Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
CAGL0L01111g7.350ON38138120240.0
Kpol_530.317.350ON38037816940.0
Kwal_56.246427.350ON38138116830.0
YDL168W (SFA1)7.350ON38637616810.0
Smik_4.707.350ON38638016800.0
KLTH0H01254g7.350ON38138116750.0
Skud_4.897.350ON38538016700.0
Suva_4.787.350ON38538016530.0
TBLA0E00390singletonON38338016480.0
KLLA0D12342g7.350ON38437916380.0
SAKL0F11374g7.350ON38338016350.0
ACL148C7.350ON38137816330.0
Ecym_47237.350ON38137916270.0
TPHA0F029707.350ON38137716200.0
TDEL0C019807.350ON38538015960.0
KAFR0B008807.350ON38137815940.0
NCAS0A141607.350ON45138015990.0
ZYRO0F11704g7.350ON38237915880.0
KNAG0C037907.350ON38238513730.0
NDAI0A018907.350ON42238013590.0
SAKL0A00880gsingletonON38837611861e-162
KLLA0B00451gsingletonON3863772831e-27
KNAG0K020003.118ON3503882732e-26
YBR145W (ADH5)3.118ON3513792582e-24
KLLA0D19929gsingletonON3863442584e-24
NCAS0I023503.118ON3513622565e-24
AER032W3.118ON3512792531e-23
Suva_4.3943.118ON3513792531e-23
KAFR0G014203.118ON3513652531e-23
KAFR0A007902.480ON3773752513e-23
Skud_2.2723.118ON3513792495e-23
NCAS0I01720singletonON3513782487e-23
SAKL0C10164g3.118ON3513792487e-23
Ecym_53313.118ON3483752471e-22
CAGL0J01441g2.480ON3723382471e-22
Smik_2.2843.118ON3513672452e-22
TBLA0I011402.480ON3773842435e-22
Kpol_1058.118.16ON3533532416e-22
Skud_13.477na 1ON3483592391e-21
TBLA0E034403.118ON3513622372e-21
YOL086C (ADH1)3.118ON3483592372e-21
SAKL0F06270gna 2ON3513792372e-21
TPHA0M007303.118ON3503652353e-21
KLTH0G18986g8.16ON3543812354e-21
TBLA0E03430singletonON3513622344e-21
KLLA0B09064gna 3ON3743212355e-21
Kwal_56.231983.118ON3512832336e-21
KLLA0F13530g2.480ON3753672347e-21
Kwal_55.19574singletonON3563592337e-21
YMR303C (ADH2)na 1ON3483612337e-21
Ecym_73912.480ON3753872331e-20
KLTH0G15686g3.118ON3512982321e-20
Smik_13.520na 1ON3482982311e-20
NDAI0A069303.118ON3513622302e-20
KAFR0L02010singletonON3513782292e-20
SAKL0B00814g8.16ON3543482292e-20
SAKL0B08184gna 3ON3733772293e-20
KLTH0D05588g2.480ON3893672294e-20
TPHA0G032102.480ON3773732285e-20
Smik_15.713.118ON3483592265e-20
KLLA0F18260gsingletonON3482772258e-20
Suva_13.2612.480ON3753762268e-20
Suva_13.494na 1ON3482982241e-19
KLLA0F21010g3.118ON3503772241e-19
KLTH0E05588gna 2ON3482672241e-19
CAGL0I07843g3.118ON3523782231e-19
YMR083W (ADH3)2.480ON3753652242e-19
AAR084WsingletonON3852722242e-19
Smik_13.2662.480ON3753652223e-19
Suva_15.813.118ON3483592195e-19
Kwal_26.77992.480ON3873832205e-19
KNAG0K01040singletonON3912662206e-19
Skud_13.2402.480ON3753762197e-19
NDAI0H021602.480ON3813782197e-19
TDEL0C003908.16ON3533472187e-19
ZYRO0G03388g2.480ON3703732188e-19
CAGL0D00198g7.3ON3833792188e-19
Suva_10.1548.16ON3563582171e-18
Suva_12.260singletonON3573752133e-18
Skud_15.683.118ON3483592133e-18
SAKL0E02838g2.480ON3773762126e-18
ZYRO0C12562gna 2ON3483782108e-18
Kpol_431.82.480ON3802822109e-18
ZYRO0F02552g8.16ON3513752091e-17
YLR070C (XYL2)8.16ON3563542081e-17
ZYRO0B05940g3.118ON3792922082e-17
TDEL0D050503.118ON3513642072e-17
NCAS0A077802.480ON3732952082e-17
Kpol_1036.193.118ON3532782072e-17
TDEL0A025602.480ON3732952063e-17
Skud_20.2singletonON3573642063e-17
Skud_4.2singletonON3573642063e-17
KLLA0F00506g7.3ON3853342046e-17
TBLA0A042907.3ON3952402048e-17
TDEL0F03190na 2ON3513492029e-17
NCAS0J003008.16ON3573562021e-16
Kwal_26.6684singletonON3563802011e-16
ZYRO0G03410gsingletonON3733642002e-16
KAFR0L02000singletonON3612592002e-16
YAL060W (BDH1)7.3ON3822391993e-16
ABL033C2.480ON3733811975e-16
KNAG0E025902.480ON3742571967e-16
KLTH0A00418gsingletonON3563541958e-16
YJR159W (SOR1)na 4ON3573571949e-16
YDL246C (SOR2)singletonON3573661931e-15
Smik_48.1singletonON3573601932e-15
ABR229C8.16ON3533591913e-15
Kwal_55.20564singletonON2162171843e-15
KLTH0D00616g7.3ON3823991904e-15
Smik_1.67.3ON3822391896e-15
TDEL0H044607.3ON3823691879e-15
Skud_1.37.3ON3822391861e-14
Kpol_1049.187.2ON3862421781e-13
SAKL0D14894g7.2ON3852411772e-13
Suva_1.77.3ON3822391753e-13
Kwal_26.67397.3ON3822321737e-13
NCAS0A076707.2ON4392411737e-13
KLLA0D05511g8.16ON3543471683e-12
KAFR0I001607.2ON3853021674e-12
SAKL0D14872g7.3ON3832371648e-12
KLLA0F00528g7.2ON3812801603e-11
KNAG0D00110singletonON3623341594e-11
NDAI0H020507.3ON3852421568e-11
YAL061W (BDH2)7.2ON4173021542e-10
Suva_1.67.2ON4172281542e-10
YBR046C (ZTA1)3.253ON3342491504e-10
Smik_2.1703.253ON3342511461e-09
NCAS0A076607.3ON3863311471e-09
Kwal_47.17532na 5ON3733271461e-09
Skud_1.27.2ON4172381471e-09
Smik_1.57.2ON4172381462e-09
KNAG0I00120singletonON3812931452e-09
TPHA0J00170singletonON3613441433e-09
KNAG0E042007.2ON3853191416e-09
Kwal_56.229853.253ON3463691372e-08
NDAI0H02950singletonON3633341362e-08
KAFR0C005803.253ON3343351353e-08
KAFR0I001707.3ON3812801354e-08
TDEL0D037203.253ON3352521335e-08
NCAS0D01220na 6ON3623601336e-08
KLLA0A10549g3.253ON3531921337e-08
NDAI0G04880singletonON3613391327e-08
ABL090W3.253ON3342971319e-08
NDAI0H020607.2ON3993111329e-08
SAKL0H22088gna 5ON3763231311e-07
TPHA0H03100singletonON3922401321e-07
Suva_4.2793.253ON3342271273e-07
KLTH0C07854g3.253ON3583481273e-07
SAKL0D14938gsingletonON3783271264e-07
Skud_2.1623.253ON3342471231e-06
SAKL0D03872g3.253ON3483711231e-06
NCAS0C03020singletonON3623721221e-06
KLTH0E07964gna 5ON3742551202e-06
NDAI0H02940na 6ON3613301184e-06
KAFR0A08730singletonON3602171141e-05
NDAI0A063203.253ON3491671122e-05
Ecym_1093singletonON3833201123e-05
ZYRO0A03366g3.253ON3492191113e-05
KNAG0K02680singletonON3592841079e-05
KLLA0F00638gna 7ON3822591061e-04
KLTH0B04972gna 8ON3603311061e-04
CAGL0M14047gna 9ON3593371033e-04
CAGL0H09944g3.253ON3332971007e-04
Smik_13.535na 9ON3603481008e-04
CAGL0H06853gsingletonON360340998e-04
KLLA0E19889gna 8ON366233990.001
Suva_13.513na 9ON360346980.001
NCAS0I017303.253ON349253960.002
KNAG0B06990singletonON358340960.002
Skud_13.494na 9ON360344960.003
SAKL0H00374gsingletonON428314920.007
KLTH0C10538gsingletonON273230900.009
SAKL0C00264gsingletonON359344900.012
YMR318C (ADH6)na 9ON360348880.022
Suva_6.13singletonON6859780.035
TPHA0M009303.253ON343338860.042
TDEL0F02300na 5ON379298800.22
ZYRO0G10318gna 5ON37692790.24
Smik_26.3singletonON12580750.30
Kpol_526.18singletonON361211780.32
KLTH0B00506gna 7ON398295760.61
TBLA0C014901.400ON86283722.1
TDEL0A00140singletonON405154722.1
KNAG0I013001.400ON80674696.1
KAFR0H03770singletonON365221677.3
NCAS0C034308.295ON493448687.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0L01111g
         (381 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0L01111g Chr12 (133129..134274) [1146 bp, 381 aa] {ON} highl...   784   0.0  
Kpol_530.31 s530 (77132..78274) [1143 bp, 380 aa] {ON} (77132..7...   657   0.0  
Kwal_56.24642 s56 complement(1085556..1086701) [1146 bp, 381 aa]...   652   0.0  
YDL168W Chr4 (159604..160764) [1161 bp, 386 aa] {ON}  SFA1Bifunc...   652   0.0  
Smik_4.70 Chr4 (136242..137402) [1161 bp, 386 aa] {ON} YDL168W (...   651   0.0  
KLTH0H01254g Chr8 (121076..122221) [1146 bp, 381 aa] {ON} highly...   649   0.0  
Skud_4.89 Chr4 (155298..156455) [1158 bp, 385 aa] {ON} YDL168W (...   647   0.0  
Suva_4.78 Chr4 (147109..148266) [1158 bp, 385 aa] {ON} YDL168W (...   641   0.0  
TBLA0E00390 Chr5 complement(71890..73041) [1152 bp, 383 aa] {ON}      639   0.0  
KLLA0D12342g Chr4 (1050181..1051335) [1155 bp, 384 aa] {ON} high...   635   0.0  
SAKL0F11374g Chr6 complement(885478..886629) [1152 bp, 383 aa] {...   634   0.0  
ACL148C Chr3 complement(90932..92077) [1146 bp, 381 aa] {ON} Syn...   633   0.0  
Ecym_4723 Chr4 (1415078..1416223) [1146 bp, 381 aa] {ON} similar...   631   0.0  
TPHA0F02970 Chr6 complement(653405..654550) [1146 bp, 381 aa] {O...   628   0.0  
TDEL0C01980 Chr3 (344639..345796) [1158 bp, 385 aa] {ON} Anc_7.3...   619   0.0  
KAFR0B00880 Chr2 complement(164475..165620) [1146 bp, 381 aa] {O...   618   0.0  
NCAS0A14160 Chr1 complement(2782022..2783377) [1356 bp, 451 aa] ...   620   0.0  
ZYRO0F11704g Chr6 complement(958546..959694) [1149 bp, 382 aa] {...   616   0.0  
KNAG0C03790 Chr3 complement(745394..746542) [1149 bp, 382 aa] {O...   533   0.0  
NDAI0A01890 Chr1 (425090..426358) [1269 bp, 422 aa] {ON} Anc_7.350    528   0.0  
SAKL0A00880g Chr1 complement(92246..93412) [1167 bp, 388 aa] {ON...   461   e-162
KLLA0B00451g Chr2 complement(31822..32982) [1161 bp, 386 aa] {ON...   113   1e-27
KNAG0K02000 Chr11 (410263..411315) [1053 bp, 350 aa] {ON} Anc_3....   109   2e-26
YBR145W Chr2 (533762..534817) [1056 bp, 351 aa] {ON}  ADH5Alcoho...   103   2e-24
KLLA0D19929g Chr4 (1694826..1695986) [1161 bp, 386 aa] {ON} weak...   103   4e-24
NCAS0I02350 Chr9 (444097..445152) [1056 bp, 351 aa] {ON} Anc_3.118    103   5e-24
AER032W Chr5 (696807..697862) [1056 bp, 351 aa] {ON} Syntenic ho...   102   1e-23
Suva_4.394 Chr4 (702935..703990) [1056 bp, 351 aa] {ON} YBR145W ...   102   1e-23
KAFR0G01420 Chr7 complement(314119..315174) [1056 bp, 351 aa] {O...   102   1e-23
KAFR0A00790 Chr1 complement(140666..141799) [1134 bp, 377 aa] {O...   101   3e-23
Skud_2.272 Chr2 (501260..502315) [1056 bp, 351 aa] {ON} YBR145W ...   100   5e-23
NCAS0I01720 Chr9 (318144..319199) [1056 bp, 351 aa] {ON}              100   7e-23
SAKL0C10164g Chr3 complement(914732..915787) [1056 bp, 351 aa] {...   100   7e-23
Ecym_5331 Chr5 (676233..677279) [1047 bp, 348 aa] {ON} similar t...   100   1e-22
CAGL0J01441g Chr10 complement(134383..135501) [1119 bp, 372 aa] ...   100   1e-22
Smik_2.284 Chr2 (518341..519396) [1056 bp, 351 aa] {ON} YBR145W ...    99   2e-22
TBLA0I01140 Chr9 (233777..234910) [1134 bp, 377 aa] {ON} Anc_2.4...    98   5e-22
Kpol_1058.11 s1058 (41165..42226) [1062 bp, 353 aa] {ON} (41165....    97   6e-22
Skud_13.477 Chr13 complement(846790..847836) [1047 bp, 348 aa] {...    97   1e-21
TBLA0E03440 Chr5 (852767..853822) [1056 bp, 351 aa] {ON} Anc_3.1...    96   2e-21
YOL086C Chr15 complement(159548..160594) [1047 bp, 348 aa] {ON} ...    96   2e-21
SAKL0F06270g Chr6 (472877..473932) [1056 bp, 351 aa] {ON} simila...    96   2e-21
TPHA0M00730 Chr13 complement(137798..138850) [1053 bp, 350 aa] {...    95   3e-21
KLTH0G18986g Chr7 complement(1639254..1640318) [1065 bp, 354 aa]...    95   4e-21
TBLA0E03430 Chr5 (850493..851548) [1056 bp, 351 aa] {ON}               95   4e-21
KLLA0B09064g Chr2 complement(792849..793973) [1125 bp, 374 aa] {...    95   5e-21
Kwal_56.23198 s56 (443881..444936) [1056 bp, 351 aa] {ON} YOL086...    94   6e-21
KLLA0F13530g Chr6 (1251162..1252289) [1128 bp, 375 aa] {ON} unip...    95   7e-21
Kwal_55.19574 s55 complement(32260..33330) [1071 bp, 356 aa] {ON...    94   7e-21
YMR303C Chr13 complement(873291..874337) [1047 bp, 348 aa] {ON} ...    94   7e-21
Ecym_7391 Chr7 (801773..802900) [1128 bp, 375 aa] {ON} similar t...    94   1e-20
KLTH0G15686g Chr7 complement(1367997..1369052) [1056 bp, 351 aa]...    94   1e-20
Smik_13.520 Chr13 complement(856008..857054) [1047 bp, 348 aa] {...    94   1e-20
NDAI0A06930 Chr1 (1585575..1586630) [1056 bp, 351 aa] {ON} Anc_3...    93   2e-20
KAFR0L02010 Chr12 (379623..380678) [1056 bp, 351 aa] {ON}              93   2e-20
SAKL0B00814g Chr2 (74565..75629) [1065 bp, 354 aa] {ON} similar ...    93   2e-20
SAKL0B08184g Chr2 (698686..699807) [1122 bp, 373 aa] {ON} unipro...    93   3e-20
KLTH0D05588g Chr4 complement(502176..503345) [1170 bp, 389 aa] {...    93   4e-20
TPHA0G03210 Chr7 complement(688137..689270) [1134 bp, 377 aa] {O...    92   5e-20
Smik_15.71 Chr15 complement(122645..123691) [1047 bp, 348 aa] {O...    92   5e-20
KLLA0F18260g Chr6 complement(1683417..1684463) [1047 bp, 348 aa]...    91   8e-20
Suva_13.261 Chr13 (416378..417505) [1128 bp, 375 aa] {ON} YMR083...    92   8e-20
Suva_13.494 Chr13 complement(856051..857097) [1047 bp, 348 aa] {...    91   1e-19
KLLA0F21010g Chr6 (1962951..1964003) [1053 bp, 350 aa] {ON} unip...    91   1e-19
KLTH0E05588g Chr5 complement(494815..495861) [1047 bp, 348 aa] {...    91   1e-19
CAGL0I07843g Chr9 complement(756345..757403) [1059 bp, 352 aa] {...    91   1e-19
YMR083W Chr13 (434788..435915) [1128 bp, 375 aa] {ON}  ADH3Mitoc...    91   2e-19
AAR084W Chr1 (494021..495178) [1158 bp, 385 aa] {ON} Non-synteni...    91   2e-19
Smik_13.266 Chr13 (418869..419996) [1128 bp, 375 aa] {ON} YMR083...    90   3e-19
Suva_15.81 Chr15 complement(132739..133785) [1047 bp, 348 aa] {O...    89   5e-19
Kwal_26.7799 s26 complement(515580..516743) [1164 bp, 387 aa] {O...    89   5e-19
KNAG0K01040 Chr11 complement(204636..205811) [1176 bp, 391 aa] {...    89   6e-19
Skud_13.240 Chr13 (408909..410036) [1128 bp, 375 aa] {ON} YMR083...    89   7e-19
NDAI0H02160 Chr8 (528551..529696) [1146 bp, 381 aa] {ON} Anc_2.480     89   7e-19
TDEL0C00390 Chr3 (53995..55056) [1062 bp, 353 aa] {ON} Anc_8.16 ...    89   7e-19
ZYRO0G03388g Chr7 complement(265952..267064) [1113 bp, 370 aa] {...    89   8e-19
CAGL0D00198g Chr4 (27559..28710) [1152 bp, 383 aa] {ON} similar ...    89   8e-19
Suva_10.154 Chr10 complement(275737..276807) [1071 bp, 356 aa] {...    88   1e-18
Suva_12.260 Chr12 (427406..428479) [1074 bp, 357 aa] {ON} YJR159...    87   3e-18
Skud_15.68 Chr15 complement(118795..119841) [1047 bp, 348 aa] {O...    87   3e-18
SAKL0E02838g Chr5 (226264..227397) [1134 bp, 377 aa] {ON} unipro...    86   6e-18
ZYRO0C12562g Chr3 (993434..994480) [1047 bp, 348 aa] {ON} highly...    86   8e-18
Kpol_431.8 s431 (21043..22185) [1143 bp, 380 aa] {ON} (21043..22...    86   9e-18
ZYRO0F02552g Chr6 (203037..204092) [1056 bp, 351 aa] {ON} simila...    85   1e-17
YLR070C Chr12 complement(274141..275211) [1071 bp, 356 aa] {ON} ...    85   1e-17
ZYRO0B05940g Chr2 (480279..481418) [1140 bp, 379 aa] {ON} highly...    85   2e-17
TDEL0D05050 Chr4 (921065..922120) [1056 bp, 351 aa] {ON} Anc_3.1...    84   2e-17
NCAS0A07780 Chr1 (1548197..1549318) [1122 bp, 373 aa] {ON} Anc_2...    85   2e-17
Kpol_1036.19 s1036 (51276..52337) [1062 bp, 353 aa] {ON} (51276....    84   2e-17
TDEL0A02560 Chr1 complement(462053..463174) [1122 bp, 373 aa] {O...    84   3e-17
Skud_20.2 Chr20 (1588..2661) [1074 bp, 357 aa] {ON} YJR159W (REAL)     84   3e-17
Skud_4.2 Chr4 complement(6287..7360) [1074 bp, 357 aa] {ON} YJR1...    84   3e-17
KLLA0F00506g Chr6 complement(36518..37675) [1158 bp, 385 aa] {ON...    83   6e-17
TBLA0A04290 Chr1 (1063289..1064476) [1188 bp, 395 aa] {ON} Anc_7...    83   8e-17
TDEL0F03190 Chr6 (583849..584904) [1056 bp, 351 aa] {ON}  possib...    82   9e-17
NCAS0J00300 Chr10 (43719..44792) [1074 bp, 357 aa] {ON} Anc_8.16       82   1e-16
Kwal_26.6684 s26 (21910..22980) [1071 bp, 356 aa] {ON} YJR159W (...    82   1e-16
ZYRO0G03410g Chr7 complement(269170..270291) [1122 bp, 373 aa] {...    82   2e-16
KAFR0L02000 Chr12 (378013..379098) [1086 bp, 361 aa] {ON}              82   2e-16
YAL060W Chr1 (35155..36303) [1149 bp, 382 aa] {ON}  BDH1NAD-depe...    81   3e-16
ABL033C Chr2 complement(337866..338987) [1122 bp, 373 aa] {ON} S...    80   5e-16
KNAG0E02590 Chr5 complement(513565..514689) [1125 bp, 374 aa] {O...    80   7e-16
KLTH0A00418g Chr1 complement(34685..35755) [1071 bp, 356 aa] {ON...    80   8e-16
YJR159W Chr10 (736044..737117) [1074 bp, 357 aa] {ON}  SOR1Sorbi...    79   9e-16
YDL246C Chr4 complement(8683..9756) [1074 bp, 357 aa] {ON}  SOR2...    79   1e-15
Smik_48.1 Chr48 complement(1..1074) [1074 bp, 357 aa] {ON} YJR15...    79   2e-15
ABR229C Chr2 complement(831895..832956) [1062 bp, 353 aa] {ON} S...    78   3e-15
Kwal_55.20564 s55 complement(459253..459903) [651 bp, 216 aa] {O...    75   3e-15
KLTH0D00616g Chr4 (59883..61031) [1149 bp, 382 aa] {ON} similar ...    78   4e-15
Smik_1.6 Chr1 (18115..19263) [1149 bp, 382 aa] {ON} YAL060W (REAL)     77   6e-15
TDEL0H04460 Chr8 complement(769988..771136) [1149 bp, 382 aa] {O...    77   9e-15
Skud_1.3 Chr1 (11174..12322) [1149 bp, 382 aa] {ON} YAL060W (REAL)     76   1e-14
Kpol_1049.18 s1049 complement(35191..36351) [1161 bp, 386 aa] {O...    73   1e-13
SAKL0D14894g Chr4 complement(1230497..1231654) [1158 bp, 385 aa]...    73   2e-13
Suva_1.7 Chr1 (12310..13458) [1149 bp, 382 aa] {ON} YAL060W (REAL)     72   3e-13
Kwal_26.6739 s26 (46044..47192) [1149 bp, 382 aa] {ON} YAL060W (...    71   7e-13
NCAS0A07670 Chr1 complement(1527273..1528592) [1320 bp, 439 aa] ...    71   7e-13
KLLA0D05511g Chr4 complement(476363..477427) [1065 bp, 354 aa] {...    69   3e-12
KAFR0I00160 Chr9 (33043..34200) [1158 bp, 385 aa] {ON} Anc_7.2 Y...    69   4e-12
SAKL0D14872g Chr4 complement(1226093..1227244) [1152 bp, 383 aa]...    68   8e-12
KLLA0F00528g Chr6 complement(40081..41226) [1146 bp, 381 aa] {ON...    66   3e-11
KNAG0D00110 Chr4 (3538..4626) [1089 bp, 362 aa] {ON}                   66   4e-11
NDAI0H02050 Chr8 complement(500914..502071) [1158 bp, 385 aa] {O...    65   8e-11
YAL061W Chr1 (33448..34701) [1254 bp, 417 aa] {ON}  BDH2Putative...    64   2e-10
Suva_1.6 Chr1 (10591..11844) [1254 bp, 417 aa] {ON} YAL061W (REAL)     64   2e-10
YBR046C Chr2 complement(330507..331511) [1005 bp, 334 aa] {ON}  ...    62   4e-10
Smik_2.170 Chr2 complement(312211..313215) [1005 bp, 334 aa] {ON...    61   1e-09
NCAS0A07660 Chr1 complement(1525755..1526915) [1161 bp, 386 aa] ...    61   1e-09
Kwal_47.17532 s47 (444594..445715) [1122 bp, 373 aa] {ON} YMR318...    61   1e-09
Skud_1.2 Chr1 (9513..10766) [1254 bp, 417 aa] {ON} YAL061W (REAL)      61   1e-09
Smik_1.5 Chr1 (16385..17638) [1254 bp, 417 aa] {ON} YAL061W (REAL)     61   2e-09
KNAG0I00120 Chr9 (9352..10497) [1146 bp, 381 aa] {ON}                  60   2e-09
TPHA0J00170 Chr10 (40911..41996) [1086 bp, 361 aa] {ON}                60   3e-09
KNAG0E04200 Chr5 complement(837232..838389) [1158 bp, 385 aa] {O...    59   6e-09
Kwal_56.22985 s56 complement(357501..358541) [1041 bp, 346 aa] {...    57   2e-08
NDAI0H02950 Chr8 complement(718762..719853) [1092 bp, 363 aa] {O...    57   2e-08
KAFR0C00580 Chr3 (113544..114548) [1005 bp, 334 aa] {ON} Anc_3.2...    57   3e-08
KAFR0I00170 Chr9 (34519..35664) [1146 bp, 381 aa] {ON} Anc_7.3 Y...    57   4e-08
TDEL0D03720 Chr4 (683833..684840) [1008 bp, 335 aa] {ON} Anc_3.2...    56   5e-08
NCAS0D01220 Chr4 (223821..224909) [1089 bp, 362 aa] {ON}               56   6e-08
KLLA0A10549g Chr1 (921022..922083) [1062 bp, 353 aa] {ON} highly...    56   7e-08
NDAI0G04880 Chr7 complement(1175518..1176603) [1086 bp, 361 aa] ...    55   7e-08
ABL090W Chr2 (230699..231703) [1005 bp, 334 aa] {ON} Syntenic ho...    55   9e-08
NDAI0H02060 Chr8 complement(502872..504071) [1200 bp, 399 aa] {O...    55   9e-08
SAKL0H22088g Chr8 (1934171..1935301) [1131 bp, 376 aa] {ON} simi...    55   1e-07
TPHA0H03100 Chr8 complement(736924..738102) [1179 bp, 392 aa] {O...    55   1e-07
Suva_4.279 Chr4 complement(495380..496384) [1005 bp, 334 aa] {ON...    54   3e-07
KLTH0C07854g Chr3 (673945..675021) [1077 bp, 358 aa] {ON} simila...    54   3e-07
SAKL0D14938g Chr4 complement(1235542..1236678) [1137 bp, 378 aa]...    53   4e-07
Skud_2.162 Chr2 complement(299642..300646) [1005 bp, 334 aa] {ON...    52   1e-06
SAKL0D03872g Chr4 (316127..317173) [1047 bp, 348 aa] {ON} highly...    52   1e-06
NCAS0C03020 Chr3 complement(593785..594873) [1089 bp, 362 aa] {O...    52   1e-06
KLTH0E07964g Chr5 (735214..736338) [1125 bp, 374 aa] {ON} simila...    51   2e-06
NDAI0H02940 Chr8 complement(717073..718158) [1086 bp, 361 aa] {O...    50   4e-06
KAFR0A08730 Chr1 complement(1747657..1748739) [1083 bp, 360 aa] ...    49   1e-05
NDAI0A06320 Chr1 (1438393..1439442) [1050 bp, 349 aa] {ON} Anc_3...    48   2e-05
Ecym_1093 Chr1 complement(195854..197005) [1152 bp, 383 aa] {ON}...    48   3e-05
ZYRO0A03366g Chr1 (271779..272828) [1050 bp, 349 aa] {ON} highly...    47   3e-05
KNAG0K02680 Chr11 complement(531173..532252) [1080 bp, 359 aa] {...    46   9e-05
KLLA0F00638g Chr6 (51849..52997) [1149 bp, 382 aa] {ON} weakly s...    45   1e-04
KLTH0B04972g Chr2 (408153..409235) [1083 bp, 360 aa] {ON} highly...    45   1e-04
CAGL0M14047g Chr13 complement(1386775..1387854) [1080 bp, 359 aa...    44   3e-04
CAGL0H09944g Chr8 complement(971519..972520) [1002 bp, 333 aa] {...    43   7e-04
Smik_13.535 Chr13 complement(893727..894809) [1083 bp, 360 aa] {...    43   8e-04
CAGL0H06853g Chr8 complement(680184..681266) [1083 bp, 360 aa] {...    43   8e-04
KLLA0E19889g Chr5 (1770061..1771161) [1101 bp, 366 aa] {ON} simi...    43   0.001
Suva_13.513 Chr13 complement(894394..895476) [1083 bp, 360 aa] {...    42   0.001
NCAS0I01730 Chr9 (319449..320498) [1050 bp, 349 aa] {ON} Anc_3.253     42   0.002
KNAG0B06990 Chr2 (1393058..1394134) [1077 bp, 358 aa] {ON}             42   0.002
Skud_13.494 Chr13 complement(884038..885120) [1083 bp, 360 aa] {...    42   0.003
SAKL0H00374g Chr8 (45725..47011) [1287 bp, 428 aa] {ON} weakly s...    40   0.007
KLTH0C10538g Chr3 complement(873623..874444) [822 bp, 273 aa] {O...    39   0.009
SAKL0C00264g Chr3 complement(17429..18508) [1080 bp, 359 aa] {ON...    39   0.012
YMR318C Chr13 complement(911061..912143) [1083 bp, 360 aa] {ON} ...    39   0.022
Suva_6.13 Chr6 (21861..22031,22035..22067) [204 bp, 68 aa] {ON} ...    35   0.035
TPHA0M00930 Chr13 complement(180084..181115) [1032 bp, 343 aa] {...    38   0.042
TDEL0F02300 Chr6 complement(421372..422511) [1140 bp, 379 aa] {O...    35   0.22 
ZYRO0G10318g Chr7 (831554..832684) [1131 bp, 376 aa] {ON} simila...    35   0.24 
Smik_26.3 Chr26 (2136..2513) [378 bp, 125 aa] {ON} YMR318C (REAL)      33   0.30 
Kpol_526.18 s526 (51360..52445) [1086 bp, 361 aa] {ON} (51360..5...    35   0.32 
KLTH0B00506g Chr2 complement(53662..54858) [1197 bp, 398 aa] {ON...    34   0.61 
TBLA0C01490 Chr3 complement(343276..345864) [2589 bp, 862 aa] {O...    32   2.1  
TDEL0A00140 Chr1 (23016..24233) [1218 bp, 405 aa] {ON}                 32   2.1  
KNAG0I01300 Chr9 (248944..251364) [2421 bp, 806 aa] {ON} Anc_1.4...    31   6.1  
KAFR0H03770 Chr8 complement(715399..716496) [1098 bp, 365 aa] {O...    30   7.3  
NCAS0C03430 Chr3 (672540..687344) [14805 bp, 4934 aa] {ON} Anc_8...    31   7.4  

