSNMAACYISLEHNKEAIEACSKAL 146
           E K +GN  +K  ++ +A+N+YK A+     +PV YSN A   I L +  +A + C + L
Sbjct: 6   EFKIKGNTAYKQNNFTDAVNFYKKAITYDPTNPVGYSNCAMALIKLNNYADASQMCQRGL 65

>KAFR0B06610 Chr2 (1372434..1373969) [1536 bp, 511 aa] {ON}
           Anc_3.481 YGR123C
          Length = 511

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 30/99 (30%), Positives = 46/99 (46%), Gaps = 5/99 (5%)

Query: 84  EYASELKKRGNAYFKVKDYENAINYYKFALQLKNDP---VFYSNMAACYISLEHNKEAIE 140
           E A+  K  GN + K +D++ A   Y  A++   DP   +FYSN A   + L++   A+ 
Sbjct: 7   ELATSYKDEGNKFLKQQDFQRANELYTKAIE--TDPTQSIFYSNRALANLKLDNFMNALN 64

Query: 141 ACSKALELNPDYSKVLLKRAAVYENIGKFADALLDLTAV 179
            C+ A+ELN    K   +R      +  F  A  D   V
Sbjct: 65  DCTNAIELNSSNLKAYHRRGLANIGLLNFKSARNDFNIV 103

 Score = 32.0 bits (71), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 34/123 (27%), Positives = 53/123 (43%), Gaps = 14/123 (11%)

Query: 309 FLKN-DPLTARELVDEAIKLHPRPKSYIYLGLLMADKGLDE--EYYSNFQKAIDLDPNMA 365
           FLK  D   A EL  +AI+  P  +S  Y    +A+  LD      ++   AI+L+ +  
Sbjct: 19  FLKQQDFQRANELYTKAIETDPT-QSIFYSNRALANLKLDNFMNALNDCTNAIELNSSNL 77

Query: 366 AIYYHRGQMNFIIQKYEKAGEDFDKAKECDPTNIFPYIQLACMSYREGHFDDCETLFSEA 425
             Y+ RG  N  +  ++ A  DF+   +  P +I            +  FD CE +  E 
Sbjct: 78  KAYHRRGLANIGLLNFKSARNDFNIVLKYKPNDIIA----------KNGFDTCEKVIREE 127

Query: 426 RRK 428
           R K
Sbjct: 128 RFK 130

>Suva_7.408 Chr7 complement(706942..708483) [1542 bp, 513 aa] {ON}
           YGR123C (REAL)
          Length = 513

 Score = 42.4 bits (98), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 29/95 (30%), Positives = 48/95 (50%), Gaps = 1/95 (1%)

Query: 86  ASELKKRGNAYFKVKDYENAINYYKFALQL-KNDPVFYSNMAACYISLEHNKEAIEACSK 144
           A E K  GN + K K +  AI  Y  A+ L     +++SN A  +  +++ + A+  C +
Sbjct: 12  ALERKNEGNVFIKEKHFLKAIEKYTQAIDLDSTQSIYFSNRAFAHFKVDNFQSALNDCDE 71

Query: 145 ALELNPDYSKVLLKRAAVYENIGKFADALLDLTAV 179
           AL+L+P   K   +RA     + +F  A  DLT +
Sbjct: 72  ALKLDPKNIKAYHRRALSCMALLEFKKAKKDLTVL 106

 Score = 35.4 bits (80), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 20/61 (32%), Positives = 34/61 (55%), Gaps = 2/61 (3%)

Query: 354 FQKAIDLDPNMAAIYYHRGQMNFIIQKYEKAGEDFDKAKECDPTNIFPYIQ--LACMSYR 411
           + +AIDLD   +  + +R   +F +  ++ A  D D+A + DP NI  Y +  L+CM+  
Sbjct: 35  YTQAIDLDSTQSIYFSNRAFAHFKVDNFQSALNDCDEALKLDPKNIKAYHRRALSCMALL 94

Query: 412 E 412
           E
Sbjct: 95  E 95

>NCAS0B02560 Chr2 complement(427447..429183) [1737 bp, 578 aa] {ON}
           Anc_8.470
          Length = 578

 Score = 42.7 bits (99), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 36/132 (27%), Positives = 64/132 (48%), Gaps = 9/132 (6%)

Query: 75  KLAETAEKNEYASELKKRGNAYFKVKDYENAINYYKFALQLK-NDPVFYSNMAACYISLE 133
           +LAE+  +++   EL  RG  Y+   D++  I  +K +L++  ND V ++ + A   +  
Sbjct: 421 RLAESLPEHDAKLELI-RGLLYYAEDDFDKTIECFKESLKINPNDEVMWNRLGASLANSN 479

Query: 134 HNKEAIEACSKALELNPDYSKVLLKRAAVYENIGKFADALLDLTAV-------SLNGDYN 186
             ++AI+A  +AL L P + +     A    NIG + +A   L  V        +N    
Sbjct: 480 KPEDAIQAYHRALNLKPSFVRARYNLAVASMNIGCYKEAGEHLLTVLRMHQVEGVNNVET 539

Query: 187 DATIQPIVERVL 198
           D  +  I++RVL
Sbjct: 540 DNNVLEILKRVL 551

>Smik_4.491 Chr4 (895429..897267) [1839 bp, 612 aa] {ON} YDR244W
           (REAL)
          Length = 612

 Score = 42.0 bits (97), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 32/114 (28%), Positives = 57/114 (50%), Gaps = 16/114 (14%)

Query: 93  GNAYFKVKDYENAINYYKFALQLK-NDPVFYSNMAACYISLEHNKEAIEACSKALELNPD 151
           G  ++   D++  I+ ++ AL++  ND + ++ + A   +   ++EAI+A  +AL+L P 
Sbjct: 465 GLLFYTKDDFDKTIDCFESALKVNPNDELMWNRLGASLANSNRSEEAIQAYHRALQLKPS 524

Query: 152 YSKVLLKRAAVYENIGKFADA------LLDLTAVSLN--GD-------YNDATI 190
           + +     A    NIG F +A      +L +  V+ N  GD       YNDA I
Sbjct: 525 FVRARYNLAVSSMNIGCFKEAAGYLLSVLSMHEVNTNRKGDVGSLLNTYNDAVI 578

>Skud_2.24 Chr2 complement(50790..53099) [2310 bp, 769 aa] {ON}
           YBL084C (REAL)
          Length = 769

 Score = 42.0 bits (97), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 38/157 (24%), Positives = 67/157 (42%), Gaps = 1/157 (0%)

Query: 312 NDPLTARELVDEAIKLHP-RPKSYIYLGLLMADKGLDEEYYSNFQKAIDLDPNMAAIYYH 370
           +D + +  L +  + + P +P+++  +G L++ +   +     F+KA  LDPN A  Y  
Sbjct: 531 HDKVKSSNLANGLMDIMPNKPETWCCIGNLLSLQKDHDAAIKAFEKATQLDPNFAYAYTL 590

Query: 371 RGQMNFIIQKYEKAGEDFDKAKECDPTNIFPYIQLACMSYREGHFDDCETLFSEARRKFP 430
           +G  +      + A   + KA  CD  +   Y  L   S + G +++    F +AR   P
Sbjct: 591 QGHEHSSNDSSDSAKTCYRKALACDSQHYNAYYGLGTSSMKLGQYEEALLYFEKARSINP 650

Query: 431 DAPEVPNFFAEILSDKGEIEKAAAEYDKAIELESKSE 467
               +       L   G  EKA   Y+ A  L+  S 
Sbjct: 651 VNVVLICCCGGSLEKLGYKEKALQYYELACHLQPTSS 687

>SAKL0H11946g Chr8 complement(1020512..1022233) [1722 bp, 573 aa]
           {ON} similar to uniprot|P35056 Saccharomyces cerevisiae
           YDR244W PEX5 Essential for import of proteins with SKL-
           like import signal into peroxisomal matrix 69-kDa
           protein containing tetratricopeptide repeat (TPR)
          Length = 573

 Score = 42.0 bits (97), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 27/92 (29%), Positives = 52/92 (56%), Gaps = 2/92 (2%)

Query: 93  GNAYFKVKDYENAINYYKFALQLK-NDPVFYSNMAACYISLEHNKEAIEACSKALELNPD 151
           G  ++  +DY+  I+ +K AL +K +D + ++ + A   +   ++EAI+A  +AL+L P 
Sbjct: 429 GILFYANEDYDKTIDCFKAALTVKPDDELMWNRLGASLANSNRSEEAIQAYHRALQLKPS 488

Query: 152 YSKVLLKRAAVYENIGKFADAL-LDLTAVSLN 182
           + +     A    NIG + +A    LTA+S++
Sbjct: 489 FVRARYNLAVSSMNIGCYKEAAEYLLTALSMH 520

>KNAG0H00610 Chr8 (99931..102852) [2922 bp, 973 aa] {ON} Anc_3.367
           YBR112C
          Length = 973

 Score = 42.0 bits (97), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 29/124 (23%), Positives = 56/124 (45%), Gaps = 17/124 (13%)

Query: 356 KAIDLDPNMAAIYYHRGQMNFIIQKYEKAGEDFDKAKECDPTNIFPYIQLACMSYREGHF 415
           K++++DP+ A  +YH G+++ +   Y  A + F +A   D  N   +  +  + Y+   +
Sbjct: 306 KSLEVDPSDATTWYHLGRVHMVRSDYTAAYDAFQQAVNRDSRNPIFWCSIGVLYYQISQY 365

Query: 416 DDCETLFSEARRKFPDAPEVPNFFAEILSDKG--------EIEKAAAEYDKAIELESKSE 467
            D    ++ A R  P       + +E+  D G        ++  A   Y +A  L+   E
Sbjct: 366 RDALDAYTRAIRLNP-------YISEVWYDLGTLYETCNNQLTDALDAYKQAARLD--PE 416

Query: 468 NIHV 471
           NIH+
Sbjct: 417 NIHI 420

 Score = 38.1 bits (87), Expect = 0.063,   Method: Compositional matrix adjust.
 Identities = 21/83 (25%), Positives = 42/83 (50%), Gaps = 2/83 (2%)

Query: 93  GNAYFKVKDYENAINYYKFALQL-KNDPVFYSNMAACYISLEHNKEAIEACSKALELNPD 151
           G  +    DY  A + ++ A+     +P+F+ ++   Y  +   ++A++A ++A+ LNP 
Sbjct: 322 GRVHMVRSDYTAAYDAFQQAVNRDSRNPIFWCSIGVLYYQISQYRDALDAYTRAIRLNPY 381

Query: 152 YSKVLLKRAAVYENI-GKFADAL 173
            S+V      +YE    +  DAL
Sbjct: 382 ISEVWYDLGTLYETCNNQLTDAL 404

>KAFR0L01870 Chr12 (345757..347895) [2139 bp, 712 aa] {ON} Anc_7.412
           YBL084C
          Length = 712

 Score = 41.6 bits (96), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 42/173 (24%), Positives = 73/173 (42%), Gaps = 19/173 (10%)

Query: 372 GQMNFIIQKYEKAGEDFDKAKECDPTNIFPYIQLACMSYREGHFDD---CETLFSEARRK 428
           G++++ IQ Y+ A   F++ +   PT +     L   S    H  D      L +E    
Sbjct: 433 GKLHYEIQNYKMALSHFERLRIIQPTRL---NDLEIFSTLLWHLHDKVKLSNLANELIDN 489

Query: 429 FPDAPEVPNFFAEILSDKGEIEKAAAEYDKAIELESKSENIHVGIAPLVGKATTLL--KY 486
           FP+A +         S + + ++A   ++KA EL+           P    A TL   +Y
Sbjct: 490 FPEAAQTWCVLGNHFSLQKDHDEAIKAFNKATELD-----------PRFAYAYTLQGHEY 538

Query: 487 PTVENFIEADDLFEQANNEDPRSEKAKMGLAQCKLQQEDLDDAIRLFEEAAIL 539
            + E+F  A   + +A   D +   A  GL  C  Q  + D ++  FE+A ++
Sbjct: 539 ASNESFDTARTFYRKALACDSQHYNAYYGLGTCDSQNGNHDRSLLFFEKARMI 591

 Score = 32.7 bits (73), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 30/120 (25%), Positives = 49/120 (40%), Gaps = 1/120 (0%)

Query: 312 NDPLTARELVDEAIKLHPRP-KSYIYLGLLMADKGLDEEYYSNFQKAIDLDPNMAAIYYH 370
           +D +    L +E I   P   +++  LG   + +   +E    F KA +LDP  A  Y  
Sbjct: 474 HDKVKLSNLANELIDNFPEAAQTWCVLGNHFSLQKDHDEAIKAFNKATELDPRFAYAYTL 533

Query: 371 RGQMNFIIQKYEKAGEDFDKAKECDPTNIFPYIQLACMSYREGHFDDCETLFSEARRKFP 430
           +G      + ++ A   + KA  CD  +   Y  L     + G+ D     F +AR   P
Sbjct: 534 QGHEYASNESFDTARTFYRKALACDSQHYNAYYGLGTCDSQNGNHDRSLLFFEKARMINP 593

>KNAG0A04120 Chr1 complement(556919..558727) [1809 bp, 602 aa] {ON}
           Anc_8.470 YDR244W
          Length = 602

 Score = 41.6 bits (96), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 26/91 (28%), Positives = 50/91 (54%), Gaps = 2/91 (2%)

Query: 93  GNAYFKVKDYENAINYYKFALQLK-NDPVFYSNMAACYISLEHNKEAIEACSKALELNPD 151
           G  ++   D+   I+ +K ALQ+  ND + ++ + A   +   ++E+I+A  +AL+L P 
Sbjct: 453 GLLFYANDDFNKTIDCFKTALQVNPNDELMWNRLGAALANSNRSEESIKAYHRALQLKPS 512

Query: 152 YSKVLLKRAAVYENIGKFADALLD-LTAVSL 181
           + +     A    NIG + +A+   LTA+S+
Sbjct: 513 FVRARYNLAVSSMNIGCYKEAVEHLLTALSM 543

>TDEL0C02720 Chr3 (477529..479631) [2103 bp, 700 aa] {ON} Anc_7.412
           YBL084C
          Length = 700

 Score = 41.6 bits (96), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 39/156 (25%), Positives = 65/156 (41%), Gaps = 1/156 (0%)

Query: 312 NDPLTARELVDEAIKLHP-RPKSYIYLGLLMADKGLDEEYYSNFQKAIDLDPNMAAIYYH 370
           +D      L +E ++  P +P+++  LG L + +   E+    F+KA  +D N A  Y  
Sbjct: 462 HDSTRLSHLSNELVETLPNKPQTWCCLGNLYSLQRDHEDAIKYFEKATKIDYNFAYAYTL 521

Query: 371 RGQMNFIIQKYEKAGEDFDKAKECDPTNIFPYIQLACMSYREGHFDDCETLFSEARRKFP 430
           +G  +      + A   + +A  CDP +   Y  L     + G +D     F +AR   P
Sbjct: 522 QGHEHSSNDSIDTAKNCYRRALACDPQHYNAYYGLGMCYMKLGQYDKALLFFEKARNINP 581

Query: 431 DAPEVPNFFAEILSDKGEIEKAAAEYDKAIELESKS 466
               +       L      EKA   Y++A EL+  S
Sbjct: 582 VNVILICCCGVALEKLSYQEKALQYYEQACELQPSS 617

 Score = 32.0 bits (71), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 21/84 (25%), Positives = 45/84 (53%), Gaps = 5/84 (5%)

Query: 93  GNAYFKVKDYENAINYYKFALQLKNDPVFYSNMAACYISLE---HNKEAIEACSKALELN 149
           G  Y K+  Y+ A+ +++ A  +  +PV    +  C ++LE   + ++A++   +A EL 
Sbjct: 557 GMCYMKLGQYDKALLFFEKARNI--NPVNVILICCCGVALEKLSYQEKALQYYEQACELQ 614

Query: 150 PDYSKVLLKRAAVYENIGKFADAL 173
           P  S    K+A +  ++ +++ AL
Sbjct: 615 PSSSLAKFKKAHLLYSMARYSAAL 638

>KLTH0E10934g Chr5 (981831..983537) [1707 bp, 568 aa] {ON} similar
           to uniprot|P35056 Saccharomyces cerevisiae YDR244W PEX5
           Essential for import of proteins with SKL- like import
           signal into peroxisomal matrix 69-kDa protein containing
           tetratricopeptide repeat (TPR)
          Length = 568

 Score = 41.2 bits (95), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 26/92 (28%), Positives = 51/92 (55%), Gaps = 2/92 (2%)

Query: 93  GNAYFKVKDYENAINYYKFALQLK-NDPVFYSNMAACYISLEHNKEAIEACSKALELNPD 151
           G  ++   DY+  ++ ++ AL +K +D + ++ + A   +   ++EAI+A  KAL+L P 
Sbjct: 426 GILFYSNDDYDKTVDCFRAALAVKPDDELMWNRLGASLANSNRSEEAIQAYRKALQLKPT 485

Query: 152 YSKVLLKRAAVYENIGKFADAL-LDLTAVSLN 182
           + +     A    N+G F +A    LTA+S++
Sbjct: 486 FVRARCNLAVSCMNMGCFKEAAEYLLTALSMH 517

>KNAG0I02520 Chr9 complement(487699..488052) [354 bp, 117 aa] {ON}
           Anc_6.328 YCR060W
          Length = 117

 Score = 38.5 bits (88), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 27/89 (30%), Positives = 45/89 (50%), Gaps = 8/89 (8%)

Query: 89  LKKRGNAYFKVKDYENAINYYKFALQLK-NDPVFYSNMAACYISLEHNKEAIEACSKA-- 145
           +K++GN  F+  ++ +A  YY   + L+  +P+ YSN A   I L+   E I+ C +   
Sbjct: 7   VKEQGNVAFRNSNFSSAAEYYGKCICLEPENPIGYSNRAMALIKLQKFSETIDTCQRGLG 66

Query: 146 -LELN----PDYSKVLLKRAAVYENIGKF 169
            LE N    P   K+L +     E++ KF
Sbjct: 67  KLEDNEKDEPIRKKLLYRLHLAQESLNKF 95

>TBLA0H01520 Chr8 (344716..346785) [2070 bp, 689 aa] {ON} Anc_3.367
           YBR112C
          Length = 689

 Score = 41.2 bits (95), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 28/106 (26%), Positives = 54/106 (50%), Gaps = 11/106 (10%)

Query: 118 DPVFYSNMAACYISLEHNKEAIEACSKALELNPDYSKVLLKRAAVYENIG-KFADALLDL 176
           +P+F+ ++   Y  +  N +A++A ++A+ LNP  S+V      +YE    +  DAL   
Sbjct: 447 NPIFWCSIGVLYYQIGQNHDALDAYTRAIRLNPYISEVWYNLGTLYETCNDQITDALDSY 506

Query: 177 -TAVSLNGDYNDATIQPIVERVLNKQAMMALKDHLEASEKNKVLPS 221
             A+SL+ +       P+++  LN    + ++D     + N V+PS
Sbjct: 507 ERALSLDPE------NPVIQGRLNA---LKIQDKKSEYDPNNVVPS 543

 Score = 37.0 bits (84), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 72/340 (21%), Positives = 127/340 (37%), Gaps = 67/340 (19%)

Query: 93  GNAYFKVKDYENAINYYKFALQLKND---PVFYSNMAACYISLEHNKEAIEACSKALELN 149
           G+ Y  + D + A N Y+ AL   +D   P  +  +   Y        A EA  K L+L+
Sbjct: 239 GHCYLMLDDLQKAYNAYQQALNNLSDPNVPKLWHGIGILYDRYGSLDFAEEAFKKVLDLD 298

Query: 150 PDYSK---VLLKRAAVYENIGKFADALLDLTAVSLNGDYNDATIQPIVERVLNKQAMMAL 206
           P++ K   +  +   +Y++ G++ +A+  L  +            P+ E  +  Q    L
Sbjct: 299 PNFEKANEIYFRLGIIYKHKGRWNEAIESLNCIL------KRPPPPLTESDIWFQIGNIL 352

Query: 207 KDHLEASEKNKVLPSYTSMAAFFGVFDAETDIPGHDATEESDKILSDALTHLYSQTKEGY 266
           ++  +                + G  DA   +        S+  L   L  LYS     +
Sbjct: 353 ENKFD----------------WNGAKDAYEHV---SKNNNSNPKLLKQLGCLYSMENVEF 393

Query: 267 DRCDSEFTKATELYKAKLENDRTNSVTNEKAAIAFEHTAILSFLKNDPLTARELVDEAIK 326
              D        L K+ LE D T+S T       + +   +   K D   A E + +A+ 
Sbjct: 394 YNLD---IAMGHLVKS-LELDPTDSTT-------WYYLGRIHMAKKDFTAAYESLQQAVN 442

Query: 327 LHPR-PKSYIYLGLLMADKGLDEEYYSNFQKAIDLDPNMAAIYYHRGQM----------- 374
              R P  +  +G+L    G + +    + +AI L+P ++ ++Y+ G +           
Sbjct: 443 RDSRNPIFWCSIGVLYYQIGQNHDALDAYTRAIRLNPYISEVWYNLGTLYETCNDQITDA 502

Query: 375 -------------NFIIQKYEKAGEDFDKAKECDPTNIFP 401
                        N +IQ    A +  DK  E DP N+ P
Sbjct: 503 LDSYERALSLDPENPVIQGRLNALKIQDKKSEYDPNNVVP 542

 Score = 34.7 bits (78), Expect = 0.68,   Method: Compositional matrix adjust.
 Identities = 25/122 (20%), Positives = 54/122 (44%), Gaps = 15/122 (12%)

Query: 356 KAIDLDPNMAAIYYHRGQMNFIIQKYEKAGEDFDKAKECDPTNIFPYIQLACMSYREGHF 415
           K+++LDP  +  +Y+ G+++   + +  A E   +A   D  N   +  +  + Y+ G  
Sbjct: 405 KSLELDPTDSTTWYYLGRIHMAKKDFTAAYESLQQAVNRDSRNPIFWCSIGVLYYQIGQN 464

Query: 416 DDCETLFSEARRKFPDAPEVPNFFAEILSDKG--------EIEKAAAEYDKAIELESKSE 467
            D    ++ A R  P       + +E+  + G        +I  A   Y++A+ L+ ++ 
Sbjct: 465 HDALDAYTRAIRLNP-------YISEVWYNLGTLYETCNDQITDALDSYERALSLDPENP 517

Query: 468 NI 469
            I
Sbjct: 518 VI 519

>Suva_3.95 Chr3 (137419..137754) [336 bp, 111 aa] {ON} YCR060W
           (REAL)
          Length = 111

 Score = 38.5 bits (88), Expect = 0.007,   Method: Composition-based stats.
 Identities = 27/76 (35%), Positives = 38/76 (50%), Gaps = 3/76 (3%)

Query: 90  KKRGNAYFKVKDYENAINYYK--FALQLKNDPVFYSNMAACYISLEHNKEAIEACSKALE 147
           K+ GN  +K   Y +AI  Y    A Q +N PV +SN A   I L  + +AIEAC + L+
Sbjct: 8   KEEGNELYKQGLYRDAIGCYDRLIAAQPQN-PVGHSNKAMALIKLGEHAQAIEACQQGLQ 66

Query: 148 LNPDYSKVLLKRAAVY 163
           L        L+   +Y
Sbjct: 67  LAASPQHAALRAKLLY 82

>TBLA0A01690 Chr1 complement(404419..406407) [1989 bp, 662 aa] {ON}
           Anc_8.470 YDR244W
          Length = 662

 Score = 41.2 bits (95), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 27/91 (29%), Positives = 47/91 (51%), Gaps = 2/91 (2%)

Query: 93  GNAYFKVKDYENAINYYKFALQLK-NDPVFYSNMAACYISLEHNKEAIEACSKALELNPD 151
           G  ++   DY+  I+ +K AL +  ND + ++ + A   +   ++EA+ A  +AL L P 
Sbjct: 500 GLLFYTTADYDKTIDCFKTALTVNPNDELMWNRLGASLANSNRSEEAVAAYHRALTLKPS 559

Query: 152 YSKVLLKRAAVYENIGKFADALLD-LTAVSL 181
           + +     A    NIG F +A    LTA+S+
Sbjct: 560 FVRARYNLAVSSINIGCFKEAAEHLLTALSM 590

>Smik_3.159 Chr3 (222475..222822) [348 bp, 115 aa] {ON} YCR060W
           (REAL)
          Length = 115

 Score = 38.1 bits (87), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 23/69 (33%), Positives = 34/69 (49%), Gaps = 3/69 (4%)

Query: 90  KKRGNAYFKVKDYENAINYY-KFALQLKNDPVFYSNMAACYISLEHNKEAIEACSKALE- 147
           K+ GNA FK   Y  A++ Y +       +PV YSN A   I L     AI+ C + L  
Sbjct: 12  KELGNALFKQGLYREAVDSYDQLITAQPQNPVGYSNKAMALIKLAEYTHAIQTCQEGLRY 71

Query: 148 -LNPDYSKV 155
            L P+++ +
Sbjct: 72  ALGPEHAAI 80

>YDR244W Chr4 (950563..952401) [1839 bp, 612 aa] {ON}
           PEX5Peroxisomal membrane signal receptor for the
           C-terminal tripeptide signal sequence (PTS1) of
           peroxisomal matrix proteins, required for peroxisomal
           matrix protein import; also proposed to have
           PTS1-receptor independent functions
          Length = 612

 Score = 40.8 bits (94), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 31/118 (26%), Positives = 58/118 (49%), Gaps = 17/118 (14%)

Query: 93  GNAYFKVKDYENAINYYKFALQLK-NDPVFYSNMAACYISLEHNKEAIEACSKALELNPD 151
           G  ++   D++  I+ ++ AL++  ND + ++ + A   +   ++EAI+A  +AL+L P 
Sbjct: 464 GLLFYTKDDFDKTIDCFESALRVNPNDELMWNRLGASLANSNRSEEAIQAYHRALQLKPS 523

Query: 152 YSKVLLKRAAVYENIGKFADA------LLDLTAVSLN---GD-------YNDATIQPI 193
           + +     A    NIG F +A      +L +  V+ N   GD       YND  I+ +
Sbjct: 524 FVRARYNLAVSSMNIGCFKEAAGYLLSVLSMHEVNTNNKKGDVGSLLNTYNDTVIETL 581

>TPHA0M01630 Chr13 complement(340500..343631) [3132 bp, 1043 aa]
           {ON} Anc_3.367 YBR112C
          Length = 1043

 Score = 41.2 bits (95), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 29/124 (23%), Positives = 57/124 (45%), Gaps = 17/124 (13%)

Query: 356 KAIDLDPNMAAIYYHRGQMNFIIQKYEKAGEDFDKAKECDPTNIFPYIQLACMSYREGHF 415
           K++++DP+ AA +YH G+++ I   Y  A + F +A   D  N   +  +  + Y+   +
Sbjct: 296 KSLEIDPSDAATWYHLGRVHMIRADYTAAYDAFQQAVNRDSRNPIFWCSIGVLYYQISQY 355

Query: 416 DDCETLFSEARRKFPDAPEVPNFFAEILSDKG--------EIEKAAAEYDKAIELESKSE 467
            D    ++ A R  P       + +E+  D G        ++  A   Y +A  L+   +
Sbjct: 356 RDALDAYTRAIRLNP-------YISEVWYDLGTLYETCNKQLNDALDAYKQAARLD--PD 406

Query: 468 NIHV 471
           N+H+
Sbjct: 407 NVHI 410

 Score = 38.1 bits (87), Expect = 0.068,   Method: Compositional matrix adjust.
 Identities = 21/84 (25%), Positives = 42/84 (50%), Gaps = 1/84 (1%)

Query: 93  GNAYFKVKDYENAINYYKFALQL-KNDPVFYSNMAACYISLEHNKEAIEACSKALELNPD 151
           G  +    DY  A + ++ A+     +P+F+ ++   Y  +   ++A++A ++A+ LNP 
Sbjct: 312 GRVHMIRADYTAAYDAFQQAVNRDSRNPIFWCSIGVLYYQISQYRDALDAYTRAIRLNPY 371

Query: 152 YSKVLLKRAAVYENIGKFADALLD 175
            S+V      +YE   K  +  LD
Sbjct: 372 ISEVWYDLGTLYETCNKQLNDALD 395

 Score = 35.8 bits (81), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 27/90 (30%), Positives = 45/90 (50%), Gaps = 12/90 (13%)

Query: 93  GNAYFKVKDYENAINYYKFAL---QLKNDPVFYSNMAACY---ISLEHNKEAIEACSKAL 146
           G+ Y  + D + A N Y+ AL      N P  +  +   Y    SLE+ +EA    +K L
Sbjct: 130 GHCYLMLDDLQRAYNSYQQALYYLSNPNVPKLWHGIGILYDRYGSLEYAEEAF---AKVL 186

Query: 147 ELNPDYSK---VLLKRAAVYENIGKFADAL 173
           EL+P++ K   +  +   +Y++ GK+  AL
Sbjct: 187 ELDPNFDKANEIYFRLGIIYKHQGKWTQAL 216

>ZYRO0C16522g Chr3 complement(1281166..1284090) [2925 bp, 974 aa]
           {ON} highly similar to uniprot|P14922 Saccharomyces
           cerevisiae YBR112C CYC8 General transcriptional co-
           repressor acts together with Tup1p also acts as part of
           a transcriptional co-activator complex that recruits the
           SWI/SNF and SAGA complexes to promoters
          Length = 974

 Score = 40.8 bits (94), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 29/126 (23%), Positives = 56/126 (44%), Gaps = 17/126 (13%)

Query: 354 FQKAIDLDPNMAAIYYHRGQMNFIIQKYEKAGEDFDKAKECDPTNIFPYIQLACMSYREG 413
             K++++DP+ A  +YH G+++ I   Y  A + F +A   D  N   +  +  + Y+  
Sbjct: 293 LSKSLEVDPSDATTWYHLGRVHMIRSDYTAAYDAFQQAVNRDSRNPIFWCSIGVLYYQIS 352

Query: 414 HFDDCETLFSEARRKFPDAPEVPNFFAEILSDKG--------EIEKAAAEYDKAIELESK 465
            + D    ++ A R  P       + +E+  D G        ++  A   Y +A  L+  
Sbjct: 353 QYRDALDAYTRAIRLNP-------YISEVWYDLGTLYETCNNQLTDALDAYKQAARLD-- 403

Query: 466 SENIHV 471
            EN+H+
Sbjct: 404 PENMHI 409

 Score = 38.1 bits (87), Expect = 0.077,   Method: Compositional matrix adjust.
 Identities = 21/83 (25%), Positives = 42/83 (50%), Gaps = 2/83 (2%)

Query: 93  GNAYFKVKDYENAINYYKFALQL-KNDPVFYSNMAACYISLEHNKEAIEACSKALELNPD 151
           G  +    DY  A + ++ A+     +P+F+ ++   Y  +   ++A++A ++A+ LNP 
Sbjct: 311 GRVHMIRSDYTAAYDAFQQAVNRDSRNPIFWCSIGVLYYQISQYRDALDAYTRAIRLNPY 370

Query: 152 YSKVLLKRAAVYENI-GKFADAL 173
            S+V      +YE    +  DAL
Sbjct: 371 ISEVWYDLGTLYETCNNQLTDAL 393

>TPHA0D03860 Chr4 (807913..808275) [363 bp, 120 aa] {ON} Anc_6.328
           YCR060W
          Length = 120

 Score = 37.7 bits (86), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 22/71 (30%), Positives = 35/71 (49%), Gaps = 1/71 (1%)

Query: 90  KKRGNAYFKVKDYENAINYYKFALQLK-NDPVFYSNMAACYISLEHNKEAIEACSKALEL 148
           K+ GN  FK   Y+ A   Y+  + ++  +P+ YSN A   I L    E +E C K L  
Sbjct: 7   KEEGNRNFKEGSYKVAAELYQKCVDIEPENPIGYSNKAMALIKLGRYTEVVELCRKGLTF 66

Query: 149 NPDYSKVLLKR 159
            P+ +  + K+
Sbjct: 67  TPNTTDTVYKK 77

>CAGL0D01364g Chr4 (152033..155479) [3447 bp, 1148 aa] {ON} similar
           to uniprot|P14922 Saccharomyces cerevisiae YBR112c CYC8
           general repressor of transcription
          Length = 1148

 Score = 40.4 bits (93), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 30/124 (24%), Positives = 56/124 (45%), Gaps = 17/124 (13%)

Query: 356 KAIDLDPNMAAIYYHRGQMNFIIQKYEKAGEDFDKAKECDPTNIFPYIQLACMSYREGHF 415
           K++++DP+ A  +YH G+++ I   Y  A + F +A   D  N   +  +  + Y+   +
Sbjct: 289 KSLEVDPSDATTWYHLGRVHMIRSDYTAAYDAFQQAVNRDSRNPIFWCSIGVLYYQISQY 348

Query: 416 DDCETLFSEARRKFPDAPEVPNFFAEILSDKG--------EIEKAAAEYDKAIELESKSE 467
            D    ++ A R  P       + +E+  D G        ++  A   Y +A  L+   E
Sbjct: 349 RDALDAYTRAIRLNP-------YISEVWYDLGTLYETCNNQLSDALDAYKQAARLD--PE 399

Query: 468 NIHV 471
           NIH+
Sbjct: 400 NIHI 403

 Score = 37.7 bits (86), Expect = 0.095,   Method: Compositional matrix adjust.
 Identities = 21/83 (25%), Positives = 44/83 (53%), Gaps = 2/83 (2%)

Query: 93  GNAYFKVKDYENAINYYKFALQLKN-DPVFYSNMAACYISLEHNKEAIEACSKALELNPD 151
           G  +    DY  A + ++ A+   + +P+F+ ++   Y  +   ++A++A ++A+ LNP 
Sbjct: 305 GRVHMIRSDYTAAYDAFQQAVNRDSRNPIFWCSIGVLYYQISQYRDALDAYTRAIRLNPY 364

Query: 152 YSKVLLKRAAVYENI-GKFADAL 173
            S+V      +YE    + +DAL
Sbjct: 365 ISEVWYDLGTLYETCNNQLSDAL 387

>Kwal_27.10740 s27 complement(476617..478503) [1887 bp, 628 aa] {ON}
           YBL084C (CDC27) - component of the anaphase-promoting
           complex [contig 33] FULL
          Length = 628

 Score = 40.0 bits (92), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 38/156 (24%), Positives = 64/156 (41%), Gaps = 1/156 (0%)

Query: 312 NDPLTARELVDEAIKLHP-RPKSYIYLGLLMADKGLDEEYYSNFQKAIDLDPNMAAIYYH 370
           ND      L  E ++++   P+++  +G L + K   EE    FQ++  LDP+    Y  
Sbjct: 390 NDTTGLSHLCHELLEVNRLAPETWCCIGNLFSLKKDHEESIKAFQRSTQLDPSFTYAYTL 449

Query: 371 RGQMNFIIQKYEKAGEDFDKAKECDPTNIFPYIQLACMSYREGHFDDCETLFSEARRKFP 430
           +G        ++ A   + KA   +  +   Y  L   S + G +++C   F +AR   P
Sbjct: 450 QGHEYSSNDAFDTAMTCYRKALASNSQHYNAYYGLGMCSLKLGQYEECLLHFEKARSINP 509

Query: 431 DAPEVPNFFAEILSDKGEIEKAAAEYDKAIELESKS 466
               +       L      E+A   YD A EL+  S
Sbjct: 510 VNVILICCCGVALEKLSHQERALQNYDLACELQPMS 545

 Score = 34.3 bits (77), Expect = 0.97,   Method: Compositional matrix adjust.
 Identities = 25/84 (29%), Positives = 41/84 (48%), Gaps = 5/84 (5%)

Query: 93  GNAYFKVKDYENAINYYKFALQLKNDPVFYSNMAACYISLE---HNKEAIEACSKALELN 149
           G    K+  YE  + +++ A  +  +PV    +  C ++LE   H + A++    A EL 
Sbjct: 485 GMCSLKLGQYEECLLHFEKARSI--NPVNVILICCCGVALEKLSHQERALQNYDLACELQ 542

Query: 150 PDYSKVLLKRAAVYENIGKFADAL 173
           P  S  L KRA +   +GK+  AL
Sbjct: 543 PMSSLALFKRAQLLLAMGKYNYAL 566

>YGR123C Chr7 complement(736662..738203) [1542 bp, 513 aa] {ON}
           PPT1Protein serine/threonine phosphatase, regulates
           Hsp90 chaperone by affecting its ATPase and cochaperone
           binding activities; has similarity to human phosphatase
           PP5; present in both the nucleus and cytoplasm;
           expressed during logarithmic growth
          Length = 513

 Score = 40.0 bits (92), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 29/102 (28%), Positives = 49/102 (48%), Gaps = 1/102 (0%)

Query: 79  TAEKNEYASELKKRGNAYFKVKDYENAINYYKFALQL-KNDPVFYSNMAACYISLEHNKE 137
           TA     A E K  GN + K K +  AI  Y  A+ L     +++SN A  +  +++ + 
Sbjct: 5   TAADRAKALERKNEGNVFVKEKHFLKAIEKYTEAIDLDSTQSIYFSNRAFAHFKVDNFQS 64

Query: 138 AIEACSKALELNPDYSKVLLKRAAVYENIGKFADALLDLTAV 179
           A+  C +A++L+P   K   +RA     + +F  A  DL  +
Sbjct: 65  ALNDCDEAIKLDPKNIKAYHRRALSCMALLEFKKARKDLNVL 106

 Score = 35.0 bits (79), Expect = 0.53,   Method: Compositional matrix adjust.
 Identities = 20/61 (32%), Positives = 34/61 (55%), Gaps = 2/61 (3%)

Query: 354 FQKAIDLDPNMAAIYYHRGQMNFIIQKYEKAGEDFDKAKECDPTNIFPYIQ--LACMSYR 411
           + +AIDLD   +  + +R   +F +  ++ A  D D+A + DP NI  Y +  L+CM+  
Sbjct: 35  YTEAIDLDSTQSIYFSNRAFAHFKVDNFQSALNDCDEAIKLDPKNIKAYHRRALSCMALL 94

Query: 412 E 412
           E
Sbjct: 95  E 95

>KLTH0C06204g Chr3 complement(538533..540416) [1884 bp, 627 aa] {ON}
           some similarities with uniprot|P38042 Saccharomyces
           cerevisiae YBL084C CDC27 Subunit of the
           Anaphase-Promoting Complex/Cyclosome (APC/C) which is a
           ubiquitin-protein ligase required for degradation of
           anaphase inhibitors including mitotic cyclins during the
           metaphase/anaphase transition
          Length = 627

 Score = 39.7 bits (91), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 34/136 (25%), Positives = 56/136 (41%)

Query: 331 PKSYIYLGLLMADKGLDEEYYSNFQKAIDLDPNMAAIYYHRGQMNFIIQKYEKAGEDFDK 390
           P+++  +G L + K   EE    FQ++  LDP+    Y  +G        ++ A   + K
Sbjct: 409 PETWCCIGNLFSLKKDHEESIKAFQRSTQLDPSFTYAYTLQGHEYSSNDAFDTAMTCYRK 468

Query: 391 AKECDPTNIFPYIQLACMSYREGHFDDCETLFSEARRKFPDAPEVPNFFAEILSDKGEIE 450
           A   +P +   +  L     + G +++C   F +AR   P    +       L      E
Sbjct: 469 ALGSNPQHYNAHYGLGMCCLKLGQYEECLLHFEKARSINPVNVILICCCGVALEKLSHQE 528

Query: 451 KAAAEYDKAIELESKS 466
           KA   YD A EL+  S
Sbjct: 529 KALQYYDLACELQPVS 544

 Score = 34.7 bits (78), Expect = 0.74,   Method: Compositional matrix adjust.
 Identities = 25/84 (29%), Positives = 42/84 (50%), Gaps = 5/84 (5%)

Query: 93  GNAYFKVKDYENAINYYKFALQLKNDPVFYSNMAACYISLE---HNKEAIEACSKALELN 149
           G    K+  YE  + +++ A  +  +PV    +  C ++LE   H ++A++    A EL 
Sbjct: 484 GMCCLKLGQYEECLLHFEKARSI--NPVNVILICCCGVALEKLSHQEKALQYYDLACELQ 541

Query: 150 PDYSKVLLKRAAVYENIGKFADAL 173
           P  S  L KRA +   +GK+  AL
Sbjct: 542 PVSSLALFKRAQLLLAMGKYNFAL 565

>Skud_4.506 Chr4 (905143..906978) [1836 bp, 611 aa] {ON} YDR244W
           (REAL)
          Length = 611

 Score = 39.7 bits (91), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 31/114 (27%), Positives = 56/114 (49%), Gaps = 16/114 (14%)

Query: 93  GNAYFKVKDYENAINYYKFALQLK-NDPVFYSNMAACYISLEHNKEAIEACSKALELNPD 151
           G  ++   D++  I+ ++ AL++  ND + ++ + A   +   ++EAI+A  +AL+L P 
Sbjct: 464 GLLFYTKDDFDKTIDCFESALKVNPNDELMWNRLGASLANSNRSEEAIQAYHRALQLKPS 523

Query: 152 YSKVLLKRAAVYENIGKFADA------LLDLTAVSLN--GD-------YNDATI 190
           + +     A    NIG   +A      +L +  V+ N  GD       YNDA I
Sbjct: 524 FVRARYNLAVSSMNIGCLKEAAGYLLSVLSMHEVNTNKKGDVGSLLNTYNDAVI 577

>KNAG0B02240 Chr2 complement(434466..436685) [2220 bp, 739 aa] {ON}
           Anc_7.412 YBL084C
          Length = 739

 Score = 39.3 bits (90), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 52/192 (27%), Positives = 78/192 (40%), Gaps = 38/192 (19%)

Query: 363 NMAAIYYHRGQMNFIIQKYEKAGE------DFDKAKECDPTNIFPYIQLACMSYREGHFD 416
           NM       G++++ I  Y    E       F   +   P N F   QL        H  
Sbjct: 450 NMPWCQAQMGKLHYEISNYGIVAEILPELTKFPTYENEGPGNFF---QLLLW-----HLR 501

Query: 417 DCETLFS---EARRKFPDAPE----VPNFFAEILSDKGEIEKAAAEYDKAIELESKSENI 469
           D  TLF+   E    FP+APE    V N+F+ ++ D GE  KA   ++KA  L+ K    
Sbjct: 502 DKFTLFNLSDELMNSFPEAPETWCVVGNYFS-LIKDHGEAIKA---FEKATSLDRK---- 553

Query: 470 HVGIAPLVGKATTLL--KYPTVENFIEADDLFEQANNEDPRSEKAKMGLAQCKLQQEDLD 527
                     A TL   ++   E +  A  ++ +A   DP+   A  GL  C  +    D
Sbjct: 554 -------FAYAYTLQGHEHAANETYDTAKIMYRKAIACDPQHYNAYYGLGDCASRLGKYD 606

Query: 528 DAIRLFEEAAIL 539
            A+  FE+A ++
Sbjct: 607 KALLYFEKARVI 618

 Score = 38.9 bits (89), Expect = 0.039,   Method: Compositional matrix adjust.
 Identities = 36/125 (28%), Positives = 54/125 (43%), Gaps = 7/125 (5%)