>CAGL0L01111g Chr12 (133129..134274) [1146 bp, 381 aa] {ON} highly
           similar to uniprot|P32771 Saccharomyces cerevisiae
           YDL168w SFA1 long-chain alcohol dehydrogenase
          Length = 381

 Score =  784 bits (2024), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 381/381 (100%), Positives = 381/381 (100%)

Query: 1   MTEGKPIECLAAVAYEAGKPQVVEQIVVDPPKAHEVRIKIVNTAVCHTDAYTLSGADPEG 60
           MTEGKPIECLAAVAYEAGKPQVVEQIVVDPPKAHEVRIKIVNTAVCHTDAYTLSGADPEG
Sbjct: 1   MTEGKPIECLAAVAYEAGKPQVVEQIVVDPPKAHEVRIKIVNTAVCHTDAYTLSGADPEG 60

Query: 61  LFPCVLGHEGAGIVESVGDGVTNVKPGDHVIALYTAECQKCKFCLSGKTNLCGAVRATQG 120
           LFPCVLGHEGAGIVESVGDGVTNVKPGDHVIALYTAECQKCKFCLSGKTNLCGAVRATQG
Sbjct: 61  LFPCVLGHEGAGIVESVGDGVTNVKPGDHVIALYTAECQKCKFCLSGKTNLCGAVRATQG 120

Query: 121 KGVMPDGTSRFHNKKGESLYHFMGCSTFSEYTVVADVSVVAIDQTAPLESVCLLGCGVTT 180
           KGVMPDGTSRFHNKKGESLYHFMGCSTFSEYTVVADVSVVAIDQTAPLESVCLLGCGVTT
Sbjct: 121 KGVMPDGTSRFHNKKGESLYHFMGCSTFSEYTVVADVSVVAIDQTAPLESVCLLGCGVTT 180

Query: 181 GYGAAVKTANVQKGDTVAVFGCGTVGLSVLQGAHQRGASRIIAIDTNDQKKDFCTQFGAT 240
           GYGAAVKTANVQKGDTVAVFGCGTVGLSVLQGAHQRGASRIIAIDTNDQKKDFCTQFGAT
Sbjct: 181 GYGAAVKTANVQKGDTVAVFGCGTVGLSVLQGAHQRGASRIIAIDTNDQKKDFCTQFGAT 240

Query: 241 DFINPTKDLKENETIVAKLIEMTDGGLDHTFDCTGNVNVMRSALEACHKGWGQSVIIGVA 300
           DFINPTKDLKENETIVAKLIEMTDGGLDHTFDCTGNVNVMRSALEACHKGWGQSVIIGVA
Sbjct: 241 DFINPTKDLKENETIVAKLIEMTDGGLDHTFDCTGNVNVMRSALEACHKGWGQSVIIGVA 300

Query: 301 AAGQEISTRPFQLVTGRVWKGSAFGGVKGRSEMAGLIEQYKKGELKVDEFITHRRSFNEI 360
           AAGQEISTRPFQLVTGRVWKGSAFGGVKGRSEMAGLIEQYKKGELKVDEFITHRRSFNEI
Sbjct: 301 AAGQEISTRPFQLVTGRVWKGSAFGGVKGRSEMAGLIEQYKKGELKVDEFITHRRSFNEI 360

Query: 361 NEAFDDLHNGLCLRTVLSFSK 381
           NEAFDDLHNGLCLRTVLSFSK
Sbjct: 361 NEAFDDLHNGLCLRTVLSFSK 381

>Kpol_530.31 s530 (77132..78274) [1143 bp, 380 aa] {ON}
           (77132..78274) [1143 nt, 381 aa]
          Length = 380

 Score =  657 bits (1694), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 315/378 (83%), Positives = 345/378 (91%), Gaps = 1/378 (0%)

Query: 2   TEGKPIECLAAVAYEAGKPQVVEQIVVDPPKAHEVRIKIVNTAVCHTDAYTLSGADPEGL 61
           T GKPI C AAVAYEA KP VVE+IVVDPPKAHEVRIKI+NTAVCHTDAYTLSG DPEGL
Sbjct: 3   TVGKPITCQAAVAYEAAKPLVVEEIVVDPPKAHEVRIKIINTAVCHTDAYTLSGVDPEGL 62

Query: 62  FPCVLGHEGAGIVESVGDGVTNVKPGDHVIALYTAECQKCKFCLSGKTNLCGAVRATQGK 121
           FPCVLGHEG+GIVESVGD VT VKPGDHV+ALYTAEC KCKFCLSGKTNLCG+VRATQGK
Sbjct: 63  FPCVLGHEGSGIVESVGDNVTTVKPGDHVVALYTAECGKCKFCLSGKTNLCGSVRATQGK 122

Query: 122 GVMPDGTSRFHNKKGESLYHFMGCSTFSEYTVVADVSVVAIDQTAPLESVCLLGCGVTTG 181
           GVMPDGT RFHNKKGE LYHFMGCSTFSEYTVVADVSVVAID TAPL+SVCLLGCGVTTG
Sbjct: 123 GVMPDGTPRFHNKKGEPLYHFMGCSTFSEYTVVADVSVVAIDPTAPLDSVCLLGCGVTTG 182

Query: 182 YGAAVKTANVQKGDTVAVFGCGTVGLSVLQGAHQRGASRIIAIDTNDQKKDFCTQFGATD 241
           YGAA+KTANVQKGDTVAVFG GTVGLSV+QGA  RGAS+II +D N+ KK++  +FGATD
Sbjct: 183 YGAAIKTANVQKGDTVAVFGAGTVGLSVVQGAKSRGASKIIVVDINNDKKEWSAEFGATD 242

Query: 242 FINPTKDLKENETIVAKLIEMTDGGLDHTFDCTGNVNVMRSALEACHKGWGQSVIIGVAA 301
           F+NP+ +L E + IV+KL+EMTDGGLD TFDCTGNVNVMR ALEACHKGWGQS+IIGVAA
Sbjct: 243 FVNPS-ELPEGQDIVSKLVEMTDGGLDFTFDCTGNVNVMRDALEACHKGWGQSIIIGVAA 301

Query: 302 AGQEISTRPFQLVTGRVWKGSAFGGVKGRSEMAGLIEQYKKGELKVDEFITHRRSFNEIN 361
           AG+EISTRPFQLVTGRVWKGSAFGG+KGRSEM GLI+ Y+ G LKVDEFIT+RR F EIN
Sbjct: 302 AGKEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIKDYQNGSLKVDEFITNRRPFVEIN 361

Query: 362 EAFDDLHNGLCLRTVLSF 379
           +AF++LH+G CLRTVLSF
Sbjct: 362 DAFEELHHGNCLRTVLSF 379

>Kwal_56.24642 s56 complement(1085556..1086701) [1146 bp, 381 aa]
           {ON} YDL168W (SFA1) - Long-chain alcohol dehydrogenase
           (glutathione-dependent formaldehyde dehydrogenase)
           [contig 161] FULL
          Length = 381

 Score =  652 bits (1683), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 308/381 (80%), Positives = 342/381 (89%)

Query: 1   MTEGKPIECLAAVAYEAGKPQVVEQIVVDPPKAHEVRIKIVNTAVCHTDAYTLSGADPEG 60
           M+EGKPI CLAAVAYEAGKP  +E+IVVDPPKAHEVR+KI  TAVCHTDAYTLSG DPEG
Sbjct: 1   MSEGKPITCLAAVAYEAGKPLTIEEIVVDPPKAHEVRVKIAYTAVCHTDAYTLSGVDPEG 60

Query: 61  LFPCVLGHEGAGIVESVGDGVTNVKPGDHVIALYTAECQKCKFCLSGKTNLCGAVRATQG 120
            FP +LGHEGAGIVES+G+GVTNVKPGDHVIALYTAEC++CKFC SGKTNLCG+VRATQG
Sbjct: 61  AFPSILGHEGAGIVESIGEGVTNVKPGDHVIALYTAECKECKFCKSGKTNLCGSVRATQG 120

Query: 121 KGVMPDGTSRFHNKKGESLYHFMGCSTFSEYTVVADVSVVAIDQTAPLESVCLLGCGVTT 180
           KGVMPDGT+RFHNKKGE + HFMGCSTFS+YTV+ADVSVVAID  APL+  CLLGCGVTT
Sbjct: 121 KGVMPDGTTRFHNKKGEDILHFMGCSTFSQYTVLADVSVVAIDPKAPLDKTCLLGCGVTT 180

Query: 181 GYGAAVKTANVQKGDTVAVFGCGTVGLSVLQGAHQRGASRIIAIDTNDQKKDFCTQFGAT 240
           GYGAAVKTANVQKGDTVAVFG GTVGLSV+QGA  RGASRII +D NDQKK +  +FGAT
Sbjct: 181 GYGAAVKTANVQKGDTVAVFGAGTVGLSVVQGAKVRGASRIIVVDINDQKKQWANEFGAT 240

Query: 241 DFINPTKDLKENETIVAKLIEMTDGGLDHTFDCTGNVNVMRSALEACHKGWGQSVIIGVA 300
           DF+NP+KDLK+ +TIV  L+EMTDGGLD+TFDCTGN +VMRSALEACHKGWG+S+IIGVA
Sbjct: 241 DFVNPSKDLKDGKTIVDMLVEMTDGGLDYTFDCTGNTDVMRSALEACHKGWGESIIIGVA 300

Query: 301 AAGQEISTRPFQLVTGRVWKGSAFGGVKGRSEMAGLIEQYKKGELKVDEFITHRRSFNEI 360
           AAG+EISTRPFQLVTGRVWKGSAFGG+KGRSEM GLI  Y  G+LKVDEFITHRR F +I
Sbjct: 301 AAGKEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLISDYMDGKLKVDEFITHRRGFTDI 360

Query: 361 NEAFDDLHNGLCLRTVLSFSK 381
           N AF+DLH+G CLRTVL   K
Sbjct: 361 NSAFEDLHHGDCLRTVLDLLK 381

>YDL168W Chr4 (159604..160764) [1161 bp, 386 aa] {ON}
           SFA1Bifunctional enzyme containing both alcohol
           dehydrogenase and glutathione-dependent formaldehyde
           dehydrogenase activities, functions in formaldehyde
           detoxification and formation of long chain and complex
           alcohols, regulated by Hog1p-Sko1p
          Length = 386

 Score =  652 bits (1681), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 310/376 (82%), Positives = 341/376 (90%)

Query: 2   TEGKPIECLAAVAYEAGKPQVVEQIVVDPPKAHEVRIKIVNTAVCHTDAYTLSGADPEGL 61
           T GKPI+C+AAVAY+A KP  VE+I VD PKAHEVRIKI  TAVCHTDAYTLSG+DPEGL
Sbjct: 5   TVGKPIKCIAAVAYDAKKPLSVEEITVDAPKAHEVRIKIEYTAVCHTDAYTLSGSDPEGL 64

Query: 62  FPCVLGHEGAGIVESVGDGVTNVKPGDHVIALYTAECQKCKFCLSGKTNLCGAVRATQGK 121
           FPCVLGHEGAGIVESVGD V  VKPGDHVIALYTAEC KCKFC SGKTNLCGAVRATQGK
Sbjct: 65  FPCVLGHEGAGIVESVGDDVITVKPGDHVIALYTAECGKCKFCTSGKTNLCGAVRATQGK 124

Query: 122 GVMPDGTSRFHNKKGESLYHFMGCSTFSEYTVVADVSVVAIDQTAPLESVCLLGCGVTTG 181
           GVMPDGT+RFHN KGE +YHFMGCSTFSEYTVVADVSVVAID  APL++ CLLGCGVTTG
Sbjct: 125 GVMPDGTTRFHNAKGEDIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDAACLLGCGVTTG 184

Query: 182 YGAAVKTANVQKGDTVAVFGCGTVGLSVLQGAHQRGASRIIAIDTNDQKKDFCTQFGATD 241
           +GAA+KTANVQKGDTVAVFGCGTVGLSV+QGA  RGAS+IIAID N++KK +C+QFGATD
Sbjct: 185 FGAALKTANVQKGDTVAVFGCGTVGLSVIQGAKLRGASKIIAIDINNKKKQYCSQFGATD 244

Query: 242 FINPTKDLKENETIVAKLIEMTDGGLDHTFDCTGNVNVMRSALEACHKGWGQSVIIGVAA 301
           F+NP +DL +++TIV KLIEMTDGGLD TFDCTGN  +MR ALEACHKGWGQS+IIGVAA
Sbjct: 245 FVNPKEDLAKDQTIVEKLIEMTDGGLDFTFDCTGNTKIMRDALEACHKGWGQSIIIGVAA 304

Query: 302 AGQEISTRPFQLVTGRVWKGSAFGGVKGRSEMAGLIEQYKKGELKVDEFITHRRSFNEIN 361
           AG+EISTRPFQLVTGRVWKGSAFGG+KGRSEM GLI+ Y+KG LKV+EFITHRR F EIN
Sbjct: 305 AGEEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIKDYQKGALKVEEFITHRRPFKEIN 364

Query: 362 EAFDDLHNGLCLRTVL 377
           +AF+DLHNG CLRTVL
Sbjct: 365 QAFEDLHNGDCLRTVL 380

>Smik_4.70 Chr4 (136242..137402) [1161 bp, 386 aa] {ON} YDL168W
           (REAL)
          Length = 386

 Score =  651 bits (1680), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 309/380 (81%), Positives = 340/380 (89%)

Query: 2   TEGKPIECLAAVAYEAGKPQVVEQIVVDPPKAHEVRIKIVNTAVCHTDAYTLSGADPEGL 61
           T GKPI+C+AAVAY+A KP  VE+I VD PKAHEVRIKI  TAVCHTDAYTLSG+DPEGL
Sbjct: 5   TVGKPIKCIAAVAYDAKKPSSVEEITVDAPKAHEVRIKIEYTAVCHTDAYTLSGSDPEGL 64

Query: 62  FPCVLGHEGAGIVESVGDGVTNVKPGDHVIALYTAECQKCKFCLSGKTNLCGAVRATQGK 121
           FPC+LGHEGAGIVESVGDGV  VKPGDHVIALYTAEC KCKFC SGKTNLC AVRATQGK
Sbjct: 65  FPCILGHEGAGIVESVGDGVVTVKPGDHVIALYTAECGKCKFCTSGKTNLCSAVRATQGK 124

Query: 122 GVMPDGTSRFHNKKGESLYHFMGCSTFSEYTVVADVSVVAIDQTAPLESVCLLGCGVTTG 181
           GVMPDGT+RFHN KG+ +YHFMGCSTFSEYTVVADVSVVAID  APL++ CLLGCGVTTG
Sbjct: 125 GVMPDGTTRFHNAKGKDIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDASCLLGCGVTTG 184

Query: 182 YGAAVKTANVQKGDTVAVFGCGTVGLSVLQGAHQRGASRIIAIDTNDQKKDFCTQFGATD 241
           YGAAVKTANVQKGDTVAVFGCGTVGLSV+QGA  RGAS+IIA+D N+ KK +C+QFGATD
Sbjct: 185 YGAAVKTANVQKGDTVAVFGCGTVGLSVIQGAKLRGASKIIAVDINNNKKKYCSQFGATD 244

Query: 242 FINPTKDLKENETIVAKLIEMTDGGLDHTFDCTGNVNVMRSALEACHKGWGQSVIIGVAA 301
           FINP +DL +++TIV KL+EMTDGGLD TFDCTGN  +MR ALEACHKGWGQS+IIGVAA
Sbjct: 245 FINPKEDLAKDQTIVEKLVEMTDGGLDFTFDCTGNTKIMRDALEACHKGWGQSIIIGVAA 304

Query: 302 AGQEISTRPFQLVTGRVWKGSAFGGVKGRSEMAGLIEQYKKGELKVDEFITHRRSFNEIN 361
           AG+EISTRPFQLVTGRVWKGSAFGG+KGRSEM GLI+ Y+ G LKV+EFITHRR F EIN
Sbjct: 305 AGEEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIKDYQSGVLKVEEFITHRRPFKEIN 364

Query: 362 EAFDDLHNGLCLRTVLSFSK 381
            AF+DLHNG CLRTVL F +
Sbjct: 365 HAFEDLHNGDCLRTVLKFDE 384

>KLTH0H01254g Chr8 (121076..122221) [1146 bp, 381 aa] {ON} highly
           similar to uniprot|P32771 Saccharomyces cerevisiae
           YDL168W SFA1 Long-chain alcohol dehydrogenase
           (glutathione-dependent formaldehyde dehydrogenase)
          Length = 381

 Score =  649 bits (1675), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 309/381 (81%), Positives = 340/381 (89%)

Query: 1   MTEGKPIECLAAVAYEAGKPQVVEQIVVDPPKAHEVRIKIVNTAVCHTDAYTLSGADPEG 60
           M+EGKPI C AAVAYEAGKP  VE+IVVDPPKAHEVRIK+  TAVCHTDAYTLSG DPEG
Sbjct: 1   MSEGKPITCTAAVAYEAGKPLTVEEIVVDPPKAHEVRIKVEYTAVCHTDAYTLSGVDPEG 60

Query: 61  LFPCVLGHEGAGIVESVGDGVTNVKPGDHVIALYTAECQKCKFCLSGKTNLCGAVRATQG 120
            FP +LGHEGAG+VESVG+GVTNVK GDHVIALYTAEC++CKFC SGKTNLCG+VRATQG
Sbjct: 61  AFPSILGHEGAGVVESVGEGVTNVKAGDHVIALYTAECKECKFCKSGKTNLCGSVRATQG 120

Query: 121 KGVMPDGTSRFHNKKGESLYHFMGCSTFSEYTVVADVSVVAIDQTAPLESVCLLGCGVTT 180
           KGVMPDGTSRFHNKKGE L HFMGCSTFS+YTVVADVSVVAID  APL+  CLLGCGVTT
Sbjct: 121 KGVMPDGTSRFHNKKGEDLLHFMGCSTFSQYTVVADVSVVAIDPKAPLDKTCLLGCGVTT 180

Query: 181 GYGAAVKTANVQKGDTVAVFGCGTVGLSVLQGAHQRGASRIIAIDTNDQKKDFCTQFGAT 240
           GYGAAVKTA+VQKGDTVA+FG GTVGLSV+QGAH RGAS+II +D NDQKK +   FGAT
Sbjct: 181 GYGAAVKTADVQKGDTVAIFGAGTVGLSVVQGAHVRGASKIIVVDINDQKKQWSLDFGAT 240

Query: 241 DFINPTKDLKENETIVAKLIEMTDGGLDHTFDCTGNVNVMRSALEACHKGWGQSVIIGVA 300
           DF+NP+K LK+ +TIV KL+EMTDGGLD TFDCTGN +VMRSALEACHKGWGQS+IIGVA
Sbjct: 241 DFVNPSKGLKDGQTIVDKLVEMTDGGLDFTFDCTGNTDVMRSALEACHKGWGQSIIIGVA 300

Query: 301 AAGQEISTRPFQLVTGRVWKGSAFGGVKGRSEMAGLIEQYKKGELKVDEFITHRRSFNEI 360
           AAG+EISTRPFQLVTGRVWKGSAFGG+KGRSEM GL+  Y  G+LKVDEFITHRR F +I
Sbjct: 301 AAGKEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLVSDYMDGKLKVDEFITHRRGFTDI 360

Query: 361 NEAFDDLHNGLCLRTVLSFSK 381
           N AF+DLH+G CLRTVL  SK
Sbjct: 361 NSAFEDLHHGDCLRTVLDLSK 381

>Skud_4.89 Chr4 (155298..156455) [1158 bp, 385 aa] {ON} YDL168W
           (REAL)
          Length = 385

 Score =  647 bits (1670), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 306/380 (80%), Positives = 339/380 (89%)

Query: 2   TEGKPIECLAAVAYEAGKPQVVEQIVVDPPKAHEVRIKIVNTAVCHTDAYTLSGADPEGL 61
           T GKPI+C+AAVAY A K   VE+I VDPPKAHEVRIKI  TAVCHTDAYTLSG+DPEGL
Sbjct: 5   TVGKPIQCVAAVAYNAKKSLSVEEITVDPPKAHEVRIKIEFTAVCHTDAYTLSGSDPEGL 64

Query: 62  FPCVLGHEGAGIVESVGDGVTNVKPGDHVIALYTAECQKCKFCLSGKTNLCGAVRATQGK 121
           FPC+LGHEGAGIVESVGD V  VKPGDHVIALYTAEC KCKFC SGKTNLC AVRATQGK
Sbjct: 65  FPCILGHEGAGIVESVGDDVMTVKPGDHVIALYTAECGKCKFCTSGKTNLCSAVRATQGK 124

Query: 122 GVMPDGTSRFHNKKGESLYHFMGCSTFSEYTVVADVSVVAIDQTAPLESVCLLGCGVTTG 181
           GVMPDGT+RFHN KGE +YHFMGCSTFSEYTVVADVSVVAID  APL++ CLLGCGVTTG
Sbjct: 125 GVMPDGTTRFHNAKGEDIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDAACLLGCGVTTG 184

Query: 182 YGAAVKTANVQKGDTVAVFGCGTVGLSVLQGAHQRGASRIIAIDTNDQKKDFCTQFGATD 241
           YGAA+KTANVQ+GDTVAVFGCGTVGLSV+QGA  RGAS+IIA+D N++K+ + + FGATD
Sbjct: 185 YGAAIKTANVQEGDTVAVFGCGTVGLSVMQGAKSRGASKIIAVDINNKKRQYSSNFGATD 244

Query: 242 FINPTKDLKENETIVAKLIEMTDGGLDHTFDCTGNVNVMRSALEACHKGWGQSVIIGVAA 301
           FINP +DL E++TIV KLI+MTDGGLD TFDCTGN N+MR ALEACHKGWGQS+IIGVAA
Sbjct: 245 FINPKEDLAEDQTIVEKLIDMTDGGLDFTFDCTGNTNIMRDALEACHKGWGQSIIIGVAA 304

Query: 302 AGQEISTRPFQLVTGRVWKGSAFGGVKGRSEMAGLIEQYKKGELKVDEFITHRRSFNEIN 361
           AG+EISTRPFQLVTGRVWKGSAFGG+KGRSEM GLI+ Y+ G LKV+EFITHRR F EIN
Sbjct: 305 AGEEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIKDYQSGALKVEEFITHRRPFKEIN 364

Query: 362 EAFDDLHNGLCLRTVLSFSK 381
           +AF+DLHNG CLRTVL F +
Sbjct: 365 QAFEDLHNGDCLRTVLRFQE 384

>Suva_4.78 Chr4 (147109..148266) [1158 bp, 385 aa] {ON} YDL168W
           (REAL)
          Length = 385

 Score =  641 bits (1653), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 305/380 (80%), Positives = 335/380 (88%)

Query: 2   TEGKPIECLAAVAYEAGKPQVVEQIVVDPPKAHEVRIKIVNTAVCHTDAYTLSGADPEGL 61
           T GKPI+C+AA+AY+A KP  VE+I VDPPKAHEVRIKI  TAVCHTDAYTLSG+DPEGL
Sbjct: 5   TVGKPIQCIAAIAYDAKKPLSVEEITVDPPKAHEVRIKIEYTAVCHTDAYTLSGSDPEGL 64

Query: 62  FPCVLGHEGAGIVESVGDGVTNVKPGDHVIALYTAECQKCKFCLSGKTNLCGAVRATQGK 121
           FPC+LGHEGAGIVESVGD VT VKPGDHVIALYTAEC KCKFC SGKTNLC AVRATQG+
Sbjct: 65  FPCILGHEGAGIVESVGDDVTTVKPGDHVIALYTAECGKCKFCTSGKTNLCSAVRATQGR 124

Query: 122 GVMPDGTSRFHNKKGESLYHFMGCSTFSEYTVVADVSVVAIDQTAPLESVCLLGCGVTTG 181
           G+MPD T+RFHN KGE +YHFMGCSTFSEYTVVADVSVVAID  APL++  LLGCGVTTG
Sbjct: 125 GIMPDETTRFHNGKGEDIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDAASLLGCGVTTG 184

Query: 182 YGAAVKTANVQKGDTVAVFGCGTVGLSVLQGAHQRGASRIIAIDTNDQKKDFCTQFGATD 241
           YGAAVKTANVQKGDTVAVFGCGTVGLSV+QGA  RGAS+II ID N++KK +C  FGATD
Sbjct: 185 YGAAVKTANVQKGDTVAVFGCGTVGLSVIQGAKARGASKIIGIDINNKKKQYCFDFGATD 244

Query: 242 FINPTKDLKENETIVAKLIEMTDGGLDHTFDCTGNVNVMRSALEACHKGWGQSVIIGVAA 301
           FINP +DL + +TIV KLIE TDGGLD TFDCTGN  +MR ALEACHKGWGQS+IIGVAA
Sbjct: 245 FINPKEDLAKGQTIVEKLIETTDGGLDFTFDCTGNTKIMRDALEACHKGWGQSIIIGVAA 304

Query: 302 AGQEISTRPFQLVTGRVWKGSAFGGVKGRSEMAGLIEQYKKGELKVDEFITHRRSFNEIN 361
           AG+EISTRPFQLVTGRVWKGSAFGG+KGRSEM GLI+ Y+ G LKV+EFITHRR F EIN
Sbjct: 305 AGEEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIKDYQNGALKVEEFITHRRPFKEIN 364

Query: 362 EAFDDLHNGLCLRTVLSFSK 381
           +AF+DLH G CLRTVL F K
Sbjct: 365 QAFEDLHQGDCLRTVLKFDK 384

>TBLA0E00390 Chr5 complement(71890..73041) [1152 bp, 383 aa] {ON} 
          Length = 383

 Score =  639 bits (1648), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 305/380 (80%), Positives = 340/380 (89%)

Query: 2   TEGKPIECLAAVAYEAGKPQVVEQIVVDPPKAHEVRIKIVNTAVCHTDAYTLSGADPEGL 61
           T+GKPI+CLAAVAY+A +P  VE+I+V+PP+AHEVRIKI +TAVCHTDAYTLSG DPEG 
Sbjct: 4   TQGKPIKCLAAVAYKAAEPLTVEEIIVEPPEAHEVRIKITHTAVCHTDAYTLSGVDPEGA 63

Query: 62  FPCVLGHEGAGIVESVGDGVTNVKPGDHVIALYTAECQKCKFCLSGKTNLCGAVRATQGK 121
           FPCVLGHEG+GIVESVG+GV++VK GDHVIALYTAEC  CKFC SGKTNLCG+VR TQGK
Sbjct: 64  FPCVLGHEGSGIVESVGEGVSSVKVGDHVIALYTAECGVCKFCKSGKTNLCGSVRETQGK 123

Query: 122 GVMPDGTSRFHNKKGESLYHFMGCSTFSEYTVVADVSVVAIDQTAPLESVCLLGCGVTTG 181
           GVMPDGTSRF N KGESL HFMGCSTFS+YTVVADVSVVAI++TAPL+SVCLLGCGVTTG
Sbjct: 124 GVMPDGTSRFKNLKGESLLHFMGCSTFSQYTVVADVSVVAINKTAPLQSVCLLGCGVTTG 183

Query: 182 YGAAVKTANVQKGDTVAVFGCGTVGLSVLQGAHQRGASRIIAIDTNDQKKDFCTQFGATD 241
           YGAA+KTANVQK DTVAVFG GTVGLSV+QGA  RGAS+II +D N +K+ +  QFGATD
Sbjct: 184 YGAAIKTANVQKNDTVAVFGAGTVGLSVVQGAQARGASKIIMVDVNSKKETYSRQFGATD 243

Query: 242 FINPTKDLKENETIVAKLIEMTDGGLDHTFDCTGNVNVMRSALEACHKGWGQSVIIGVAA 301
           FINP  DLK  ETIV+KL+EMTDGGLDHTFDCTGNV VMR ALE CHKGWGQS+IIGVAA
Sbjct: 244 FINPMTDLKPGETIVSKLVEMTDGGLDHTFDCTGNVKVMRDALECCHKGWGQSIIIGVAA 303

Query: 302 AGQEISTRPFQLVTGRVWKGSAFGGVKGRSEMAGLIEQYKKGELKVDEFITHRRSFNEIN 361
           AGQEISTRPFQLVTGRVWKGSAFGGVKGRSEM GLIE Y+KG+LKVD+FIT++R F EIN
Sbjct: 304 AGQEISTRPFQLVTGRVWKGSAFGGVKGRSEMGGLIESYQKGDLKVDQFITNKRPFTEIN 363

Query: 362 EAFDDLHNGLCLRTVLSFSK 381
            AF+DLH+G CLRTVL   K
Sbjct: 364 AAFEDLHHGDCLRTVLDLEK 383

>KLLA0D12342g Chr4 (1050181..1051335) [1155 bp, 384 aa] {ON} highly
           similar to uniprot|P32771 Saccharomyces cerevisiae
           YDL168W SFA1 Long-chain alcohol dehydrogenase
           (glutathione-dependent formaldehyde dehydrogenase)
          Length = 384

 Score =  635 bits (1638), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 301/379 (79%), Positives = 335/379 (88%)

Query: 2   TEGKPIECLAAVAYEAGKPQVVEQIVVDPPKAHEVRIKIVNTAVCHTDAYTLSGADPEGL 61
           T GKPIEC+AAVAYEAGKP  VE+I+VD PKAHEVR+++ +TAVCHTDAYTLSG DPEG 
Sbjct: 5   TAGKPIECVAAVAYEAGKPLTVEKIIVDAPKAHEVRVQVTHTAVCHTDAYTLSGVDPEGA 64

Query: 62  FPCVLGHEGAGIVESVGDGVTNVKPGDHVIALYTAECQKCKFCLSGKTNLCGAVRATQGK 121
           FP +LGHEGAGIVESVGDGVTNVK GDHV+ LYTAEC KCKFC S KTNLCG+VRATQGK
Sbjct: 65  FPSILGHEGAGIVESVGDGVTNVKVGDHVVLLYTAECGKCKFCKSNKTNLCGSVRATQGK 124

Query: 122 GVMPDGTSRFHNKKGESLYHFMGCSTFSEYTVVADVSVVAIDQTAPLESVCLLGCGVTTG 181
           GVMPDGT+RFHN KGE L HFMGCSTFS+YTVVADVS+V ID +APL SVCLLGCGVTTG
Sbjct: 125 GVMPDGTTRFHNLKGEPLLHFMGCSTFSQYTVVADVSLVTIDPSAPLSSVCLLGCGVTTG 184

Query: 182 YGAAVKTANVQKGDTVAVFGCGTVGLSVLQGAHQRGASRIIAIDTNDQKKDFCTQFGATD 241
           YGAAVKTANVQ+GDTVAVFG GTVGLSV+QGA  RGAS+II +D NDQKK +   FGAT 
Sbjct: 185 YGAAVKTANVQEGDTVAVFGAGTVGLSVVQGAKSRGASKIIVVDVNDQKKQWSMDFGATG 244

Query: 242 FINPTKDLKENETIVAKLIEMTDGGLDHTFDCTGNVNVMRSALEACHKGWGQSVIIGVAA 301
           F+NP KDLKE ETIV+KLI+MTDGGLD TFDCTGNV VMR ALEACHKGWGQS+IIGVAA
Sbjct: 245 FVNPLKDLKEGETIVSKLIDMTDGGLDFTFDCTGNVKVMRDALEACHKGWGQSIIIGVAA 304

Query: 302 AGQEISTRPFQLVTGRVWKGSAFGGVKGRSEMAGLIEQYKKGELKVDEFITHRRSFNEIN 361
           AG+EISTRPFQL+TGRVWKGSAFGG+KGRSEM  L+  Y+KG+LKVD+FITH+R F EIN
Sbjct: 305 AGEEISTRPFQLITGRVWKGSAFGGIKGRSEMGQLVTSYQKGDLKVDDFITHKRPFTEIN 364

Query: 362 EAFDDLHNGLCLRTVLSFS 380
            AF+DLH+G CLRTVL  +
Sbjct: 365 NAFEDLHHGDCLRTVLDLA 383

>SAKL0F11374g Chr6 complement(885478..886629) [1152 bp, 383 aa] {ON}
           highly similar to uniprot|P32771 Saccharomyces
           cerevisiae YDL168W SFA1 Long-chain alcohol dehydrogenase
           (glutathione-dependent formaldehyde dehydrogenase)
          Length = 383

 Score =  634 bits (1635), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 311/380 (81%), Positives = 338/380 (88%)

Query: 2   TEGKPIECLAAVAYEAGKPQVVEQIVVDPPKAHEVRIKIVNTAVCHTDAYTLSGADPEGL 61
           T GKPI CLAAVAYEAGKP  VE+I+V+PPKAHEVRI+I  TAVCHTDAYTLSG DPEG 
Sbjct: 4   TVGKPITCLAAVAYEAGKPLTVEEIIVEPPKAHEVRIRITYTAVCHTDAYTLSGVDPEGA 63

Query: 62  FPCVLGHEGAGIVESVGDGVTNVKPGDHVIALYTAECQKCKFCLSGKTNLCGAVRATQGK 121
           FP +LGHEGAG+VESVG GVTNVKPGDHV+ALYTAECQKCKFC SGKTNLCG+VRATQGK
Sbjct: 64  FPSILGHEGAGVVESVGKGVTNVKPGDHVVALYTAECQKCKFCTSGKTNLCGSVRATQGK 123

Query: 122 GVMPDGTSRFHNKKGESLYHFMGCSTFSEYTVVADVSVVAIDQTAPLESVCLLGCGVTTG 181
           GVMPDGTSRF  K GES+ HFMGCSTFS+YTVVADVSVVA+D  APL+ +CLLGCGVTTG
Sbjct: 124 GVMPDGTSRFRTKNGESILHFMGCSTFSQYTVVADVSVVAVDSQAPLDRICLLGCGVTTG 183

Query: 182 YGAAVKTANVQKGDTVAVFGCGTVGLSVLQGAHQRGASRIIAIDTNDQKKDFCTQFGATD 241
           YGAA+KTANVQKGDTVAVFG GTVGLSV+QGA  RGASRII +D NDQKK + + FGATD
Sbjct: 184 YGAAIKTANVQKGDTVAVFGAGTVGLSVVQGAKARGASRIIVVDINDQKKQWASDFGATD 243

Query: 242 FINPTKDLKENETIVAKLIEMTDGGLDHTFDCTGNVNVMRSALEACHKGWGQSVIIGVAA 301
           F+NP+KDLKE ETIV+KLIE+TDGGLD TFDCTGN  VMR ALEACHKGWGQS+IIGVAA
Sbjct: 244 FVNPSKDLKEGETIVSKLIELTDGGLDFTFDCTGNTKVMRDALEACHKGWGQSIIIGVAA 303

Query: 302 AGQEISTRPFQLVTGRVWKGSAFGGVKGRSEMAGLIEQYKKGELKVDEFITHRRSFNEIN 361
           AGQEISTRPFQLVTGRVWKGSAFGG+KGRSEM GL+  Y  G+LKVDEFITHRR F EIN
Sbjct: 304 AGQEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLVSDYMDGQLKVDEFITHRRPFTEIN 363

Query: 362 EAFDDLHNGLCLRTVLSFSK 381
            AFDDLH+G CLRTVL  SK
Sbjct: 364 AAFDDLHHGDCLRTVLDLSK 383

>ACL148C Chr3 complement(90932..92077) [1146 bp, 381 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDL168W
           (SFA1)
          Length = 381

 Score =  633 bits (1633), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 307/378 (81%), Positives = 342/378 (90%)

Query: 2   TEGKPIECLAAVAYEAGKPQVVEQIVVDPPKAHEVRIKIVNTAVCHTDAYTLSGADPEGL 61
           T+GKPI+C AAVAY AG+P  +E++ VDPPKAHEVRIKIVN+A+CHTDAYTLSG+DPEGL
Sbjct: 4   TQGKPIQCTAAVAYAAGEPLRIEKVTVDPPKAHEVRIKIVNSAICHTDAYTLSGSDPEGL 63

Query: 62  FPCVLGHEGAGIVESVGDGVTNVKPGDHVIALYTAECQKCKFCLSGKTNLCGAVRATQGK 121
           FPC+LGHEG+GIVESVG+GVTNVKPGDHV+ LYTAECQ+CKFC+SGKTNLCGAVRATQGK
Sbjct: 64  FPCILGHEGSGIVESVGEGVTNVKPGDHVVPLYTAECQQCKFCVSGKTNLCGAVRATQGK 123

Query: 122 GVMPDGTSRFHNKKGESLYHFMGCSTFSEYTVVADVSVVAIDQTAPLESVCLLGCGVTTG 181
           GVMPDGTSRF N KGE+LYHFMGCSTFSEYTVVADVSVVA+DQ APLE+VCLLGCGVTTG
Sbjct: 124 GVMPDGTSRFRNGKGETLYHFMGCSTFSEYTVVADVSVVAVDQQAPLETVCLLGCGVTTG 183

Query: 182 YGAAVKTANVQKGDTVAVFGCGTVGLSVLQGAHQRGASRIIAIDTNDQKKDFCTQFGATD 241
           YGAAVKTA+VQ+GDTVAVFG GTVGLSV+QGA  R ASRII +D ND K+++ ++FGATD
Sbjct: 184 YGAAVKTADVQEGDTVAVFGAGTVGLSVVQGAKARNASRIIVVDINDAKREWASKFGATD 243

Query: 242 FINPTKDLKENETIVAKLIEMTDGGLDHTFDCTGNVNVMRSALEACHKGWGQSVIIGVAA 301
           FINP  DLKE ETIVA+LIEMTDGGLDHTFDCTGN  VMR ALEACHKGWGQS+IIGVAA
Sbjct: 244 FINPKTDLKEGETIVARLIEMTDGGLDHTFDCTGNTKVMRDALEACHKGWGQSIIIGVAA 303

Query: 302 AGQEISTRPFQLVTGRVWKGSAFGGVKGRSEMAGLIEQYKKGELKVDEFITHRRSFNEIN 361
           AGQEISTRPFQLVTGRVWKGSAFGG+KGRSEM GL+  Y  G LKV EF+TH+R F EIN
Sbjct: 304 AGQEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLVRDYLNGTLKVQEFVTHKRPFEEIN 363

Query: 362 EAFDDLHNGLCLRTVLSF 379
             F+DLH+G CLRTVLS 
Sbjct: 364 SGFEDLHHGDCLRTVLSL 381

>Ecym_4723 Chr4 (1415078..1416223) [1146 bp, 381 aa] {ON} similar to
           Ashbya gossypii ACL148C
          Length = 381

 Score =  631 bits (1627), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 300/379 (79%), Positives = 332/379 (87%)

Query: 1   MTEGKPIECLAAVAYEAGKPQVVEQIVVDPPKAHEVRIKIVNTAVCHTDAYTLSGADPEG 60
           +T GK I+C AA+AY AG P  +E I VDPPKAHEVRIKI +TA+CHTDAYTLSG DPEG
Sbjct: 3   ITAGKTIQCKAAIAYTAGNPLKIETITVDPPKAHEVRIKITHTALCHTDAYTLSGVDPEG 62

Query: 61  LFPCVLGHEGAGIVESVGDGVTNVKPGDHVIALYTAECQKCKFCLSGKTNLCGAVRATQG 120
           +FP +LGHEG+GIVESVG GVTNVK GDHVI LYTAECQ+CKFC+SGKTNLCG+VRATQG
Sbjct: 63  IFPSILGHEGSGIVESVGTGVTNVKVGDHVIPLYTAECQECKFCISGKTNLCGSVRATQG 122

Query: 121 KGVMPDGTSRFHNKKGESLYHFMGCSTFSEYTVVADVSVVAIDQTAPLESVCLLGCGVTT 180
           KG+MPDGTSRF N KGE +YHFMGCSTFSEYTVVADVSVVAID+ APL+ VCLLGCGVTT
Sbjct: 123 KGLMPDGTSRFKNSKGEVIYHFMGCSTFSEYTVVADVSVVAIDEKAPLDKVCLLGCGVTT 182

Query: 181 GYGAAVKTANVQKGDTVAVFGCGTVGLSVLQGAHQRGASRIIAIDTNDQKKDFCTQFGAT 240
           GYGAAVKTA+VQKGDTVAVFG GTVGLSV+QGA  RGAS+II +D ND KK +   FGAT
Sbjct: 183 GYGAAVKTADVQKGDTVAVFGAGTVGLSVVQGAQSRGASKIIVVDINDDKKKWSFDFGAT 242

Query: 241 DFINPTKDLKENETIVAKLIEMTDGGLDHTFDCTGNVNVMRSALEACHKGWGQSVIIGVA 300
           DFINPTKDL + ETIV+KLI+MTDGGLDHTFDCTGN  VMR ALEACHKGWGQS+IIGVA
Sbjct: 243 DFINPTKDLNDGETIVSKLIDMTDGGLDHTFDCTGNTKVMRDALEACHKGWGQSIIIGVA 302

Query: 301 AAGQEISTRPFQLVTGRVWKGSAFGGVKGRSEMAGLIEQYKKGELKVDEFITHRRSFNEI 360
           AAGQEISTRPFQLVTGRVWKGSAFGG+KGRSEM  LI  Y  G+LKVDEF+TH R F+EI
Sbjct: 303 AAGQEISTRPFQLVTGRVWKGSAFGGIKGRSEMGNLISDYFAGKLKVDEFVTHTRPFSEI 362

Query: 361 NEAFDDLHNGLCLRTVLSF 379
           N+   DLH+G CLRTVL+F
Sbjct: 363 NDGLTDLHHGDCLRTVLNF 381

>TPHA0F02970 Chr6 complement(653405..654550) [1146 bp, 381 aa] {ON}
           Anc_7.350 YDL168W
          Length = 381

 Score =  628 bits (1620), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 299/377 (79%), Positives = 334/377 (88%), Gaps = 1/377 (0%)

Query: 4   GKPIECLAAVAYEAGKPQVVEQIVVDPPKAHEVRIKIVNTAVCHTDAYTLSGADPEGLFP 63
           GKPI C AA+AYEA KP  V +IVVDPPKAHEVRIKIV TAVCHTDAY+LSG DPEGLFP
Sbjct: 5   GKPITCTAAIAYEANKPLTVTEIVVDPPKAHEVRIKIVKTAVCHTDAYSLSGVDPEGLFP 64

Query: 64  CVLGHEGAGIVESVGDGVTNVKPGDHVIALYTAECQKCKFCLSGKTNLCGAVRATQGKGV 123
           CVLGHEG+GIVES+G  VTNVK GDHVIALYTAEC KCKFCLSGKTNLCG+VRATQGKGV
Sbjct: 65  CVLGHEGSGIVESIGADVTNVKVGDHVIALYTAECGKCKFCLSGKTNLCGSVRATQGKGV 124

Query: 124 MPDGTSRFHNKKGESLYHFMGCSTFSEYTVVADVSVVAIDQTAPLESVCLLGCGVTTGYG 183
           MPDGT+RFH+K G+ +YHFMGCSTFS+YTVVADVS+VA D++   E   LLGCGVTTGYG
Sbjct: 125 MPDGTTRFHDKDGKPIYHFMGCSTFSQYTVVADVSLVAFDKSVSFEPTALLGCGVTTGYG 184

Query: 184 AAVKTANVQKGDTVAVFGCGTVGLSVLQGAHQRGASRIIAIDTNDQKKDFCTQFGATDFI 243
           AA+KTAN+QKGDTVAVFG GTVGLSV+QGA  RGAS+II +D N+ KKD+  +FGATDF+
Sbjct: 185 AAIKTANIQKGDTVAVFGAGTVGLSVVQGAKSRGASKIIVVDLNNDKKDWSFEFGATDFV 244

Query: 244 NPTKDLKENETIVAKLIEMTDGGLDHTFDCTGNVNVMRSALEACHKGWGQSVIIGVAAAG 303
           NP K+LK++E IV+KLIEMTDGGLD TFDCTGNVNVMR+ALEACHKGWGQS+IIGVAAAG
Sbjct: 245 NP-KELKDSEDIVSKLIEMTDGGLDFTFDCTGNVNVMRNALEACHKGWGQSIIIGVAAAG 303

Query: 304 QEISTRPFQLVTGRVWKGSAFGGVKGRSEMAGLIEQYKKGELKVDEFITHRRSFNEINEA 363
           QEI+TRPFQLVTGRVW+GSAFGG+KGRSEM GLI+ Y+ G LKVDEFIT RR F EIN A
Sbjct: 304 QEIATRPFQLVTGRVWRGSAFGGIKGRSEMGGLIKDYQSGTLKVDEFITGRRPFTEINAA 363

Query: 364 FDDLHNGLCLRTVLSFS 380
           F+DLHNG CLRTVL  S
Sbjct: 364 FEDLHNGSCLRTVLDTS 380

>TDEL0C01980 Chr3 (344639..345796) [1158 bp, 385 aa] {ON} Anc_7.350
           YDL168W
          Length = 385

 Score =  619 bits (1596), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 309/380 (81%), Positives = 334/380 (87%)

Query: 2   TEGKPIECLAAVAYEAGKPQVVEQIVVDPPKAHEVRIKIVNTAVCHTDAYTLSGADPEGL 61
           TEGK I C+AAVAYEAGKP  VE+I V+ P+AHEVRIKI  TAVCHTDAYTLSG DPEG 
Sbjct: 6   TEGKSITCVAAVAYEAGKPLTVEEITVEAPRAHEVRIKIEYTAVCHTDAYTLSGVDPEGA 65

Query: 62  FPCVLGHEGAGIVESVGDGVTNVKPGDHVIALYTAECQKCKFCLSGKTNLCGAVRATQGK 121
           FP +LGHEGAGIVESVG+GVTNVKPGDHVIALYTAECQKCKFC SGKTNLC +VRATQGK
Sbjct: 66  FPSILGHEGAGIVESVGEGVTNVKPGDHVIALYTAECQKCKFCKSGKTNLCSSVRATQGK 125

Query: 122 GVMPDGTSRFHNKKGESLYHFMGCSTFSEYTVVADVSVVAIDQTAPLESVCLLGCGVTTG 181
           GVMPDGTSRF N+KGE L HFMGCSTFS+YTVVADVSVVA+D +APLES+CLLGCGVTTG
Sbjct: 126 GVMPDGTSRFKNQKGEELKHFMGCSTFSQYTVVADVSVVAVDPSAPLESICLLGCGVTTG 185

Query: 182 YGAAVKTANVQKGDTVAVFGCGTVGLSVLQGAHQRGASRIIAIDTNDQKKDFCTQFGATD 241
           YGAA KTANVQKGDTVAVFG GTVGLSV+QGA  RGASRII +D NDQK+ +  +FGATD
Sbjct: 186 YGAATKTANVQKGDTVAVFGAGTVGLSVIQGAKVRGASRIILVDINDQKRKYGNEFGATD 245

Query: 242 FINPTKDLKENETIVAKLIEMTDGGLDHTFDCTGNVNVMRSALEACHKGWGQSVIIGVAA 301
           FINP  DLK+ +TIV KLIEMTDGGLD+TFDCTGN  VMR ALEACHKGWG SVIIGVAA
Sbjct: 246 FINPKSDLKDGQTIVEKLIEMTDGGLDYTFDCTGNTKVMRDALEACHKGWGTSVIIGVAA 305

Query: 302 AGQEISTRPFQLVTGRVWKGSAFGGVKGRSEMAGLIEQYKKGELKVDEFITHRRSFNEIN 361
           A +EISTRPFQLVTGRVWKGSAFGG+KGRSEM GLIE YKKG LKVDEFIT+ R F EIN
Sbjct: 306 AEEEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIEDYKKGTLKVDEFITNERPFTEIN 365

Query: 362 EAFDDLHNGLCLRTVLSFSK 381
           +AF+DLH G CLRTVL   K
Sbjct: 366 KAFEDLHAGDCLRTVLDLKK 385

>KAFR0B00880 Chr2 complement(164475..165620) [1146 bp, 381 aa] {ON}
           Anc_7.350 YDL168W
          Length = 381

 Score =  618 bits (1594), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 291/378 (76%), Positives = 331/378 (87%)

Query: 2   TEGKPIECLAAVAYEAGKPQVVEQIVVDPPKAHEVRIKIVNTAVCHTDAYTLSGADPEGL 61
           T+GK I+C AAVAYEA KP VV+ ++VD PKAHEVRIKI+NTA+CHTDAYTLSG DPEGL
Sbjct: 4   TQGKAIQCKAAVAYEAKKPLVVQDVIVDAPKAHEVRIKIMNTAICHTDAYTLSGVDPEGL 63

Query: 62  FPCVLGHEGAGIVESVGDGVTNVKPGDHVIALYTAECQKCKFCLSGKTNLCGAVRATQGK 121
           FPC+LGHEG+GIVES+G+GVT+VK GDHVI LYTAECQKCKFC SGKTNLCGAVR TQGK
Sbjct: 64  FPCILGHEGSGIVESIGEGVTSVKVGDHVIPLYTAECQKCKFCKSGKTNLCGAVRETQGK 123

Query: 122 GVMPDGTSRFHNKKGESLYHFMGCSTFSEYTVVADVSVVAIDQTAPLESVCLLGCGVTTG 181
           GVMPDGTSRFH  +G+ ++HFMGCSTFSEYTVVADVSVVAID+   LE   LLGCGVTTG
Sbjct: 124 GVMPDGTSRFHTLEGKDIFHFMGCSTFSEYTVVADVSVVAIDKKVSLEPASLLGCGVTTG 183

Query: 182 YGAAVKTANVQKGDTVAVFGCGTVGLSVLQGAHQRGASRIIAIDTNDQKKDFCTQFGATD 241
           +GAAVK ANVQKGDTVAVFG GTVGLSV+QGA  RG S++I +D ND+KK F   FGATD
Sbjct: 184 FGAAVKAANVQKGDTVAVFGAGTVGLSVVQGARMRGCSKVIVVDINDEKKQFSYDFGATD 243

Query: 242 FINPTKDLKENETIVAKLIEMTDGGLDHTFDCTGNVNVMRSALEACHKGWGQSVIIGVAA 301
           F+NP  DLK+ ETIV KLI MTDGGLD+TFDCTGNV+VMR+ALEACHKGWGQS IIGVAA
Sbjct: 244 FVNPMTDLKDGETIVNKLISMTDGGLDYTFDCTGNVHVMRNALEACHKGWGQSFIIGVAA 303

Query: 302 AGQEISTRPFQLVTGRVWKGSAFGGVKGRSEMAGLIEQYKKGELKVDEFITHRRSFNEIN 361
           AGQEISTRPFQLVTGRVW+G+AFG +KGR++M  L++ Y+KG LK+DEFITHRR F+EIN
Sbjct: 304 AGQEISTRPFQLVTGRVWRGTAFGDIKGRTDMPQLLDDYEKGLLKIDEFITHRRQFDEIN 363

Query: 362 EAFDDLHNGLCLRTVLSF 379
           + F+DLH G CLRTVL F
Sbjct: 364 DGFEDLHMGTCLRTVLKF 381

>NCAS0A14160 Chr1 complement(2782022..2783377) [1356 bp, 451 aa]
           {ON} Anc_7.350
          Length = 451

 Score =  620 bits (1599), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 308/380 (81%), Positives = 338/380 (88%)