Query: 306 ILSFLKNDPLTARELVDEAIKLHPR-PKSYIYLG---LLMADKGLDEEYYSNFQKAIDLD 361
           +L +   D  T   L DE +   P  P+++  +G    L+ D G   E    F+KA  LD
Sbjct: 495 LLLWHLRDKFTLFNLSDELMNSFPEAPETWCVVGNYFSLIKDHG---EAIKAFEKATSLD 551

Query: 362 PNMAAIYYHRGQMNFIIQKYEKAGEDFDKAKECDPTNIFPYIQLACMSYREGHFDDCETL 421
              A  Y  +G  +   + Y+ A   + KA  CDP +   Y  L   + R G +D     
Sbjct: 552 RKFAYAYTLQGHEHAANETYDTAKIMYRKAIACDPQHYNAYYGLGDCASRLGKYDKALLY 611

Query: 422 FSEAR 426
           F +AR
Sbjct: 612 FEKAR 616

 Score = 35.0 bits (79), Expect = 0.60,   Method: Compositional matrix adjust.
 Identities = 40/174 (22%), Positives = 71/174 (40%), Gaps = 16/174 (9%)

Query: 354 FQKAIDLDPNMAAIYYHRGQMNFIIQKYEKAGEDFDKAKECDPTNIFPYIQLACM--SYR 411
           ++KAI  DP     YY  G     + KY+KA   F+KA+  +P N    I + C   S  
Sbjct: 578 YRKAIACDPQHYNAYYGLGDCASRLGKYDKALLYFEKARVINPVNA---ILICCCGHSLE 634

Query: 412 EGHFDDCETLFSEARRKFPDAPEVPNF-FAEILSDKGEIEKAAAEYDKAIELESKSENIH 470
           + +  D    + E   K      +P +  A++L   G+   A   ++   +L  +   +H
Sbjct: 635 KLNLPDQALTYYELAEKLQPEMTIPKYKKAQLLFSLGKFSSAMYIFESLTKLSPEEVTVH 694

Query: 471 VGIAPLVGKATTLLKYPTVENFIEADDLFEQANNEDPRSEKAKM-GLAQCKLQQ 523
             +  +         Y T+    +A   +  A N DP   +  +  L +C +Q+
Sbjct: 695 FMLGQI---------YQTMGRKKDAIKEYTIALNLDPMGNQVIIDALQKCHIQE 739

>Smik_6.215 Chr6 complement(354154..355695) [1542 bp, 513 aa] {ON}
           YGR123C (REAL)
          Length = 513

 Score = 39.3 bits (90), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 29/102 (28%), Positives = 49/102 (48%), Gaps = 1/102 (0%)

Query: 79  TAEKNEYASELKKRGNAYFKVKDYENAINYYKFALQL-KNDPVFYSNMAACYISLEHNKE 137
           TA     A E K  GN + K K +  AI  Y  A+ L     +++SN A  +  +++ + 
Sbjct: 5   TASDCAKALERKNEGNVFVKEKHFLKAIEKYTEAIDLDATQSIYFSNRAFAHFKVDNFQS 64

Query: 138 AIEACSKALELNPDYSKVLLKRAAVYENIGKFADALLDLTAV 179
           A+  C +A++L+P   K   +RA     + +F  A  DL  +
Sbjct: 65  ALNDCDEAIKLDPKNIKAYHRRALSCMALLEFKKAKKDLNVL 106

 Score = 35.0 bits (79), Expect = 0.56,   Method: Compositional matrix adjust.
 Identities = 20/61 (32%), Positives = 34/61 (55%), Gaps = 2/61 (3%)

Query: 354 FQKAIDLDPNMAAIYYHRGQMNFIIQKYEKAGEDFDKAKECDPTNIFPYIQ--LACMSYR 411
           + +AIDLD   +  + +R   +F +  ++ A  D D+A + DP NI  Y +  L+CM+  
Sbjct: 35  YTEAIDLDATQSIYFSNRAFAHFKVDNFQSALNDCDEAIKLDPKNIKAYHRRALSCMALL 94

Query: 412 E 412
           E
Sbjct: 95  E 95

>Kwal_27.11737 s27 (926622..928349) [1728 bp, 575 aa] {ON} YDR244W
           (PEX5) - 1:1 [contig 27] FULL
          Length = 575

 Score = 39.3 bits (90), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 24/92 (26%), Positives = 51/92 (55%), Gaps = 2/92 (2%)

Query: 93  GNAYFKVKDYENAINYYKFALQLK-NDPVFYSNMAACYISLEHNKEAIEACSKALELNPD 151
           G  ++   DY+  ++ ++ AL ++ +D + ++ + A   +   ++EAI+A  KAL+L P 
Sbjct: 433 GILFYSNDDYDKTVDCFRAALAVRPDDELMWNRLGASLANSNRSEEAIQAYRKALQLKPT 492

Query: 152 YSKVLLKRAAVYENIGKFADAL-LDLTAVSLN 182
           + +     A    N+G + +A    LTA+S++
Sbjct: 493 FVRARCNLAVSCMNMGCYKEAAEYLLTALSMH 524

>ZYRO0B03828g Chr2 (318153..320336) [2184 bp, 727 aa] {ON} similar
           to uniprot|P38042 Saccharomyces cerevisiae YBL084C CDC27
           Subunit of the Anaphase-Promoting Complex/Cyclosome
           (APC/C) which is a ubiquitin-protein ligase required for
           degradation of anaphase inhibitors including mitotic
           cyclins during the metaphase/anaphase transition
          Length = 727

 Score = 39.3 bits (90), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 40/164 (24%), Positives = 69/164 (42%), Gaps = 17/164 (10%)

Query: 312 NDPLTARELVDEAIKLHP-RPKSYIYLGLLMADKGLDEEYYSNFQKAIDLDPNMAAIYYH 370
           +D +    L +E ++  P +P+++  LG L + +   +E    F+KA ++DP+ A     
Sbjct: 489 HDKINLSHLSNELLETQPDKPQTWCSLGNLYSLQRDHDEAIRYFEKATEVDPHFA----- 543

Query: 371 RGQMNFIIQKYEKAGED-FDKAKEC-------DPTNIFPYIQLACMSYREGHFDDCETLF 422
                + +Q +E +  D  D AK C       DP +   Y  L     + G +++    F
Sbjct: 544 ---YGYTLQGHEHSSNDSIDMAKTCYRKAIASDPQHYNAYYGLGMCCMKLGQYEEALLYF 600

Query: 423 SEARRKFPDAPEVPNFFAEILSDKGEIEKAAAEYDKAIELESKS 466
            +AR   P    +       L      EKA   Y+ A EL+  S
Sbjct: 601 EKARSINPVNVILICCCGVALEKMSYQEKALQYYELASELQPSS 644

>TBLA0A07270 Chr1 complement(1811640..1812761) [1122 bp, 373 aa]
           {ON} Anc_6.21 YOR007C
          Length = 373

 Score = 38.9 bits (89), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 27/107 (25%), Positives = 53/107 (49%), Gaps = 7/107 (6%)

Query: 74  MKLAETAEKN------EYASELKKRGNAYFKVKDYENAINYYKFAL-QLKNDPVFYSNMA 126
           + L +T++ N      + A   K  GN     +DY+ AI  Y  A+ +   DP++YSN +
Sbjct: 119 INLNDTSKNNFSDKDKQIADTFKDEGNRLMFSEDYKKAIECYTNAISKYPCDPIYYSNRS 178

Query: 127 ACYISLEHNKEAIEACSKALELNPDYSKVLLKRAAVYENIGKFADAL 173
             Y+ +   + AI   +  + ++ ++SK  ++ A +     ++ DAL
Sbjct: 179 VAYLKVNDYESAINDANFCISIDANFSKAYIRLANIKVQQHQYIDAL 225

>TDEL0B01660 Chr2 complement(295823..297472) [1650 bp, 549 aa] {ON}
           Anc_8.470 YDR244W
          Length = 549

 Score = 38.9 bits (89), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 40/152 (26%), Positives = 71/152 (46%), Gaps = 19/152 (12%)

Query: 93  GNAYFKVKDYENAINYYKFALQLK-NDPVFYSNMAACYISLEHNKEAIEACSKALELNPD 151
           G  ++   +++  I+ +K AL +  ND + ++ + A   +   ++EAI+A  KAL+L P 
Sbjct: 403 GLLFYADSEFDKTIDCFKAALSVNPNDELMWNRLGASLANSNRSEEAIQAYYKALQLKPS 462

Query: 152 YSKVLLKRAAVYENIGKFADA---------LLDLTAVSLNGDYNDATIQPIVERVLNKQA 202
           + +     A    NIG + +A         + ++  VS NG  N  +    +   L K+A
Sbjct: 463 FVRARYNLAVSSINIGCYKEAAEYLLSALKMHEVEGVSQNGTANPVSGNNNILETL-KRA 521

Query: 203 MMAL--KDHLEASEKNKVLPSYTSMAAFFGVF 232
            +A+  +D LE     KV P    +  F G F
Sbjct: 522 FVAMDRRDLLE-----KVQPG-MDLEQFRGDF 547

>CAGL0H07095g Chr8 (700262..702247) [1986 bp, 661 aa] {ON} similar
           to uniprot|Q06677 Saccharomyces cerevisiae YDR320c SWA2
          Length = 661

 Score = 38.9 bits (89), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 30/113 (26%), Positives = 52/113 (46%), Gaps = 26/113 (23%)

Query: 87  SELKKRGNAYFKVKDYENAINYYKFALQL--KNDP---VFYSNMAACYISLEHNKEAIEA 141
           +E K RG  YFK  DY +A+  Y+ +L       P   + YSN+ A  I +  + +++  
Sbjct: 363 NEFKARGTDYFKNGDYASAVEEYEKSLNTLPMKHPLRIIAYSNIIASRIKIGQHSQSVVD 422

Query: 142 CSKALELNPD---------------------YSKVLLKRAAVYENIGKFADAL 173
             +A++L P+                     + K++L++A  YE I K+  AL
Sbjct: 423 AQEAMKLLPEEKSLWTAAIQNSDPVRSYNDIWPKIILRQAESYEAIEKYKLAL 475

>Ecym_1396 Chr1 (820413..822134) [1722 bp, 573 aa] {ON} similar to
           Ashbya gossypii AFR453W
          Length = 573

 Score = 38.9 bits (89), Expect = 0.038,   Method: Compositional matrix adjust.
 Identities = 24/92 (26%), Positives = 50/92 (54%), Gaps = 2/92 (2%)

Query: 93  GNAYFKVKDYENAINYYKFALQLK-NDPVFYSNMAACYISLEHNKEAIEACSKALELNPD 151
           G  ++   +++  I+ +K AL ++ ND   ++ + A   +   ++EAI+A  +A++L P 
Sbjct: 428 GVLFYANDEFDKTIDCFKAALHVRPNDECMWNRLGASLANSNRSEEAIQAYHRAIQLKPA 487

Query: 152 YSKVLLKRAAVYENIGKFADALLD-LTAVSLN 182
           + +     A    NIG + +A    LTA+S++
Sbjct: 488 FVRARYNLAVSSMNIGCYKEAAEQLLTALSMH 519

>Kpol_172.2 s172 (4270..5523) [1254 bp, 418 aa] {ON} (4270..5523)
           [1254 nt, 418 aa]
          Length = 418

 Score = 38.5 bits (88), Expect = 0.039,   Method: Compositional matrix adjust.
 Identities = 22/91 (24%), Positives = 42/91 (46%), Gaps = 7/91 (7%)

Query: 359 DLDPNMAAIYYHRGQMNFIIQKYEKAGEDFDKAKECDPTNIFPYIQLACMSYREGHFDDC 418
           ++DP+ AA +YH G+++ I   Y  A + F +A   D  N   +  +  + Y+   + D 
Sbjct: 307 EIDPSDAATWYHLGRVHMIRTDYTAAYDAFQQAVNRDSRNPIFWCSIGVLYYQISQYRDA 366

Query: 419 ETLFSEARRKFPDAPEVPNFFAEILSDKGEI 449
              ++ A R  P       + +E+  D G +
Sbjct: 367 LDAYTRAIRLNP-------YISEVWYDLGTL 390

 Score = 38.1 bits (87), Expect = 0.055,   Method: Compositional matrix adjust.
 Identities = 22/90 (24%), Positives = 45/90 (50%), Gaps = 2/90 (2%)

Query: 86  ASELKKRGNAYFKVKDYENAINYYKFALQL-KNDPVFYSNMAACYISLEHNKEAIEACSK 144
           A+     G  +    DY  A + ++ A+     +P+F+ ++   Y  +   ++A++A ++
Sbjct: 313 AATWYHLGRVHMIRTDYTAAYDAFQQAVNRDSRNPIFWCSIGVLYYQISQYRDALDAYTR 372

Query: 145 ALELNPDYSKVLLKRAAVYENI-GKFADAL 173
           A+ LNP  S+V      +YE    + +DAL
Sbjct: 373 AIRLNPYISEVWYDLGTLYETCNNQLSDAL 402

 Score = 36.2 bits (82), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 24/87 (27%), Positives = 42/87 (48%), Gaps = 6/87 (6%)

Query: 93  GNAYFKVKDYENAINYYK---FALQLKNDPVFYSNMAACYISLEHNKEAIEACSKALELN 149
           G+ Y  + D + A N Y+   + L   N P  +  +   Y      + A EA +K LEL+
Sbjct: 138 GHCYLMLDDLQRAYNAYQQALYHLSNPNVPKLWHGIGILYDRYGSLEYAEEAFAKVLELD 197

Query: 150 PDYSK---VLLKRAAVYENIGKFADAL 173
           P++ K   +  +   +Y++ GK+  AL
Sbjct: 198 PNFEKANEIYFRLGIIYKHQGKWTQAL 224

 Score = 32.0 bits (71), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 23/98 (23%), Positives = 41/98 (41%), Gaps = 9/98 (9%)

Query: 439 FAEILSDKGEIEKAAAEYDKAIELESKSENIHVGIAPLVGKATTLLKYPTVENFIEADDL 498
            A +    G+ ++AA  YD  ++    S      +A L         Y + + F  A +L
Sbjct: 69  IASLAETVGDTDRAALAYDATLQYNQSSTKALTSLANL---------YRSRDMFQRAAEL 119

Query: 499 FEQANNEDPRSEKAKMGLAQCKLQQEDLDDAIRLFEEA 536
           +E+A + +P        L  C L  +DL  A   +++A
Sbjct: 120 YERALSVNPELSDVWATLGHCYLMLDDLQRAYNAYQQA 157

>KAFR0H00870 Chr8 (162118..164781) [2664 bp, 887 aa] {ON} Anc_3.367
           YBR112C
          Length = 887

 Score = 38.9 bits (89), Expect = 0.042,   Method: Compositional matrix adjust.
 Identities = 22/94 (23%), Positives = 44/94 (46%), Gaps = 7/94 (7%)

Query: 356 KAIDLDPNMAAIYYHRGQMNFIIQKYEKAGEDFDKAKECDPTNIFPYIQLACMSYREGHF 415
           K++++DP+ A  +YH G+++ I   Y  A + F +A   D  N   +  +  + Y+   +
Sbjct: 295 KSLEVDPSDATTWYHLGRVHMIRSDYTAAYDAFQQAVNRDSRNPIFWCSIGVLYYQISQY 354

Query: 416 DDCETLFSEARRKFPDAPEVPNFFAEILSDKGEI 449
            D    ++ A R  P       + +E+  D G +
Sbjct: 355 RDALDAYTRAIRLNP-------YISEVWYDLGTL 381

 Score = 37.0 bits (84), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 21/83 (25%), Positives = 42/83 (50%), Gaps = 2/83 (2%)

Query: 93  GNAYFKVKDYENAINYYKFALQL-KNDPVFYSNMAACYISLEHNKEAIEACSKALELNPD 151
           G  +    DY  A + ++ A+     +P+F+ ++   Y  +   ++A++A ++A+ LNP 
Sbjct: 311 GRVHMIRSDYTAAYDAFQQAVNRDSRNPIFWCSIGVLYYQISQYRDALDAYTRAIRLNPY 370

Query: 152 YSKVLLKRAAVYENI-GKFADAL 173
            S+V      +YE    +  DAL
Sbjct: 371 ISEVWYDLGTLYETCNNQLTDAL 393

>AFR663W Chr6 (1648116..1651232) [3117 bp, 1038 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YGR047C (TFC4)
          Length = 1038

 Score = 38.5 bits (88), Expect = 0.050,   Method: Compositional matrix adjust.
 Identities = 22/85 (25%), Positives = 42/85 (49%), Gaps = 1/85 (1%)

Query: 90  KKRGNAYFKVKDYENAINYYKFALQLK-NDPVFYSNMAACYISLEHNKEAIEACSKALEL 148
           K  G+ Y     Y +  N +  A  L  +D  F+  +A     L+H ++A+   S+A+ +
Sbjct: 164 KTLGDIYHLQGRYNDCCNSWFLAAHLNPSDWEFWKMVATLSSELKHIRQAVYCYSRAISM 223

Query: 149 NPDYSKVLLKRAAVYENIGKFADAL 173
           NP   + +  RA +Y++ G+   +L
Sbjct: 224 NPQEWECIYSRAMLYKDTGQLGRSL 248

>Skud_7.432 Chr7 complement(715852..717393) [1542 bp, 513 aa] {ON}
           YGR123C (REAL)
          Length = 513

 Score = 38.5 bits (88), Expect = 0.051,   Method: Compositional matrix adjust.
 Identities = 27/95 (28%), Positives = 46/95 (48%), Gaps = 1/95 (1%)

Query: 86  ASELKKRGNAYFKVKDYENAINYYKFALQL-KNDPVFYSNMAACYISLEHNKEAIEACSK 144
           A E K  GN   K K +  AI  Y  A+ L     +++SN A  +  +++ + A+  C +
Sbjct: 12  AHERKNEGNVLVKEKHFLKAIEKYTEAIDLDSTQTIYFSNRALSHFKVDNFQSALNDCDE 71

Query: 145 ALELNPDYSKVLLKRAAVYENIGKFADALLDLTAV 179
           A++L+P   K   +RA     + +F  A  DL  +
Sbjct: 72  AIKLDPKNIKAYHRRALSCMALLEFKKAKRDLNVL 106

 Score = 35.0 bits (79), Expect = 0.50,   Method: Compositional matrix adjust.
 Identities = 20/61 (32%), Positives = 33/61 (54%), Gaps = 2/61 (3%)

Query: 354 FQKAIDLDPNMAAIYYHRGQMNFIIQKYEKAGEDFDKAKECDPTNIFPYIQ--LACMSYR 411
           + +AIDLD      + +R   +F +  ++ A  D D+A + DP NI  Y +  L+CM+  
Sbjct: 35  YTEAIDLDSTQTIYFSNRALSHFKVDNFQSALNDCDEAIKLDPKNIKAYHRRALSCMALL 94

Query: 412 E 412
           E
Sbjct: 95  E 95

>Suva_2.410 Chr2 (729992..731827) [1836 bp, 611 aa] {ON} YDR244W
           (REAL)
          Length = 611

 Score = 38.5 bits (88), Expect = 0.052,   Method: Compositional matrix adjust.
 Identities = 29/114 (25%), Positives = 56/114 (49%), Gaps = 16/114 (14%)

Query: 93  GNAYFKVKDYENAINYYKFALQLK-NDPVFYSNMAACYISLEHNKEAIEACSKALELNPD 151
           G  ++   D++  I+ ++ AL++  ND + ++ + A   +   ++EAI+A  +AL+L P 
Sbjct: 464 GLLFYTKDDFDKTIDCFESALKVNPNDELMWNRLGASLANSNRSEEAIQAYHRALQLKPS 523

Query: 152 YSKVLLKRAAVYENIGKFADA---LLDLTAV------------SLNGDYNDATI 190
           + +     A    NIG + +A   LL + ++            SL   YND+ I
Sbjct: 524 FVRARYNLAVSSMNIGCYKEAAGYLLTVLSMHEVDTKKKGDLGSLLNTYNDSVI 577

>Suva_4.361 Chr4
           complement(631697..632812,632933..633154,633188..634741)
           [2892 bp, 963 aa] {ON} YBR112C (REAL)
          Length = 963

 Score = 38.5 bits (88), Expect = 0.052,   Method: Compositional matrix adjust.
 Identities = 29/124 (23%), Positives = 54/124 (43%), Gaps = 17/124 (13%)

Query: 356 KAIDLDPNMAAIYYHRGQMNFIIQKYEKAGEDFDKAKECDPTNIFPYIQLACMSYREGHF 415
           K+++ DP+ A  +YH G+++ I   Y  A + F +A   D  N   +  +  + Y+   +
Sbjct: 291 KSLEADPSDATTWYHLGRVHMIRTDYTAAYDAFQQAVNRDSRNPIFWCSIGVLYYQISQY 350

Query: 416 DDCETLFSEARRKFPDAPEVPNFFAEILSDKG--------EIEKAAAEYDKAIELESKSE 467
            D    ++ A R  P       + +E+  D G        ++  A   Y +A  L+    
Sbjct: 351 RDALDAYTRAIRLNP-------YISEVWYDLGTLYETCNNQLSDALDAYKQAARLDVN-- 401

Query: 468 NIHV 471
           NIH+
Sbjct: 402 NIHI 405

 Score = 38.1 bits (87), Expect = 0.061,   Method: Compositional matrix adjust.
 Identities = 21/83 (25%), Positives = 43/83 (51%), Gaps = 2/83 (2%)

Query: 93  GNAYFKVKDYENAINYYKFALQL-KNDPVFYSNMAACYISLEHNKEAIEACSKALELNPD 151
           G  +    DY  A + ++ A+     +P+F+ ++   Y  +   ++A++A ++A+ LNP 
Sbjct: 307 GRVHMIRTDYTAAYDAFQQAVNRDSRNPIFWCSIGVLYYQISQYRDALDAYTRAIRLNPY 366