Query: 2   TEGKPIECLAAVAYEAGKPQVVEQIVVDPPKAHEVRIKIVNTAVCHTDAYTLSGADPEGL 61
           T+GKPI C AAVAY AGKP  VEQIVVDPPKAHEVRIKI  TAVCHTDAYTLSG DPEG 
Sbjct: 72  TQGKPITCTAAVAYAAGKPLTVEQIVVDPPKAHEVRIKIEYTAVCHTDAYTLSGIDPEGA 131

Query: 62  FPCVLGHEGAGIVESVGDGVTNVKPGDHVIALYTAECQKCKFCLSGKTNLCGAVRATQGK 121
           FP +LGHEG+GIVESVG+GVTNVK GDHVIALYTAEC KCKFC SGKTNLCG+VRATQGK
Sbjct: 132 FPSILGHEGSGIVESVGEGVTNVKVGDHVIALYTAECGKCKFCKSGKTNLCGSVRATQGK 191

Query: 122 GVMPDGTSRFHNKKGESLYHFMGCSTFSEYTVVADVSVVAIDQTAPLESVCLLGCGVTTG 181
           GVMPDGTSRFHN+KGE L HFMGCSTFS+YTVVADVSVVA+D  APL+S+ LLGCGVTTG
Sbjct: 192 GVMPDGTSRFHNQKGEPLLHFMGCSTFSQYTVVADVSVVAVDPKAPLDSISLLGCGVTTG 251

Query: 182 YGAAVKTANVQKGDTVAVFGCGTVGLSVLQGAHQRGASRIIAIDTNDQKKDFCTQFGATD 241
           YGAA+KTANVQKGDTVAVFG GTVGLSV+QGA  RGAS+II +D N+ KK +   FGATD
Sbjct: 252 YGAAIKTANVQKGDTVAVFGAGTVGLSVVQGAKSRGASKIIVVDINNDKKQWSFDFGATD 311

Query: 242 FINPTKDLKENETIVAKLIEMTDGGLDHTFDCTGNVNVMRSALEACHKGWGQSVIIGVAA 301
           F+NP +DLKE ETIV KLIEMTDGGL++TFDCTGNV VMR ALEACHKGWG+S+IIGVA 
Sbjct: 312 FVNPKEDLKEGETIVQKLIEMTDGGLEYTFDCTGNVKVMRDALEACHKGWGESIIIGVAG 371

Query: 302 AGQEISTRPFQLVTGRVWKGSAFGGVKGRSEMAGLIEQYKKGELKVDEFITHRRSFNEIN 361
           AG+EISTRPFQLVTGRVWKGSAFGG+KGRSEM GLIE Y+ G+LKVDEFITHRR F EIN
Sbjct: 372 AGEEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIEDYQNGKLKVDEFITHRRPFTEIN 431

Query: 362 EAFDDLHNGLCLRTVLSFSK 381
           +AF+DLH+G CLRTVL  +K
Sbjct: 432 DAFEDLHHGDCLRTVLDLAK 451

>ZYRO0F11704g Chr6 complement(958546..959694) [1149 bp, 382 aa] {ON}
           highly similar to uniprot|P32771 Saccharomyces
           cerevisiae YDL168W SFA1 Long-chain alcohol dehydrogenase
           (glutathione-dependent formaldehyde dehydrogenase)
          Length = 382

 Score =  616 bits (1588), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 306/379 (80%), Positives = 335/379 (88%)

Query: 2   TEGKPIECLAAVAYEAGKPQVVEQIVVDPPKAHEVRIKIVNTAVCHTDAYTLSGADPEGL 61
           TEGKP+  LAAVAYEAGKP  VE+I VDPPKAHEVRI++  TAVCHTDAYTLSGADPEG 
Sbjct: 3   TEGKPVTSLAAVAYEAGKPLSVEEITVDPPKAHEVRIRVKKTAVCHTDAYTLSGADPEGA 62

Query: 62  FPCVLGHEGAGIVESVGDGVTNVKPGDHVIALYTAECQKCKFCLSGKTNLCGAVRATQGK 121
           FP +LGHEGAGIVESVG+GVT+VKPGDHV+ALYTAEC KCKFC SGKTNLCG+VRATQGK
Sbjct: 63  FPSILGHEGAGIVESVGEGVTSVKPGDHVVALYTAECGKCKFCKSGKTNLCGSVRATQGK 122

Query: 122 GVMPDGTSRFHNKKGESLYHFMGCSTFSEYTVVADVSVVAIDQTAPLESVCLLGCGVTTG 181
           GVMPDGTSRF NKKGE+L HFMGCSTFSEYTVVADVSVVA+D  APLES CLLGCGVTTG
Sbjct: 123 GVMPDGTSRFKNKKGETLLHFMGCSTFSEYTVVADVSVVAVDPKAPLESACLLGCGVTTG 182

Query: 182 YGAAVKTANVQKGDTVAVFGCGTVGLSVLQGAHQRGASRIIAIDTNDQKKDFCTQFGATD 241
           YGAAVKTANVQKGDTVA+FG GTVGLSV QGA  RGAS+II +D ND KK +  +FGATD
Sbjct: 183 YGAAVKTANVQKGDTVAIFGAGTVGLSVAQGAKARGASQIILVDINDAKKKYMHEFGATD 242

Query: 242 FINPTKDLKENETIVAKLIEMTDGGLDHTFDCTGNVNVMRSALEACHKGWGQSVIIGVAA 301
           FINP  DL+  +TIV KLIEMTDGGLD TFDCTGNV VMR ALEACHKGWG SV+IGVAA
Sbjct: 243 FINPATDLQNGQTIVEKLIEMTDGGLDFTFDCTGNVKVMRDALEACHKGWGVSVVIGVAA 302

Query: 302 AGQEISTRPFQLVTGRVWKGSAFGGVKGRSEMAGLIEQYKKGELKVDEFITHRRSFNEIN 361
           +GQEISTRPFQLVTGRVWKGSAFGG+KGRSEM GLI+ Y+ G LKVDEFIT+RR F +IN
Sbjct: 303 SGQEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIKDYQGGALKVDEFITNRRPFKQIN 362

Query: 362 EAFDDLHNGLCLRTVLSFS 380
           EAF+DLH G  LRTVL+++
Sbjct: 363 EAFEDLHAGDSLRTVLNYT 381

>KNAG0C03790 Chr3 complement(745394..746542) [1149 bp, 382 aa] {ON}
           Anc_7.350 YDL168W
          Length = 382

 Score =  533 bits (1373), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 273/385 (70%), Positives = 300/385 (77%), Gaps = 13/385 (3%)

Query: 2   TEGKPIECLAAVAYEAGKPQVVEQIVVDPPKAHEVRIKIVNTAVCHTDAYTLSGADPEGL 61
           TEG+ I C AAVAY AGKP  VEQI V+ P       +       H   Y   G      
Sbjct: 4   TEGQTITCTAAVAYAAGKPLTVEQITVEAPTGARGAYQD------HQHCYLPHGCVHSVW 57

Query: 62  F----PCV---LGHEGAGIVESVGDGVTNVKPGDHVIALYTAECQKCKFCLSGKTNLCGA 114
           F     CV    G  GAG+VESVG  VT+VK GDHVIALYTAEC++CK C SGKTNLC A
Sbjct: 58  FGSEVRCVSLCFGARGAGVVESVGPDVTSVKVGDHVIALYTAECKECKMCKSGKTNLCSA 117

Query: 115 VRATQGKGVMPDGTSRFHNKKGESLYHFMGCSTFSEYTVVADVSVVAIDQTAPLESVCLL 174
           VRATQGKGVMPDGTSRF N KGE L HFMGCSTF+EYTVVADVSVVAID+ APLE VCLL
Sbjct: 118 VRATQGKGVMPDGTSRFRNSKGEPLLHFMGCSTFAEYTVVADVSVVAIDRDAPLEKVCLL 177

Query: 175 GCGVTTGYGAAVKTANVQKGDTVAVFGCGTVGLSVLQGAHQRGASRIIAIDTNDQKKDFC 234
           GCGVTTGYGAA+KTANVQKGDTVAVFG GT+GLSV+QGA  R AS+II +D ND KK F 
Sbjct: 178 GCGVTTGYGAALKTANVQKGDTVAVFGAGTIGLSVVQGAKAREASKIIVVDINDTKKKFA 237

Query: 235 TQFGATDFINPTKDLKENETIVAKLIEMTDGGLDHTFDCTGNVNVMRSALEACHKGWGQS 294
             FGATDF+NP  DLK+ +TIV KL+EMTDGGLD TFD TGNV VMR ALEACHKGWGQS
Sbjct: 238 FDFGATDFVNPKTDLKDGQTIVEKLVEMTDGGLDFTFDGTGNVQVMRDALEACHKGWGQS 297

Query: 295 VIIGVAAAGQEISTRPFQLVTGRVWKGSAFGGVKGRSEMAGLIEQYKKGELKVDEFITHR 354
           +IIGVAAAG+EISTRPFQLVTGRVWKGSAFGGVKGRSEM  LIE Y KG LK+DEFIT++
Sbjct: 298 IIIGVAAAGKEISTRPFQLVTGRVWKGSAFGGVKGRSEMGSLIEDYNKGNLKIDEFITNK 357

Query: 355 RSFNEINEAFDDLHNGLCLRTVLSF 379
           R F EINE F+DLH+G CLRTVL++
Sbjct: 358 RPFKEINEGFEDLHHGDCLRTVLNY 382

>NDAI0A01890 Chr1 (425090..426358) [1269 bp, 422 aa] {ON} Anc_7.350
          Length = 422

 Score =  528 bits (1359), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 262/380 (68%), Positives = 288/380 (75%), Gaps = 46/380 (12%)

Query: 2   TEGKPIECLAAVAYEAGKPQVVEQIVVDPPKAHEVRIKIVNTAVCHTDAYTLSGADPEGL 61
           T+GKPI C AAVAYEAGKP  VE IVVDPPKAHEVRIKI  TAVCHTDAYTLSG DPEG 
Sbjct: 89  TQGKPITCTAAVAYEAGKPLTVEDIVVDPPKAHEVRIKIDYTAVCHTDAYTLSGVDPEGA 148

Query: 62  FPCVLGHEGAGIVESVGDGVTNVKPGDHVIALYTAECQKCKFCLSGKTNLCGAVRATQGK 121
           FP +LGHEG+GIVESVG+GVTNVK GDHVIALYTAEC +CKFC SG              
Sbjct: 149 FPSILGHEGSGIVESVGEGVTNVKVGDHVIALYTAECGECKFCKSGXXX----------- 197

Query: 122 GVMPDGTSRFHNKKGESLYHFMGCSTFSEYTVVADVSVVAIDQTAPLESVCLLGCGVTTG 181
                                                  A+D+ AP++S+CLLGCGVTTG
Sbjct: 198 -----------------------------------XXXXAVDKNAPMDSICLLGCGVTTG 222

Query: 182 YGAAVKTANVQKGDTVAVFGCGTVGLSVLQGAHQRGASRIIAIDTNDQKKDFCTQFGATD 241
           YGAA+KTANVQKGDTVAVFG GTVGLSV+QGA  RGAS+II +D NDQKK +   FGATD
Sbjct: 223 YGAAIKTANVQKGDTVAVFGAGTVGLSVVQGAKARGASKIIVVDVNDQKKQWSMDFGATD 282

Query: 242 FINPTKDLKENETIVAKLIEMTDGGLDHTFDCTGNVNVMRSALEACHKGWGQSVIIGVAA 301
           FINP  DLKE ETIV+KLIEMTDGGL++TFDCTGN  VMR ALEACHKGWG+S+IIGVAA
Sbjct: 283 FINPKTDLKEGETIVSKLIEMTDGGLEYTFDCTGNTKVMRDALEACHKGWGESIIIGVAA 342

Query: 302 AGQEISTRPFQLVTGRVWKGSAFGGVKGRSEMAGLIEQYKKGELKVDEFITHRRSFNEIN 361
           AG+EISTRPFQLVTGRVWKGSAFGG+KGRSEM GLI+ Y+ G LKVDEFITHRR F EIN
Sbjct: 343 AGEEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIKDYQNGNLKVDEFITHRRPFTEIN 402

Query: 362 EAFDDLHNGLCLRTVLSFSK 381
            AF+DLH+G CLRTVL  SK
Sbjct: 403 NAFEDLHHGDCLRTVLDLSK 422

>SAKL0A00880g Chr1 complement(92246..93412) [1167 bp, 388 aa] {ON}
           similar to uniprot|P32771 Saccharomyces cerevisiae
           YDL168W SFA1 Long-chain alcohol dehydrogenase
           (glutathione- dependent formaldehyde dehydrogenase)
          Length = 388

 Score =  461 bits (1186), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 217/376 (57%), Positives = 281/376 (74%), Gaps = 3/376 (0%)

Query: 3   EGKPIECLAAVAYEAGKPQVVEQIVVDPPKAHEVRIKIVNTAVCHTDAYTLSGADPEGLF 62
           EG+PI C AAVAY   KP V+EQI+VDPP+ HEVR+K+ NTA+C TD +TL G +PEG F
Sbjct: 5   EGEPIRCTAAVAYSINKPLVLEQIIVDPPQEHEVRVKVTNTALCRTDLFTLKGLNPEGKF 64

Query: 63  PCVLGHEGAGIVESVGDGVTNVKPGDHVIALYTAECQKCKFCLSGKTNLCGAVRATQGKG 122
           PCVLGHEG+GIVES G  V  VK GDHV+ LY  EC  C  C S K+NLC  ++ATQ +G
Sbjct: 65  PCVLGHEGSGIVESCGSKVETVKKGDHVLLLYIPECGHCADCKSEKSNLCSVIKATQAQG 124

Query: 123 VMPDGTSRFHNKKGESLYHFMGCSTFSEYTVVADVSVVAIDQTAPLESVCLLGCGVTTGY 182
           VMP G+SR HN + ++L+HFMGCS+FS+Y VV+D+S V I   APL+ +CLLGCGVTTG+
Sbjct: 125 VMPQGSSRLHNLENKTLWHFMGCSSFSQYAVVSDISCVKIRDDAPLDKICLLGCGVTTGF 184

Query: 183 GAAVKTANVQKGDTVAVFGCGTVGLSVLQGAHQRGASRIIAIDTNDQKKDFCTQFGATDF 242
           GA +    V+ GD VAVFG GTVGLSV+Q   Q    ++I +D  D K+++   FGATDF
Sbjct: 185 GAPI-AKGVKAGDRVAVFGSGTVGLSVVQSCSQLKCFQVIVVDVQDNKREWALGFGATDF 243

Query: 243 INPTKDLKENETIVAKLIEMTDG-GLDHTFDCTGNVNVMRSALEACHKGWGQSVIIGVAA 301
           INP K + +N++++  LI+ + G G D TFDCTG+ +VMR+ALE+C KGWG SVIIG+A 
Sbjct: 244 INPQK-IPKNKSLLQTLIDKSGGDGFDFTFDCTGSTSVMRTALESCRKGWGTSVIIGLAG 302

Query: 302 AGQEISTRPFQLVTGRVWKGSAFGGVKGRSEMAGLIEQYKKGELKVDEFITHRRSFNEIN 361
           AG+EIST P+ L+ GR W+G AFGGVKGRSE+  L+E+Y   E+K+DE+IT++R   EIN
Sbjct: 303 AGEEISTLPYNLIVGRSWEGCAFGGVKGRSELPTLVERYMNNEIKLDEYITNKRPLKEIN 362

Query: 362 EAFDDLHNGLCLRTVL 377
           EA  +L +GL L+TVL
Sbjct: 363 EALKELEDGLVLKTVL 378

>KLLA0B00451g Chr2 complement(31822..32982) [1161 bp, 386 aa] {ON}
           weakly similar to uniprot|P35497 Saccharomyces
           cerevisiae YJR159W SOR1 Sorbitol dehydrogenase
          Length = 386

 Score =  113 bits (283), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 101/377 (26%), Positives = 164/377 (43%), Gaps = 57/377 (15%)

Query: 20  PQVVEQIVVDPPKAHEVRIKIVNTAVCHTDAYTLSGADPE---------GLFPC-VLGHE 69
           P++++Q         +  IK+ NT++C TD     G  PE         G F   VLGHE
Sbjct: 50  PKIIDQ--------RDAIIKMTNTSICGTDVGIWKGKSPEIEEIAVKNEGSFNGRVLGHE 101

Query: 70  GAGIVESVGDGVTNVKPGDHVIALYTAECQKCKFCLSGKTNLCGAVRATQGKGVMPDGTS 129
           G GIV  VGD V N+K GD VI      C  C+ C  G    C           M DG  
Sbjct: 102 GTGIVTEVGDAVRNIKKGDKVIISCITRCGTCENCARGMYAHC-----------MNDG-- 148

Query: 130 RFHNKKGESL-YHFMGCSTFSEYTVVADVSVVAIDQTAPLESVCLLGCGVTTGYGAAVKT 188
                 G +L Y   G       T  AD S+ A+ +    E+  LL   + T +   V+ 
Sbjct: 149 ------GWALGYSIDGTQAEYVRTPFADTSLYALPEGLSDENAVLLSDALPTAHEIGVQM 202

Query: 189 ANVQKGDTVAVFGCGTVGLSVLQGAHQRGASRIIAIDTNDQKKDFCTQFGATDFINPTKD 248
            NV+ GD+VA+ G G VG+  +  +     S +I +D +D + +   + GAT  IN  K 
Sbjct: 203 GNVKPGDSVAILGAGPVGMGCVLTSQLYSPSLLIVVDMDDNRLEMAKEMGATHTINSGK- 261

Query: 249 LKENETIVAKLIEMTDG-GLDHTFDCTGNVNVMRSALEACHKGWGQSVIIGVAAAGQEIS 307
               E  VAK++E+T+G G+D   +  G     +   + C     Q +  G   A   + 
Sbjct: 262 ----EDAVAKILEITNGRGVDCAMEAVG----AQPTWDICQ----QIIKEGGHLANVGVH 309

Query: 308 TRPFQLVTGRVW--KGSAFGGVKGRSEMAGLIEQYKKGELKVDEFITHRRSFNEINEAFD 365
            +P      ++W    +   G+   +  + L++    G+L+ D+ ++H  +F ++   ++
Sbjct: 310 GKPVDFAIDKLWIKNLTITSGLVNTNTTSMLMKNCCSGKLQSDKLVSHHCNFKDMANNYN 369

Query: 366 DLHNGL---CLRTVLSF 379
              +      L+ ++SF
Sbjct: 370 IFKHAAKEKALKLLISF 386

>KNAG0K02000 Chr11 (410263..411315) [1053 bp, 350 aa] {ON} Anc_3.118
           YBR145W
          Length = 350

 Score =  109 bits (273), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 108/388 (27%), Positives = 170/388 (43%), Gaps = 45/388 (11%)

Query: 1   MTEGKPIECLAAVAYEAGKPQVVEQIVVDPPKAHEVRIKIVNTAVCHTDAYTLSGADPEG 60
           M+   P   +  +    G P   ++I V  PKA+E+ I +  + VCHTD +   G  P  
Sbjct: 1   MSSSIPETQMGVIFESNGGPLEYKEIPVPKPKANELLINVKYSGVCHTDLHAWHGDWPLP 60

Query: 61  L-FPCVLGHEGAGIVESVGDGVTNVKPGDHV-IALYTAECQKCKFCLSGKTNLCGAVRAT 118
           +  P V GHEGAGIV ++GD V N   GD+  I      C  C+ C     + C     +
Sbjct: 61  VKLPLVGGHEGAGIVVAMGDSVKNWNIGDYAGIKWLNGSCMNCESCELANESNCPQADLS 120

Query: 119 QGKGVMPDGTSRFHNKKGESLYHFMGCSTFSEYTVVADVSVVAIDQTAPLESVCLLGCGV 178
              G   DG                   +F +Y     V    I     L  V  + C  
Sbjct: 121 ---GYTHDG-------------------SFQQYATADAVQAAKIPHGTDLAEVAPILCAG 158

Query: 179 TTGYGAAVKTANVQKGDTVAVFG-CGTVGLSVLQGAHQRGASRIIAIDTNDQKKDFCTQF 237
            T Y  A+K+AN++ GD VA+ G CG +G   +Q A   G  R++ ID  ++K +   + 
Sbjct: 159 VTVY-KALKSANLKAGDWVAISGACGGLGSLAIQYATAMG-YRVLGIDGGEEKAELFKKL 216

Query: 238 GATDFINPTKDLKENETIVAKLIEMTDGGLDHTFDCTGNVNVMRSALEACH---KGWGQS 294
           G   FI    D  + + ++A+++E+TDGG         NV+V  +A+EA     +  G  
Sbjct: 217 GGEYFI----DFTKCKDVIAEILEVTDGGAHGVI----NVSVSEAAIEASTRYCRANGTV 268

Query: 295 VIIGVAAAGQEISTRPFQLVTGRVWKGSAFGGVKGRSEMAGLIEQYKKGELKVDEFITHR 354
           V++G+ A     S    Q+V      GS  G    R++    ++ + +G +K      H 
Sbjct: 269 VLVGLPANAYCKSEVFSQVVKSISIVGSYVG---NRADTRQALDFFARGLVKSP---IHI 322

Query: 355 RSFNEINEAFDDLHNGLCL-RTVLSFSK 381
              +++ E FD +  G  + R V+  SK
Sbjct: 323 APLSDLPEIFDKMAKGQIVGRYVVDTSK 350

>YBR145W Chr2 (533762..534817) [1056 bp, 351 aa] {ON}  ADH5Alcohol
           dehydrogenase isoenzyme V; involved in ethanol
           production
          Length = 351

 Score =  103 bits (258), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 109/379 (28%), Positives = 158/379 (41%), Gaps = 47/379 (12%)

Query: 11  AAVAYEAGKPQVVEQIVVDPPKAHEVRIKIVNTAVCHTDAYTLSGADPEGL-FPCVLGHE 69
           A V YE       + + V  PK +E+ + +  + VCH+D +   G  P  L FP + GHE
Sbjct: 12  AIVFYETDGKLEYKDVTVPEPKPNEILVHVKYSGVCHSDLHAWHGDWPFQLKFPLIGGHE 71

Query: 70  GAGIVESVGDGVTNVKPGDHV-IALYTAECQKCKFCLSGKTNLCGAVRATQGKGVMPDGT 128
           GAG+V  +G  V   K GD   I      C  C++C  G  + C  +          DGT
Sbjct: 72  GAGVVVKLGSNVKGWKVGDFAGIKWLNGTCMSCEYCEVGNESQCPYL----------DGT 121

Query: 129 SRFHNKKGESLYHFMGCSTFSEYTVVADVSVVAIDQTAPLESVCLLGCGVTTGYGAAVKT 188
              H+             TF EY     V    I     L  V  + C   T Y  A+K 
Sbjct: 122 GFTHD------------GTFQEYATADAVQAAHIPPNVNLAEVAPILCAGITVY-KALKR 168

Query: 189 ANVQKGDTVAVFG-CGTVGLSVLQGAHQRGASRIIAIDTNDQKKDFCTQFGATDFINPTK 247
           ANV  G  V + G CG +G   +Q A   G  R+I ID  + K+    Q G   FI    
Sbjct: 169 ANVIPGQWVTISGACGGLGSLAIQYALAMG-YRVIGIDGGNAKRKLFEQLGGEIFI---- 223

Query: 248 DLKENETIVAKLIEMTDGGLDHTFDCTGNVNVMRSALEA----CHKGWGQSVIIGVAAAG 303
           D  E + IV  +I+ T+GG         NV+V  +A+EA    C    G  V++G+ A  
Sbjct: 224 DFTEEKDIVGAIIKATNGGSHGVI----NVSVSEAAIEASTRYCRPN-GTVVLVGMPAHA 278

Query: 304 QEISTRPFQLVTGRVWKGSAFGGVKGRSEMAGLIEQYKKGELKVDEFITHRRSFNEINEA 363
              S    Q+V      GS  G    R++    ++ + +G +K      H    +++ E 
Sbjct: 279 YCNSDVFNQVVKSISIVGSCVG---NRADTREALDFFARGLIKSP---IHLAGLSDVPEI 332

Query: 364 FDDLHNG-LCLRTVLSFSK 381
           F  +  G +  R V+  SK
Sbjct: 333 FAKMEKGEIVGRYVVETSK 351

>KLLA0D19929g Chr4 (1694826..1695986) [1161 bp, 386 aa] {ON} weakly
           similar to uniprot|P35497 Saccharomyces cerevisiae
           YJR159W SOR1 Sorbitol dehydrogenase
          Length = 386

 Score =  103 bits (258), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 93/344 (27%), Positives = 153/344 (44%), Gaps = 50/344 (14%)

Query: 38  IKIVNTAVCHTDAYTLSGADPE---------GLFPC-VLGHEGAGIVESVGDGVTNVKPG 87
           IK+ +T++C TD     G +PE         G F   +LGHEG GI++ VGD V N K G
Sbjct: 60  IKMTHTSICGTDLGIWKGKNPEIEQTAQTKEGSFNGRILGHEGIGIIDEVGDAVHNFKKG 119

Query: 88  DHVIALYTAECQKCKFCLSGKTNLCGAVRATQGKGVMPDGTSRFHNKKGESLYHFMGCST 147
           D VI    + C  C+ C     + C     T G G                +  +M   T
Sbjct: 120 DRVIVSCISRCGTCENCAKSLYSHC-----TNGGGW---------------ILGYMIDGT 159

Query: 148 FSEY--TVVADVSVVAIDQTAPLESVCLLGCGVTTGYGAAVKTANVQKGDTVAVFGCGTV 205
            +EY  T  AD S+ ++ +    E+  +L   + T +   V+  NV+ GDTVA+ G G V
Sbjct: 160 QAEYVRTPFADTSLYSVPENLSDEAAVMLSDALPTAHEIGVQMGNVKPGDTVAIVGAGPV 219

Query: 206 GLSVLQGAHQRGASRIIAIDTNDQKKDFCTQFGATDFINPTKDLKENETIVAKLIEMTDG 265
           G+  +  +     S +I +D +D +     + G+T  IN  K     E  V+K++E T+G
Sbjct: 220 GMGCVLTSQLYSPSLLIVVDIDDNRLAMAKEMGSTHTINSAK-----EDAVSKILEYTNG 274

Query: 266 -GLDHTFDCTGNVNVMRSALEACHKGWGQSVII-GVAAAGQEISTRPFQLVTGRVW--KG 321
            G+D   +  G     ++  + C     Q VI  G   A   +  +P      ++W    
Sbjct: 275 RGVDCVMEAVG----AQATWDIC-----QRVIKEGGHLANVGVHGKPVNFEIDKLWIKNL 325

Query: 322 SAFGGVKGRSEMAGLIEQYKKGELKVDEFITHRRSFNEINEAFD 365
           +   G+   +    L++    G+LK +  +TH  +F E++  ++
Sbjct: 326 TITSGLVNTNTTGMLMKSCCSGKLKSERLVTHHCNFGEMSGNYN 369

>NCAS0I02350 Chr9 (444097..445152) [1056 bp, 351 aa] {ON} Anc_3.118
          Length = 351

 Score =  103 bits (256), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 98/362 (27%), Positives = 160/362 (44%), Gaps = 39/362 (10%)

Query: 24  EQIVVDPPKAHEVRIKIVNTAVCHTDAYTLSGADP-EGLFPCVLGHEGAGIVESVGDGVT 82
           + I V  PK++E+ I +  + VCHTD +   G  P     P V GHEGAG+V ++GD V 
Sbjct: 25  KDIPVPTPKSNEILINVKYSGVCHTDLHAWKGDWPLPTKLPLVGGHEGAGVVVAMGDAVK 84