Query: 152 YSKVLLKRAAVYENI-GKFADAL 173
            S+V      +YE    + +DAL
Sbjct: 367 ISEVWYDLGTLYETCNNQLSDAL 389

>ZYRO0A02926g Chr1 complement(238036..239769) [1734 bp, 577 aa] {ON}
           similar to uniprot|P35056 Saccharomyces cerevisiae
           YDR244W PEX5 Essential for import of proteins with SKL-
           like import signal into peroxisomal matrix 69-kDa
           protein containing tetratricopeptide repeat (TPR)
          Length = 577

 Score = 38.1 bits (87), Expect = 0.060,   Method: Compositional matrix adjust.
 Identities = 27/89 (30%), Positives = 49/89 (55%), Gaps = 3/89 (3%)

Query: 97  FKVKD-YENAINYYKFALQLK-NDPVFYSNMAACYISLEHNKEAIEACSKALELNPDYSK 154
           F V D ++  I+ +K AL +  ND + ++ + A   +   ++EAI+A  +AL+L P + +
Sbjct: 436 FYVDDQFDKTIDCFKAALSVNSNDELMWNRLGASLANSSRSEEAIQAYHRALQLKPSFVR 495

Query: 155 VLLKRAAVYENIGKFADALLD-LTAVSLN 182
                A    NIG + +A    LTA+S++
Sbjct: 496 ARYNLAVSSINIGCYKEAAEHLLTALSMH 524

>Kpol_1031.64 s1031 (161135..162958) [1824 bp, 607 aa] {ON}
           (161135..162958) [1824 nt, 608 aa]
          Length = 607

 Score = 38.1 bits (87), Expect = 0.064,   Method: Compositional matrix adjust.
 Identities = 26/91 (28%), Positives = 49/91 (53%), Gaps = 2/91 (2%)

Query: 93  GNAYFKVKDYENAINYYKFALQLK-NDPVFYSNMAACYISLEHNKEAIEACSKALELNPD 151
           G  ++   +++  I+ +K AL++  ND + ++ + A   +   ++EAI+A  KAL L P 
Sbjct: 457 GLLFYSNNEFDKTIDCFKAALKVSPNDELLWNRLGASLANSNRSEEAIQAYHKALNLKPS 516

Query: 152 YSKVLLKRAAVYENIGKFADAL-LDLTAVSL 181
           + +     A    NIG + +A    LTA+S+
Sbjct: 517 FVRARYNLAVSSINIGCYKEAAQYLLTALSM 547

>TDEL0E02750 Chr5 (529920..531614) [1695 bp, 564 aa] {ON} Anc_5.352
           YDR320C
          Length = 564

 Score = 38.1 bits (87), Expect = 0.066,   Method: Compositional matrix adjust.
 Identities = 32/133 (24%), Positives = 53/133 (39%), Gaps = 34/133 (25%)

Query: 88  ELKKRGNAYFKVKDYENAINYYK---------FALQLKNDPVFYSNMAACYISLEHNKEA 138
           E K RG  +FK  DY +A   Y+          AL++    V YSN+ A    +   K  
Sbjct: 275 EYKDRGTEFFKAGDYVSASQEYEKSLNSLPQNHALRI----VAYSNLTAALFKVGEYKRC 330

Query: 139 IEACSKALELNPD---------------------YSKVLLKRAAVYENIGKFADALLDLT 177
           +     ALE+ P                      + K++ +RA  +E+I  +  AL D  
Sbjct: 331 LSDIESALEMFPKDPNLWDEPIQDSQPIRTFKEMWPKIVTRRAEAFEHIENYERALQDYQ 390

Query: 178 AVSLNGDYNDATI 190
           ++    ++ND  +
Sbjct: 391 SLIEKNNFNDKIM 403

>NCAS0E02490 Chr5 complement(493779..496208) [2430 bp, 809 aa] {ON}
           Anc_7.412 YBL084C
          Length = 809

 Score = 38.1 bits (87), Expect = 0.066,   Method: Compositional matrix adjust.
 Identities = 32/137 (23%), Positives = 56/137 (40%)

Query: 330 RPKSYIYLGLLMADKGLDEEYYSNFQKAIDLDPNMAAIYYHRGQMNFIIQKYEKAGEDFD 389
           +P+++  +G L + +   +E    F KA  LDPN    Y  +G     +  Y+ A   + 
Sbjct: 589 KPETWCAVGNLFSLQKDHDEAIRAFDKATKLDPNFVYAYTLQGHEYLSMDSYDTAKTFYR 648

Query: 390 KAKECDPTNIFPYIQLACMSYREGHFDDCETLFSEARRKFPDAPEVPNFFAEILSDKGEI 449
           KA   D  +   Y  +   S + G ++     F +AR   P    +       +   G  
Sbjct: 649 KAISNDLHHYNAYYGMGMCSMKLGEYEQALVYFEKARSINPSNAILICCCGVTMEKLGNQ 708

Query: 450 EKAAAEYDKAIELESKS 466
           EKA   Y+ A +++  S
Sbjct: 709 EKALNYYELACQIQPTS 725

 Score = 33.1 bits (74), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 37/176 (21%), Positives = 74/176 (42%), Gaps = 13/176 (7%)

Query: 363 NMAAIYYHRGQMNFIIQKYEKAGEDFDKAKECDPTNIFPYIQLACMSYREGHFDDCETLF 422
           NM       G+++F I  Y+ + + F K +   PT I      + + +      +   L 
Sbjct: 520 NMPWCQAQLGKLHFEIVNYKTSLKYFKKLRLLQPTRIKDLETFSTLLWHLHDKTNLTDLS 579

Query: 423 SEARRKFPDAPEVPNFFAEILSDKGEIEKAAAEYDKAIELESKSENIHVGIAPLVGKATT 482
           +    +F D PE       + S + + ++A   +DKA +L+           P    A T
Sbjct: 580 NILMDEFRDKPETWCAVGNLFSLQKDHDEAIRAFDKATKLD-----------PNFVYAYT 628

Query: 483 LL--KYPTVENFIEADDLFEQANNEDPRSEKAKMGLAQCKLQQEDLDDAIRLFEEA 536
           L   +Y +++++  A   + +A + D     A  G+  C ++  + + A+  FE+A
Sbjct: 629 LQGHEYLSMDSYDTAKTFYRKAISNDLHHYNAYYGMGMCSMKLGEYEQALVYFEKA 684

>YDR320C Chr4 complement(1106095..1108101) [2007 bp, 668 aa] {ON}
           SWA2Auxilin-like protein involved in vesicular
           transport; clathrin-binding protein required for
           uncoating of clathrin-coated vesicles
          Length = 668

 Score = 38.1 bits (87), Expect = 0.067,   Method: Compositional matrix adjust.
 Identities = 30/113 (26%), Positives = 51/113 (45%), Gaps = 26/113 (23%)

Query: 87  SELKKRGNAYFKVKDYENAINYYKFALQLK--NDP---VFYSNMAACYISLEHNKEAIEA 141
           +E K +G + FK  DY N++  Y+ +L     N P   +  SN+ A  + +    ++IE 
Sbjct: 375 NEFKAKGTSLFKNGDYINSLQEYEKSLNTLPLNHPLRIIALSNIIASQLKIGEYSKSIEN 434

Query: 142 CSKALELNPD---------------------YSKVLLKRAAVYENIGKFADAL 173
            S ALEL P                      + K++++RA  +E++  F  AL
Sbjct: 435 SSMALELFPSSKAKWKNKISNSDPERSFNDIWPKIMIRRAESFEHLESFKKAL 487

>CAGL0K11209g Chr11 (1089300..1091072) [1773 bp, 590 aa] {ON}
           similar to uniprot|P35056 Saccharomyces cerevisiae
           YDR244w PAS10 peroxisomal targeting signal receptor
          Length = 590

 Score = 38.1 bits (87), Expect = 0.067,   Method: Compositional matrix adjust.
 Identities = 24/91 (26%), Positives = 50/91 (54%), Gaps = 2/91 (2%)

Query: 93  GNAYFKVKDYENAINYYKFALQLK-NDPVFYSNMAACYISLEHNKEAIEACSKALELNPD 151
           G  ++   +++  I+ ++ AL++  ND + ++ + A   +   ++EAI+A  +AL+L P 
Sbjct: 431 GLLFYANDEFDRTIDCFQAALKVNPNDELMWNRLGASLANSNRSEEAIQAYHRALQLKPS 490

Query: 152 YSKVLLKRAAVYENIGKFADALLD-LTAVSL 181
           + +     A    NIG + +A    LTA+S+
Sbjct: 491 FVRARYNLAVSSMNIGCYKEAAEHLLTALSM 521

>TDEL0C05090 Chr3 complement(908033..910312) [2280 bp, 759 aa] {ON}
           Anc_3.367 YBR112C
          Length = 759

 Score = 38.1 bits (87), Expect = 0.070,   Method: Compositional matrix adjust.
 Identities = 21/83 (25%), Positives = 42/83 (50%), Gaps = 2/83 (2%)

Query: 93  GNAYFKVKDYENAINYYKFALQL-KNDPVFYSNMAACYISLEHNKEAIEACSKALELNPD 151
           G  +    DY  A + ++ A+     +P+F+ ++   Y  +   ++A++A ++A+ LNP 
Sbjct: 283 GRVHMIRSDYTAAYDAFQQAVNRDSRNPIFWCSIGVLYYQISQYRDALDAYTRAIRLNPY 342

Query: 152 YSKVLLKRAAVYENI-GKFADAL 173
            S+V      +YE    +  DAL
Sbjct: 343 ISEVWYDLGTLYETCNNQLTDAL 365

>YBR112C Chr2 complement(462870..465770) [2901 bp, 966 aa] {ON}
           CYC8General transcriptional co-repressor, acts together
           with Tup1p; also acts as part of a transcriptional
           co-activator complex that recruits the SWI/SNF and SAGA
           complexes to promoters; can form the prion [OCT+]
          Length = 966

 Score = 38.1 bits (87), Expect = 0.071,   Method: Compositional matrix adjust.
 Identities = 22/94 (23%), Positives = 43/94 (45%), Gaps = 7/94 (7%)

Query: 356 KAIDLDPNMAAIYYHRGQMNFIIQKYEKAGEDFDKAKECDPTNIFPYIQLACMSYREGHF 415
           K+++ DP+ A  +YH G+++ I   Y  A + F +A   D  N   +  +  + Y+   +
Sbjct: 287 KSLEADPSDATTWYHLGRVHMIRTDYTAAYDAFQQAVNRDSRNPIFWCSIGVLYYQISQY 346

Query: 416 DDCETLFSEARRKFPDAPEVPNFFAEILSDKGEI 449
            D    ++ A R  P       + +E+  D G +
Sbjct: 347 RDALDAYTRAIRLNP-------YISEVWYDLGTL 373

 Score = 38.1 bits (87), Expect = 0.079,   Method: Compositional matrix adjust.
 Identities = 21/83 (25%), Positives = 43/83 (51%), Gaps = 2/83 (2%)

Query: 93  GNAYFKVKDYENAINYYKFALQL-KNDPVFYSNMAACYISLEHNKEAIEACSKALELNPD 151
           G  +    DY  A + ++ A+     +P+F+ ++   Y  +   ++A++A ++A+ LNP 
Sbjct: 303 GRVHMIRTDYTAAYDAFQQAVNRDSRNPIFWCSIGVLYYQISQYRDALDAYTRAIRLNPY 362

Query: 152 YSKVLLKRAAVYENI-GKFADAL 173
            S+V      +YE    + +DAL
Sbjct: 363 ISEVWYDLGTLYETCNNQLSDAL 385

>AFR453W Chr6 (1251460..1253169) [1710 bp, 569 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR244W (PEX5)
          Length = 569

 Score = 37.7 bits (86), Expect = 0.075,   Method: Compositional matrix adjust.
 Identities = 23/92 (25%), Positives = 51/92 (55%), Gaps = 2/92 (2%)

Query: 93  GNAYFKVKDYENAINYYKFALQLK-NDPVFYSNMAACYISLEHNKEAIEACSKALELNPD 151
           G  ++  +D++  I+ ++ AL ++ +D   ++ + A   +   ++EAI+A  +A++L P 
Sbjct: 424 GILFYANEDFDKTIDCFRAALAVRPDDECMWNRLGASLANSNRSEEAIQAYHRAIQLKPT 483

Query: 152 YSKVLLKRAAVYENIGKFADALLD-LTAVSLN 182
           + +     A    NIG + +A    LTA+S++
Sbjct: 484 FVRARYNLAVSSMNIGCYREAAEHLLTALSMH 515

>Skud_2.240 Chr2 complement(431507..434461) [2955 bp, 984 aa] {ON}
           YBR112C (REAL)
          Length = 984

 Score = 38.1 bits (87), Expect = 0.076,   Method: Compositional matrix adjust.
 Identities = 21/83 (25%), Positives = 43/83 (51%), Gaps = 2/83 (2%)

Query: 93  GNAYFKVKDYENAINYYKFALQL-KNDPVFYSNMAACYISLEHNKEAIEACSKALELNPD 151
           G  +    DY  A + ++ A+     +P+F+ ++   Y  +   ++A++A ++A+ LNP 
Sbjct: 297 GRVHMIRTDYTAAYDAFQQAVNRDSRNPIFWCSIGVLYYQISQYRDALDAYTRAIRLNPY 356

Query: 152 YSKVLLKRAAVYENI-GKFADAL 173
            S+V      +YE    + +DAL
Sbjct: 357 ISEVWYDLGTLYETCNNQLSDAL 379

 Score = 37.7 bits (86), Expect = 0.091,   Method: Compositional matrix adjust.
 Identities = 22/94 (23%), Positives = 43/94 (45%), Gaps = 7/94 (7%)

Query: 356 KAIDLDPNMAAIYYHRGQMNFIIQKYEKAGEDFDKAKECDPTNIFPYIQLACMSYREGHF 415
           K+++ DP+ A  +YH G+++ I   Y  A + F +A   D  N   +  +  + Y+   +
Sbjct: 281 KSLEADPSDATTWYHLGRVHMIRTDYTAAYDAFQQAVNRDSRNPIFWCSIGVLYYQISQY 340

Query: 416 DDCETLFSEARRKFPDAPEVPNFFAEILSDKGEI 449
            D    ++ A R  P       + +E+  D G +
Sbjct: 341 RDALDAYTRAIRLNP-------YISEVWYDLGTL 367

>Smik_2.254 Chr2 complement(447517..450579) [3063 bp, 1020 aa] {ON}
           YBR112C (REAL)
          Length = 1020

 Score = 38.1 bits (87), Expect = 0.078,   Method: Compositional matrix adjust.
 Identities = 22/94 (23%), Positives = 43/94 (45%), Gaps = 7/94 (7%)

Query: 356 KAIDLDPNMAAIYYHRGQMNFIIQKYEKAGEDFDKAKECDPTNIFPYIQLACMSYREGHF 415
           K+++ DP+ A  +YH G+++ I   Y  A + F +A   D  N   +  +  + Y+   +
Sbjct: 289 KSLEADPSDATTWYHLGRVHMIRTDYTAAYDAFQQAVNRDSRNPIFWCSIGVLYYQISQY 348

Query: 416 DDCETLFSEARRKFPDAPEVPNFFAEILSDKGEI 449
            D    ++ A R  P       + +E+  D G +
Sbjct: 349 RDALDAYTRAIRLNP-------YISEVWYDLGTL 375

 Score = 38.1 bits (87), Expect = 0.080,   Method: Compositional matrix adjust.
 Identities = 21/83 (25%), Positives = 43/83 (51%), Gaps = 2/83 (2%)

Query: 93  GNAYFKVKDYENAINYYKFALQL-KNDPVFYSNMAACYISLEHNKEAIEACSKALELNPD 151
           G  +    DY  A + ++ A+     +P+F+ ++   Y  +   ++A++A ++A+ LNP 
Sbjct: 305 GRVHMIRTDYTAAYDAFQQAVNRDSRNPIFWCSIGVLYYQISQYRDALDAYTRAIRLNPY 364

Query: 152 YSKVLLKRAAVYENI-GKFADAL 173
            S+V      +YE    + +DAL
Sbjct: 365 ISEVWYDLGTLYETCNNQLSDAL 387

>Smik_4.579 Chr4 complement(1032558..1034561) [2004 bp, 667 aa] {ON}
           YDR320C (REAL)
          Length = 667

 Score = 37.7 bits (86), Expect = 0.081,   Method: Compositional matrix adjust.
 Identities = 29/113 (25%), Positives = 53/113 (46%), Gaps = 26/113 (23%)

Query: 87  SELKKRGNAYFKVKDYENAINYYKFALQ--LKNDP---VFYSNMAACYISLEHNKEAIEA 141
           +E K +G+ +FK  DY N++  Y+ +L     N P   +  SN+ A  + +    ++IE 
Sbjct: 375 NEFKAKGSNFFKNGDYVNSLQEYEKSLNSLPSNHPLRIIALSNIIASQLKVGEYSKSIEN 434

Query: 142 CSKALELNPD---------------------YSKVLLKRAAVYENIGKFADAL 173
            S AL L P                      + K++++RA  +E++  F++AL
Sbjct: 435 SSMALALFPPTKANWSNMISDSDPQRSFNDIWPKIMIRRAESFEHLESFSNAL 487

>TDEL0D03600 Chr4 (661898..664537) [2640 bp, 879 aa] {ON} Anc_3.265
           YBR055C
          Length = 879

 Score = 37.7 bits (86), Expect = 0.090,   Method: Compositional matrix adjust.
 Identities = 39/178 (21%), Positives = 75/178 (42%), Gaps = 11/178 (6%)

Query: 332 KSYIYLGLLMADKGLDEEYYSNFQKAIDLDPNMAAIYYHRGQMNFI-IQKYEKAGEDFDK 390
           K YI LG +    G  ++    +       P+ A ++  + + + I  Q+  +A  + DK
Sbjct: 650 KFYIQLGQIYQYIGQPKKMRETYSIGSKTLPHCAILWILKAKADEIDFQQPTRARSELDK 709

Query: 391 AKECDPTNIFPYIQLACMSYREGHFDDCETLFSEARRKFPDAPEVPNFFAEILSDKGEIE 450
           A   +P  I  Y+    M  R G  D    +  +A +KFP++P++ +    +L  K    
Sbjct: 710 ALLKNPNEISLYLAKIQMEVRLGFQDQARLIVQQALQKFPNSPDLWSANISLLPAKRASM 769

Query: 451 KAAAEYDKAIELESKSENIHVGIAPLVGKATTLLKYPTVENFIEADDLFEQANNEDPR 508
           K    +  A++  + S  + + I          L +     F+ A   F++A+  DP+
Sbjct: 770 KKTM-FQDALKKTNNSCQVLLEIG---------LSFYRDSQFVTALKWFDRASKSDPK 817

>NCAS0F02870 Chr6 complement(573068..575170) [2103 bp, 700 aa] {ON}
           Anc_5.352 YDR320C
          Length = 700

 Score = 37.7 bits (86), Expect = 0.092,   Method: Compositional matrix adjust.
 Identities = 31/113 (27%), Positives = 50/113 (44%), Gaps = 26/113 (23%)

Query: 87  SELKKRGNAYFKVKDYENAINYYKFALQL--KNDP---VFYSNMAACYISLEHNKEAIEA 141
           +E + RG  YFK  DY ++   Y+ +L     N P   + YSN+ A  + +    ++++ 
Sbjct: 404 AEFRNRGTQYFKNGDYVSSFQEYEKSLNTLPVNHPLRIIAYSNIIASELKIGEYSKSLKN 463

Query: 142 CSKALELNPD---------------------YSKVLLKRAAVYENIGKFADAL 173
            S ALE+ PD                     + KV L++A   E+I  F  AL
Sbjct: 464 SSSALEMFPDDTAQWTAVIQDSDPQRTYKDIWPKVKLRQAEALEHIESFKAAL 516

>KLLA0C15455g Chr3 (1341570..1343270) [1701 bp, 566 aa] {ON} similar
           to uniprot|P35056 Saccharomyces cerevisiae YDR244W PEX5
           Essential for import of proteins with SKL- like import
           signal into peroxisomal matrix 69-kDa protein containing
           tetratricopeptide repeat (TPR)
          Length = 566

 Score = 37.4 bits (85), Expect = 0.099,   Method: Compositional matrix adjust.
 Identities = 24/92 (26%), Positives = 50/92 (54%), Gaps = 2/92 (2%)

Query: 93  GNAYFKVKDYENAINYYKFALQLK-NDPVFYSNMAACYISLEHNKEAIEACSKALELNPD 151
           G  ++  +++   I+ ++ AL++  ND + ++ + A   +   ++EAI+A  KAL L P 
Sbjct: 423 GTLFYANEEFGKTIDCFRTALEVNPNDELMWNRLGASLANSNRSEEAIQAYHKALALKPS 482

Query: 152 YSKVLLKRAAVYENIGKFADALLD-LTAVSLN 182
           + +     A    NIG + +A    L+A+S++
Sbjct: 483 FVRARYNLAISSMNIGCYKEAAESLLSALSMH 514

>SAKL0F16236g Chr6 (1313573..1317799) [4227 bp, 1408 aa] {ON}
           similar to uniprot|P17883 Saccharomyces cerevisiae
           YPR189W SKI3 dsRNA virus protection family member
           contains 8 copies of the tetratricopeptide (TPR) domain
          Length = 1408

 Score = 37.7 bits (86), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 43/190 (22%), Positives = 77/190 (40%), Gaps = 29/190 (15%)

Query: 334 YIYLGLLMADKGLDEEYYSNFQKAIDLDPNMAAIYYHRGQMNFIIQKYEKAGEDFDKAKE 393
           Y  LG+   +K  + E    FQ A+ +D N    +   GQ  +   + E + + F+KA E
Sbjct: 681 YRVLGVSYLEKQKEPESIEWFQSALRVDANDVESWVGLGQAYYACGRLEASIKVFEKATE 740

Query: 394 CDPTNIFP----YIQLACMSYREGHFDDCETLFSEARRKFPDAPEVPNFFAEILSD---- 445
             P ++F      I LA +    G ++ C  + +    K P+          IL D    
Sbjct: 741 LAPDHLFAGYFKAISLAGI----GEYEQCIEIIAALLEKLPNEESFQVSMVNILIDYSVE 796

Query: 446 ---KGEIEKAAAEYDKAIE--------LESKSENIHVGIAP------LVGKATTLLKYPT 488
              +G + KA A+   +I+        +  K +N+ + ++       LV     +L   +
Sbjct: 797 LFSQGYLAKAVAQAVDSIKRIEYIISNISHKVQNVWISLSKALKLFILVQSKVDMLPIES 856

Query: 489 VENFIEADDL 498
           + N  EA +L
Sbjct: 857 LVNIFEACEL 866

>YCR060W Chr3 (224399..224734) [336 bp, 111 aa] {ON}  TAH1Component
           of the conserved R2TP complex (Rvb1-Rvb2-Tah1-Pih1);
           contains a single TPR domain with at least two TPR
           motifs; R2TP complex interacts with Hsp90 (Hsp82p and
           Hsc82p) to mediate assembly large protein complexes such
           as box C/D snoRNPs and RNA polymerase II
          Length = 111

 Score = 35.0 bits (79), Expect = 0.11,   Method: Composition-based stats.
 Identities = 22/75 (29%), Positives = 35/75 (46%), Gaps = 1/75 (1%)

Query: 90  KKRGNAYFKVKDYENAINYYKFALQLK-NDPVFYSNMAACYISLEHNKEAIEACSKALEL 148
           K++GN+ FK   Y  A++ Y   +  +  +PV YSN A   I L    +AI+ C + L  
Sbjct: 8   KEQGNSLFKQGLYREAVHCYDQLITAQPQNPVGYSNKAMALIKLGEYTQAIQMCQQGLRY 67

Query: 149 NPDYSKVLLKRAAVY 163
                 V ++    Y
Sbjct: 68  TSTAEHVAIRSKLQY 82

>KLTH0F10428g Chr6 (902697..905084) [2388 bp, 795 aa] {ON} highly
           similar to uniprot|P14922 Saccharomyces cerevisiae
           YBR112C CYC8 General transcriptional co- repressor acts
           together with Tup1p also acts as part of a
           transcriptional co-activator complex that recruits the
           SWI/SNF and SAGA complexes to promoters
          Length = 795

 Score = 37.0 bits (84), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 21/83 (25%), Positives = 41/83 (49%), Gaps = 2/83 (2%)

Query: 93  GNAYFKVKDYENAINYYKFALQL-KNDPVFYSNMAACYISLEHNKEAIEACSKALELNPD 151
           G  +    DY  A + ++ A+     +P F+ ++   Y  +   ++A++A ++A+ LNP 
Sbjct: 319 GRIHMVRNDYTAAYDAFQHAVNRDSRNPTFWCSIGVLYYQISQYRDALDAYTRAIRLNPY 378

Query: 152 YSKVLLKRAAVYENI-GKFADAL 173
            S+V      +YE    +  DAL
Sbjct: 379 ISEVWYDLGTLYETCNNQLTDAL 401

>KLTH0A00638g Chr1 complement(63363..67598) [4236 bp, 1411 aa] {ON}
           similar to uniprot|P17883 Saccharomyces cerevisiae
           YPR189W SKI3 dsRNA virus protection family member
           contains 8 copies of the tetratricopeptide (TPR) domain
          Length = 1411

 Score = 37.4 bits (85), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 27/110 (24%), Positives = 47/110 (42%)

Query: 334 YIYLGLLMADKGLDEEYYSNFQKAIDLDPNMAAIYYHRGQMNFIIQKYEKAGEDFDKAKE 393
           Y  LG+   +K  + E    FQ A+ ++P     +   GQ  +   + E + + F+KA E
Sbjct: 684 YRVLGIAHLEKQAESESIEWFQSALRVEPADLESWLGLGQAYYSCGRVEASVKVFEKALE 743

Query: 394 CDPTNIFPYIQLACMSYREGHFDDCETLFSEARRKFPDAPEVPNFFAEIL 443
             P N + +   A    + G +D+   +F E   + PD         E+L
Sbjct: 744 VSPGNAYAHYFKALSLSKMGLYDESIEIFRELTAEHPDEESYQVSMVEVL 793

>Kwal_23.3670 s23 (387536..389944) [2409 bp, 802 aa] {ON} YBR112C
           (CYC8) - 1:1 [contig 253] FULL
          Length = 802

 Score = 37.0 bits (84), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 21/83 (25%), Positives = 41/83 (49%), Gaps = 2/83 (2%)

Query: 93  GNAYFKVKDYENAINYYKFALQL-KNDPVFYSNMAACYISLEHNKEAIEACSKALELNPD 151
           G  +    DY  A + ++ A+     +P F+ ++   Y  +   ++A++A ++A+ LNP 
Sbjct: 323 GRIHMVRNDYTAAYDAFQHAVNRDSRNPTFWCSIGVLYYQISQYRDALDAYTRAIRLNPY 382

Query: 152 YSKVLLKRAAVYENI-GKFADAL 173
            S+V      +YE    +  DAL
Sbjct: 383 ISEVWYDLGTLYETCNNQLTDAL 405

>NDAI0A05100 Chr1 (1157935..1160958) [3024 bp, 1007 aa] {ON}
           Anc_3.367
          Length = 1007

 Score = 37.0 bits (84), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 21/83 (25%), Positives = 42/83 (50%), Gaps = 2/83 (2%)

Query: 93  GNAYFKVKDYENAINYYKFALQL-KNDPVFYSNMAACYISLEHNKEAIEACSKALELNPD 151
           G  +    DY  A + ++ A+     +P+F+ ++   Y  +   ++A++A ++A+ LNP 
Sbjct: 318 GRVHMIRNDYTAAYDAFQQAVNRDSRNPIFWCSIGVLYYQISQYRDALDAYTRAIRLNPY 377

Query: 152 YSKVLLKRAAVYENI-GKFADAL 173
            S+V      +YE    +  DAL
Sbjct: 378 ISEVWYDLGTLYETCNNQLNDAL 400

>KLLA0B09262g Chr2 (814303..817128) [2826 bp, 941 aa] {ON} highly
           similar to uniprot|P14922 Saccharomyces cerevisiae
           YBR112C CYC8 General transcriptional co- repressor acts
           together with Tup1p also acts as part of a
           transcriptional co-activator complex that recruits the
           SWI/SNF and SAGA complexes to promoters
          Length = 941

 Score = 36.6 bits (83), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 23/100 (23%), Positives = 47/100 (47%), Gaps = 1/100 (1%)

Query: 93  GNAYFKVKDYENAINYYKFALQL-KNDPVFYSNMAACYISLEHNKEAIEACSKALELNPD 151
           G  +    DY +A + ++ A+     +P F+ ++   Y  +   ++A++A ++A+ LNP 
Sbjct: 365 GRIHMIRNDYTSAYDAFQQAVNRDSRNPTFWCSIGVLYYQIAQYRDALDAYTRAIRLNPY 424

Query: 152 YSKVLLKRAAVYENIGKFADALLDLTAVSLNGDYNDATIQ 191
            S+V      +YE      +  LD    +   D N+  I+
Sbjct: 425 ISEVWYDLGTLYETCNNQVNDALDAYKQAARLDPNNVHIR 464

>SAKL0B07986g Chr2 complement(675999..678641) [2643 bp, 880 aa] {ON}
           highly similar to uniprot|P14922 Saccharomyces
           cerevisiae YBR112C CYC8 General transcriptional co-
           repressor acts together with Tup1p also acts as part of
           a transcriptional co-activator complex that recruits the
           SWI/SNF and SAGA complexes to promoters
          Length = 880

 Score = 36.6 bits (83), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 21/83 (25%), Positives = 41/83 (49%), Gaps = 2/83 (2%)

Query: 93  GNAYFKVKDYENAINYYKFALQL-KNDPVFYSNMAACYISLEHNKEAIEACSKALELNPD 151
           G  +    DY  A + ++ A+     +P F+ ++   Y  +   ++A++A ++A+ LNP 
Sbjct: 315 GRIHMVRNDYTAAYDAFQQAVNRDSRNPTFWCSIGVLYYQISQYRDALDAYTRAIRLNPY 374

Query: 152 YSKVLLKRAAVYENI-GKFADAL 173
            S+V      +YE    +  DAL
Sbjct: 375 ISEVWYDLGTLYETCNNQLTDAL 397

>TBLA0F01230 Chr6 complement(304299..307868) [3570 bp, 1189 aa] {ON}
           Anc_3.367 YBR112C
          Length = 1189

 Score = 36.6 bits (83), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 28/121 (23%), Positives = 52/121 (42%), Gaps = 17/121 (14%)

Query: 359 DLDPNMAAIYYHRGQMNFIIQKYEKAGEDFDKAKECDPTNIFPYIQLACMSYREGHFDDC 418
           + DP+ A  +YH G+++ I   Y  A + F +A   D  N   +  +  + Y+   + D 
Sbjct: 279 EFDPSDATTWYHLGRIHMIRTDYTAAYDAFQQAVNRDSRNPIFWCSIGVLYYQISQYRDA 338

Query: 419 ETLFSEARRKFPDAPEVPNFFAEILSDKG--------EIEKAAAEYDKAIELESKSENIH 470
              ++ A R  P       + +E+  D G        ++  A   Y +A  L+   EN+H
Sbjct: 339 LDAYTRAIRLNP-------YISEVWYDLGTLYETCNNQLTDALDAYKQAARLD--PENVH 389

Query: 471 V 471
           +
Sbjct: 390 I 390

 Score = 35.8 bits (81), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 21/83 (25%), Positives = 42/83 (50%), Gaps = 2/83 (2%)

Query: 93  GNAYFKVKDYENAINYYKFALQL-KNDPVFYSNMAACYISLEHNKEAIEACSKALELNPD 151
           G  +    DY  A + ++ A+     +P+F+ ++   Y  +   ++A++A ++A+ LNP 
Sbjct: 292 GRIHMIRTDYTAAYDAFQQAVNRDSRNPIFWCSIGVLYYQISQYRDALDAYTRAIRLNPY 351

Query: 152 YSKVLLKRAAVYENI-GKFADAL 173
            S+V      +YE    +  DAL
Sbjct: 352 ISEVWYDLGTLYETCNNQLTDAL 374

>Kpol_2000.60 s2000 (119866..122967) [3102 bp, 1033 aa] {ON}
           (119866..122967) [3102 nt, 1034 aa]
          Length = 1033

 Score = 36.6 bits (83), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 17/57 (29%), Positives = 34/57 (59%)

Query: 117 NDPVFYSNMAACYISLEHNKEAIEACSKALELNPDYSKVLLKRAAVYENIGKFADAL 173
           +D  F+  +AA    L H ++AI   S+ + ++ D ++ + +RA +Y++IG+   AL
Sbjct: 183 SDWEFWRVVAALSADLGHARQAIYCYSRVINIHHDDTEAVYRRAVLYKDIGQIGRAL 239

>ADL344W Chr4 (103565..106297) [2733 bp, 910 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YBR112C (CYC8)
          Length = 910

 Score = 36.6 bits (83), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 21/83 (25%), Positives = 42/83 (50%), Gaps = 2/83 (2%)

Query: 93  GNAYFKVKDYENAINYYKFALQL-KNDPVFYSNMAACYISLEHNKEAIEACSKALELNPD 151
           G  +    DY  A + ++ A+     +P F+ ++   Y  +   ++A++A ++A+ LNP 
Sbjct: 319 GRIHMVRNDYTAAYDAFQQAVNRDSRNPTFWCSIGVLYYQISQYRDALDAYTRAIRLNPY 378

Query: 152 YSKVLLKRAAVYENI-GKFADAL 173
            S+V      +YE    + +DAL
Sbjct: 379 ISEVWYDLGTLYETCNNQLSDAL 401

>Smik_6.132 Chr6 complement(212341..215418) [3078 bp, 1025 aa] {ON}
           YGR047C (REAL)
          Length = 1025

 Score = 36.6 bits (83), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 18/57 (31%), Positives = 32/57 (56%)

Query: 117 NDPVFYSNMAACYISLEHNKEAIEACSKALELNPDYSKVLLKRAAVYENIGKFADAL 173
           +D  F+  +A     L+H ++AI   S+ + LNP   + + +RA +Y+  G+ A AL
Sbjct: 194 SDWEFWKIVAILSADLDHVRQAIYCFSRVISLNPMEWESIYRRAMLYKKTGQLARAL 250

>Skud_7.346 Chr7 complement(573751..576828) [3078 bp, 1025 aa] {ON}
           YGR047C (REAL)
          Length = 1025

 Score = 36.2 bits (82), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 18/57 (31%), Positives = 32/57 (56%)

Query: 117 NDPVFYSNMAACYISLEHNKEAIEACSKALELNPDYSKVLLKRAAVYENIGKFADAL 173
           +D  F+  +A     L+H ++AI   S+ + LNP   + + +RA +Y+  G+ A AL
Sbjct: 194 SDWEFWKIVAILSADLDHVRQAIYCFSRVISLNPMEWESIYRRAILYKKTGQLARAL 250

>Skud_10.7 Chr10 (12019..13974) [1956 bp, 651 aa] {ON} YJL209W
           (REAL)
          Length = 651

 Score = 36.2 bits (82), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 33/118 (27%), Positives = 55/118 (46%), Gaps = 21/118 (17%)

Query: 475 PLVGKATTLLKYPT-------VENFIEADDLFEQANNEDPRSEKAKMGLAQCKLQQEDLD 527
           P   K  + L YP        +  +++ + LFE+         +A  G+   + Q E L 
Sbjct: 179 PYARKIISTLAYPNPLHDHVHLVKYLQLNSLFER---------RAGNGIKLTRFQLEILS 229

Query: 528 D-AIRLFEEAAILCRTLDEKLQATTFAEATKVQMRVRADERLQAKTMKALDEIRRNGG 584
             A+ L +EA  LC+ +  KL    F+ AT  ++++R D+ L A   K++DE  R G 
Sbjct: 230 SKALGLGDEAPQLCKAILNKLMNINFSSAT--ELKLRDDQVLLA--YKSIDENYRRGN 283

>KAFR0D00470 Chr4 (70746..73901) [3156 bp, 1051 aa] {ON} Anc_1.88
           YGR047C
          Length = 1051

 Score = 35.8 bits (81), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 17/57 (29%), Positives = 32/57 (56%)

Query: 117 NDPVFYSNMAACYISLEHNKEAIEACSKALELNPDYSKVLLKRAAVYENIGKFADAL 173
           +D  F+  +A     LEH ++AI   S+ + +N +  + L +R+ +Y+ IG+   AL
Sbjct: 209 SDWEFWKIVAILSADLEHYRQAIYCFSRVININHEEWEALYRRSILYKKIGQIGKAL 265

>Kwal_55.21839 s55 (998426..1000498) [2073 bp, 690 aa] {ON} YOR080W
           (DIA2) - may be involved in regulation of invasive
           growth and budding pattern [contig 126] FULL
          Length = 690

 Score = 35.8 bits (81), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 29/85 (34%), Positives = 41/85 (48%), Gaps = 7/85 (8%)

Query: 93  GNAYFKVKDYENAINYYKFALQLKNDPVFYSNMAACYISLEH--NKEAIEACSKALELNP 150
           G  YFK +DY+NA N +  AL+L    + YS      I   H  +K       K   ++P
Sbjct: 14  GFVYFKNEDYKNACNLFTKALRL---ALSYSQSKLEQIRESHGLSKRPFYETEKV--VHP 68

Query: 151 DYSKVLLKRAAVYENIGKFADALLD 175
            + K+L  RAA +E +G    AL D
Sbjct: 69  RFVKLLDNRAATWEKLGDLTKALKD 93

>TBLA0H01970 Chr8 (464239..466761) [2523 bp, 840 aa] {ON} Anc_5.352
           YDR320C
          Length = 840

 Score = 35.8 bits (81), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 21/69 (30%), Positives = 38/69 (55%), Gaps = 5/69 (7%)

Query: 87  SELKKRGNAYFKVKDYENAINYYKFALQL--KNDP---VFYSNMAACYISLEHNKEAIEA 141
           +E +  G  +FK  DY++A++ YK +L    +  P   + YSN+ A  + +    ++++ 
Sbjct: 547 TEFRANGTEFFKKGDYDSALSEYKKSLNTLPQKHPLRLISYSNILAAQLKVGEYSQSVKD 606

Query: 142 CSKALELNP 150
           C  ALEL P
Sbjct: 607 CDVALELFP 615

>NCAS0G00350 Chr7 complement(60735..62831) [2097 bp, 698 aa] {ON}
           Anc_5.689 YOR080W
          Length = 698

 Score = 35.4 bits (80), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 25/83 (30%), Positives = 40/83 (48%), Gaps = 5/83 (6%)

Query: 93  GNAYFKVKDYENAINYYKFALQLKNDPVFYSNMAACYISLEHNKEAIEACSKALELNPDY 152
           G  YF+ + Y  AI  ++ A++L      YS      +  +HN  +    + A   +P Y
Sbjct: 18  GTTYFQSEKYTKAIKIFQKAIELTKS---YSKNDIIELRRKHNLHSYPESANAY--HPKY 72

Query: 153 SKVLLKRAAVYENIGKFADALLD 175
            K+L  RAA +E +G+   AL D
Sbjct: 73  IKLLDNRAACWEKLGELERALRD 95

>Suva_7.331 Chr7 complement(561665..564739) [3075 bp, 1024 aa] {ON}
           YGR047C (REAL)
          Length = 1024

 Score = 35.8 bits (81), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 18/57 (31%), Positives = 31/57 (54%)

Query: 117 NDPVFYSNMAACYISLEHNKEAIEACSKALELNPDYSKVLLKRAAVYENIGKFADAL 173
           +D  F+  +A     L+H ++AI   S+ + LNP   +   +RA +Y+  G+ A AL
Sbjct: 194 SDWEFWKIVAILSADLDHVRQAIYCLSRVISLNPMEWESTYRRAMLYKKTGQLARAL 250

>Kwal_23.5408 s23 (1146253..1150485) [4233 bp, 1410 aa] {ON} YPR189W
           (SKI3) - Contains 8 copies of the TPR domain [contig 8]
           FULL
          Length = 1410

 Score = 35.4 bits (80), Expect = 0.44,   Method: Compositional matrix adjust.
 Identities = 23/84 (27%), Positives = 41/84 (48%)

Query: 334 YIYLGLLMADKGLDEEYYSNFQKAIDLDPNMAAIYYHRGQMNFIIQKYEKAGEDFDKAKE 393
           Y  LG+   +K  + E    FQ A+ +DP+    +   GQ  +   + E + + F+KA E
Sbjct: 683 YRVLGIANLEKQSESESIEWFQSALRVDPSDLESWVGLGQAYYACGRVEASVKVFEKALE 742

Query: 394 CDPTNIFPYIQLACMSYREGHFDD 417
            +PT+ + +   A    R G ++D
Sbjct: 743 VEPTSAYAHYFKALSLSRMGLYND 766

>KNAG0C00550 Chr3 (92890..96084) [3195 bp, 1064 aa] {ON} Anc_1.88
           YGR047C
          Length = 1064

 Score = 35.4 bits (80), Expect = 0.47,   Method: Compositional matrix adjust.
 Identities = 22/74 (29%), Positives = 37/74 (50%), Gaps = 1/74 (1%)

Query: 117 NDPVFYSNMAACYISLEHNKEAIEACSKALELNPDYSKVLLKRAAVYENIGKFADALLDL 176
           +D  F+  +A     LEH ++AI   S+ + LN    + + +RA +Y+ IG+   AL   
Sbjct: 199 SDIEFWKVVAILSADLEHYRQAIYCFSRVINLNKQDWETVYRRATLYKKIGQTGKALEGF 258

Query: 177 TAVSLNGDYNDATI 190
             +  +  Y DA I
Sbjct: 259 QKIYASNPY-DANI 271

>Kpol_1006.4 s1006 complement(17836..20034) [2199 bp, 732 aa] {ON}
           complement(17836..20034) [2199 nt, 733 aa]
          Length = 732

 Score = 35.4 bits (80), Expect = 0.47,   Method: Compositional matrix adjust.
 Identities = 16/57 (28%), Positives = 32/57 (56%), Gaps = 1/57 (1%)

Query: 118 DPVFYSNMAACYISLEHNKEAIEACSKALELNPDYSKVLLKRAAVYENI-GKFADAL 173
           +P+F+ ++   Y  +   ++A++A ++A+ LNP  S+V      +YE    +  DAL
Sbjct: 319 NPIFWCSIGVLYYQIYQYRDALDAYTRAIRLNPYISEVWYDLGTLYETCNNQLTDAL 375

 Score = 33.1 bits (74), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 25/87 (28%), Positives = 42/87 (48%), Gaps = 6/87 (6%)

Query: 93  GNAYFKVKDYENAINYYKFALQL---KNDPVFYSNMAACYISLEHNKEAIEACSKALELN 149
           G++Y  + + + A N Y+ AL      N P  +  +   Y      + A EA +K LEL+
Sbjct: 110 GHSYLMLDELQKAYNAYQQALYHLADPNVPRLWHGIGILYDRYGSLEYAEEAFAKVLELD 169

Query: 150 PDYSK---VLLKRAAVYENIGKFADAL 173
           P + K   +  +   +Y++ GKF  AL
Sbjct: 170 PKFDKANEIYFRLGIIYKHQGKFNQAL 196