Query: 83  NVKPGDHV-IALYTAECQKCKFCLSGKTNLCGAVRATQGKGVMPDGTSRFHNKKGESLYH 141
             K GD+  I      C  C++C  G  + C     +   G   DG              
Sbjct: 85  GWKIGDYAGIKWLNGSCMSCEYCELGNESNCPHADLS---GYTHDG-------------- 127

Query: 142 FMGCSTFSEYTVVADVSVVAIDQTAPLESVCLLGCGVTTGYGAAVKTANVQKGDTVAVFG 201
                +F +Y     V    I   + L  V  + C   T Y  A+K+AN++ G+ VA+ G
Sbjct: 128 -----SFQQYATADAVQAARIAPGSDLAEVAPVLCAGITVY-KALKSANLRAGEWVAISG 181

Query: 202 -CGTVGLSVLQGAHQRGASRIIAIDTNDQKKDFCTQFGATDFINPTKDLKENETIVAKLI 260
            CG +G   +Q A   G  R++ ID  D+K       G   FI+ TK     + IV  +I
Sbjct: 182 ACGGLGSLAIQFAKAMG-YRVVGIDGGDEKAKMFKDLGGEVFIDFTK----TKDIVGDII 236

Query: 261 EMTDGGLDHTFDCTGNVNVMRSALEACHKGWGQSVIIGVAAAGQEISTRPFQLVTGRVWK 320
           + T+GG     + + +   + ++++ C    G +V++G+    Q  S    Q+V      
Sbjct: 237 KATNGGAHGVINVSVSEQAIDASVKYCRAN-GTAVLVGMPGGAQVKSDVFNQVVKSISIV 295

Query: 321 GSAFGGVKGRSEMAGLIEQYKKGELKVDEFITHRRSFNEINEAFDDLHNGLCL-RTVLSF 379
           GS  G    R++    ++ + +G +K      H    +++ E F+ +  G  + R V+  
Sbjct: 296 GSYVG---NRADTREALDFFSRGLVKSP---IHIAKLSDVPEIFEKMEKGQIVGRYVVDC 349

Query: 380 SK 381
           SK
Sbjct: 350 SK 351

>AER032W Chr5 (696807..697862) [1056 bp, 351 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOL086C (ADH1) and
           YBR145W (ADH5)
          Length = 351

 Score =  102 bits (253), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 84/279 (30%), Positives = 125/279 (44%), Gaps = 35/279 (12%)

Query: 11  AAVAYEAGKPQVVEQIVVDPPKAHEVRIKIVNTAVCHTDAYTLSGADP-EGLFPCVLGHE 69
           A + YE G P     I V  PKA E+ I +  + VCHTD +   G  P     P V GHE
Sbjct: 12  AVIFYENGGPLQYTDIEVPKPKATELLINVKYSGVCHTDLHAWKGDWPLPTKLPLVGGHE 71

Query: 70  GAGIVESVGDGVTNVKPGDHV-IALYTAECQKCKFCLSGKTNLCGAVRATQGKGVMPDGT 128
           GAG+V ++G+ V   K GD   I      C  C++C     + C            P+  
Sbjct: 72  GAGVVVAMGENVRGWKIGDLAGIKWLNGSCMACEYCEKSNESNC------------PEAD 119

Query: 129 SRFHNKKGESLYHFMGCSTFSEYTVVADVSVVAIDQTAPLESVCLLGCGVTTGYGAAVKT 188
              +   G          +F +Y     V    I     L  V  + C   T Y  A+K+
Sbjct: 120 LSGYTHDG----------SFQQYATADAVQAAHIPAGTDLAQVAPILCAGITVY-KALKS 168

Query: 189 ANVQKGDTVAVFG-CGTVGLSVLQGAHQRGASRIIAIDTNDQKKDFCTQFGATDFINPTK 247
           AN++ GD VA+ G CG +G   +Q A   G  R++ ID  ++K+    Q G   FI    
Sbjct: 169 ANLRAGDWVAISGACGGLGSLAIQYATAMG-YRVLGIDGGEEKEQLFRQLGGEVFI---- 223

Query: 248 DLKENETIVAKLIEMTDGGLDHTFDCTGNVNVMRSALEA 286
           D ++++ IVA +++ T+GG         NV+V  +A+E+
Sbjct: 224 DFRKSKDIVADVVKATNGGAHGVI----NVSVSEAAIES 258

>Suva_4.394 Chr4 (702935..703990) [1056 bp, 351 aa] {ON} YBR145W
           (REAL)
          Length = 351

 Score =  102 bits (253), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 109/379 (28%), Positives = 161/379 (42%), Gaps = 47/379 (12%)

Query: 11  AAVAYEAGKPQVVEQIVVDPPKAHEVRIKIVNTAVCHTDAYTLSGADPEGL-FPCVLGHE 69
           A V YE       + I V  PKA+E+ + +  + VCH+D +   G  P  L FP + GHE
Sbjct: 12  AIVFYETNGKLEYKDIAVPEPKANEILVHVKYSGVCHSDLHAWRGDWPFQLKFPLIGGHE 71

Query: 70  GAGIVESVGDGVTNVKPGDHV-IALYTAECQKCKFCLSGKTNLCGAVRATQGKGVMPDGT 128
           GAG+V  +G  V   K GD   I      C  C++C  G  + C  +          DGT
Sbjct: 72  GAGVVVKLGSNVKGWKVGDLAGIKWLNGTCMSCEYCEVGNESQCPHL----------DGT 121

Query: 129 SRFHNKKGESLYHFMGCSTFSEYTVVADVSVVAIDQTAPLESVCLLGCGVTTGYGAAVKT 188
              H+             TF EY     V    + +   L  V  + C   T Y  A+K 
Sbjct: 122 GFTHD------------GTFQEYATADAVQAAHLPENVDLAEVAPILCAGVTVY-KALKR 168

Query: 189 ANVQKGDTVAVFG-CGTVGLSVLQGAHQRGASRIIAIDTNDQKKDFCTQFGATDFINPTK 247
           AN+  G  V + G CG +G   +Q A   G  R+I ID  + KK      G   FI+ TK
Sbjct: 169 ANLIPGQWVTISGACGGLGSLAIQYATAMG-YRVIGIDEGETKKQLFEGLGGEVFIDFTK 227

Query: 248 DLKENETIVAKLIEMTDGGLDHTFDCTGNVNVMRSALEA----CHKGWGQSVIIGVAAAG 303
           +    + IV  +I+ TDGG         NV+V  +A+EA    C    G  V++G+ A  
Sbjct: 228 E----KDIVGAVIKATDGGSHGVI----NVSVSEAAIEASTRYCRPN-GTVVLVGMPAHA 278

Query: 304 QEISTRPFQLVTGRVWKGSAFGGVKGRSEMAGLIEQYKKGELKVDEFITHRRSFNEINEA 363
              S    Q+V      GS  G    R++    ++ + +  +K           +++ E 
Sbjct: 279 YCKSDVFNQVVKSISIVGSCVG---NRADTREALDFFARHLVKSP---IRLAGLSDVPEI 332

Query: 364 FDDLHNGLCL-RTVLSFSK 381
           F+ + NG  + R V+  SK
Sbjct: 333 FEKMENGSIVGRYVVDTSK 351

>KAFR0G01420 Chr7 complement(314119..315174) [1056 bp, 351 aa] {ON}
           Anc_3.118 YBR145W
          Length = 351

 Score =  102 bits (253), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 102/365 (27%), Positives = 160/365 (43%), Gaps = 46/365 (12%)

Query: 13  VAYEAGKPQVVEQIVVDPPKAHEVRIKIVNTAVCHTDAYTLSGADPEGL-FPCVLGHEGA 71
           + YE G     + I V  PKA+E+ I +  + VCHTD +   G  P  +  P V GHEGA
Sbjct: 14  IFYENGGKLEYKDIPVPTPKANELLINVKYSGVCHTDLHAWKGDWPLDVKLPLVGGHEGA 73

Query: 72  GIVESVGDGVTNVKPGDHV-IALYTAECQKCKFC-LSGKTNLCGAVRATQGKGVMPDGTS 129
           G+V ++G+ V   K GD+  I      C  C++C LS ++N              P+   
Sbjct: 74  GVVVAMGENVRGWKIGDYAGIKWLNGSCMSCEYCELSNESNC-------------PEADL 120

Query: 130 RFHNKKGESLYHFMGCSTFSEYTVVADVSVVAIDQTAPLESVCLLGCGVTTGYGAAVKTA 189
             +   G          +F +Y     V    I Q   L  V  + C   T Y  A+K+A
Sbjct: 121 SGYTHDG----------SFQQYATADAVQAAKIPQGTDLAQVAPILCAGITVY-KALKSA 169

Query: 190 NVQKGDTVAVFG-CGTVGLSVLQGAHQRGASRIIAIDTNDQKKDFCTQFGATDFINPTKD 248
           N+  G+ VA+ G CG +G   +Q A   G  RI+ ID  D+K     + G   FI+ TK 
Sbjct: 170 NLSAGEWVAISGACGGLGSLAIQYAKAMG-YRILGIDGGDEKAALFKELGGEVFIDFTK- 227

Query: 249 LKENETIVAKLIEMTDGGLDHTFDCTGNVNVMRSALEACH---KGWGQSVIIGVAAAGQE 305
               + I A +IE T+GG         NV+V  +A+E+     +  G  V++G+   G  
Sbjct: 228 ---TKDIEAAVIEATNGGAHGVI----NVSVSEAAIESSTRYVRSNGTCVLVGL-PGGAY 279

Query: 306 ISTRPFQLVTGRVWKGSAFGGVKGRSEMAGLIEQYKKGELKVDEFITHRRSFNEINEAFD 365
             +  F  V   +    ++  V  R++    I+ + +G +K      H    + + E F+
Sbjct: 280 CKSEVFSHVVKSISIVGSY--VGNRADTREAIDFFTRGLVKAP---IHIAPLSAVPEIFE 334

Query: 366 DLHNG 370
            +  G
Sbjct: 335 KMEKG 339

>KAFR0A00790 Chr1 complement(140666..141799) [1134 bp, 377 aa] {ON}
           Anc_2.480 YMR083W
          Length = 377

 Score =  101 bits (251), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 106/375 (28%), Positives = 156/375 (41%), Gaps = 40/375 (10%)

Query: 13  VAYEAGKPQVVEQIVVDPPKAHEVRIKIVNTAVCHTDAYTLSGADPEGL-FPCVLGHEGA 71
           + YE G P   + + V  PK +E+ I +  + VCHTD +   G  P  +  P V GHEGA
Sbjct: 37  IFYENGGPLTYKDMPVPVPKPNEILINVKYSGVCHTDLHAWKGDWPLPVKLPLVGGHEGA 96

Query: 72  GIVESVGDGVTNVKPGDHV-IALYTAECQKCKFCLSGKTNLCGAVRATQGKGVMPDGTSR 130
           GIV + G  V N + GD   I      C  C+ C  G  + C     +   G   DG   
Sbjct: 97  GIVVAKGSNVKNFEIGDLAGIKWLNGSCMACELCEKGYESNCEHADLS---GYTHDG--- 150

Query: 131 FHNKKGESLYHFMGCSTFSEYTVVADVSVVAIDQTAPLESVCLLGCGVTTGYGAAVKTAN 190
                           +F +Y          I +   L  V  + C   T Y  A+KTA 
Sbjct: 151 ----------------SFQQYATADATQAAQIPRGTDLAEVAPILCAGVTVY-KALKTAA 193

Query: 191 VQKGDTVAVFG-CGTVGLSVLQGAHQRGASRIIAIDTNDQKKDFCTQFGATDFINPTKDL 249
           +Q G+ VA+ G CG +G   +Q A   G  R++ ID  + K     + G   FI+ TK  
Sbjct: 194 LQPGEWVAISGACGGLGSLAIQYAKAMGL-RVLGIDGGEAKAKMFKELGGETFIDFTK-Y 251

Query: 250 KENETIVAKLIEMTDGGLDHTFDCTGNVNVMRSALEACH---KGWGQSVIIGVAAAGQEI 306
           K NE ++  + E T GG         NV+V  +A+ A     +  G  VI+G+ A     
Sbjct: 252 KNNEAMIKDIQEATKGGPQGVI----NVSVSEAAISASTQYVRPTGTVVIVGMPAGAYVK 307

Query: 307 STRPFQLVTGRVWKGSAFGGVKGRSEMAGLIEQYKKGELKVDEFITHRRSFNEINEAFDD 366
           S     +V     KGS  G    R++    I+ + +G +K    +       +I E  + 
Sbjct: 308 SDVFSHVVKSISIKGSYVG---NRADTREAIDFFSRGLVKSPITVVGLSELPKIYELMEK 364

Query: 367 LHNGLCLRTVLSFSK 381
             N +  R V+  SK
Sbjct: 365 --NKILGRYVVDTSK 377

>Skud_2.272 Chr2 (501260..502315) [1056 bp, 351 aa] {ON} YBR145W
           (REAL)
          Length = 351

 Score =  100 bits (249), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 107/379 (28%), Positives = 160/379 (42%), Gaps = 47/379 (12%)

Query: 11  AAVAYEAGKPQVVEQIVVDPPKAHEVRIKIVNTAVCHTDAYTLSGADPEGL-FPCVLGHE 69
           A V YE       + + V  PK +E+ + +  + VCH+D +   G  P  L FP + GHE
Sbjct: 12  AIVFYETDGKLEYKDVAVPEPKPNEILVHVKYSGVCHSDLHAWHGDWPFQLKFPLIGGHE 71

Query: 70  GAGIVESVGDGVTNVKPGDHV-IALYTAECQKCKFCLSGKTNLCGAVRATQGKGVMPDGT 128
           GAG+V  +G  V   K GD   I      C  C++C  G  + C  +          DGT
Sbjct: 72  GAGVVVKLGSNVKGWKVGDIAGIKWLNGTCMSCEYCEVGNESQCPHL----------DGT 121

Query: 129 SRFHNKKGESLYHFMGCSTFSEYTVVADVSVVAIDQTAPLESVCLLGCGVTTGYGAAVKT 188
              H+             TF EY     V    I Q   L  V  + C   T Y  A+K 
Sbjct: 122 GFTHD------------GTFQEYATADAVQAAHIPQNVDLAEVAPILCAGITVY-KALKR 168

Query: 189 ANVQKGDTVAVFG-CGTVGLSVLQGAHQRGASRIIAIDTNDQKKDFCTQFGATDFINPTK 247
           AN+  G  V + G CG +G   +Q A   G  R+I ID  + K+    +     FI+ TK
Sbjct: 169 ANLMPGQWVTISGACGGLGSLAVQYALAMG-YRVIGIDGGEAKQKLFEELHGEIFIDFTK 227

Query: 248 DLKENETIVAKLIEMTDGGLDHTFDCTGNVNVMRSALEA----CHKGWGQSVIIGVAAAG 303
           +    + +V  +I+ TDGG         NV+V  +A+EA    C    G  V++G+ A  
Sbjct: 228 E----KDVVGAVIKATDGGSHGVI----NVSVSEAAIEASTRYCRPN-GTVVLVGMPAHA 278

Query: 304 QEISTRPFQLVTGRVWKGSAFGGVKGRSEMAGLIEQYKKGELKVDEFITHRRSFNEINEA 363
              S    Q+V      GS  G    R++    ++ + +G +K      H    +++ E 
Sbjct: 279 YCKSDVFNQVVKSISIVGSCVG---NRADTREALDFFARGLIKSP---IHLAGLSDVPEI 332

Query: 364 FDDLHNGLCL-RTVLSFSK 381
           F  +  G  + R V+  SK
Sbjct: 333 FGKMERGQIVGRYVVDTSK 351

>NCAS0I01720 Chr9 (318144..319199) [1056 bp, 351 aa] {ON} 
          Length = 351

 Score =  100 bits (248), Expect = 7e-23,   Method: Compositional matrix adjust.
 Identities = 100/378 (26%), Positives = 166/378 (43%), Gaps = 46/378 (12%)

Query: 12  AVAYEA-GKPQVVEQIVVDPPKAHEVRIKIVNTAVCHTDAYTLSGADP-EGLFPCVLGHE 69
           A+ +E+ G P   + I V  PK++E+ + I  + VCHTD +   G  P +   P V GHE
Sbjct: 12  AIIFESNGGPLEYKDIPVPTPKSNEILVNIKYSGVCHTDLHAWKGDWPLDTKLPLVGGHE 71

Query: 70  GAGIVESVGDGVTNVKPGDHV-IALYTAECQKCKFCLSGKTNLCGAVRATQGKGVMPDGT 128
           GAGIV ++GD V   K GD+  +      C  C++C  G  + C            P+  
Sbjct: 72  GAGIVVAIGDNVKGWKIGDYAGVKWLNGSCMACEYCELGNESNC------------PNAD 119

Query: 129 SRFHNKKGESLYHFMGCSTFSEYTVVADVSVVAIDQTAPLESVCLLGCGVTTGYGAAVKT 188
              +   G          +F +Y     V    I     L  V  + C   T Y  A+K+
Sbjct: 120 LSGYTHDG----------SFQQYATADAVQAARIPAGTNLSEVAPILCAGMTVY-KALKS 168

Query: 189 ANVQKGDTVAVFG-CGTVGLSVLQGAHQRGASRIIAIDTNDQKKDFCTQFGATDFINPTK 247
           AN++ G+ VA+ G CG +G   +Q A+  G  R++ ID  D K     Q     FI    
Sbjct: 169 ANLRAGEWVAISGACGGLGSLCIQYANAMG-YRVLGIDGGDDKAKLFKQLHGEVFI---- 223

Query: 248 DLKENETIVAKLIEMTDGGLDHTFDCTGNVNVMRSALEACHK---GWGQSVIIGVAAAGQ 304
           D  + + +++++ ++T+GG         NV+V  +A+EA  K     G  V++G+    +
Sbjct: 224 DFTKTKDVISEVNKVTNGGAHGVI----NVSVSEAAIEASTKYCRANGTVVLVGLPGGAK 279

Query: 305 EISTRPFQLVTGRVWKGSAFGGVKGRSEMAGLIEQYKKGELKVDEFITHRRSFNEINEAF 364
             S    Q+V      GS  G    R++    ++ + +G +K      H    + +   F
Sbjct: 280 CKSDVFNQVVKSMTIVGSYVG---NRADTREALDFFTRGLVKAP---IHVAPLSTLPTIF 333

Query: 365 DDLHNGLCL-RTVLSFSK 381
           + +  G  + R V+  S+
Sbjct: 334 EKMEKGQIVGRYVVDTSR 351

>SAKL0C10164g Chr3 complement(914732..915787) [1056 bp, 351 aa] {ON}
           uniprot|Q6XQ74 Saccharomyces kluyveri ADH1 Alcohol
           dehydrogenase 1
          Length = 351

 Score =  100 bits (248), Expect = 7e-23,   Method: Compositional matrix adjust.
 Identities = 104/379 (27%), Positives = 165/379 (43%), Gaps = 47/379 (12%)

Query: 11  AAVAYEAGKPQVVEQIVVDPPKAHEVRIKIVNTAVCHTDAYTLSGADP-EGLFPCVLGHE 69
           A + YE G     + I V  PK++E+ I I  + VCHTD +   G  P     P V GHE
Sbjct: 12  AVIFYENGGELQYKDIPVPKPKSNEILINIKYSGVCHTDLHAWKGDWPLPTKLPLVGGHE 71

Query: 70  GAGIVESVGDGVTNVKPGDHV-IALYTAECQKCKFC-LSGKTNLCGAVRATQGKGVMPDG 127
           GAGIV  +G+ V   K GD+  I      C  C++C LS ++N              PD 
Sbjct: 72  GAGIVVGMGENVKGWKIGDYAGIKWLNGSCMSCEYCELSNESNC-------------PDA 118

Query: 128 TSRFHNKKGESLYHFMGCSTFSEYTVVADVSVVAIDQTAPLESVCLLGCGVTTGYGAAVK 187
               +   G          +F +Y     V    I     L  V  + C   T Y  A+K
Sbjct: 119 DLSGYTHDG----------SFQQYATADAVQAARIAPGTDLAEVAPVLCAGITVY-KALK 167

Query: 188 TANVQKGDTVAVFG-CGTVGLSVLQGAHQRGASRIIAIDTNDQKKDFCTQFGATDFINPT 246
           +AN++ G+ VA+ G CG +G   +Q A   G  R++ ID  D+K     + G   FI+ T
Sbjct: 168 SANLRAGEWVAISGACGGLGSLAIQYAKAMG-YRVLGIDGGDEKAALFKELGGEVFIDFT 226

Query: 247 KDLKENETIVAKLIEMTDGGLDHTFDCTGNVNVMRSALEACH---KGWGQSVIIGVAAAG 303
           K     + +V  +++ T+GG         NV+V  +A+EA     +  G  V++G+    
Sbjct: 227 K----TKDVVKAVVDATNGGAHGVI----NVSVSEAAIEASTVYCRANGTVVLVGLPGGA 278

Query: 304 QEISTRPFQLVTGRVWKGSAFGGVKGRSEMAGLIEQYKKGELKVDEFITHRRSFNEINEA 363
           +  S    Q+V      GS  G    R++    ++ + +G +K    +      +E+   
Sbjct: 279 KCKSDVFNQVVKSISIVGSYVG---NRADTREALDFFSRGLVKSPIMVV---GLSELPSI 332

Query: 364 FDDLHNGLCL-RTVLSFSK 381
           ++ +  G  + R V+  SK
Sbjct: 333 YEKMEKGAIVGRYVVDTSK 351

>Ecym_5331 Chr5 (676233..677279) [1047 bp, 348 aa] {ON} similar to
           Ashbya gossypii AER032W
          Length = 348

 Score = 99.8 bits (247), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 99/375 (26%), Positives = 164/375 (43%), Gaps = 39/375 (10%)

Query: 11  AAVAYEAGKPQVVEQIVVDPPKAHEVRIKIVNTAVCHTDAYTLSGADP-EGLFPCVLGHE 69
           A + YE G       I V  PK  E+ I +  + VCHTD +   G  P     P V GHE
Sbjct: 9   AVIFYENGGELKYTDIPVPKPKPSELLINVKYSGVCHTDLHAWKGDWPLPTKLPLVGGHE 68

Query: 70  GAGIVESVGDGVTNVKPGDHV-IALYTAECQKCKFCLSGKTNLCGAVRATQGKGVMPDGT 128
           GAG+V ++G+ V   K GD   I      C  C++C     + C            PD  
Sbjct: 69  GAGVVVAMGENVRGWKIGDFAGIKWLNGSCMTCEYCEKSNESNC------------PDAD 116

Query: 129 SRFHNKKGESLYHFMGCSTFSEYTVVADVSVVAIDQTAPLESVCLLGCGVTTGYGAAVKT 188
              +   G          +F +Y     V    I Q   L  V  + C   T Y  A+K+
Sbjct: 117 LSGYTHDG----------SFQQYATADAVHAAKIPQGTDLAQVAPVLCAGITVY-KALKS 165

Query: 189 ANVQKGDTVAVFGC-GTVGLSVLQGAHQRGASRIIAIDTNDQKKDFCTQFGATDFINPTK 247
           A +Q G+ VA+ G  G +G   +Q A   G  RI+ ID+ ++KK    + G   FI    
Sbjct: 166 ARLQAGEWVAISGASGGLGSLAVQYAKAMG-YRILGIDSGEEKKKLFKELGGEYFI---- 220

Query: 248 DLKENETIVAKLIEMTDGGLDHTFDCTGNVNVMRSALEACHKGWGQSVIIGVAAAGQEIS 307
           D  E++ +VA++I++T+GG     + + +   + ++ E C    G  V++G+  AG ++ 
Sbjct: 221 DFAESKDVVAEVIKVTNGGAHGVINVSVSEAAIAASAEYCRSN-GTVVLVGL-PAGAQMR 278

Query: 308 TRPFQLVTGRVWKGSAFGGVKGRSEMAGLIEQYKKGELKVDEFITHRRSFNEINEAFDDL 367
           +  F  V   +    ++ G +  S  A  I+ + +G +     +      +++ E ++ +
Sbjct: 279 SEVFSHVVKSISVVGSYVGNRADSREA--IDFFTRGLVSAPIKVV---GLSQLAEVYEKM 333

Query: 368 HNGLCL-RTVLSFSK 381
             G+   R V+  SK
Sbjct: 334 EKGMIAGRYVVDTSK 348

>CAGL0J01441g Chr10 complement(134383..135501) [1119 bp, 372 aa]
           {ON} highly similar to uniprot|P07246 Saccharomyces
           cerevisiae YMR083w ADH3 or uniprot|P00330 Saccharomyces
           cerevisiae YOL086c ADH1 or uniprot|P00331 Saccharomyces
           cerevisiae YMR303c ADH2
          Length = 372

 Score = 99.8 bits (247), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 91/338 (26%), Positives = 150/338 (44%), Gaps = 37/338 (10%)

Query: 13  VAYEAGKPQVVEQIVVDPPKAHEVRIKIVNTAVCHTDAYTLSGADPEGL-FPCVLGHEGA 71
           + YE G     + + V  PK +E+ I +  + VCHTD +   G  P G   P V GHEGA
Sbjct: 35  IFYEHGGKLEYKDLPVPKPKPNEILINVRYSGVCHTDLHAWHGDWPLGAKLPLVGGHEGA 94

Query: 72  GIVESVGDGVTNVKPGDHV-IALYTAECQKCKFCLSGKTNLCGAVRATQGKGVMPDGTSR 130
           G+V + G  VTN + GD+  I      C  C+FC  G  + C     +   G   DG   
Sbjct: 95  GVVVAKGSSVTNFEIGDYAGIKWLNGSCMSCEFCEQGNESNCAKADLS---GYTHDG--- 148

Query: 131 FHNKKGESLYHFMGCSTFSEYTVVADVSVVAIDQTAPLESVCLLGCGVTTGYGAAVKTAN 190
                           +F +Y     +    I +   L  V  + C   T Y  A+K ++
Sbjct: 149 ----------------SFQQYATADAIQAAQIPKGTDLAQVAPILCAGVTVY-KALKDSD 191

Query: 191 VQKGDTVAVFG-CGTVGLSVLQGAHQRGASRIIAIDTNDQKKDFCTQFGATDFINPTKDL 249
           V+ G  VA+ G  G +G   +Q A   G  R++ ID  D+K+      G   F+    D 
Sbjct: 192 VKPGQWVAISGAAGGLGSLAVQYAKAMGM-RVLGIDAGDEKRKLFESLGGNHFV----DF 246

Query: 250 KENETIVAKLIEMTDGGLDHTFDCTGNVNVMRSALEACHKGWGQSVIIGVAAAGQEISTR 309
            + + +V+++ E+T+GG     + + +   +  ++E   +  G  V++G+  AG  + + 
Sbjct: 247 TKTKDLVSEIQEITEGGPHGVINVSVSEKAIGQSVEYV-RPCGTVVLVGL-PAGATVKSD 304

Query: 310 PFQLVTGRV-WKGSAFGGVKGRSEMAGLIEQYKKGELK 346
            F  V   +  KGS  G    R++    I+ + KG++K
Sbjct: 305 VFNHVIKSINIKGSYVG---NRADTREAIDFFAKGQVK 339

>Smik_2.284 Chr2 (518341..519396) [1056 bp, 351 aa] {ON} YBR145W
           (REAL)
          Length = 351

 Score = 99.0 bits (245), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 102/367 (27%), Positives = 153/367 (41%), Gaps = 46/367 (12%)