>NDAI0C05130 Chr3 (1193350..1195122) [1773 bp, 590 aa] {ON}
           Anc_8.470
          Length = 590

 Score = 35.4 bits (80), Expect = 0.49,   Method: Compositional matrix adjust.
 Identities = 27/114 (23%), Positives = 56/114 (49%), Gaps = 4/114 (3%)

Query: 70  DIELMKLAETAEKNEYASELKKR---GNAYFKVKDYENAINYYKFALQLK-NDPVFYSNM 125
           D+ L K  +  + N  A++ + +   G  ++   D++  +  ++ AL++  ND + ++ +
Sbjct: 422 DLILKKFLKIGQINNNANDAEFQLCLGLLHYSNDDFDKTLECFQNALKINPNDELMWNRL 481

Query: 126 AACYISLEHNKEAIEACSKALELNPDYSKVLLKRAAVYENIGKFADALLDLTAV 179
            A   +   ++EAI+A  KA+ L P + +     A    NIG + +A   L  V
Sbjct: 482 GASLANSNRSEEAIKAYHKAINLKPSFVRARYNLAVASMNIGCYQEAAGHLLTV 535

>Ecym_7142 Chr7 complement(287110..289137) [2028 bp, 675 aa] {ON}
           similar to Ashbya gossypii AGL294W
          Length = 675

 Score = 35.0 bits (79), Expect = 0.52,   Method: Compositional matrix adjust.
 Identities = 51/234 (21%), Positives = 94/234 (40%), Gaps = 17/234 (7%)

Query: 294 NEKAAIAFEHTAILSFLKNDPLTARELVDEAIKLHPRPKSYIYLGLLMADKGLDEEYYSN 353
           ++K+AI +     L  L  D   A + + +A  L PR   + Y   L   +  + + + N
Sbjct: 453 DDKSAITWCCLGNLFSLNRDHDEAIKALKKATNLDPR---FAYAYTLQGHEYSNNDAFDN 509

Query: 354 ----FQKAIDLDPNMAAIYYHRGQMNFIIQKYEKAGEDFDKAKECDPTNIFPYIQLACMS 409
               ++KA+ ++PN    +Y  G     + +Y++A   F+KA+  +P N+          
Sbjct: 510 AKMCYRKALAINPNHYNAHYGLGMSCIKLGQYDEALLHFEKARSINPVNVILNCCCGVAL 569

Query: 410 YREGHFDDCETLFSEARRKFPDAPEVPNFFAEILSDKGEIEKAAAEYDKAIELESKSENI 469
            R G  +     +  A    P++       +++L + G+   A   ++K  +L      I
Sbjct: 570 ERLGRREKALDFYQLACELQPNSSLALFKKSQLLFNLGQYSNALQNFEKLEQLTPNEAPI 629

Query: 470 HVGIAPLVGKATTLLKYPTVENFIEADDLFEQANNEDPRS-EKAKMGLAQCKLQ 522
           H  +  L         Y  V    +A   F  A N DP+  +  K  L +C  Q
Sbjct: 630 HFLLGQL---------YQIVGRKKDAITQFTIAMNLDPKGIQLVKEALEKCHEQ 674

 Score = 32.7 bits (73), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 22/84 (26%), Positives = 46/84 (54%), Gaps = 5/84 (5%)

Query: 93  GNAYFKVKDYENAINYYKFALQLKNDPVFYSNMAACYISLEH---NKEAIEACSKALELN 149
           G +  K+  Y+ A+ +++ A  +  +PV       C ++LE     ++A++    A EL 
Sbjct: 532 GMSCIKLGQYDEALLHFEKARSI--NPVNVILNCCCGVALERLGRREKALDFYQLACELQ 589

Query: 150 PDYSKVLLKRAAVYENIGKFADAL 173
           P+ S  L K++ +  N+G++++AL
Sbjct: 590 PNSSLALFKKSQLLFNLGQYSNAL 613

>YGR047C Chr7 complement(586392..589469) [3078 bp, 1025 aa] {ON}
           TFC4One of six subunits of the RNA polymerase III
           transcription initiation factor complex (TFIIIC); part
           of the TauA domain of TFIIIC that binds BoxA DNA
           promoter sites of tRNA and similar genes; has TPR
           motifs; human homolog is TFIIIC-102
          Length = 1025

 Score = 35.4 bits (80), Expect = 0.52,   Method: Compositional matrix adjust.
 Identities = 17/57 (29%), Positives = 32/57 (56%)

Query: 117 NDPVFYSNMAACYISLEHNKEAIEACSKALELNPDYSKVLLKRAAVYENIGKFADAL 173
           +D  F+  +A     L+H ++AI   S+ + LNP   + + +R+ +Y+  G+ A AL
Sbjct: 194 SDWEFWKIVAILSADLDHVRQAIYCFSRVISLNPMEWESIYRRSMLYKKTGQLARAL 250

>NDAI0C04320 Chr3 complement(983914..986034) [2121 bp, 706 aa] {ON}
           Anc_5.352 YDR320C
          Length = 706

 Score = 35.0 bits (79), Expect = 0.57,   Method: Compositional matrix adjust.
 Identities = 30/114 (26%), Positives = 51/114 (44%), Gaps = 28/114 (24%)

Query: 88  ELKKRGNAYFKVKDYENAINYYKFALQL--KNDP---VFYSNMAACYISLEHNKEAIEAC 142
           E K RG+  FK  DY +A+  Y+ +L    +  P   + YSN+ A  + +    ++IE C
Sbjct: 416 EFKTRGSELFKNGDYVSALQEYEKSLNTLPQYHPLRIISYSNIIATQLKIGEYSKSIEDC 475

Query: 143 SKALELNPD-----------------------YSKVLLKRAAVYENIGKFADAL 173
             AL L P                        +SK+++++A  YE++  +  AL
Sbjct: 476 KIALSLFPKGKVTSAWNQIIPDSTPQRSFKDIWSKLIMRQAESYEHLENYKLAL 529

>Ecym_3459 Chr3 (864878..868225) [3348 bp, 1115 aa] {ON} similar to
           Ashbya gossypii ADL344W
          Length = 1115

 Score = 35.0 bits (79), Expect = 0.63,   Method: Compositional matrix adjust.
 Identities = 21/83 (25%), Positives = 41/83 (49%), Gaps = 2/83 (2%)

Query: 93  GNAYFKVKDYENAINYYKFALQL-KNDPVFYSNMAACYISLEHNKEAIEACSKALELNPD 151
           G  +    DY  A + ++ A+     +P F+ ++   Y  +   ++A++A ++A+ LNP 
Sbjct: 385 GRIHMVRNDYTAAYDAFQQAVNRDSRNPTFWCSIGVLYYQISQYRDALDAYTRAIRLNPY 444

Query: 152 YSKVLLKRAAVYENI-GKFADAL 173
            S+V      +YE    +  DAL
Sbjct: 445 ISEVWYDLGTLYETCNNQLNDAL 467

>NDAI0E04040 Chr5 (900685..903036) [2352 bp, 783 aa] {ON} Anc_7.412
           YBL084C
          Length = 783

 Score = 35.0 bits (79), Expect = 0.63,   Method: Compositional matrix adjust.
 Identities = 37/170 (21%), Positives = 74/170 (43%), Gaps = 19/170 (11%)

Query: 372 GQMNFIIQKYEKAGEDFDKAKECDPTNIFPYIQLACMSYREGHFDD---CETLFSEARRK 428
           G ++F I  YE + + F+K ++  PT +     L   S    H  D      L +E  ++
Sbjct: 504 GMLHFEIVNYEMSLKYFEKLRKLQPTRL---KDLETYSTLLWHLHDKIKLTVLSNELLKE 560

Query: 429 FPDAPEVPNFFAEILSDKGEIEKAAAEYDKAIELESKSENIHVGIAPLVGKATTLL--KY 486
           F + P+       + S + + ++A   ++K  +L+           P      TL   +Y
Sbjct: 561 FKNEPQTWCCLGNLFSLQKDHKEAIKAFEKVTKLD-----------PTFTYGYTLQAHEY 609

Query: 487 PTVENFIEADDLFEQANNEDPRSEKAKMGLAQCKLQQEDLDDAIRLFEEA 536
            + ++F  A + F +A + D +   A  G+  C ++  + + A+  FE+A
Sbjct: 610 LSDDSFDLAKNYFRKAVSTDSQHYNAYYGIGMCSMKLGEFEHALLYFEKA 659

 Score = 31.6 bits (70), Expect = 6.9,   Method: Compositional matrix adjust.
 Identities = 31/150 (20%), Positives = 56/150 (37%), Gaps = 34/150 (22%)

Query: 354 FQKAIDLDPNMAAIYYHRGQMNFIIQKYEKAGEDFDKAKECDPTNI-------------- 399
           F+KA+  D      YY  G  +  + ++E A   F+KA+  +P+N+              
Sbjct: 622 FRKAVSTDSQHYNAYYGIGMCSMKLGEFEHALLYFEKARSINPSNVILICCCGVAFEKLS 681

Query: 400 FP-----YIQLAC---------------MSYREGHFDDCETLFSEARRKFPDAPEVPNFF 439
           +P     Y +LAC               + Y   ++      F E  +  P+   V    
Sbjct: 682 YPEKALSYYELACQVQPSSSLAKFKRAHLLYSMANYPLALECFEELTKLAPEEATVHFIL 741

Query: 440 AEILSDKGEIEKAAAEYDKAIELESKSENI 469
            ++ +  G  + A  EY  A+ L+ K   +
Sbjct: 742 GQLYNIMGRKKDAVKEYTIAMNLDPKGNQV 771

>KLLA0B10197g Chr2 complement(891842..893707) [1866 bp, 621 aa] {ON}
           similar to uniprot|Q06677 Saccharomyces cerevisiae
           YDR320C SWA2 auxilin-like protein
          Length = 621

 Score = 34.7 bits (78), Expect = 0.70,   Method: Compositional matrix adjust.
 Identities = 31/113 (27%), Positives = 48/113 (42%), Gaps = 29/113 (25%)

Query: 88  ELKKRGNAYFKVKDYENAI-------NYYKFALQLKNDPVFYSNMAACYISLEHNKEAIE 140
           E K  G  YF   DY NA+       N   F   L+   +  SN+ +C + L  N +A+E
Sbjct: 335 EFKNNGVKYFSSGDYHNALLEFEKSFNTLPFKHPLRI--ISLSNIVSCQLKLGENSKALE 392

Query: 141 ACSKALELN---PDYS-----------------KVLLKRAAVYENIGKFADAL 173
           +   AL+L+   P+ S                 K+ LK A + E++  +  AL
Sbjct: 393 SVKLALDLSDLAPNASDIIEHSVPERTFKQMINKIQLKHAEIQEHLENYEKAL 445

>TBLA0A05500 Chr1 complement(1358478..1361771) [3294 bp, 1097 aa]
           {ON} Anc_1.88 YGR047C
          Length = 1097

 Score = 34.7 bits (78), Expect = 0.76,   Method: Compositional matrix adjust.
 Identities = 17/57 (29%), Positives = 30/57 (52%)

Query: 117 NDPVFYSNMAACYISLEHNKEAIEACSKALELNPDYSKVLLKRAAVYENIGKFADAL 173
           +D  F+  +A   + L H ++AI   S+ + +N    + L KR+ +Y  IG+   AL
Sbjct: 213 SDWSFWKMVANLSVELNHIRQAIYCYSRVININHQDLESLYKRSVLYRQIGQIGRAL 269

>CAGL0I02288g Chr9 complement(203605..205524) [1920 bp, 639 aa] {ON}
           similar to uniprot|P16522 Saccharomyces cerevisiae
           YHR166c CDC23
          Length = 639

 Score = 34.7 bits (78), Expect = 0.79,   Method: Compositional matrix adjust.
 Identities = 65/266 (24%), Positives = 110/266 (41%), Gaps = 48/266 (18%)

Query: 302 EHTAILS-FLKNDPLTARELVDEAIKLHPRPKSYIYLGLLMAD-KGLDEEYYSNFQKAID 359
           E   +LS F+ N      E ++   KL       I+  LL  + +G  +EY + F+  + 
Sbjct: 277 ESQMLLSHFMSNFQFENLENINSQSKLESNIPFKIFQLLLFKEFQGNVDEYLTTFEDLLT 336

Query: 360 LDPNMAAIYYHRGQMNFIIQKYEKAGEDFDKAKECDP---------TNIFPYIQ----LA 406
           L PN   +   +   ++    Y  + + F+K  E DP         +NI   +Q    LA
Sbjct: 337 LFPNFTFLQAQKALTSYQYMDYVNSEQIFEKIMEDDPYRLDDMDTFSNILYVMQKNAKLA 396

Query: 407 CMSYREGHFDDCETLFSEARRKFPDAPEVPNFFAEILSDKGEIEKAAAEYDKAIELESKS 466
            ++      D           +F   PE     A   S + E EK+   + +A+ L+ K+
Sbjct: 397 YLAQFVSQID-----------RF--RPETCCVIANYYSARQEHEKSIMYFRRALTLDKKT 443

Query: 467 ENIHVGIAPLVGKATTLLKYPTVE--NFIEADDLFEQANNEDPRSEKAKMGLAQCKLQQE 524
            +           A TL+ +  VE  N   A + + +A + DPR  +A  GL Q     E
Sbjct: 444 TS-----------AWTLMGHEFVELKNSNAAIESYRRAVDIDPRDFRAWYGLGQA---YE 489

Query: 525 DLDD---AIRLFEEAAILCRTLDEKL 547
            LD    ++  F+ A IL + LD+++
Sbjct: 490 VLDMHLYSLYYFQRACIL-KPLDKRM 514

>CAGL0K09240g Chr11 complement(914042..914470) [429 bp, 142 aa] {ON}
           weakly similar to uniprot|P25638 Saccharomyces
           cerevisiae YCR060w
          Length = 142

 Score = 33.1 bits (74), Expect = 0.84,   Method: Compositional matrix adjust.
 Identities = 20/55 (36%), Positives = 29/55 (52%), Gaps = 1/55 (1%)

Query: 93  GNAYFKVKDYENAINYYKFALQLK-NDPVFYSNMAACYISLEHNKEAIEACSKAL 146
           GN +FK  +Y+ AI  Y+  + L+  + V YSN+A  Y+      EA  AC   L
Sbjct: 42  GNEHFKKGEYDLAIEQYRKCISLEPTNAVGYSNLAMAYLKNRCPDEAKTACEMGL 96

>Kpol_1050.82 s1050 complement(185867..187786) [1920 bp, 639 aa]
           {ON} complement(185867..187786) [1920 nt, 640 aa]
          Length = 639

 Score = 34.7 bits (78), Expect = 0.85,   Method: Compositional matrix adjust.
 Identities = 28/111 (25%), Positives = 54/111 (48%), Gaps = 9/111 (8%)

Query: 93  GNAYFKVKDYENAINYYKFALQL-KNDPVFYSNMAACYISLEHNKEAIEACSKALELNPD 151
            N Y   +++E +I Y++ AL L K +   ++ M   ++ L++++ AIE   +A+++NP 
Sbjct: 416 ANYYSARQEHEKSIMYFRRALTLNKKNTSAWTLMGHEFVELKNSQAAIECYRRAVDINPR 475

Query: 152 YSKVLLKRAAVYENIGKFADALLDLTAVSLNGDYNDATIQPIVERVLNKQA 202
             K        YE        +LD+   SL       T++P+ +R+    A
Sbjct: 476 DFKAWYGLGQAYE--------VLDMHLYSLYYFQKACTLKPLDKRMWQALA 518

>KNAG0E00680 Chr5 complement(122876..124795) [1920 bp, 639 aa] {ON}
           Anc_5.72 YHR166C
          Length = 639

 Score = 34.7 bits (78), Expect = 0.85,   Method: Compositional matrix adjust.
 Identities = 47/189 (24%), Positives = 73/189 (38%), Gaps = 39/189 (20%)

Query: 345 GLDEEYYSNFQKAIDLDPNMAAIYYHRGQMNFIIQKYEKAGEDFDKAKECDP-------- 396
           G  +E++   +  + L PN   +      MN+    Y  A   FD   +CDP        
Sbjct: 320 GSVDEFFFILENLLILLPNFTYLKSQSAIMNYNYMDYSVAENIFDNIFKCDPYRLEDLDI 379

Query: 397 -TNIFPYIQ----LACMSYREGHFDDCETLFSEARRKFPDAPEVPNFFAEILSDKGEIEK 451
            +NI   +Q    LA ++    H D           +F   PE     A   S + E EK
Sbjct: 380 YSNILYVMQKHSKLAYLAQYVSHVD-----------RF--RPETCCIVANYYSARQEHEK 426

Query: 452 AAAEYDKAIELESKSENIHVGIAPLVGKATTLLKYPTVE--NFIEADDLFEQANNEDPRS 509
           +   + +A+ L  KS +           A TL+ +  VE  N   A + + +A + + R 
Sbjct: 427 SIMYFRRALVLNKKSTS-----------AWTLMGHEFVELKNSHAAIECYRRAVDINERD 475

Query: 510 EKAKMGLAQ 518
            KA  GL Q
Sbjct: 476 YKAWFGLGQ 484

 Score = 31.6 bits (70), Expect = 7.5,   Method: Compositional matrix adjust.
 Identities = 34/139 (24%), Positives = 69/139 (49%), Gaps = 7/139 (5%)

Query: 93  GNAYFKVKDYENAINYYKFALQLKN-DPVFYSNMAACYISLEHNKEAIEACSKALELNPD 151
           G AY  +  +  ++ Y++ A  LK  D   +  +A CY  L+++++AIE   +AL+L+ +
Sbjct: 483 GQAYEVLDMHLYSLYYFQKACTLKPLDRRMWQALAECYGLLKNSEQAIECYRRALQLSSN 542

Query: 152 YSK---VLLKRAAVYE---NIGKFADALLDLTAVSLNGDYNDATIQPIVERVLNKQAMMA 205
             +   +L + A  YE   +I      +L   A+  + D +  T + +  R+   +  M 
Sbjct: 543 AGQDVLLLFRMAEQYELILDIESCKQNMLKCVALEDSSDGSFVTDETVKARLWLARYEMR 602

Query: 206 LKDHLEASEKNKVLPSYTS 224
           + ++ EA +  K + + TS
Sbjct: 603 MHNYQEAYDYAKRISNGTS 621

>Kpol_339.13 s339 complement(21257..23317) [2061 bp, 686 aa] {ON}
           complement(21257..23317) [2061 nt, 687 aa]
          Length = 686

 Score = 34.3 bits (77), Expect = 0.92,   Method: Compositional matrix adjust.
 Identities = 30/114 (26%), Positives = 48/114 (42%), Gaps = 30/114 (26%)

Query: 88  ELKKRGNAYFKVKDYENAINYYKFALQLKNDPVFY-------SNMAACYISLEHNKEAIE 140
           E K+RG   FK  DY  A+  Y+ +L     P+ +       SN+ A        +++IE
Sbjct: 396 EFKERGTENFKTGDYVTALEAYQKSLNTL--PIKHPLRIIASSNILASMSKTGEYRKSIE 453

Query: 141 ACSKALELNPD---------------------YSKVLLKRAAVYENIGKFADAL 173
             + ALE  P                      + K++LKRA  +E+I  + +AL
Sbjct: 454 ISTSALEQFPGDQKQWNEFIQDSEPQRTYKDIWPKIVLKRAEAFEHIESYENAL 507

>NCAS0B08010 Chr2 complement(1517575..1520772) [3198 bp, 1065 aa]
           {ON} Anc_1.88 YGR047C
          Length = 1065

 Score = 34.3 bits (77), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 17/56 (30%), Positives = 31/56 (55%)

Query: 118 DPVFYSNMAACYISLEHNKEAIEACSKALELNPDYSKVLLKRAAVYENIGKFADAL 173
           D  F+  +A     L+H ++AI   S+ + LN +  + L +R+ +Y+ IG+   AL
Sbjct: 214 DWEFWKVVAILSSELDHIRQAIYCFSRVIHLNGEEWESLYRRSLLYKKIGQIGRAL 269

>ZYRO0C03564g Chr3 (281661..284951) [3291 bp, 1096 aa] {ON} similar
           to uniprot|P89105 Saccharomyces cerevisiae YOL145C CTR9
           Component of the Paf1p complex which is a large complex
           that binds to and modulates the activity of RNA
           polymerase II and is required for expression of a subset
           of genes including cyclin genes contains TPR repeats
          Length = 1096

 Score = 34.3 bits (77), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 25/86 (29%), Positives = 43/86 (50%), Gaps = 11/86 (12%)

Query: 92  RGNAYFKVKDYENAINYYKFALQLKNDPVFYSN----MAACYISLEHNKEAIEACSKALE 147
           R    ++ K+Y  ++  ++  L +  +PV Y +    +  C+  L+  K AI A  +ALE
Sbjct: 188 RAKLLYQKKNYMASLRAFQELLVI--NPVMYPDPRIGIGMCFWQLKDYKLAIAAWKRALE 245

Query: 148 LNPDYSKVLLKRAAVYENIGKFADAL 173
           LNP     +   AAV   +G F ++L
Sbjct: 246 LNP-----VNNNAAVLVTLGNFHNSL 266

>SAKL0H02244g Chr8 (216327..218213) [1887 bp, 628 aa] {ON} similar
           to uniprot|P16522 Saccharomyces cerevisiae YHR166C CDC23
           Subunit of the anaphase-promoting complex/cyclosome
           (APC/C) which is a ubiquitin-protein ligase required for
           degradation of anaphase inhibitors including mitotic
           cyclins during the metaphase/anaphase transition
          Length = 628

 Score = 34.3 bits (77), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 33/131 (25%), Positives = 65/131 (49%), Gaps = 13/131 (9%)