Query: 11  AAVAYEAGKPQVVEQIVVDPPKAHEVRIKIVNTAVCHTDAYTLSGADPEGL-FPCVLGHE 69
           A V YE       + + V  PK +E+ + +  + VCH+D +   G  P  L FP + GHE
Sbjct: 12  AIVFYETDGKLEYKDVTVPEPKPNEILVHVKYSGVCHSDLHAWHGDWPFQLKFPLIGGHE 71

Query: 70  GAGIVESVGDGVTNVKPGDHV-IALYTAECQKCKFCLSGKTNLCGAVRATQGKGVMPDGT 128
           GAG+V  +G  V   K GD   I      C  C++C  G  + C  +          DGT
Sbjct: 72  GAGVVVKLGSNVKGWKVGDLAGIKWLNGTCMSCEYCEVGNESQCPHL----------DGT 121

Query: 129 SRFHNKKGESLYHFMGCSTFSEYTVVADVSVVAIDQTAPLESVCLLGCGVTTGYGAAVKT 188
              H+             TF EY     V    I Q   L  V  + C   T Y  A+K 
Sbjct: 122 GFTHD------------GTFQEYATADAVQAAHIPQNVNLAEVAPILCAGITVY-KALKR 168

Query: 189 ANVQKGDTVAVFG-CGTVGLSVLQGAHQRGASRIIAIDTNDQKKDFCTQFGATDFINPTK 247
           AN+  G  V + G CG +G   +Q A   G  R+I ID  + K+    + G   FI+ TK
Sbjct: 169 ANLMPGQWVTISGACGGLGSLAIQYALAMG-FRVIGIDGGEAKRKLFEKLGGEIFIDFTK 227

Query: 248 DLKENETIVAKLIEMTDGGLDHTFDCTGNVNVMRSALEA----CHKGWGQSVIIGVAAAG 303
           +      +   +I+ T+GG         NV+V  +A+EA    C    G  V++G+ A  
Sbjct: 228 E----RDVAGAVIKATNGGSHGII----NVSVSEAAIEASTRYCRPN-GTVVLVGMPAHA 278

Query: 304 QEISTRPFQLVTGRVWKGSAFGGVKGRSEMAGLIEQYKKGELKVDEFITHRRSFNEINEA 363
              S    Q+V      GS  G    R++    ++ + +G +   E   H    +++ E 
Sbjct: 279 HCKSDVFNQVVKSISIVGSCVG---NRADTREALDFFARGLI---ESPIHLAGLSDVPEI 332

Query: 364 FDDLHNG 370
           F  +  G
Sbjct: 333 FGKMEKG 339

>TBLA0I01140 Chr9 (233777..234910) [1134 bp, 377 aa] {ON} Anc_2.480
           YMR083W
          Length = 377

 Score = 98.2 bits (243), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 107/384 (27%), Positives = 155/384 (40%), Gaps = 47/384 (12%)

Query: 6   PIECLAAVAYEAGKPQVVEQIVVDPPKAHEVRIKIVNTAVCHTDAYTLSGADPEGL-FPC 64
           P    A V YE G P     I V  PK +E+ I +  + VCHTD +   G  P  +  P 
Sbjct: 33  PTTQKAVVFYENGGPLKYTTIPVPKPKPNEILINVKYSGVCHTDLHAWKGDWPLAVKLPL 92

Query: 65  VLGHEGAGIVESVGDGVTNVKPGDHV-IALYTAECQKCKFCLSGKTNLCGAVRATQGKGV 123
           V GHEGAG+V + G  V N + GD+  I      C  C+ C  G  + C         G 
Sbjct: 93  VGGHEGAGVVVAKGSEVKNFEIGDYAGIKWLNGSCMSCELCEKGFESNC---EQADLSGY 149

Query: 124 MPDGTSRFHNKKGESLYHFMGCSTFSEYTVVADVSVVAIDQTAPLESVCLLGCGVTTGYG 183
             DG                   +F +Y     V    I +   L  V  + C   T Y 
Sbjct: 150 THDG-------------------SFQQYATADAVQAAHIPKNVDLAEVAPILCAGVTVY- 189

Query: 184 AAVKTANVQKGDTVAVFG-CGTVGLSVLQGAHQRGASRIIAIDTNDQKKDFCTQFGATDF 242
            A+KTA+V+ G  VA+ G CG +G   +Q A   G  R++ ID  D+KK      G   F
Sbjct: 190 KALKTADVKPGQWVAISGACGGLGSLAVQYAKAMGL-RVVGIDGGDEKKKLFHSLGGDIF 248

Query: 243 INPTKDLKENETIVAKLIEMTDGGLDHTFDCTGNVNVMRSALEACH-----KGWGQSVII 297
           +    D  +  +IV  + ++T+GG        G +NV  S L         +  G  V++
Sbjct: 249 V----DFTKTHSIVKDIQDVTNGGPH------GVINVSVSELATSMSTEYVRPAGTVVLV 298

Query: 298 GVAAAGQEISTRPFQLVTGRVWKGSAFGGVKGRSEMAGLIEQYKKGELKVDEFITHRRSF 357
           G+ A     S     +V     KGS  G    R++    ++ +++G +K    I      
Sbjct: 299 GLPANSYVKSEVFSHVVKSINIKGSYVG---NRADTREALDFFQRGLVKSPIKIVGLSEL 355

Query: 358 NEINEAFDDLHNGLCLRTVLSFSK 381
             + E      N +  R VL  SK
Sbjct: 356 PMVYELM--AQNKILGRYVLDTSK 377

>Kpol_1058.11 s1058 (41165..42226) [1062 bp, 353 aa] {ON}
           (41165..42226) [1062 nt, 354 aa]
          Length = 353

 Score = 97.4 bits (241), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 103/353 (29%), Positives = 159/353 (45%), Gaps = 40/353 (11%)

Query: 34  HEVRIKIVNTAVCHTDA-YTLSGADPEGLF----PCVLGHEGAGIVESVGDGVTNVKPGD 88
           H V+++I  T +C +D  +   GA   G F    P VLGHE +GIV  VG  VT V  GD
Sbjct: 31  HFVKVQIKATGICGSDVHFCTHGAI--GSFIVKEPMVLGHESSGIVVEVGSEVTKVAVGD 88

Query: 89  HVIALYTAECQKCKFCLSGKTNLCGAVRATQGKGVMPDGTS-RFHNKKGESLYHFMGCST 147
            V        +  +  +SG  NLC  ++      V  DGT  ++     + +Y      T
Sbjct: 89  RVAIEPGYPSRYSEETVSGHYNLCPGMKFAATPPV--DGTLLKYFQVPEDFVYKLPDDVT 146

Query: 148 FSEYTVVADVSVVAIDQTAPLESVCLLGCGVTTGYGAAVKTANVQKGDTVAVFGCGTVGL 207
           F E  +V  ++V                         AVK A V+ GD V VFG G VGL
Sbjct: 147 FEEGALVEPLAVAV----------------------HAVKLAGVKFGDKVVVFGAGPVGL 184

Query: 208 SVLQGAHQRGASRIIAIDTNDQKKDFCTQFGATDFINPTKDLKENETIVAKLIEMTDGGL 267
            V       GA+ +++ID  D+K D   + G+T  IN +KD+ E    +    ++     
Sbjct: 185 LVGSVCKAFGATEVVSIDVVDKKLDKSLEMGSTIAIN-SKDMAEEALALEIQNDLNGQHP 243

Query: 268 DHTFDCTGNVNVMRSALEACHKGWGQSVIIGVAAAGQEISTRPFQLVTGRVWKGSAFGGV 327
           +   DCTG    +RS++ AC  G G  V +G+      +      ++    +KGS     
Sbjct: 244 NKVIDCTGAEPCLRSSILACKPG-GTVVQVGMGTTNASLPVSDI-VIKELTFKGS-MRYC 300

Query: 328 KGRSEMAGLIEQYKKGELKVDEFITHRRSFNEINEA--FDDLHNGLCLRTVLS 378
            G  + A  + +YKK ++K    ITHR SF++  +A  F+   +   ++TV++
Sbjct: 301 HGDYQDAIQLLKYKKVDVKA--IITHRFSFDDAIKALQFNISRDPSIVKTVIA 351

>Skud_13.477 Chr13 complement(846790..847836) [1047 bp, 348 aa] {ON}
           YMR303C (REAL)
          Length = 348

 Score = 96.7 bits (239), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 98/359 (27%), Positives = 158/359 (44%), Gaps = 41/359 (11%)

Query: 13  VAYEAGKPQVVEQIVVDPPKAHEVRIKIVNTAVCHTDAYTLSGADP-EGLFPCVLGHEGA 71
           + YE+      + I V  PK +E+ I +  + VCHTD +   G  P     P V GHEGA
Sbjct: 11  IFYESNGKLEHKNIPVPKPKPNELLINVKYSGVCHTDLHAWHGDWPLPTKLPLVGGHEGA 70

Query: 72  GIVESVGDGVTNVKPGDHV-IALYTAECQKCKFCLSGKTNLCGAVRATQGKGVMPDGTSR 130
           G+V ++GD V   K GD   +    + C  C++C  G  + C     +   G   DG   
Sbjct: 71  GVVVAIGDNVRGWKVGDLAGVKWLNSSCMACEYCELGNESNCPHADLS---GYTHDG--- 124

Query: 131 FHNKKGESLYHFMGCSTFSEYTVVADVSVVAIDQTAPLESVCLLGCGVTTGYGAAVKTAN 190
                           +F +Y     V    I +   L  V  + C   T Y  A+K+AN
Sbjct: 125 ----------------SFQQYATADAVQAARIPEGTDLAEVAPILCAGITVY-KALKSAN 167

Query: 191 VQKGDTVAVFG-CGTVGLSVLQGAHQRGASRIIAIDTNDQKKDFCTQFGATDFINPTKDL 249
           ++ G+ VA+ G  G +G   +Q A   G  R++ ID    K++  T  G   FI+ TK+ 
Sbjct: 168 LRAGNWVAISGAAGGLGSLAVQYAKAMG-YRVLGIDGGPGKQELFTSLGGEVFIDFTKE- 225

Query: 250 KENETIVAKLIEMTDGGLDHTFDCTGNVNVMRSALEACHK---GWGQSVIIGVAAAGQEI 306
              + I+  +++ TDGG         NV+V  +A+EA  K     G  V++G+  AG + 
Sbjct: 226 ---KDIIGAVVKATDGGAHGII----NVSVSEAAIEASTKYCRANGTVVLVGL-PAGAKC 277

Query: 307 STRPFQLVTGRVWKGSAFGGVKGRSEMAGLIEQYKKGELKVDEFITHRRSFNEINEAFD 365
           S+  F  V   +    ++  V  R++    ++ + +G +K    +    S  EI E  +
Sbjct: 278 SSDVFNHVVKSISIVGSY--VGNRADTREALDFFARGLVKSPIKVVGLSSLPEIYEKME 334

>TBLA0E03440 Chr5 (852767..853822) [1056 bp, 351 aa] {ON} Anc_3.118
           YBR145W
          Length = 351

 Score = 95.9 bits (237), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 99/362 (27%), Positives = 156/362 (43%), Gaps = 43/362 (11%)

Query: 11  AAVAYEAGKPQVVEQIVVDPPKAHEVRIKIVNTAVCHTDAYTLSGADP-EGLFPCVLGHE 69
           A + Y+ G P   + + V  PK +E+ I I  + VCHTD +   G  P +   P + GHE
Sbjct: 12  AVIFYKNGGPLEYKDVPVPTPKPNEILINIKYSGVCHTDLHAWKGDWPLDTKLPLIGGHE 71

Query: 70  GAGIVESVGDGVTNVKPGDHV-IALYTAECQKCKFC-LSGKTNLCGAVRATQGKGVMPDG 127
           GAG+V  +G  V   K GD+  +      C  C+ C LS ++N   A           D 
Sbjct: 72  GAGVVVGMGSNVKGWKIGDYAGVKWLNGSCMSCEECELSNESNCPEA-----------DL 120

Query: 128 TSRFHNKKGESLYHFMGCSTFSEYTVVADVSVVAIDQTAPLESVCLLGCGVTTGYGAAVK 187
           +   H+             +F EY     V    I Q   L  V  L C   T Y  A+K
Sbjct: 121 SGYTHD------------GSFQEYCTADAVQAARIPQGTDLAQVAPLLCAGVTVY-KALK 167

Query: 188 TANVQKGDTVAVFG-CGTVGLSVLQGAHQRGASRIIAIDTNDQKKDFCTQFGATDFINPT 246
           +A++  G  VA+ G CG +G   +Q A   G  R++ ID  ++KK    + G   F+   
Sbjct: 168 SADLAAGQWVAISGACGGLGSLAIQFAKAMGL-RVLGIDGGEEKKKMFHELGGEVFL--- 223

Query: 247 KDLKENETIVAKLIEMTDGGLDHTFDCTGNVNVMRSALEACH---KGWGQSVIIGVAAAG 303
            D +  + + A +I+ T+GG         NV+V  +A+E+     +  G  V++G+ A  
Sbjct: 224 -DFRLEKDMEAAIIKATNGGAHGVI----NVSVSEAAIESSTRYVRSNGTVVLVGLPANA 278

Query: 304 QEISTRPFQLVTGRVWKGSAFGGVKGRSEMAGLIEQYKKGELKVDEFITHRRSFNEINEA 363
              S    Q+V      GS  G    R++    ++ + +G +K    I    +  EI E 
Sbjct: 279 YCKSEVFAQVVKSYKIVGSYVG---NRADTREALDFFSRGLVKSPIHIVGLSTLPEIYEK 335

Query: 364 FD 365
            +
Sbjct: 336 ME 337

>YOL086C Chr15 complement(159548..160594) [1047 bp, 348 aa] {ON}
           ADH1Alcohol dehydrogenase, fermentative isozyme active
           as homo- or heterotetramers; required for the reduction
           of acetaldehyde to ethanol, the last step in the
           glycolytic pathway
          Length = 348

 Score = 95.9 bits (237), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 99/359 (27%), Positives = 156/359 (43%), Gaps = 41/359 (11%)

Query: 13  VAYEAGKPQVVEQIVVDPPKAHEVRIKIVNTAVCHTDAYTLSGADPEGL-FPCVLGHEGA 71
           + YE+      + I V  PKA+E+ I +  + VCHTD +   G  P  +  P V GHEGA
Sbjct: 11  IFYESHGKLEYKDIPVPKPKANELLINVKYSGVCHTDLHAWHGDWPLPVKLPLVGGHEGA 70

Query: 72  GIVESVGDGVTNVKPGDHV-IALYTAECQKCKFCLSGKTNLCGAVRATQGKGVMPDGTSR 130
           G+V  +G+ V   K GD+  I      C  C++C  G  + C     +   G   DG   
Sbjct: 71  GVVVGMGENVKGWKIGDYAGIKWLNGSCMACEYCELGNESNCPHADLS---GYTHDG--- 124

Query: 131 FHNKKGESLYHFMGCSTFSEYTVVADVSVVAIDQTAPLESVCLLGCGVTTGYGAAVKTAN 190
                           +F +Y     V    I Q   L  V  + C   T Y  A+K+AN
Sbjct: 125 ----------------SFQQYATADAVQAAHIPQGTDLAQVAPILCAGITVY-KALKSAN 167

Query: 191 VQKGDTVAVFG-CGTVGLSVLQGAHQRGASRIIAIDTNDQKKDFCTQFGATDFINPTKDL 249
           +  G  VA+ G  G +G   +Q A   G  R++ ID  + K++     G   FI+ TK+ 
Sbjct: 168 LMAGHWVAISGAAGGLGSLAVQYAKAMG-YRVLGIDGGEGKEELFRSIGGEVFIDFTKE- 225

Query: 250 KENETIVAKLIEMTDGGLDHTFDCTGNVNVMRSALEACH---KGWGQSVIIGVAAAGQEI 306
              + IV  +++ TDGG         NV+V  +A+EA     +  G +V++G+ A  +  
Sbjct: 226 ---KDIVGAVLKATDGGAHGVI----NVSVSEAAIEASTRYVRANGTTVLVGMPAGAKCC 278

Query: 307 STRPFQLVTGRVWKGSAFGGVKGRSEMAGLIEQYKKGELKVDEFITHRRSFNEINEAFD 365
           S    Q+V      GS  G    R++    ++ + +G +K    +    +  EI E  +
Sbjct: 279 SDVFNQVVKSISIVGSYVG---NRADTREALDFFARGLVKSPIKVVGLSTLPEIYEKME 334

>SAKL0F06270g Chr6 (472877..473932) [1056 bp, 351 aa] {ON} similar
           to uniprot|P00331 Saccharomyces cerevisiae YMR303C ADH2
           Glucose-repressible alcohol dehydrogenase II
          Length = 351

 Score = 95.9 bits (237), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 100/379 (26%), Positives = 166/379 (43%), Gaps = 47/379 (12%)

Query: 11  AAVAYEAGKPQVVEQIVVDPPKAHEVRIKIVNTAVCHTDAYTLSGADP-EGLFPCVLGHE 69
           A + YE G     + I V  PK++E+ I +  + VCHTD +   G  P     P V GHE
Sbjct: 12  AVIFYENGGELQYKDIPVPKPKSNEILINVKYSGVCHTDLHAWKGDWPLPTKLPLVGGHE 71

Query: 70  GAGIVESVGDGVTNVKPGDHV-IALYTAECQKCKFC-LSGKTNLCGAVRATQGKGVMPDG 127
           GAG+V ++G+ V   K GD+  I      C  C++C LS ++N              P+ 
Sbjct: 72  GAGVVVAIGENVKGWKIGDYAGIKWLNGSCMACEYCELSNESNC-------------PEA 118

Query: 128 TSRFHNKKGESLYHFMGCSTFSEYTVVADVSVVAIDQTAPLESVCLLGCGVTTGYGAAVK 187
               +   G          +F +Y     V    I     L  V  + C   T Y  A+K
Sbjct: 119 DLSGYTHDG----------SFQQYATADAVQAARIPAGTDLAEVAPVLCAGITVY-KALK 167

Query: 188 TANVQKGDTVAVFG-CGTVGLSVLQGAHQRGASRIIAIDTNDQKKDFCTQFGATDFINPT 246
           +AN++ G+ VA+ G CG +G   +Q A   G  R++ ID  ++K     + G   FI+ T
Sbjct: 168 SANLRAGEWVAISGACGGLGSLAIQYAKAMG-YRVLGIDGGEEKAALFKELGGEVFIDFT 226

Query: 247 KDLKENETIVAKLIEMTDGGLDHTFDCTGNVNVMRSALEACH---KGWGQSVIIGVAAAG 303
           K     + +V  +++ T+GG         NV+V  +A+EA     +  G  V++G+    
Sbjct: 227 K----TKDVVKAVVDATNGGAHGVI----NVSVSEAAIEASTVYCRANGTVVLVGLPGGA 278

Query: 304 QEISTRPFQLVTGRVWKGSAFGGVKGRSEMAGLIEQYKKGELKVDEFITHRRSFNEINEA 363
           +  S    Q+V      GS  G    R++    ++ + +G +K    +      +E+   
Sbjct: 279 KCKSDVFNQVVKSTTIVGSYVG---NRADTREALDFFARGLVKSPIKVV---GLSELPSI 332

Query: 364 FDDLHNGLCL-RTVLSFSK 381
           ++ +  G  + R V+  SK
Sbjct: 333 YEKMEKGAIVGRYVVDTSK 351

>TPHA0M00730 Chr13 complement(137798..138850) [1053 bp, 350 aa] {ON}
           Anc_3.118 YBR145W
          Length = 350

 Score = 95.1 bits (235), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 98/365 (26%), Positives = 160/365 (43%), Gaps = 46/365 (12%)

Query: 13  VAYEAGKPQVVEQIVVDPPKAHEVRIKIVNTAVCHTDAYTLSGADPEGL-FPCVLGHEGA 71
           + YE   P   + I V  P  +E+ I ++ + VCHTD +   G  P  +  P V GHEGA
Sbjct: 13  IFYENNGPLEYKDIPVPTPLPNELLIHVLYSGVCHTDLHAWHGDWPLPVKLPLVGGHEGA 72

Query: 72  GIVESVGDGVTNVKPGDHV-IALYTAECQKCKFC-LSGKTNLCGAVRATQGKGVMPDGTS 129
           G+V  +G  V   K GD+  I      C  C+ C LS ++N              P+   
Sbjct: 73  GVVVGMGSSVKGWKVGDYAGIKWLNGSCMSCEECELSNESNC-------------PEADL 119

Query: 130 RFHNKKGESLYHFMGCSTFSEYTVVADVSVVAIDQTAPLESVCLLGCGVTTGYGAAVKTA 189
             +   G          +F +Y     V    I   A L+++  + C   T Y  A+K+A
Sbjct: 120 SGYTHDG----------SFQQYATADAVQAAKIPAGADLKNIAPILCAGVTVY-KAIKSA 168

Query: 190 NVQKGDTVAVFG-CGTVGLSVLQGAHQRGASRIIAIDTNDQKKDFCTQFGATDFINPTKD 248
           N++ GD +A+ G CG +G   +Q     G  RI+ ID   +K++   + G   FI    D
Sbjct: 169 NLKAGDWLAISGACGGLGSLAIQYGKAMGF-RILGIDGGAEKEELFKKLGGEYFI----D 223

Query: 249 LKENETIVAKLIEMTDGGLDHTFDCTGNVNVMRSALEACH---KGWGQSVIIGVAAAGQE 305
             + + I+A++ + T+GG         NV+V  +A+EA     +  G  V++G+ A    
Sbjct: 224 FTQCKDIIAEVKKATNGGAHGVI----NVSVSEAAIEASTNYVRSNGTVVLVGLPAGAVC 279

Query: 306 ISTRPFQLVTGRVWKGSAFGGVKGRSEMAGLIEQYKKGELKVDEFITHRRSFNEINEAFD 365
            S    Q+V      GS  G    R++    I+ + +G +K    +      +++   FD
Sbjct: 280 KSNVFNQVVKSTKIVGSYVG---NRADTREAIDFFVRGLVKSPIKVV---GLSQLASVFD 333

Query: 366 DLHNG 370
           D+  G
Sbjct: 334 DMQAG 338

>KLTH0G18986g Chr7 complement(1639254..1640318) [1065 bp, 354 aa]
           {ON} similar to uniprot|P35497 Saccharomyces cerevisiae
           YJR159W SOR1 Sorbitol dehydrogenase expression is
           induced in the presence of sorbitol
          Length = 354

 Score = 95.1 bits (235), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 103/381 (27%), Positives = 168/381 (44%), Gaps = 49/381 (12%)

Query: 11  AAVAYEAGKPQVVEQIVVDPPKAHEVRIKIVNTAVCHTDA-YTLSGADPEGLF--PCVLG 67
           A V  + G+  V  + V +    H V+++I  T +C +D  Y ++GA  + +   P +LG
Sbjct: 7   AIVLVQKGEIAVESKPVPEITDPHYVKLQIKKTGICGSDVHYYVAGAIGDFVVKKPMILG 66

Query: 68  HEGAGIVESVGDGVTNVKPGDHVIALYTAECQKCKFCLSGKTNLCGAVRATQGKGVMPDG 127
           HE +G+V  VG  V+ V+ GD V        +      +G+ NLC  ++      +  DG
Sbjct: 67  HESSGLVVEVGSEVSRVRVGDRVAIEPGVPSRYSDETKAGRYNLCPHMQFAATPPI--DG 124

Query: 128 T-SRFHNKKGESLYHFMGCSTFSEYTVVADVSVVAIDQTAPLESVCLLGCGVTTGYGAAV 186
           T  +++    + L       ++ E  +V  +SV                 GV      A 
Sbjct: 125 TLVKYYLAPEDFLVKLPDHVSYEEGALVEPLSV-----------------GVH-----AN 162

Query: 187 KTANVQKGDTVAVFGCGTVGLSVLQGAHQRGASRIIAIDTNDQKKDFCTQFGATDFINPT 246
           K A V     VAVFG G VGL     A   GAS ++ ID  + K    + FG T F+N +
Sbjct: 163 KLAGVAFNQRVAVFGAGPVGLLTGAVARAFGASEVVYIDVFEHKLSLSSNFGGTQFVN-S 221

Query: 247 KDLKENETIVAKLIEMTDGGL--DHTFDCTGNVNVMRSALEACHKGWGQSVIIGVAAAGQ 304
            ++K+ + +V K IE   GG   D  FDCTG    +R+ ++ C+ G G  V +G+   G 
Sbjct: 222 ANIKDEDDLV-KEIERVLGGARPDVVFDCTGAEICIRTGIKVCNSG-GTYVQVGM---GH 276

Query: 305 EISTRPFQLVTGRVWK-----GSAFGGVKGRSEMAGLIEQYKKGELKVDEFITHRRSFNE 359
           +    P   +  +  K       AFG  +   ++         G++ V   +THR  F +
Sbjct: 277 DDVNFPIGAIGAKELKVLGCFRYAFGDYRDAVQLIA------SGDVNVKPLVTHRFKFED 330

Query: 360 INEA--FDDLHNGLCLRTVLS 378
              A  F+  H    ++T++S
Sbjct: 331 AEAAYEFNIKHGSEVIKTIIS 351

>TBLA0E03430 Chr5 (850493..851548) [1056 bp, 351 aa] {ON} 
          Length = 351

 Score = 94.7 bits (234), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 99/362 (27%), Positives = 157/362 (43%), Gaps = 43/362 (11%)

Query: 11  AAVAYEAGKPQVVEQIVVDPPKAHEVRIKIVNTAVCHTDAYTLSGADP-EGLFPCVLGHE 69
           A + YE+G     + + V  PK +E+ I I  + VCHTD +   G  P +   P + GHE
Sbjct: 12  AVIFYESGGALEYKDVPVPTPKPNEILINIKYSGVCHTDLHAWKGDWPLDTKLPLIGGHE 71

Query: 70  GAGIVESVGDGVTNVKPGDHV-IALYTAECQKCKFC-LSGKTNLCGAVRATQGKGVMPDG 127
           GAG+V  +G  V   K GD+  +      C  C+ C LS ++N              P+ 
Sbjct: 72  GAGVVVGMGANVRGWKIGDYAGVKWLNGSCMSCEECELSNESNC-------------PEA 118

Query: 128 TSRFHNKKGESLYHFMGCSTFSEYTVVADVSVVAIDQTAPLESVCLLGCGVTTGYGAAVK 187
               +   G          +F EY     V    I Q A L  V  + C   T Y  A+K
Sbjct: 119 DLSGYTHDG----------SFQEYCTADAVQAARIPQGADLAEVAPILCAGVTVY-KALK 167

Query: 188 TANVQKGDTVAVFG-CGTVGLSVLQGAHQRGASRIIAIDTNDQKKDFCTQFGATDFINPT 246
           +A++  G+ VA+ G CG +G   +Q A   G  R++ ID  ++KK    + G   F+   
Sbjct: 168 SADLAAGEWVAISGACGGLGSLAVQFAKAMGL-RVLGIDGGEEKKKMFHEMGGEVFL--- 223

Query: 247 KDLKENETIVAKLIEMTDGGLDHTFDCTGNVNVMRSALEACH---KGWGQSVIIGVAAAG 303
            D +  + + A +I+ T+GG         NV+V  +A+EA     +  G  V++G+ A  
Sbjct: 224 -DFRLEKDMEAAVIKATNGGAHGVI----NVSVSEAAIEASTRYVRSNGTVVLVGLPANA 278

Query: 304 QEISTRPFQLVTGRVWKGSAFGGVKGRSEMAGLIEQYKKGELKVDEFITHRRSFNEINEA 363
              S    Q+V      GS  G    R++    ++ + +G +K    I    +  EI E 
Sbjct: 279 YCKSEVFSQVVKSYKIVGSYVG---NRADTREALDFFVRGLVKSPIHIVGLSTLPEIYEK 335

Query: 364 FD 365
            +
Sbjct: 336 ME 337

>KLLA0B09064g Chr2 complement(792849..793973) [1125 bp, 374 aa] {ON}
           uniprot|P49384 Kluyveromyces lactis KLLA0B09064g ADH3
           Alcohol dehydrogenase III mitochondrial precursor
          Length = 374

 Score = 95.1 bits (235), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 94/321 (29%), Positives = 142/321 (44%), Gaps = 42/321 (13%)

Query: 13  VAYEAGKPQVVEQIVVDPPKAHEVRIKIVNTAVCHTDAYTLSGADP-EGLFPCVLGHEGA 71
           + YE G     + I V  PK +E+ I +  + VCHTD +   G  P     P V GHEGA
Sbjct: 37  IFYENGGKLEYKDIPVPKPKPNEILINVKYSGVCHTDLHAWKGDWPLPTKLPLVGGHEGA 96

Query: 72  GIVESVGDGVTNVKPGDHV-IALYTAECQKCKFC-LSGKTNLCGAVRATQGKGVMPDGTS 129
           G+V ++G+ V     GD   I      C  C++C LS ++N C            PD   
Sbjct: 97  GVVVAMGENVKGWNIGDFAGIKWLNGSCMSCEYCELSNESN-C------------PDADL 143

Query: 130 RFHNKKGESLYHFMGCSTFSEYTVVADVSVVAIDQTAPLESVCLLGCGVTTGYGAAVKTA 189
             +   G          +F +Y     V    I +   L  V  + C   T Y  A+K+A
Sbjct: 144 SGYTHDG----------SFQQYATADAVQAARIPKGTDLAEVAPILCAGVTVY-KALKSA 192

Query: 190 NVQKGDTVAVFG-CGTVGLSVLQGAHQRGASRIIAIDTNDQKKDFCTQFGATDFINPTKD 248
           N++ GD VA+ G  G +G   +Q A   G  R++ ID  ++K     Q G   F+    D
Sbjct: 193 NLKAGDWVAISGAAGGLGSLAVQYAKAMG-YRVVGIDGGEEKGKLVKQLGGEAFV----D 247

Query: 249 LKENETIVAKLIEMTDGGLDHTFDCTGNVNVMRSALEACH---KGWGQSVIIGVAAAGQE 305
             + + +VA++ E+T+GG         NV+V  +A+ A     +  G  V++G+  AG  
Sbjct: 248 FTKTKDMVAEIQEITNGGPHGVI----NVSVSEAAMNASTQFVRPTGTVVLVGL-PAGAV 302

Query: 306 ISTRPFQLVTGRV-WKGSAFG 325
           I +  F  V   +  KGS  G
Sbjct: 303 IKSEVFSHVVKSINIKGSYVG 323

>Kwal_56.23198 s56 (443881..444936) [1056 bp, 351 aa] {ON} YOL086C
           (ADH1) - Alcohol dehydrogenase [contig 183] FULL
          Length = 351

 Score = 94.4 bits (233), Expect = 6e-21,   Method: Compositional matrix adjust.
 Identities = 84/283 (29%), Positives = 124/283 (43%), Gaps = 37/283 (13%)

Query: 11  AAVAYEAGKPQVVEQIVVDPPKAHEVRIKIVNTAVCHTDAYTLSGADP-EGLFPCVLGHE 69
           A + YE G P   + I V  P A E+ I +  + VCHTD +   G  P     P V GHE
Sbjct: 12  AVIFYENGGPLEYKDIPVPKPSATELLINVKYSGVCHTDLHAWKGDWPLPTKLPLVGGHE 71

Query: 70  GAGIVESVGDGVTNVKPGDHV-IALYTAECQKCKFC-LSGKTNLCGAVRATQGKGVMPDG 127
           GAG+V ++G+ V   K GD+  I      C  C+ C LS ++N              P+ 
Sbjct: 72  GAGVVVAMGENVKGWKIGDYAGIKWLNGSCMSCESCELSNESNC-------------PEA 118

Query: 128 TSRFHNKKGESLYHFMGCSTFSEYTVVADVSVVAIDQTAPLESVCLLGCGVTTGYGAAVK 187
               +   G          +F +Y     V    I Q   L  V  + C   T Y  A+K
Sbjct: 119 DLSGYTHDG----------SFQQYATADAVQAAKIPQGTDLAEVAPVLCAGITVY-KALK 167

Query: 188 TANVQKGDTVAVFG-CGTVGLSVLQGAHQRGASRIIAIDTNDQKKDFCTQFGATDFINPT 246
           +AN+  GD VA+ G CG +G   +Q A   G  R++ ID   +K +   Q G   FI   
Sbjct: 168 SANLSAGDWVAISGACGGLGSLCIQYATAMG-YRVLGIDGGAEKAELFKQLGGEVFI--- 223

Query: 247 KDLKENETIVAKLIEMTDGGLDHTFDCTGNVNVMRSALEACHK 289
            D    + +  ++I+ T+GG         NV+V  +A+E+  +
Sbjct: 224 -DFTTCKDVEGEIIKATNGGAHGVI----NVSVSEAAIESSTR 261

>KLLA0F13530g Chr6 (1251162..1252289) [1128 bp, 375 aa] {ON}
           uniprot|P49385 Kluyveromyces lactis ADH4 Alcohol
           dehydrogenase IV, mitochondrial precursor
          Length = 375

 Score = 94.7 bits (234), Expect = 7e-21,   Method: Compositional matrix adjust.
 Identities = 99/367 (26%), Positives = 159/367 (43%), Gaps = 44/367 (11%)

Query: 13  VAYEAGKPQVVEQIVVDPPKAHEVRIKIVNTAVCHTDAYTLSGADPEGL-FPCVLGHEGA 71
           + YE G     + + V  PKA+E+ I +  + VCHTD +   G  P  +  P V GHEGA
Sbjct: 38  IFYENGGKLEYKDLPVPKPKANEILINVKYSGVCHTDLHAWKGDWPLPVKLPLVGGHEGA 97

Query: 72  GIVESVGDGVTNVKPGDHV-IALYTAECQKCKFCLSGKTNLCGAVRATQGKGVMPDGTSR 130
           GIV + G+ V N + GD+  I      C  C+ C  G  + C          +  D +  
Sbjct: 98  GIVVAKGENVKNFEIGDYAGIKWLNGSCMSCELCEQGYESNC----------LQADLSGY 147

Query: 131 FHNKKGESLYHFMGCSTFSEYTVVADVSVVAIDQTAPLESVCLLGCGVTTGYGAAVKTAN 190
            H+             +F +Y     V    I +   L  +  + C   T Y  A+KTA+
Sbjct: 148 THD------------GSFQQYATADAVQAAQIPKGTDLAEIAPILCAGVTVY-KALKTAD 194

Query: 191 VQKGDTVAVFG-CGTVGLSVLQGAHQRGASRIIAIDTNDQKKDFCTQFGATDFINPTKDL 249
           ++ G  VA+ G  G +G   +Q A   G  R++ ID  D K++   Q G   FI    D 
Sbjct: 195 LKPGQWVAISGAAGGLGSLAVQYAKAMGL-RVLGIDGGDGKEELFKQCGGEVFI----DF 249

Query: 250 KENETIVAKLIEMTDGGLDHTFDCTGNVNVMRSALEACH---KGWGQSVIIGVAAAGQEI 306
           ++++ +VA + E T+GG         NV+V  +A+       +  G  V++G+ A     
Sbjct: 250 RKSKDMVADIQEATNGGPHGVI----NVSVSEAAISMSTEYVRPTGVVVLVGLPADAYVK 305

Query: 307 STRPFQLVTGRVWKGSAFGGVKGRSEMAGLIEQYKKGELKVDEFITHRRSFNEINEAFDD 366
           S     +V     KGS  G    R++     + + +G +K    I      +E+ EA++ 
Sbjct: 306 SEVFSHVVKSISIKGSYVG---NRADTREATDFFTRGLVKSPIKII---GLSELPEAYEL 359

Query: 367 LHNGLCL 373
           +  G  L
Sbjct: 360 MEQGKIL 366

>Kwal_55.19574 s55 complement(32260..33330) [1071 bp, 356 aa] {ON}
           YJR159W (SOR1) - sorbitol-induced sorbitol dehydrogenase
           [contig 159] FULL
          Length = 356

 Score = 94.4 bits (233), Expect = 7e-21,   Method: Compositional matrix adjust.
 Identities = 102/359 (28%), Positives = 152/359 (42%), Gaps = 49/359 (13%)

Query: 34  HEVRIKIVNTAVCHTDA-YTLSGADPEGLF--PCVLGHEGAGIVESVGDGVTNVKPGDHV 90
           +  ++ +  T +C +D  Y  SG   + +   P VLGHE +G+V  VG  V  +K GD V
Sbjct: 30  YYAKVAVKATGICGSDVHYYRSGGIGKYILNSPMVLGHESSGVVVEVGPKVEKIKVGDRV 89

Query: 91  IALYTAECQKCKFCLSGKTNLCGAVRATQGKGVMPDGTSRFHNKKGESLYHFMGCSTFSE 150
                   +      +GK NLC  +       +  DGT                      
Sbjct: 90  AIEPGVPDRYSDETKAGKYNLCPHMAFAATPPI--DGT------------------LVKY 129

Query: 151 YTVVADVSVVAIDQTAPLESVCL--LGCGVTTGYGAAVKTANVQKGDTVAVFGCGTVGLS 208
           Y   AD  V   D  +  E  C+  L  GV +      K A V+ G TV VFG G VGL 
Sbjct: 130 YLSPADFLVKLPDHVSFEEGACIEPLSVGVHSN-----KLAKVRFGQTVVVFGAGPVGLL 184

Query: 209 VLQGAHQRGASRIIAIDTNDQKKDFCTQFGATDFINPTKDLKENETIVAKLIEMTDGG-- 266
               A   GAS ++ +D  DQK +    FGAT  IN TK  K +   +A  +E   GG  
Sbjct: 185 TGAVAKAFGASDVVFVDVFDQKLERAKNFGATHVINSTKLPKNDPQALADEVEKLLGGAL 244

Query: 267 LDHTFDCTGNVNVMRSALEACHKGWGQSVIIGVAAAGQEISTRPFQLVTGRVWK-----G 321
            D  F+C+G  + + + ++A   G G  V IG+   G+     P   V+G+         
Sbjct: 245 ADVVFECSGAESCIDAGVKATKNG-GTMVQIGM---GKNYVNFPIAEVSGKEMTLVGCFR 300

Query: 322 SAFGGVKGRSEMAGLIEQYKKGELKVDEFITHRRSFNEINEAFD--DLHNGLCLRTVLS 378
            ++G  K    +         G + V + ITHR SF +  +A+D    H G  ++T+++
Sbjct: 301 YSYGDYKDAVNLV------STGRVDVKKLITHRFSFEDAAKAYDFNIAHGGEVVKTIIA 353

>YMR303C Chr13 complement(873291..874337) [1047 bp, 348 aa] {ON}
           ADH2Glucose-repressible alcohol dehydrogenase II,
           catalyzes the conversion of ethanol to acetaldehyde;
           involved in the production of certain carboxylate
           esters; regulated by ADR1
          Length = 348

 Score = 94.4 bits (233), Expect = 7e-21,   Method: Compositional matrix adjust.
 Identities = 99/361 (27%), Positives = 157/361 (43%), Gaps = 41/361 (11%)

Query: 11  AAVAYEAGKPQVVEQIVVDPPKAHEVRIKIVNTAVCHTDAYTLSGADP-EGLFPCVLGHE 69
           A + YE+      + I V  PK +E+ I +  + VCHTD +   G  P     P V GHE
Sbjct: 9   AIIFYESNGKLEHKDIPVPKPKPNELLINVKYSGVCHTDLHAWHGDWPLPTKLPLVGGHE 68

Query: 70  GAGIVESVGDGVTNVKPGDHV-IALYTAECQKCKFCLSGKTNLCGAVRATQGKGVMPDGT 128
           GAG+V  +G+ V   K GD+  I      C  C++C  G  + C     +   G   DG 
Sbjct: 69  GAGVVVGMGENVKGWKIGDYAGIKWLNGSCMACEYCELGNESNCPHADLS---GYTHDG- 124

Query: 129 SRFHNKKGESLYHFMGCSTFSEYTVVADVSVVAIDQTAPLESVCLLGCGVTTGYGAAVKT 188
                             +F EY     V    I Q   L  V  + C   T Y  A+K+
Sbjct: 125 ------------------SFQEYATADAVQAAHIPQGTDLAEVAPILCAGITVY-KALKS 165

Query: 189 ANVQKGDTVAVFG-CGTVGLSVLQGAHQRGASRIIAIDTNDQKKDFCTQFGATDFINPTK 247
           AN++ G   A+ G  G +G   +Q A   G  R++ ID    K++  T  G   FI+ TK
Sbjct: 166 ANLRAGHWAAISGAAGGLGSLAVQYAKAMG-YRVLGIDGGPGKEELFTSLGGEVFIDFTK 224

Query: 248 DLKENETIVAKLIEMTDGGLDHTFDCTGNVNVMRSALEACH---KGWGQSVIIGVAAAGQ 304
           +    + IV+ +++ T+GG         NV+V  +A+EA     +  G  V++G+  AG 
Sbjct: 225 E----KDIVSAVVKATNGGAHGII----NVSVSEAAIEASTRYCRANGTVVLVGL-PAGA 275

Query: 305 EISTRPFQLVTGRVWKGSAFGGVKGRSEMAGLIEQYKKGELKVDEFITHRRSFNEINEAF 364
           + S+  F  V   +    ++  V  R++    ++ + +G +K    +    S  EI E  
Sbjct: 276 KCSSDVFNHVVKSISIVGSY--VGNRADTREALDFFARGLVKSPIKVVGLSSLPEIYEKM 333

Query: 365 D 365
           +
Sbjct: 334 E 334

>Ecym_7391 Chr7 (801773..802900) [1128 bp, 375 aa] {ON} similar to
           Ashbya gossypii ABL033C
          Length = 375

 Score = 94.4 bits (233), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 107/387 (27%), Positives = 164/387 (42%), Gaps = 45/387 (11%)

Query: 2   TEGKPIECLAAVAYEAGKPQVVEQIVVDPPKAHEVRIKIVNTAVCHTDAYTLSGADPEGL 61
           + G P+   A + YE G     + I V  PK +E+ + +  + VCHTD +   G  P   
Sbjct: 27  SSGIPLTQKAVIFYEHGDKLHYKDIPVPKPKPNEILVNVKYSGVCHTDIHAWKGDWPLAT 86

Query: 62  -FPCVLGHEGAGIVESVGDGVTNVKPGDHV-IALYTAECQKCKFCLSGKTNLCGAVRATQ 119
             P V GHEGAGIV + G  VTN + GD+  +      C  C++C +G  + C     + 
Sbjct: 87  KLPLVGGHEGAGIVVAKGSNVTNFEIGDYAGVKWLNKSCMSCEYCETGHESNCAEADLS- 145

Query: 120 GKGVMPDGTSRFHNKKGESLYHFMGCSTFSEYTVVADVSVVAIDQTAPLESVCLLGCGVT 179
             G   DG                   +F +Y     V    I Q   L  V  + C   
Sbjct: 146 --GYTRDG-------------------SFQQYATADAVQAAKIPQGTDLAQVAPILCAGV 184

Query: 180 TGYGAAVKTANVQKGDTVAVFGCGTVGLSVLQGAHQRGASRIIAIDTNDQKKDFCTQFGA 239
           T Y  A+KTAN+  G  VA+ G G    S+     +    R++ ID    K     + G 
Sbjct: 185 TVY-KALKTANLDPGQWVAISGAGGGLGSLAVQYAKAMGLRVVGIDGGAAKDALFKKLGG 243

Query: 240 TDFINPTKDLKENETIVAKLIEMTDGGLDHTFDCTGNVNVMRSALEACHK---GWGQSVI 296
             FI    D  +++ IVA + E T+GG         NV+V  +A+    K     G  V+
Sbjct: 244 EVFI----DFTKSKDIVADIQEATNGGPHGAV----NVSVSEAAIVQSVKYIRPTGTVVL 295

Query: 297 IGVAAAGQEISTRPFQLVTGRV-WKGSAFGGVKGRSEMAGLIEQYKKGELKVDEFITHRR 355
           +G+  A   +++  F  V   +  KGS  G    R++M   I+ + +G +K    I    
Sbjct: 296 VGL-PANSYVNSEIFSHVIKSISIKGSYVG---NRADMREAIDFFTRGLVKAPIKII--- 348

Query: 356 SFNEINEAFDDLHNG-LCLRTVLSFSK 381
             +E+  A+ +L  G +  R V+  SK
Sbjct: 349 GLSELPTAYHELEAGNMVGRFVVDTSK 375

>KLTH0G15686g Chr7 complement(1367997..1369052) [1056 bp, 351 aa]
           {ON} highly similar to uniprot|P00330 Saccharomyces
           cerevisiae YOL086C ADH1 Alcohol dehydrogenase involved
           in the production of certain carboxylate esters
          Length = 351

 Score = 94.0 bits (232), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 85/298 (28%), Positives = 132/298 (44%), Gaps = 38/298 (12%)

Query: 13  VAYEAGKPQVVEQIVVDPPKAHEVRIKIVNTAVCHTDAYTLSGADPEGL-FPCVLGHEGA 71
           + YE G     + I V  PKA+E+ + +  + VCHTD +   G  P  +  P V GHEGA
Sbjct: 14  IFYETGGKLEYKDIDVPTPKANELLVNVKYSGVCHTDLHAYHGDWPLPVKLPLVGGHEGA 73

Query: 72  GIVESVGDGVTNVKPGDHV-IALYTAECQKCKFCLSGKTNLCGAVRATQGKGVMPDGTSR 130
           G+V ++G+ V   K GD   I      C  C+ C  G  + C            P+    
Sbjct: 74  GVVVAMGENVKGWKVGDLAGIKWLNGSCMSCESCELGNESNC------------PEADLS 121

Query: 131 FHNKKGESLYHFMGCSTFSEYTVVADVSVVAIDQTAPLESVCLLGCGVTTGYGAAVKTAN 190
            +   G          +F +Y     V    I   A L  +  + C   T Y  A+K+AN
Sbjct: 122 GYTHDG----------SFQQYATADAVQAAKIPAGADLAEIAPILCAGITVY-KALKSAN 170

Query: 191 VQKGDTVAVFG-CGTVGLSVLQGAHQRGASRIIAIDTNDQKKDFCTQFGATDFINPTKDL 249
           +Q GD VA+ G  G +G   +Q A   G  R++ ID  ++K+    Q G   FI    D 
Sbjct: 171 LQAGDWVAISGAAGGLGSLAVQYAKAMG-YRVLGIDGGEEKEQLFRQLGGEVFI----DF 225

Query: 250 KENETIVAKLIEMTDGGLDHTFDCTGNVNVMRSALEACH---KGWGQSVIIGVAAAGQ 304
           +  + I  ++I+ T+GG         NV+V  +A+E+     +  G  V++G+ A  +
Sbjct: 226 RTCKDIEGEIIKATNGGAHGVI----NVSVSEAAIESSTNYVRANGTVVLVGLPAGAK 279

>Smik_13.520 Chr13 complement(856008..857054) [1047 bp, 348 aa] {ON}
           YMR303C (REAL)
          Length = 348

 Score = 93.6 bits (231), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 87/298 (29%), Positives = 134/298 (44%), Gaps = 38/298 (12%)

Query: 13  VAYEAGKPQVVEQIVVDPPKAHEVRIKIVNTAVCHTDAYTLSGADP-EGLFPCVLGHEGA 71
           + YE+      + I V  PK +E+ I +  + VCHTD +   G  P     P V GHEGA
Sbjct: 11  IFYESNGKLEHKDIPVPKPKPNELLINVKYSGVCHTDLHAWHGDWPLPTKLPLVGGHEGA 70

Query: 72  GIVESVGDGVTNVKPGDHV-IALYTAECQKCKFCLSGKTNLCGAVRATQGKGVMPDGTSR 130
           G+V ++GD V   K GD   I    + C  C++C  G  + C     +   G   DG   
Sbjct: 71  GVVVAIGDNVRGWKVGDLAGIKWLNSSCMACEYCELGNESNCPHADLS---GYTHDG--- 124

Query: 131 FHNKKGESLYHFMGCSTFSEYTVVADVSVVAIDQTAPLESVCLLGCGVTTGYGAAVKTAN 190
                           +F +Y     V    I +   L  V  + C   T Y  A+K+AN
Sbjct: 125 ----------------SFQQYATADAVQAARIPEGTDLAQVAPILCAGITVY-KALKSAN 167

Query: 191 VQKGDTVAVFG-CGTVGLSVLQGAHQRGASRIIAIDTNDQKKDFCTQFGATDFINPTKDL 249
           ++ G  VA+ G  G +G   +Q A   G  R++ ID  + K++  T  G   FI+ TK+ 
Sbjct: 168 LRAGHWVAISGAAGGLGSLAVQYAKAMG-YRVLGIDGGEGKEELFTSLGGEVFIDFTKE- 225

Query: 250 KENETIVAKLIEMTDGGLDHTFDCTGNVNVMRSALEACH---KGWGQSVIIGVAAAGQ 304
              + IV+ +++ TDGG         NV+V  +A+EA     +  G  V++G+ A  +
Sbjct: 226 ---KDIVSAVVKATDGGAHGIV----NVSVSEAAIEASTRYCRANGTVVLVGLPAGAK 276

>NDAI0A06930 Chr1 (1585575..1586630) [1056 bp, 351 aa] {ON}
           Anc_3.118
          Length = 351

 Score = 93.2 bits (230), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 98/362 (27%), Positives = 155/362 (42%), Gaps = 39/362 (10%)

Query: 24  EQIVVDPPKAHEVRIKIVNTAVCHTDAYTLSGADPEGL-FPCVLGHEGAGIVESVGDGVT 82
           + I V  PK+ E+ I +  + VCHTD +   G  P     P V GHEGAGIV  VG+ V 
Sbjct: 25  KDIPVPVPKSTEILINVKYSGVCHTDLHAWKGDWPLATKLPLVGGHEGAGIVVQVGENVQ 84

Query: 83  NVKPGDHV-IALYTAECQKCKFCLSGKTNLCGAVRATQGKGVMPDGTSRFHNKKGESLYH 141
             K GD   I      C  C++C  G  + C            P+     +   G     
Sbjct: 85  GWKVGDLAGIKWLNGSCMACEYCELGNESNC------------PNADLSGYTHDG----- 127

Query: 142 FMGCSTFSEYTVVADVSVVAIDQTAPLESVCLLGCGVTTGYGAAVKTANVQKGDTVAVFG 201
                +F +Y     V    I Q   L  V  + C   T Y  A+K+AN++ G+ VA+ G
Sbjct: 128 -----SFQQYATADAVQAARIPQGTDLAEVAPVLCAGITVY-KALKSANLRAGEWVAISG 181

Query: 202 -CGTVGLSVLQGAHQRGASRIIAIDTNDQKKDFCTQFGATDFINPTKDLKENETIVAKLI 260
             G +G   +Q A   G  RI+ ID  ++K+    + G   FI+ TK     + IV  +I
Sbjct: 182 AAGGLGSLAVQYAKAMG-YRILGIDGGEEKEKLFRELGGEIFIDFTK----TKDIVGDII 236

Query: 261 EMTDGGLDHTFDCTGNVNVMRSALEACHKGWGQSVIIGVAAAGQEISTRPFQLVTGRVWK 320
           + T+GG     + + +   + ++ E C    G  V++G+    +  S    Q+V      
Sbjct: 237 KATNGGAHGVINVSVSEAAIGASTEYCRAN-GTVVLVGLPRDAKCKSDVFNQVVKSISIV 295

Query: 321 GSAFGGVKGRSEMAGLIEQYKKGELKVDEFITHRRSFNEINEAFDDLHNGLCL-RTVLSF 379
           GS  G    R++    ++ + +G +K      H    +++ E F  +  G  + R V+  
Sbjct: 296 GSYVG---NRADTREALDFFSRGLVKSP---IHIAPLSDLPEIFGKMEKGQIVGRYVVDT 349

Query: 380 SK 381
           SK
Sbjct: 350 SK 351

>KAFR0L02010 Chr12 (379623..380678) [1056 bp, 351 aa] {ON} 
          Length = 351

 Score = 92.8 bits (229), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 101/378 (26%), Positives = 162/378 (42%), Gaps = 45/378 (11%)

Query: 11  AAVAYEAGKPQVVEQIVVDPPKAHEVRIKIVNTAVCHTDAYTLSG-ADPEGLFPCVLGHE 69
           A +  E G     + I V  PK++E+ I ++ + VCH+D +   G        P V GHE
Sbjct: 12  AIIFSEVGGKLEYKDIPVPVPKSNELLINVLYSGVCHSDLHIWQGDLPLPLKLPLVGGHE 71

Query: 70  GAGIVESVGDGVTNVKPGDHV-IALYTAECQKCKFCLSGKTNLCGAVRATQGKGVMPDGT 128
           GAG+V  +G  V   K GD+  I      C  C+FC       C     T   G + DG 
Sbjct: 72  GAGVVVGMGSNVKGWKLGDYAGIKFLNGTCNACEFCEQSFEISCPHADFT---GTVHDG- 127

Query: 129 SRFHNKKGESLYHFMGCSTFSEYTVVADVSVVAIDQTAPLESVCLLGCGVTTGYGAAVKT 188
                             +F +Y     V    I Q   L ++  L C   T Y  A+K+
Sbjct: 128 ------------------SFQQYATADAVQAARIPQGTDLAAIAPLLCAGLTAY-KALKS 168

Query: 189 ANVQKGDTVAVFG-CGTVGLSVLQGAHQRGASRIIAIDTNDQKKDFCTQFGATDFINPTK 247
           AN++ G  VA+ G CG +G   +Q A   G  R++ ID+ ++K  +    G   FI    
Sbjct: 169 ANMRPGQWVAISGACGGLGTYAIQYATAMG-YRVLGIDSGEEKAKYFKTLGGEVFI---- 223

Query: 248 DLKENETIVAKLIEMTDGGLDHTFDCTGNVNVMRSALEACHKGWGQSVIIGV---AAAGQ 304
           D K+++ +VA +I+ TDGG     +   +   +  + +      G SV++ +   A    
Sbjct: 224 DYKKSKDVVADVIKATDGGAHGVLNIAVDPRAISMSTKYVRSN-GTSVLVSLPKDAVCES 282

Query: 305 EISTRPFQLVTGRVWKGSAFGGVKGRSEMAGLIEQYKKGELKVDEFITHRRSFNEINEAF 364
           E+ T   Q+V      GS  G    R++    I+ + +G +K+     H    + + + +
Sbjct: 283 EVFT---QVVKSTSIVGSCVG---NRADTREAIDFFTRGLIKIP---IHMAPLSSLPQIY 333

Query: 365 DDL-HNGLCLRTVLSFSK 381
           D L  N +  R V+  SK
Sbjct: 334 DKLMQNEVVGRFVVDTSK 351

>SAKL0B00814g Chr2 (74565..75629) [1065 bp, 354 aa] {ON} similar to
           uniprot|P35497 Saccharomyces cerevisiae YJR159W SOR1
           Sorbitol dehydrogenase expression is induced in the
           presence of sorbitol
          Length = 354