Query: 93  GNAYFKVKDYENAINYYKFALQL-KNDPVFYSNMAACYISLEHNKEAIEACSKALELNPD 151
            N Y   +++E +I Y++ AL L KN    ++ M   ++ L+++  AIE+  +A+++NP 
Sbjct: 405 ANYYSAKQEHEKSIMYFRRALTLNKNCTSAWTLMGHEFVELKNSHAAIESYRRAVDINPR 464

Query: 152 YSKVLLKRAAVYENIGKFADALLDLTAVSLNGDYNDATIQPIVERVLNKQAMMALKDHLE 211
             K        YE        +LD+   SL        ++P+ +R+   QA+ +  + L 
Sbjct: 465 DFKAWYGLGQAYE--------VLDMHLYSLYYFQKACALKPLDKRMW--QALASCYEKL- 513

Query: 212 ASEKNKVLPSY 222
            S+K++ +  Y
Sbjct: 514 -SKKDESIKCY 523

>TPHA0B04430 Chr2 (1036315..1039527) [3213 bp, 1070 aa] {ON}
           Anc_1.88 YGR047C
          Length = 1070

 Score = 34.3 bits (77), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 17/57 (29%), Positives = 30/57 (52%)

Query: 117 NDPVFYSNMAACYISLEHNKEAIEACSKALELNPDYSKVLLKRAAVYENIGKFADAL 173
           +D  F+  +A     L H ++AI   S+ + +N D  + L  R+ +Y+ IG+   AL
Sbjct: 214 SDWQFWKVVARLSADLGHKRQAIYCYSRVININADDWESLYNRSTMYKEIGQIGRAL 270

>TPHA0M00270 Chr13 complement(53640..54773) [1134 bp, 377 aa] {ON}
           Anc_6.21 YOR007C
          Length = 377

 Score = 33.9 bits (76), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 22/64 (34%), Positives = 35/64 (54%), Gaps = 1/64 (1%)

Query: 86  ASELKKRGNAYFKVKDYENAINYYKFALQL-KNDPVFYSNMAACYISLEHNKEAIEACSK 144
           A +LK++GN   K K Y  AI  Y  A++L   +  +Y+N A  YI   +   AI   +K
Sbjct: 134 AEKLKEKGNEEMKAKQYSKAIGSYSDAIKLYPTNFNYYNNRALAYIKANNFDHAIIDANK 193

Query: 145 ALEL 148
           ++E+
Sbjct: 194 SIEI 197

>KAFR0B00250 Chr2 complement(58608..62870) [4263 bp, 1420 aa] {ON}
           Anc_7.546 YPR189W
          Length = 1420

 Score = 34.3 bits (77), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 35/123 (28%), Positives = 51/123 (41%), Gaps = 21/123 (17%)

Query: 354 FQKAIDLDPNMAAIYYHRGQMNFIIQKYEKAGEDFDKAKECDPTN----IFPYIQLACMS 409
           FQ A+ +DPN    +   GQ  F   + E + + F+KA E  P +     F  + LA M 
Sbjct: 707 FQSALRVDPNDIESWVGLGQAYFACGRVEASIKVFEKAVELSPDHNYAKYFNSVALAQM- 765

Query: 410 YREGHFDDCETLFSEARRKFPDAPEVPNFFAEI----------LSDKGEIEKAAAEYDKA 459
                 D+ E      R    D PE   F  E+          L ++G + KA A   +A
Sbjct: 766 ------DEFERAIDILRHVLKDEPEKEVFKMELATQIVDYSFDLYNQGYLMKAIAIISEA 819

Query: 460 IEL 462
           I+L
Sbjct: 820 IDL 822

>KLLA0E20857g Chr5 (1860517..1862649) [2133 bp, 710 aa] {ON} similar
           to uniprot|Q751K0 Ashbya gossypii AGL294W AGL294Wp and
           some similarites with YBL084C uniprot|P38042
           Saccharomyces cerevisiae YBL084C CDC27 Subunit of the
           Anaphase-Promoting Complex/Cyclosome (APC/C) which is a
           ubiquitin-protein ligase required for degradation of
           anaphase inhibitors including mitotic cyclins during the
           metaphase/anaphase transition
          Length = 710

 Score = 33.9 bits (76), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 43/180 (23%), Positives = 69/180 (38%), Gaps = 33/180 (18%)

Query: 372 GQMNFIIQKYEKAGEDFDKAKECDPTNIFPYIQLACMSYREGHFDDCETLFSEARRKFPD 431
           G+++F +  YE A   F K +   PT                 F D +T FS       D
Sbjct: 431 GKLHFELVNYEMAKSYFTKLRTLQPT----------------RFQDMDT-FSTVLWHLQD 473

Query: 432 APEVPNFFAEILS-DK---------GEIEKAAAEYDKAIELESKSENIHVGIAPLVGKAT 481
              +    AE+L+ DK         G +     ++D+AI    K+    + + P    A 
Sbjct: 474 KTHLSALCAELLTLDKYNPIAWCSMGNLHSLNKDHDEAITAFGKA----IQLDPFFAYAY 529

Query: 482 TLL--KYPTVENFIEADDLFEQANNEDPRSEKAKMGLAQCKLQQEDLDDAIRLFEEAAIL 539
           TL   +Y   + F  A   F +A   +     A  GL  C ++    ++A+  FE+A  L
Sbjct: 530 TLQGHEYSNNDAFDNAKSCFRKALTIEKTHYNALYGLGMCCVKLGKFEEALLFFEKARAL 589

 Score = 33.9 bits (76), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 29/100 (29%), Positives = 50/100 (50%), Gaps = 6/100 (6%)

Query: 77  AETAEKNEYASELKKRGNAYFKVKDYENAINYYKFALQLKNDPVFYSNMAACYISLEHNK 136
           A T EK  Y + L   G    K+  +E A+ +++ A  L  +PV       C ++LE  +
Sbjct: 552 ALTIEKTHY-NALYGLGMCCVKLGKFEEALLFFEKARAL--NPVNVILNCCCGVALERLQ 608

Query: 137 E---AIEACSKALELNPDYSKVLLKRAAVYENIGKFADAL 173
           +   A+     A EL P+ S  L K++ +  N+G+++ AL
Sbjct: 609 QPERALNFYELATELQPNSSLALFKKSQLLLNMGQYSSAL 648

 Score = 31.6 bits (70), Expect = 6.3,   Method: Compositional matrix adjust.
 Identities = 37/145 (25%), Positives = 57/145 (39%), Gaps = 16/145 (11%)

Query: 331 PKSYIYLGLLMADKGLDEEYYSNFQKAIDLDPNMAAIYYHRGQMNFIIQKYEKAGED-FD 389
           P ++  +G L +     +E  + F KAI LDP  A  Y         +Q +E +  D FD
Sbjct: 492 PIAWCSMGNLHSLNKDHDEAITAFGKAIQLDPFFAYAY--------TLQGHEYSNNDAFD 543

Query: 390 KAKEC-------DPTNIFPYIQLACMSYREGHFDDCETLFSEARRKFPDAPEVPNFFAEI 442
            AK C       + T+      L     + G F++    F +AR   P    +       
Sbjct: 544 NAKSCFRKALTIEKTHYNALYGLGMCCVKLGKFEEALLFFEKARALNPVNVILNCCCGVA 603

Query: 443 LSDKGEIEKAAAEYDKAIELESKSE 467
           L    + E+A   Y+ A EL+  S 
Sbjct: 604 LERLQQPERALNFYELATELQPNSS 628

>KLTH0F02508g Chr6 complement(214785..217952) [3168 bp, 1055 aa]
           {ON} similar to uniprot|P33339 Saccharomyces cerevisiae
           YGR047C
          Length = 1055

 Score = 33.9 bits (76), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 39/174 (22%), Positives = 69/174 (39%), Gaps = 10/174 (5%)

Query: 360 LDPNMAAIYYHRGQMNFIIQKYEKAGEDFDKAKECDPTNIFPYIQLACMSYREGHFDDCE 419
           LDP +A +     +  F+    + A   +++  + D  N   Y  L  +   +G F+DC 
Sbjct: 148 LDPEVAQLLSEANEA-FVRNDIQVAEHLYNEVIKKDVKNFAAYKTLGDIYQLQGRFNDCC 206

Query: 420 TLFSEARRKFPDAPEVPNFFAEILSDKGEIEKAAAEYDKAIELESKSENIHVGIAPLVGK 479
             +  A    P   E     A + SD G I +A   Y +A+ + S       G + L  K
Sbjct: 207 NSWFLAAHLNPSDWEFWKVVATLSSDLGHIRQAIYCYTRALRMNSDDWECLYGRSILYKK 266

Query: 480 ATTLLKYPTVENFIEADDLFEQANNEDPRSEKAKMGLAQCKLQQEDLDDAIRLF 533
              L +         A + F++ +N +P        LA   +    +++AI L+
Sbjct: 267 TNQLGR---------ALEGFQRLHNNNPYDGNLLRELAILYVDYNRINEAIELY 311

>TBLA0D00460 Chr4 complement(113831..116338) [2508 bp, 835 aa] {ON}
           Anc_7.412 YBL084C
          Length = 835

 Score = 33.9 bits (76), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 20/54 (37%), Positives = 29/54 (53%), Gaps = 3/54 (5%)

Query: 354 FQKAIDLDPNMAAIYYHRGQMNFIIQKYEKAGEDFDKAKECDPTNIFPYIQLAC 407
           ++KAI  DPN    YY  G     + +Y++A   F+KAK  +P+N    I L C
Sbjct: 675 YRKAIACDPNHYNAYYGLGTCCMRLGQYDQALLYFEKAKMINPSNA---ILLCC 725

 Score = 31.2 bits (69), Expect = 9.1,   Method: Compositional matrix adjust.
 Identities = 42/189 (22%), Positives = 76/189 (40%), Gaps = 27/189 (14%)

Query: 360 LDPNMAAIYYHRGQMNFIIQKYEKAGEDFDKAKECDPTNIFPYIQLACMSYREGHFDDCE 419
           L  NM       G++ F I  Y+ +   F K  +  PT +  +   + + +   H  D  
Sbjct: 545 LRDNMPWCLATMGKLQFEIVNYKLSINYFKKLYDLQPTRLKDFEIFSTVLW---HLKDKI 601

Query: 420 TLFSEARRKFPDAPE-------VPNFFAEILSDKGEIEKAAAEYDKAIELESKSENIHVG 472
            L   ++    + P        + N+F+ I            ++DKAI+   K+  I+  
Sbjct: 602 NLSQISKTLIDNYPNNSISWCFIGNYFSLI-----------NDHDKAIKYLKKATTIN-- 648

Query: 473 IAPLVGKATTLLKY--PTVENFIEADDLFEQANNEDPRSEKAKMGLAQCKLQQEDLDDAI 530
             P    A TL  +   +++ F  A + + +A   DP    A  GL  C ++    D A+
Sbjct: 649 --PRFTYAYTLEGHEQASIDAFDTAKNCYRKAIACDPNHYNAYYGLGTCCMRLGQYDQAL 706

Query: 531 RLFEEAAIL 539
             FE+A ++
Sbjct: 707 LYFEKAKMI 715

>KLTH0H00704g Chr8 (70712..72577) [1866 bp, 621 aa] {ON} similar to
           uniprot|P16522 Saccharomyces cerevisiae YHR166C CDC23
           Subunit of the anaphase-promoting complex/cyclosome
           (APC/C) which is a ubiquitin-protein ligase required for
           degradation of anaphase inhibitors including mitotic
           cyclins during the metaphase/anaphase transition
          Length = 621

 Score = 33.9 bits (76), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 34/125 (27%), Positives = 59/125 (47%), Gaps = 10/125 (8%)

Query: 93  GNAYFKVKDYENAINYYKFALQL-KNDPVFYSNMAACYISLEHNKEAIEACSKALELNPD 151
            N Y   +++E +I Y++ AL L KN    ++ M   ++ L+++  AIE   +A+++NP 
Sbjct: 398 ANYYSAKQEHEKSILYFRRALTLNKNCTSAWTLMGHEFVELKNSHAAIECYRRAVDINPR 457

Query: 152 YSKVLLKRAAVYENIGKFADALLDLTAVSLNGDYNDATIQPIVERVLNKQAMMALK-DHL 210
             K        YE        +LD+   SL        ++P+ +R+    A    K D+L
Sbjct: 458 DFKAWYGLGQAYE--------VLDMHLYSLYYFQKSCALKPLDKRMWQALASCYEKVDNL 509

Query: 211 EASEK 215
           E S K
Sbjct: 510 EESIK 514

>Kpol_1050.112 s1050 (249717..252797,252855..252863,252906..253898)
           [4083 bp, 1360 aa] {ON}
           (249717..252797,252855..252863,252906..253898) [4083 nt,
           1361 aa]
          Length = 1360

 Score = 33.5 bits (75), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 34/131 (25%), Positives = 53/131 (40%), Gaps = 14/131 (10%)

Query: 372 GQMNFIIQKYEKAGEDFDKAKECDPTNIFPYIQLACMSYREGHFDDCETLFSEARRKFPD 431
           G  N   Q+   A E F  A   +P N+  ++ L       G  +    +F +A    PD
Sbjct: 675 GIANLERQQESDAIEWFQSALRIEPNNVESWVGLGQSYLSCGRIEASIRVFEKATELDPD 734

Query: 432 APEVPNFFAEILSDKGEIEKAAAEYDKAIELESKSENIHVGIAPLVGKATTLLKYPTVEN 491
                 F A+ LS+ GE  K+ + +++ I    K E+  V  +       TL+K+     
Sbjct: 735 HLYAKYFTAQSLSEMGEYVKSISIFEEIIMETPKEESFQVSYSE------TLMKH----- 783

Query: 492 FIEADDLFEQA 502
              A DLF Q 
Sbjct: 784 ---AQDLFNQG 791

>KLLA0C02453g Chr3 complement(216740..219826) [3087 bp, 1028 aa]
           {ON} similar to uniprot|P33339 Saccharomyces cerevisiae
           YGR047C
          Length = 1028

 Score = 33.5 bits (75), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 21/85 (24%), Positives = 40/85 (47%), Gaps = 1/85 (1%)

Query: 90  KKRGNAYFKVKDYENAINYYKFALQLKN-DPVFYSNMAACYISLEHNKEAIEACSKALEL 148
           K  G+ Y     + +  N +  A  L + D  F+  +A     L H ++AI   ++A+ +
Sbjct: 149 KTLGDIYHLQGRFNDCCNSWFLAAHLNSTDWEFWKMVAELSAELAHVRQAIYCYTRAIRI 208

Query: 149 NPDYSKVLLKRAAVYENIGKFADAL 173
           N +  + +  RA +Y+ IG+   A 
Sbjct: 209 NNEEWECIYNRALLYKEIGQLGRAF 233

>TPHA0L01210 Chr12 (252106..253872) [1767 bp, 588 aa] {ON} Anc_8.470
           YDR244W
          Length = 588

 Score = 33.1 bits (74), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 21/81 (25%), Positives = 41/81 (50%), Gaps = 1/81 (1%)

Query: 93  GNAYFKVKDYENAINYYKFALQLK-NDPVFYSNMAACYISLEHNKEAIEACSKALELNPD 151
           G  ++   +++  I+ +K AL +   D + ++ + A   +    +EAI+A  KAL+L P 
Sbjct: 438 GLLFYSNNEFDKTIDCFKTALVIHPEDELMWNRLGASLANSSRPEEAIQAYHKALQLKPS 497

Query: 152 YSKVLLKRAAVYENIGKFADA 172
           + +     A    NIG + +A
Sbjct: 498 FVRARYNLAVSSINIGCYKEA 518

>CAGL0B01375g Chr2 complement(123330..126662) [3333 bp, 1110 aa]
           {ON} similar to uniprot|P89105 Saccharomyces cerevisiae
           YOL145c CTR9 required for G1 cyclin expression
          Length = 1110

 Score = 33.5 bits (75), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 24/86 (27%), Positives = 45/86 (52%), Gaps = 11/86 (12%)

Query: 92  RGNAYFKVKDYENAINYYKFALQ----LKNDPVFYSNMAACYISLEHNKEAIEACSKALE 147
           R    ++ K+Y  ++  ++  L     LK DP     +  C+  L+  K AI+A  +AL+
Sbjct: 188 RAKLMYQKKNYVASLKLFQELLVINPVLKPDPRI--GIGMCFWQLKDYKLAIQAWERALQ 245

Query: 148 LNPDYSKVLLKRAAVYENIGKFADAL 173
           L+P+      K+A++   +GKF ++L
Sbjct: 246 LDPNN-----KQASILVLLGKFHNSL 266

>NDAI0G03710 Chr7 complement(894337..897702) [3366 bp, 1121 aa] {ON}
           Anc_3.5 YOL145C
          Length = 1121

 Score = 33.5 bits (75), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 26/88 (29%), Positives = 42/88 (47%), Gaps = 11/88 (12%)

Query: 92  RGNAYFKVKDYENAINYYKFALQLKNDPVFYSN----MAACYISLEHNKEAIEACSKALE 147
           R    F+ K++  ++    F   L N+PV   +    + AC+  L+  K AI A  ++LE
Sbjct: 203 RAKLLFRKKNFMASLKL--FQELLVNNPVLKPDPRIGIGACFWQLKDYKMAINAWERSLE 260

Query: 148 LNPDYSKVLLKRAAVYENIGKFADALLD 175
           L+P       K + V   +GKF   L+D
Sbjct: 261 LDPTN-----KNSKVLCLLGKFHKTLID 283

>KLTH0G04620g Chr7 complement(367028..368365) [1338 bp, 445 aa] {ON}
           similar to uniprot|Q02354 Saccharomyces cerevisiae
           YDR449C UTP6 Nucleolar protein component of the small
           subunit (SSU) processome containing the U3 snoRNA that
           is involved in processing of pre-18S rRNA
          Length = 445

 Score = 33.1 bits (74), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 16/56 (28%), Positives = 27/56 (48%), Gaps = 1/56 (1%)

Query: 381 YEKAGEDFDKAKECDPTNIFPYIQLACMSYR-EGHFDDCETLFSEARRKFPDAPEV 435
           Y K    +++  +  PTNI  ++  A   Y    +F  C T+F    R  PD+P++
Sbjct: 127 YRKIHNVYNQLLKLHPTNIDIWVSCAKYEYEVHANFKSCRTVFQTGLRFNPDSPQL 182

>KLTH0H14872g Chr8 complement(1289638..1291509) [1872 bp, 623 aa]
           {ON} weakly similar to uniprot|Q06677 Saccharomyces
           cerevisiae YDR320C SWA2 auxilin-like protein
          Length = 623

 Score = 33.1 bits (74), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 27/110 (24%), Positives = 46/110 (41%), Gaps = 24/110 (21%)

Query: 88  ELKKRGNAYFKVKDYENAINYYKFALQ--LKNDP---VFYSNMAACYISLEHNKEAIEAC 142
           E K++G   F+  DY  A   Y+ +L       P   V +SN+  C + +   +EA+   
Sbjct: 327 EFKEKGANSFRTGDYHAAFQNYEKSLNSLPLTHPLRVVSFSNIIICRLKVGEYREALSDA 386

Query: 143 SKALELNPD-------------------YSKVLLKRAAVYENIGKFADAL 173
           S AL+L P                    +SK++  +A  +E +  +  AL
Sbjct: 387 SSALKLIPQGSMNSNIPNLNPPKTYKEFWSKIMNNKAVAFERVENYEKAL 436

>KAFR0C03820 Chr3 complement(774134..776248) [2115 bp, 704 aa] {ON}
           Anc_2.665 YKL022C
          Length = 704

 Score = 33.1 bits (74), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 22/78 (28%), Positives = 32/78 (41%), Gaps = 1/78 (1%)

Query: 362 PNMAAIYYHRGQMNFIIQKYEKAGEDFDKAKECDPTNIFPYIQLACMSYREGHFDDCETL 421
           P  A  ++  G     + K  +A + F K+   DP     ++  A     EG  D   T 
Sbjct: 406 PKSAITWFSVGTYYLTMNKIHEARKFFSKSSIIDPNFAPSWLGFAHTFSIEGEQDQALTA 465

Query: 422 FSEARRKFPDAPEVPNFF 439
           +S A R FP    +PN F
Sbjct: 466 YSTAARFFPGV-HLPNLF 482

>Kwal_47.18464 s47 (834937..836274) [1338 bp, 445 aa] {ON} YDR449C
           (UTP6) - Protein required for cell viability [contig
           195] FULL
          Length = 445

 Score = 32.7 bits (73), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 26/100 (26%), Positives = 46/100 (46%), Gaps = 13/100 (13%)

Query: 381 YEKAGEDFDKAKECDPTNIFPYIQLACMSYR-EGHFDDCETLFSEARRKFPDAPEVP--- 436
           Y K    +++  +  PTNI  ++  A   Y    +F  C T+F    R  PD+P++    
Sbjct: 127 YRKIHNVYNQLLKLHPTNIDIWVSCAKYEYEVHANFKSCRTVFQTGLRFNPDSPQLWYEY 186

Query: 437 -----NFFAEILSDK---GEIEKAAAEYD-KAIELESKSE 467
                NF  ++++ +   G I +   E D +A E E K++
Sbjct: 187 VKFELNFITKLINRRKVMGLISEREQELDMQAQEQEKKAQ 226

>ZYRO0C11594g Chr3 complement(907459..909345) [1887 bp, 628 aa] {ON}
           similar to uniprot|P16522 Saccharomyces cerevisiae
           YHR166C CDC23 Subunit of the anaphase-promoting
           complex/cyclosome (APC/C) which is a ubiquitin-protein
           ligase required for degradation of anaphase inhibitors
           including mitotic cyclins during the metaphase/anaphase
           transition
          Length = 628

 Score = 32.7 bits (73), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 26/78 (33%), Positives = 43/78 (55%), Gaps = 4/78 (5%)

Query: 93  GNAYFKVKDYENAINYYKFALQLKN-DPVFYSNMAACYISLEHNKEAIEACSKALE--LN 149
           G AY  +  +  ++ Y++ A  LK  D   +  +AACY  + + +EAI+   +AL+  L+
Sbjct: 473 GQAYEVLDMHLYSLYYFQKACTLKPLDRRMWQALAACYAKVGNRQEAIKCYERALQLSLH 532

Query: 150 PDYSKVLLKRAA-VYENI 166
            D   V+L R A +YE I
Sbjct: 533 ADQDSVILYRLADLYEQI 550

>NDAI0B05320 Chr2 (1299911..1303027) [3117 bp, 1038 aa] {ON}
           Anc_1.88 YGR047C
          Length = 1038

 Score = 32.7 bits (73), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 17/56 (30%), Positives = 30/56 (53%)

Query: 118 DPVFYSNMAACYISLEHNKEAIEACSKALELNPDYSKVLLKRAAVYENIGKFADAL 173
           D  F+  +A     L+H ++AI   S+   LN +  + L +R+ +Y+ IG+   AL
Sbjct: 192 DWEFWKVVAILSADLDHIRQAIYCFSRVCALNHEEWESLYRRSLLYKKIGQIGRAL 247

>AGL294W Chr7 (154711..156681) [1971 bp, 656 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YBL084C (CDC27)
          Length = 656

 Score = 32.7 bits (73), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 22/84 (26%), Positives = 46/84 (54%), Gaps = 5/84 (5%)

Query: 93  GNAYFKVKDYENAINYYKFALQLKNDPVFYSNMAACYISLEH---NKEAIEACSKALELN 149
           G +  K+  Y+ A+ +++ A  +  +PV       C ++LE     ++A++    A EL 
Sbjct: 513 GMSCIKLGQYDEALLHFEKARSI--NPVNVILNCCCGVALERLGRREKALDFYQLACELQ 570

Query: 150 PDYSKVLLKRAAVYENIGKFADAL 173
           P+ S  L K++ +  N+G++++AL
Sbjct: 571 PNSSLALFKKSQLLFNLGQYSNAL 594

 Score = 32.7 bits (73), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 36/170 (21%), Positives = 67/170 (39%), Gaps = 10/170 (5%)

Query: 354 FQKAIDLDPNMAAIYYHRGQMNFIIQKYEKAGEDFDKAKECDPTNIFPYIQLACMSYREG 413
           ++KA+ ++PN    +Y  G     + +Y++A   F+KA+  +P N+           R G
Sbjct: 495 YRKALAINPNHYNAHYGLGMSCIKLGQYDEALLHFEKARSINPVNVILNCCCGVALERLG 554

Query: 414 HFDDCETLFSEARRKFPDAPEVPNFFAEILSDKGEIEKAAAEYDKAIELESKSENIHVGI 473
             +     +  A    P++       +++L + G+   A   ++K  +L      +H  +
Sbjct: 555 RREKALDFYQLACELQPNSSLALFKKSQLLFNLGQYSNALQNFEKLEQLTPNEAPVHFLL 614

Query: 474 APLVGKATTLLKYPTVENFIEADDLFEQANNEDPRS-EKAKMGLAQCKLQ 522
             L         Y  V    +A   F  A N DP   +  K  L +C  Q
Sbjct: 615 GQL---------YQIVGRKKDAITQFTIAMNLDPNGIQLVKEALEKCHEQ 655

>TPHA0O01870 Chr15 complement(371225..372526) [1302 bp, 433 aa] {ON}
           Anc_2.23 YNL220W
          Length = 433

 Score = 32.3 bits (72), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 33/127 (25%), Positives = 49/127 (38%), Gaps = 19/127 (14%)

Query: 40  ELKKSLDDGNDVGTASSKVEYKYL------------MINDEPDIELMKLAETAEKNEYAS 87
           EL  +  DG ++GT    +   Y             +IND+P       A       Y  
Sbjct: 120 ELSGASKDGKNIGTTGKGIGPTYSTKASRSGIRVHHLINDQPG------AWEEFVTRYMR 173

Query: 88  ELKKRGNAYFKVK-DYENAINYYKFALQLKNDPVFYSNMAACYISLEHNKEAIEACSKAL 146
            LK R   Y     DYE  +N YK   + K  P     +   Y +L+ NK+ +   + AL
Sbjct: 174 LLKTRKERYGNFDYDYEEELNRYKNIYRQKLRPFVTDTVHFIYDALKSNKKILVEGANAL 233

Query: 147 ELNPDYS 153
            L+ D+ 
Sbjct: 234 MLDIDFG 240

>NCAS0D02670 Chr4 complement(512529..513584) [1056 bp, 351 aa] {ON}
           Anc_6.21 YOR007C
          Length = 351

 Score = 32.3 bits (72), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 30/97 (30%), Positives = 50/97 (51%), Gaps = 6/97 (6%)

Query: 83  NEYASELKKRGNAYFKVKDYENAINYYKFALQL--KND-PVFYSNMAACYISLEHNKEAI 139
           NE A +LK  GN   + ++Y++AI+ Y  A+ L  KN  PV    ++   ++L  +    
Sbjct: 81  NEQAIKLKLEGNKAVERENYKDAIDKYTRAIDLLKKNGLPVDRGYLSNKSLALTKSGRYE 140

Query: 140 EACSKAL---ELNPDYSKVLLKRAAVYENIGKFADAL 173
           EAC  AL   +++P +SK   + A       K+ DA+
Sbjct: 141 EACDDALACIKIDPTFSKGYSRLAEAKIGQNKYEDAM 177

>KAFR0C01850 Chr3 (369596..371536) [1941 bp, 646 aa] {ON} Anc_5.352
           YDR320C
          Length = 646

 Score = 32.3 bits (72), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 29/113 (25%), Positives = 52/113 (46%), Gaps = 30/113 (26%)

Query: 83  NEYASELKKRGNAYFKVKDYENAINYYKFALQL--KNDP---VFYSNMAACYISLEHNKE 137
           NEY S    RG+++FK  DY +A+  Y+ +L    ++ P   + YSN+ A  + +     
Sbjct: 358 NEYNS----RGSSFFKNGDYISALEEYEKSLNTLPQSHPLRIIAYSNITAAELKIGEYSN 413

Query: 138 AIEACSKALELNPD---------------------YSKVLLKRAAVYENIGKF 169
            ++   KAL+L P                      +SK++L++A   E++  F
Sbjct: 414 LVKKADKALKLFPKENLKWNLIIQDSEPHKSYKDIWSKLVLRKAEALEHLENF 466

>TBLA0B07970 Chr2 (1887119..1889182) [2064 bp, 687 aa] {ON} Anc_5.72
           YHR166C
          Length = 687

 Score = 32.3 bits (72), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 26/106 (24%), Positives = 51/106 (48%), Gaps = 9/106 (8%)

Query: 93  GNAYFKVKDYENAINYYKFALQL-KNDPVFYSNMAACYISLEHNKEAIEACSKALELNPD 151
            N Y   +++E +I Y++ AL L K +   ++ M   ++ L+++  AIE   +A+++NP 
Sbjct: 460 ANFYSTRQEHEKSIMYFRRALTLNKKNTSAWTLMGHEFVELKNSHAAIECYRRAVDINPR 519

Query: 152 YSKVLLKRAAVYENIGKFADALLDLTAVSLNGDYNDATIQPIVERV 197
             K        YE        +LD+   SL        ++P+ +R+
Sbjct: 520 DFKAWYGLGQAYE--------VLDMHLYSLYYFQKACALKPLDKRM 557

>TBLA0B04990 Chr2 (1171599..1175831) [4233 bp, 1410 aa] {ON}
           Anc_7.546 YPR189W
          Length = 1410

 Score = 32.3 bits (72), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 22/74 (29%), Positives = 36/74 (48%), Gaps = 7/74 (9%)

Query: 471 VGIAPLVGKATTLLKYPTVENFIEAD-------DLFEQANNEDPRSEKAKMGLAQCKLQQ 523
           +GI     K    L   TV  +++A         LFE+  +EDP + +AKMG     +++
Sbjct: 433 LGIPLHNSKLEVTLDLGTVYTYVDAPKNHNAALSLFEKIISEDPGNARAKMGKGIIFMER 492

Query: 524 EDLDDAIRLFEEAA 537
           E+ +DA  L +E  
Sbjct: 493 ENWNDANNLLKEVT 506

>Suva_12.114 Chr12 (164933..166042) [1110 bp, 370 aa] {ON} YJR032W
           (REAL)
          Length = 370

 Score = 32.0 bits (71), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 31/113 (27%), Positives = 46/113 (40%), Gaps = 23/113 (20%)

Query: 86  ASELKKRGNAYFKVKDYENAINYYKFALQLKNDPV-------------------FYSNMA 126
           AS +K+ G   FK KDYENA   Y+ +L   N+ +                    Y N++
Sbjct: 240 ASTIKESGTLLFKKKDYENAFFKYRKSLNYINEYMPEPDLDKEKNEQFTDLKMKVYLNLS 299

Query: 127 ACYISLEHNKEAIEACSKALEL----NPDYSKVLLKRAAVYENIGKFADALLD 175
               +LE    AI   +  LE+    N D +K   +R   Y    +  +AL D
Sbjct: 300 LALFNLERYDSAITYATYLLEMDNVPNKDRAKAYYRRGNSYLRKKRLDEALRD 352

>ZYRO0A10120g Chr1 (817803..819386) [1584 bp, 527 aa] {ON} similar
           to uniprot|Q03776 Saccharomyces cerevisiae YDR235W PRP42
           U1 snRNP protein involved in splicing required for U1
           snRNP biogenesis contains multiple tetriatricopeptide
           repeats
          Length = 527

 Score = 32.0 bits (71), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 24/76 (31%), Positives = 35/76 (46%), Gaps = 9/76 (11%)

Query: 347 DEEYYSNFQKAIDLDPNMAAIYYHRGQMNFIIQKYEKAGEDFDKAKECDPTNIFPYIQLA 406
           D  ++S + + I LDPN + +   R   N   Q + KA E   K++      I P++Q  
Sbjct: 460 DGRFWSLYSRLIYLDPNRSYLERRRCISN---QVWTKARERPTKSE------ILPHLQQF 510

Query: 407 CMSYREGHFDDCETLF 422
           C SY     D  E LF
Sbjct: 511 CQSYLPEDIDHLEDLF 526

>ZYRO0D10186g Chr4 complement(856401..858308) [1908 bp, 635 aa] {ON}
           similar to uniprot|Q06677 Saccharomyces cerevisiae
           YDR320C SWA2 auxilin-like protein
          Length = 635

 Score = 32.0 bits (71), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 33/142 (23%), Positives = 61/142 (42%), Gaps = 24/142 (16%)

Query: 53  TASSKVEYKYLMINDEPDIELMKLAETAEKNEYASELKKRGNAYFKVKDYENAINYYKFA 112
           +AS  V  +  ++   P  E+ +L+   E  + A EL K G+    +++YE + N     
Sbjct: 320 SASVSVSRQGSVVPTVPITEI-ELSGYNEFKDRAGELFKTGDYVAALQEYEKSANTLPHG 378

Query: 113 LQLKNDPVFYSNMAACYISLEHNKEAIEACSKALELNPD--------------------- 151
             L+   + YSN+ A  +     KE++   S AL+L P+                     
Sbjct: 379 HPLRI--ISYSNLMASQLKTGQYKESLHVASMALKLFPEDTTQWTQLIQNSEPSKTYRDM 436

Query: 152 YSKVLLKRAAVYENIGKFADAL 173
           + K++ +RA  +E+   F +A 
Sbjct: 437 WPKIVQRRAEAFEHSENFQEAF 458

>TDEL0G00960 Chr7 (191061..192929) [1869 bp, 622 aa] {ON} Anc_5.72
           YHR166C
          Length = 622

 Score = 32.0 bits (71), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 23/72 (31%), Positives = 39/72 (54%), Gaps = 3/72 (4%)

Query: 93  GNAYFKVKDYENAINYYKFALQLKN-DPVFYSNMAACYISLEHNKEAIEACSKALEL--N 149
           G AY  +  +  ++ Y++ A  LK  D   +  +A+CY  + + +EAI+   +AL+L  N
Sbjct: 467 GQAYEVLDMHLYSLYYFQKACTLKPLDKRMWQALASCYAKVGNRQEAIKCYERALQLSVN 526

Query: 150 PDYSKVLLKRAA 161
            D + VL  R A
Sbjct: 527 VDQNSVLFYRLA 538

>YOL145C Chr15 complement(49555..52788) [3234 bp, 1077 aa] {ON}
           CTR9Component of the Paf1p complex involved in
           transcription elongation; binds to and modulates the
           activity of RNA polymerases I and II; required for
           expression of a subset of genes, including cyclin genes;
           involved in SER3 repression by helping to maintain SRG1
           transcription-dependent nucleosome occupancy; contains
           TPR repeats
          Length = 1077

 Score = 32.0 bits (71), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 84/386 (21%), Positives = 150/386 (38%), Gaps = 71/386 (18%)

Query: 115 LKNDPVFYSNMAACYISLEHNKEAIEACSKALELNPDYSKVLLKRAAVYENIGKFADALL 174
           L+ DP     +  C+  L+ +K AI++  +AL+LNP  +      A++   +G+F ++  
Sbjct: 216 LQPDPRI--GIGLCFWQLKDSKMAIKSWQRALQLNPKNTS-----ASILVLLGEFRESFT 268

Query: 175 DLTAVSLNGDYNDATIQPIVERVLNKQAMMALKDHLEASEKNKVLPSYTSMAAFF-GVFD 233
           + T        ND T +    +     A+  L +    ++ N VL +      +F G + 
Sbjct: 269 NST--------NDKTFKEAFTK-----ALSDLNNIFSENQHNPVLLTLLQTYYYFKGDYQ 315

Query: 234 AETDIPGHDATEESDKILSDALTH-LYSQTKEGYDRCDSEFTKATELYKAKLENDRTNSV 292
              DI  H   + S  I    L+   +   +  Y   D  + K+  +++  L+ +  N +
Sbjct: 316 TVLDIYHHRILKMSPMIAKIVLSESSFWCGRAHYALGD--YRKSFIMFQESLKKNEDNLL 373

Query: 293 TNEKAAIAFEHTAIL-SFLKNDPLTAREL--VDEAIKLHPRPKSYIYLGLLMADKGLDEE 349
               A +    T I  + L+   +T   L   +E++    +  +YI LG+L A K  D +
Sbjct: 374 ----AKLGLGQTQIKNNLLEESIITFENLYKTNESL----QELNYI-LGMLYAGKAFDAK 424

Query: 350 YYSNFQKAIDLDPNMAAIYYHRGQMNF----------------IIQKYE----------- 382
              N       + N  A+ Y    +                  I Q YE           
Sbjct: 425 TAKNTSAKEQSNLNEKALKYLERYLKLTLATKNQLVISRAYLVISQLYELQNQYKTSLDY 484

Query: 383 --KAGEDFDKAKECDPTNIFPYIQLACMSYREGHFDDCETLFSEARRKFPDAPEVPNFFA 440
             KA E+ +  K+  P  +     LAC  +  G F   + LF +A+ K  D  E  N   
Sbjct: 485 LSKALEEMEFIKKEIPLEVLN--NLACYHFINGDFIKADDLFKQAKAKVSDKDESVNITL 542

Query: 441 EI----LSDKGEIEKAAAEYDKAIEL 462
           E      ++K + EK+ + Y +   L
Sbjct: 543 EYNIARTNEKNDCEKSESIYSQVTSL 568

>NDAI0C03350 Chr3 complement(769764..771713) [1950 bp, 649 aa] {ON}
           Anc_5.72
          Length = 649

 Score = 32.0 bits (71), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 41/191 (21%), Positives = 79/191 (41%), Gaps = 27/191 (14%)

Query: 93  GNAYFKVKDYENAINYYKFALQL-KNDPVFYSNMAACYISLEHNKEAIEACSKALELNPD 151
            N Y   +++E +I Y++ AL L K+    ++ M   ++ L+++  AIE   +A+++NP 
Sbjct: 427 ANYYSARQEHEKSIMYFRRALTLNKSCTSAWTLMGHEFVELKNSHAAIECYRRAVDINPK 486

Query: 152 YSKVLLKRAAVYENIGKFADALLDLTAVSLNGDYNDATIQPIVERVLNKQAMMALKDHLE 211
             K        YE        +L++   SL       ++QP+  R+   QA+     +++
Sbjct: 487 DFKAWYGLGQAYE--------VLEMHLYSLFYFQKACSLQPLDRRMW--QALGTC--YIK 534

Query: 212 ASEKNKVLPSYTSMAAFFGVFDAETDIPGHDATEESDKILSDALTHLYSQTKEGYDRCDS 271
              K+  L  +                  H    E D +L   +  +  Q K+  +RC  
Sbjct: 535 IGYKSDALKCFERALQ-------------HSGNIEQDSVLLFKIAEICEQLKQ-MERCKL 580

Query: 272 EFTKATELYKA 282
              +  EL K+
Sbjct: 581 HMIRCVELEKS 591

>Skud_14.198 Chr14 complement(364246..364770) [525 bp, 174 aa] {ON}
           YNL133C (REAL)
          Length = 174

 Score = 30.8 bits (68), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 29/102 (28%), Positives = 48/102 (47%), Gaps = 3/102 (2%)

Query: 50  DVGTASSKVEYKYLMINDE--PDIELMKLAETAEKNEYASELKKRGNAYFKVKDYENAIN 107
           + GT +S  E K L    E   +IE  K+ E  E+ +Y SE K++     + +   NAI+
Sbjct: 5   NSGTGNSTREKKPLKFVSEGVSNIETQKIREQVEQKKYESEYKRKTRKSLRDQLRSNAIS 64

Query: 108 YYKFALQLKNDPVFYSNMAACYISLEHNKEAIEACSKALELN 149
             K    L  D   ++ ++   +   HN ++ E+  K  ELN
Sbjct: 65  KQKQYNGLVRDRESFTRLSKDELEFYHNSKS-ESMKKEEELN 105

>KNAG0C05500 Chr3 (1069670..1071427) [1758 bp, 585 aa] {ON}
           Anc_5.352 YDR320C
          Length = 585

 Score = 31.6 bits (70), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 32/116 (27%), Positives = 53/116 (45%), Gaps = 17/116 (14%)

Query: 45  LDDGNDVGTASSKVEYKYLMINDEPDIEL-------MKLAETAEKNEYASELKKRGNAYF 97
           LD G D  + S    +    +N+ P IEL       M+L+   E     +EL K+G+   
Sbjct: 253 LDFGEDDSSKSGSRTH----VNNSPSIELPIVPISTMELSGYNEFRAKGTELFKKGDYSA 308

Query: 98  KVKDYENAINYY--KFALQLKNDPVFYSNMAACYISLEHNKEAIEACSKALELNPD 151
            V +YE ++N    K  L++    +  SNM   Y+ +    + ++    ALEL P+
Sbjct: 309 AVLEYEKSLNTLPEKHPLRI----IAMSNMMLPYLKIGEYTKCLKLAPLALELIPE 360

>Kwal_56.24750 s56 complement(1132221..1134080) [1860 bp, 619 aa]
           {ON} YHR166C (CDC23) - Cell division cycle protein
           [contig 160] FULL
          Length = 619

 Score = 31.6 bits (70), Expect = 6.3,   Method: Compositional matrix adjust.
 Identities = 27/111 (24%), Positives = 51/111 (45%), Gaps = 9/111 (8%)

Query: 93  GNAYFKVKDYENAINYYKFALQL-KNDPVFYSNMAACYISLEHNKEAIEACSKALELNPD 151
            N Y   +++E +I Y++ AL L K     ++ M   ++ L+++  AIE   +A+++NP 
Sbjct: 396 ANYYSAKQEHEKSIMYFRRALTLNKKCTSAWTLMGHEFVELKNSHAAIECYRRAVDINPR 455

Query: 152 YSKVLLKRAAVYENIGKFADALLDLTAVSLNGDYNDATIQPIVERVLNKQA 202
             K        YE        +LD+   SL        ++P+ +R+    A
Sbjct: 456 DFKAWYGLGQAYE--------VLDMHLYSLYYFQKSCALKPLDKRMWQALA 498

>TPHA0A05290 Chr1 complement(1198497..1200497) [2001 bp, 666 aa]
           {ON} Anc_5.72 YHR166C
          Length = 666

 Score = 31.6 bits (70), Expect = 7.4,   Method: Compositional matrix adjust.
 Identities = 28/116 (24%), Positives = 55/116 (47%), Gaps = 9/116 (7%)

Query: 93  GNAYFKVKDYENAINYYKFALQL-KNDPVFYSNMAACYISLEHNKEAIEACSKALELNPD 151
            N Y   +++E +I Y++ A+ L K +   ++ M   ++ L++++ AIE    A+++NP 
Sbjct: 444 ANYYSARQEHEKSILYFRRAITLNKKNISAWTLMGHEFVELKNSQAAIECYRHAVDINPR 503

Query: 152 YSKVLLKRAAVYENIGKFADALLDLTAVSLNGDYNDATIQPIVERVLNKQAMMALK 207
             K        YE        +LD+   SL       T++P+ +R+    A   +K
Sbjct: 504 DFKAWYGLGQAYE--------VLDMHLYSLYYFQKACTLKPLDKRMWQALASCYVK 551

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.315    0.131    0.368 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 61,473,032
Number of extensions: 2758145
Number of successful extensions: 8700
Number of sequences better than 10.0: 330
Number of HSP's gapped: 8595
Number of HSP's successfully gapped: 529
Length of query: 587
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 472
Effective length of database: 40,294,809
Effective search space: 19019149848
Effective search space used: 19019149848
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 69 (31.2 bits)