 Score = 92.8 bits (229), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 104/348 (29%), Positives = 153/348 (43%), Gaps = 57/348 (16%)

Query: 34  HEVRIKIVNTAVCHTDA-YTLSGADPEGLF----PCVLGHEGAGIVESVGDGVTNVKPGD 88
           H V++ I  T +C +D  Y  +GA   G F    P VLGHE +G+V  VG  VT+VK GD
Sbjct: 30  HYVKLAIKKTGICGSDVHYYKTGAI--GNFVVKDPMVLGHESSGVVVEVGSKVTSVKVGD 87

Query: 89  HVIALYTAECQKCKFCLSGKTNLCGAVRATQGKGVMPDGTSRFHNKKGESLYHFMGCSTF 148
            V        +  K   SG  NLC ++       +  DGT                    
Sbjct: 88  RVAIEPGVPSRYSKATKSGHYNLCPSMAFAATPPI--DGT------------------LL 127

Query: 149 SEYTVVADVSVVAIDQTAPLESVCL--LGCGVTTGYGAAVKTANVQKGDTVAVFGCGTVG 206
             Y    D  V   D  +  E  C+  L  GV      A K A+V+ G  V VFG G VG
Sbjct: 128 KYYLSPEDFLVKLPDSVSFEEGACVEPLSVGVH-----ANKLADVRFGSKVVVFGAGPVG 182

Query: 207 LSVLQGAHQR--GASRIIAIDTNDQKKDFCTQFGATDFINPTKDLKENETIVAKLIEMTD 264
           L  L GA  R  GA+ ++ +D  D K +   +FGAT  +N +K  K  + +V ++  +  
Sbjct: 183 L--LAGAVSRAFGATDVVFVDVFDHKLERTNEFGATQTVNSSK-FKSEDDLVKEIQRVLS 239

Query: 265 GGLDH-TFDCTGNVNVMRSALEACHKGWGQSVIIGVAAAG-----QEISTRPFQLV-TGR 317
           G      F+C+G    +R+ ++AC  G G+ V +G+          E+ ++  Q++ T R
Sbjct: 240 GEQPEVVFECSGAEVCIRAGIKACKAG-GRYVQVGMGKDNVNFPISEVVSKELQVLGTFR 298

Query: 318 VWKGSAFGGVKGRSEMAGLIEQYKKGELKVDEFITHRRSFNEINEAFD 365
              G     VK  SE          G++ V   ITHR  F +  +A++
Sbjct: 299 YCFGDYNDSVKLISE----------GKVNVKPLITHRFKFQDAIKAYE 336

>SAKL0B08184g Chr2 (698686..699807) [1122 bp, 373 aa] {ON}
           uniprot|Q9P8S5 Saccharomyces kluyveri Alcohol
           dehydrogenase isozyme 3
          Length = 373

 Score = 92.8 bits (229), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 103/377 (27%), Positives = 162/377 (42%), Gaps = 47/377 (12%)

Query: 13  VAYEAGKPQVVEQIVVDPPKAHEVRIKIVNTAVCHTDAYTLSGADP-EGLFPCVLGHEGA 71
           + YE G     E I V  PK +E+ I +  + VCHTD +   G  P     P V GHEGA
Sbjct: 36  IFYENGGELKYEDIPVPKPKPNELLINVKYSGVCHTDLHAWKGDWPLPTKLPLVGGHEGA 95

Query: 72  GIVESVGDGVTNVKPGDHV-IALYTAECQKCKFCLSGKTNLCGAVRATQGKGVMPDGTSR 130
           G+V ++G+ V   K GD   I      C  C++C     + C     +   G   DG   
Sbjct: 96  GVVVAMGENVKGWKIGDLAGIKWLNGSCLSCEYCEKSNESNCPHADLS---GYTHDG--- 149

Query: 131 FHNKKGESLYHFMGCSTFSEYTVVADVSVVAIDQTAPLESVCLLGCGVTTGYGAAVKTAN 190
                           +F +Y     V    I +   L  V  + C   T Y  A+K+AN
Sbjct: 150 ----------------SFQQYATADYVQAARIPEGTDLAEVSPILCAGVTVY-KALKSAN 192

Query: 191 VQKGDTVAVFG-CGTVGLSVLQGAHQRGASRIIAIDTNDQKKDFCTQFGATDFINPTKDL 249
           ++ GD VA+ G  G +G   +Q A   G  R++ ID   +K +   + G   FI    D 
Sbjct: 193 LKAGDWVAISGAAGGLGSLAVQYAKAMG-YRVLGIDGGAEKGELVKKLGGEVFI----DF 247

Query: 250 KENETIVAKLIEMTDGGLDHTFDCTGNVNVMRSALEACH---KGWGQSVIIGVAAAGQEI 306
            +++ +V  + E T+GG         NV+V  +A+ A     +  G  V++G+  AG  I
Sbjct: 248 TKHKNLVEAVQEATNGGPHGVI----NVSVSEAAMTASTQFVRPTGTVVLVGL-PAGAVI 302

Query: 307 STRPFQLVTGRV-WKGSAFGGVKGRSEMAGLIEQYKKGELKVDEFITHRRSFNEINEAFD 365
            +  F  V   +  KGS  G    R++    I+ + +G +K      H    +E+ + ++
Sbjct: 303 KSEVFSHVVKSINIKGSYVG---NRADTREAIDFFARGMVKSP---IHVVGLSELPKVYE 356

Query: 366 DLHNGLCL-RTVLSFSK 381
            +  G  L R V+  +K
Sbjct: 357 LMEKGKILGRYVVDTAK 373

>KLTH0D05588g Chr4 complement(502176..503345) [1170 bp, 389 aa] {ON}
           similar to uniprot|P07246 Saccharomyces cerevisiae
           YMR083W ADH3 Alcohol dehydrogenase isoenzyme III
          Length = 389

 Score = 92.8 bits (229), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 99/367 (26%), Positives = 151/367 (41%), Gaps = 44/367 (11%)

Query: 13  VAYEAGKPQVVEQIVVDPPKAHEVRIKIVNTAVCHTDAYTLSGADPEGL-FPCVLGHEGA 71
           + YE G     + + V  PK +E+ I +  + VCHTD +   G  P  +  P V GHEGA
Sbjct: 52  IFYEHGGELHYKDLPVPKPKPNEILINVKYSGVCHTDLHAWKGDWPLAVKLPLVGGHEGA 111

Query: 72  GIVESVGDGVTNVKPGDHV-IALYTAECQKCKFCLSGKTNLCGAVRATQGKGVMPDGTSR 130
           G+V + G+ VTN + GD+  I      C  C+ C  G    C     +   G   DG   
Sbjct: 112 GVVVAKGENVTNFEIGDYAGIKWLNGSCMSCELCEQGNEPNCEHADLS---GYTHDG--- 165

Query: 131 FHNKKGESLYHFMGCSTFSEYTVVADVSVVAIDQTAPLESVCLLGCGVTTGYGAAVKTAN 190
                           +F +Y     V    I +   L  +  + C   T Y  A+KTA+
Sbjct: 166 ----------------SFQQYATADAVQAAQIPKGTDLAQIAPILCAGVTVY-KALKTAD 208

Query: 191 VQKGDTVAVFG-CGTVGLSVLQGAHQRGASRIIAIDTNDQKKDFCTQFGATDFINPTKDL 249
           V+ G  VA+ G  G +G   +Q A   G  R++ ID  + KK      G   FI    D 
Sbjct: 209 VRPGQWVAISGAAGGLGSLAVQYAKAMGL-RVLGIDGGEDKKKLFHDLGGETFI----DF 263

Query: 250 KENETIVAKLIEMTDGGLDHTFDCTGNVNVMRSALEACH---KGWGQSVIIGVAAAGQEI 306
           +  + +V  + E T GG         NV+V  +A+       +  G  V++G+ A     
Sbjct: 264 RTTKDMVGAIQEATQGGPHAVI----NVSVSEAAISMSTEYVRPTGSVVLVGLPANAYVK 319

Query: 307 STRPFQLVTGRVWKGSAFGGVKGRSEMAGLIEQYKKGELKVDEFITHRRSFNEINEAFDD 366
           S     +V     KGS  G    R++    I+ + +G +K    I      +E+ EA+  
Sbjct: 320 SEVFSHVVKSISIKGSYVG---NRADTREAIDFFARGLVKAPIKII---GLSELPEAYKL 373

Query: 367 LHNGLCL 373
           +  G  L
Sbjct: 374 MEAGKIL 380

>TPHA0G03210 Chr7 complement(688137..689270) [1134 bp, 377 aa] {ON}
           Anc_2.480 YMR083W
          Length = 377

 Score = 92.4 bits (228), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 101/373 (27%), Positives = 159/373 (42%), Gaps = 39/373 (10%)

Query: 13  VAYEAGKPQVVEQIVVDPPKAHEVRIKIVNTAVCHTDAYTLSGADPEGL-FPCVLGHEGA 71
           + YE   P   + I V  PK++E+ I +  + VCHTD +   G  P  +  P V GHEGA
Sbjct: 40  IFYENNGPLEYKDIPVPKPKSNEILINVEYSGVCHTDLHAWKGDWPLPVKLPLVGGHEGA 99

Query: 72  GIVESVGDGVTNVKPGDHV-IALYTAECQKCKFCLSGKTNLCGAVRATQGKGVMPDGTSR 130
           G+V  +GD V N K GD   I      C  C+ C +G    C     +   G   DG   
Sbjct: 100 GVVVGMGDNVKNWKIGDLAGIKWLNGSCMSCELCENGFEANCEHADLS---GYTHDG--- 153

Query: 131 FHNKKGESLYHFMGCSTFSEYTVVADVSVVAIDQTAPLESVCLLGCGVTTGYGAAVKTAN 190
                           +F +Y     V    I     L +V  + C   T Y  A+KTA+
Sbjct: 154 ----------------SFQQYATADAVQAARIPAGTDLANVAPILCAGVTVY-KALKTAD 196

Query: 191 VQKGDTVAVFG-CGTVGLSVLQGAHQRGASRIIAIDTNDQKKDFCTQFGATDFINPTKDL 249
           ++ GD VA+ G  G +G   +Q A   G  R+I ID  + KK    + G   FI    D 
Sbjct: 197 LKPGDWVAISGAAGGLGSLAVQYAAAMGL-RVIGIDGGEDKKKLFEKCGGEVFI----DF 251

Query: 250 KENETIVAKLIEMTDGGLDHTFDCTGNVNVMRSALEACHKGWGQSVIIGVAAAGQEISTR 309
            +++ IV  + E T GG     + + +   +  +++      G  V++G+ A     S  
Sbjct: 252 TKSKDIVKDIQEATHGGPHGVINVSVSDKAISQSVQYIRPT-GTVVVVGMPANAVVKSDV 310

Query: 310 PFQLVTGRVWKGSAFGGVKGRSEMAGLIEQYKKGELKVDEFITHRRSFNEINEAFDDLHN 369
             Q+V     KGS  G    R++    ++ + +G +K    +      +E+ + ++ +  
Sbjct: 311 FNQVVKSIQIKGSYVG---NRADTREALDFFTRGLVKSPIKVV---GLSELPKVYELMET 364

Query: 370 GLCL-RTVLSFSK 381
           G  L R V+  SK
Sbjct: 365 GKILGRYVVDTSK 377

>Smik_15.71 Chr15 complement(122645..123691) [1047 bp, 348 aa] {ON}
           YOL086C (REAL)
          Length = 348

 Score = 91.7 bits (226), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 98/359 (27%), Positives = 155/359 (43%), Gaps = 41/359 (11%)

Query: 13  VAYEAGKPQVVEQIVVDPPKAHEVRIKIVNTAVCHTDAYTLSGADP-EGLFPCVLGHEGA 71
           + YE+      + I V  PKA+E+ I +  + VCHTD +   G  P     P V GHEGA
Sbjct: 11  IFYESHGKLEYKDIPVPKPKANELLINVKYSGVCHTDLHAWHGDWPLPTKLPLVGGHEGA 70

Query: 72  GIVESVGDGVTNVKPGDHV-IALYTAECQKCKFCLSGKTNLCGAVRATQGKGVMPDGTSR 130
           G+V ++G+ V     GD+  I      C  C++C  G  + C     +   G   DG   
Sbjct: 71  GVVVAMGENVKGWNIGDYAGIKWLNGSCMACEYCELGNESNCPHADLS---GYTHDG--- 124

Query: 131 FHNKKGESLYHFMGCSTFSEYTVVADVSVVAIDQTAPLESVCLLGCGVTTGYGAAVKTAN 190
                           +F +Y     V    I Q   L  V  + C   T Y  A+K+AN
Sbjct: 125 ----------------SFQQYATADAVQAAHIPQGTDLAEVAPVLCAGITVY-KALKSAN 167

Query: 191 VQKGDTVAVFG-CGTVGLSVLQGAHQRGASRIIAIDTNDQKKDFCTQFGATDFINPTKDL 249
           +  G  VA+ G  G +G   +Q A   G  R++ ID  + K++     G   FI+ TK+ 
Sbjct: 168 LMAGHWVAISGAAGGLGSLAVQYAKAMG-YRVLGIDGGEGKEELFRSIGGEVFIDFTKE- 225

Query: 250 KENETIVAKLIEMTDGGLDHTFDCTGNVNVMRSALEACH---KGWGQSVIIGVAAAGQEI 306
              + IV  +++ TDGG         NV+V  +A+EA     +  G +V++G+ A  +  
Sbjct: 226 ---KDIVNAVLKATDGGAHGVI----NVSVSEAAIEASTRYVRANGTTVLVGMPANAKCS 278

Query: 307 STRPFQLVTGRVWKGSAFGGVKGRSEMAGLIEQYKKGELKVDEFITHRRSFNEINEAFD 365
           S    Q+V      GS  G    R++    ++ + +G +K    +    +  EI E  +
Sbjct: 279 SDVFNQVVKSISIVGSYVG---NRADTREALDFFARGLVKSPIKVVGLSTLPEIYEKME 334

>KLLA0F18260g Chr6 complement(1683417..1684463) [1047 bp, 348 aa]
           {ON} uniprot|P49383 Kluyveromyces lactis KLLA0F18260g
           ADH2 Alcohol dehydrogenase 2
          Length = 348

 Score = 91.3 bits (225), Expect = 8e-20,   Method: Compositional matrix adjust.
 Identities = 79/277 (28%), Positives = 123/277 (44%), Gaps = 37/277 (13%)

Query: 13  VAYEAGKPQVVEQIVVDPPKAHEVRIKIVNTAVCHTDAYTLSGADP-EGLFPCVLGHEGA 71
           + YE G     + I V  PKA+E+ I +  + VCHTD +   G  P     P V GHEGA
Sbjct: 11  IFYENGGELQYKDIPVPKPKANELLINVKYSGVCHTDLHAWKGDWPLPTKLPLVGGHEGA 70

Query: 72  GIVESVGDGVTNVKPGDHV-IALYTAECQKCKFC-LSGKTNLCGAVRATQGKGVMPDGTS 129
           G+V ++G+ V     GD   I      C  C++C LS ++N              PD   
Sbjct: 71  GVVVAMGENVKGWNIGDFAGIKWLNGSCMSCEYCELSNESNC-------------PDADL 117

Query: 130 RFHNKKGESLYHFMGCSTFSEYTVVADVSVVAIDQTAPLESVCLLGCGVTTGYGAAVKTA 189
             +   G          +F +Y     V    I +   L  V  + C   T Y  A+K+A
Sbjct: 118 SGYTHDG----------SFQQYATADAVQAARIPKGTDLAEVAPILCAGVTVY-KALKSA 166

Query: 190 NVQKGDTVAVFG-CGTVGLSVLQGAHQRGASRIIAIDTNDQKKDFCTQFGATDFINPTKD 248
           +++ GD VA+ G CG +G   +Q A   G  R++ IDT  +K     + G   F+    D
Sbjct: 167 DLKAGDWVAISGACGGLGSLAIQYAKAMG-YRVLGIDTGAEKAKLFKELGGEYFV----D 221

Query: 249 LKENETIVAKLIEMTDGGLDHTFDCTGNVNVMRSALE 285
              ++ ++ ++++ T+GG         NV+V   A+E
Sbjct: 222 YAVSKDLIKEIVDATNGGAHGVI----NVSVSEFAIE 254

>Suva_13.261 Chr13 (416378..417505) [1128 bp, 375 aa] {ON} YMR083W
           (REAL)
          Length = 375

 Score = 91.7 bits (226), Expect = 8e-20,   Method: Compositional matrix adjust.
 Identities = 101/376 (26%), Positives = 155/376 (41%), Gaps = 45/376 (11%)

Query: 13  VAYEAGKPQVVEQIVVDPPKAHEVRIKIVNTAVCHTDAYTLSGADPEGL-FPCVLGHEGA 71
           + YE       + I V  PK +E+ I +  + VCHTD +   G  P  +  P V GHEGA
Sbjct: 38  IFYENNGKLHYKDIPVPEPKPNEILINVKYSGVCHTDLHAWHGDWPLPVKLPLVGGHEGA 97

Query: 72  GIVESVGDGVTNVKPGDHV-IALYTAECQKCKFCLSGKTNLCGAVRATQGKGVMPDGTSR 130
           G+V  +G  V   K GD   I      C  C+FC SG  + C            PD    
Sbjct: 98  GVVVKLGSNVKGWKVGDLAGIKWLNGSCMTCEFCESGHESNC------------PDADLS 145

Query: 131 FHNKKGESLYHFMGCSTFSEYTVVADVSVVAIDQTAPLESVCLLGCGVTTGYGAAVKTAN 190
            +   G          +F ++     +    I Q   L  V  + C   T Y  A+K AN
Sbjct: 146 GYTHDG----------SFQQFATADAIQAAKIQQGTDLAEVAPILCAGVTVY-KALKEAN 194

Query: 191 VQKGDTVAVFG-CGTVGLSVLQGAHQRGASRIIAIDTNDQKKDFCTQFGATDFINPTKDL 249
           ++ GD VA+ G  G +G   +Q A   G  R++ ID   +K+    Q G   FI    D 
Sbjct: 195 LKAGDWVAISGAAGGLGSLAVQYATAMG-YRVLGIDAGAEKEKLFKQLGGEVFI----DF 249

Query: 250 KENETIVAKLIEMTDGGLDHTFDCTGNVNVMRSALEACH---KGWGQSVIIGVAAAGQEI 306
            + + +V+ + E T GG         NV+V  +A+       +  G  V++G+ A     
Sbjct: 250 TKTKDMVSDIQEATKGGPQGVI----NVSVSEAAISLSTEYVRPTGTVVLVGLPANAYVK 305

Query: 307 STRPFQLVTGRVWKGSAFGGVKGRSEMAGLIEQYKKGELKVDEFITHRRSFNEINEAFDD 366
           S     ++     KGS  G    R++    ++ + +G +K    I      +E+   +D 
Sbjct: 306 SEVFSHVIKSINIKGSYVG---NRADTREALDFFSRGLIKSPIKIV---GLSELPMVYDL 359

Query: 367 LHNGLCL-RTVLSFSK 381
           +  G  L R V+  SK
Sbjct: 360 MEKGKILGRYVVDTSK 375

>Suva_13.494 Chr13 complement(856051..857097) [1047 bp, 348 aa] {ON}
           YMR303C (REAL)
          Length = 348

 Score = 90.9 bits (224), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 87/298 (29%), Positives = 132/298 (44%), Gaps = 38/298 (12%)

Query: 13  VAYEAGKPQVVEQIVVDPPKAHEVRIKIVNTAVCHTDAYTLSGADPEGL-FPCVLGHEGA 71
           + YE+      + I V  PK +E+ I +  + VCHTD +   G  P     P V GHEGA
Sbjct: 11  IFYESNGKLEHKDIPVPTPKPNELLINVKYSGVCHTDLHAWHGDWPLATKLPLVGGHEGA 70

Query: 72  GIVESVGDGVTNVKPGDHV-IALYTAECQKCKFCLSGKTNLCGAVRATQGKGVMPDGTSR 130
           G+V ++G+ V   K GD   I    + C  C++C  G  + C     +   G   DG   
Sbjct: 71  GVVVAMGENVRGWKVGDLAGIKWLNSSCMACEYCELGNESNCPHADLS---GYTHDG--- 124

Query: 131 FHNKKGESLYHFMGCSTFSEYTVVADVSVVAIDQTAPLESVCLLGCGVTTGYGAAVKTAN 190
                           +F +Y     V    I +   L  V  + C   T Y  A+K+AN
Sbjct: 125 ----------------SFQQYATADAVQAAHIPEGTDLAEVAPILCAGITVY-KALKSAN 167

Query: 191 VQKGDTVAVFG-CGTVGLSVLQGAHQRGASRIIAIDTNDQKKDFCTQFGATDFINPTKDL 249
           ++ G  VA+ G  G +G   +Q A   G  R++ ID    K++  T  G   FI+ TK+ 
Sbjct: 168 LRAGHWVAISGAAGGLGSLAVQYAKAMG-YRVVGIDGGPGKEELFTSLGGEVFIDFTKE- 225

Query: 250 KENETIVAKLIEMTDGGLDHTFDCTGNVNVMRSALEACH---KGWGQSVIIGVAAAGQ 304
              + IV  +I+ TDGG         NV+V  +A+EA     +  G  V++G+ A  +
Sbjct: 226 ---KDIVGAVIKATDGGAHGIV----NVSVSEAAIEASTRYCRANGTVVLVGLPAGAK 276

>KLLA0F21010g Chr6 (1962951..1964003) [1053 bp, 350 aa] {ON}
           uniprot|P20369 Kluyveromyces lactis KLLA0F21010g ADH1
           Alcohol dehydrogenase 1
          Length = 350

 Score = 90.9 bits (224), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 104/377 (27%), Positives = 161/377 (42%), Gaps = 47/377 (12%)

Query: 13  VAYEAGKPQVVEQIVVDPPKAHEVRIKIVNTAVCHTDAYTLSGADP-EGLFPCVLGHEGA 71
           + YE G     + I V  PKA+E+ I +  + VCHTD +   G  P     P V GHEGA
Sbjct: 13  IFYENGGELQYKDIPVPKPKANELLINVKYSGVCHTDLHAWKGDWPLPTKLPLVGGHEGA 72

Query: 72  GIVESVGDGVTNVKPGDHV-IALYTAECQKCKFC-LSGKTNLCGAVRATQGKGVMPDGTS 129
           G+V ++G+ V   K GD   I      C  C++C LS ++N   A           D + 
Sbjct: 73  GVVVAMGENVKGWKIGDFAGIKWLNGSCMSCEYCELSNESNCPEA-----------DLSG 121

Query: 130 RFHNKKGESLYHFMGCSTFSEYTVVADVSVVAIDQTAPLESVCLLGCGVTTGYGAAVKTA 189
             H+             +F +Y     V    I     L  V  + C   T Y  A+K+A
Sbjct: 122 YTHD------------GSFQQYATADAVQAAKIPVGTDLAEVAPVLCAGVTVY-KALKSA 168

Query: 190 NVQKGDTVAVFG-CGTVGLSVLQGAHQRGASRIIAIDTNDQKKDFCTQFGATDFINPTKD 248
           N++ GD VA+ G  G +G   +Q A   G  R++ ID  ++K       G   FI+ TK 
Sbjct: 169 NLKAGDWVAISGAAGGLGSLAVQYAKAMG-YRVLGIDAGEEKAKLFKDLGGEYFIDFTK- 226

Query: 249 LKENETIVAKLIEMTDGGLDHTFDCTGNVNVMRSALEACH---KGWGQSVIIGVAAAGQE 305
              ++ I  ++IE T GG         NV+V   A+E      +  G  V++G+    + 
Sbjct: 227 ---SKNIPEEVIEATKGGAHGVI----NVSVSEFAIEQSTNYVRSNGTVVLVGLPRDAKC 279

Query: 306 ISTRPFQLVTGRVWKGSAFGGVKGRSEMAGLIEQYKKGELKVDEFITHRRSFNEINEAFD 365
            S    Q+V      GS  G    R++    I+ + +G +K      H    +E+   ++
Sbjct: 280 KSDVFNQVVKSISIVGSYVG---NRADTREAIDFFSRGLVKAP---IHVVGLSELPSIYE 333

Query: 366 DLHNGLCL-RTVLSFSK 381
            +  G  + R V+  SK
Sbjct: 334 KMEKGAIVGRYVVDTSK 350

>KLTH0E05588g Chr5 complement(494815..495861) [1047 bp, 348 aa] {ON}
           highly similar to uniprot|P00330 Saccharomyces
           cerevisiae YOL086C ADH1 Alcohol dehydrogenase involved
           in the production of certain carboxylate esters
          Length = 348

 Score = 90.9 bits (224), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 79/267 (29%), Positives = 123/267 (46%), Gaps = 37/267 (13%)

Query: 24  EQIVVDPPKAHEVRIKIVNTAVCHTDAYTLSGADPEGL-FPCVLGHEGAGIVESVGDGVT 82
           + I V  P A+E+ I +  + VCHTD +   G  P     P V GHEGAG+V  +G+ V 
Sbjct: 22  KDIPVPKPAANEILINVKYSGVCHTDLHAWKGDWPLATKLPLVGGHEGAGVVVGIGENVK 81

Query: 83  NVKPGDHV-IALYTAECQKCKFC-LSGKTNLCGAVRATQGKGVMPDGTSRFHNKKGESLY 140
             K GD   I      C  C+ C LS ++N   A           D +   H+       
Sbjct: 82  GWKLGDLAGIKWLNGSCMACESCELSNESNCPHA-----------DLSGYTHD------- 123

Query: 141 HFMGCSTFSEYTVVADVSVVAIDQTAPLESVCLLGCGVTTGYGAAVKTANVQKGDTVAVF 200
                 +F +Y     V    I +   L  V  + C   T Y  A+K+AN++ G+ VA+ 
Sbjct: 124 -----GSFQQYATADAVQAARIPEGTDLAEVAPILCAGITVY-KALKSANLRAGNWVAIS 177

Query: 201 G-CGTVGLSVLQGAHQRGASRIIAIDTNDQKKDFCTQFGATDFINPTKDLKENETIVAKL 259
           G  G +G   +Q A   G  R+I ID  D+K+    + G   F+    D ++++ +VA++
Sbjct: 178 GAAGGLGSLAVQYAKAMG-YRVIGIDGGDEKEQLFKKLGGEYFV----DFRKSKDVVAEI 232

Query: 260 IEMTDGGLDHTFDCTGNVNVMRSALEA 286
           +E+T GG         NV+V  +A+E+
Sbjct: 233 LEVTGGGAHGVV----NVSVSEAAIES 255

>CAGL0I07843g Chr9 complement(756345..757403) [1059 bp, 352 aa] {ON}
           highly similar to uniprot|P00330 Saccharomyces
           cerevisiae YOL086c ADH1 alcohol dehydrogenase I or
           uniprot|P00331 Saccharomyces cerevisiae YMR303c ADH2
          Length = 352

 Score = 90.5 bits (223), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 103/378 (27%), Positives = 162/378 (42%), Gaps = 49/378 (12%)

Query: 13  VAYEAGKPQVVEQIVVDPPKAHEVRIKIVNTAVCHTDAYTLSGADPEGL-FPCVLGHEGA 71
           + YE       + I V  PKA+E+ I +  + VCHTD +   G  P     P V GHEGA
Sbjct: 15  IFYENNGKLEYKDIPVPKPKANEILINVKYSGVCHTDLHAWHGDWPLATKLPLVGGHEGA 74

Query: 72  GIVESVGDGVTNVKPGDHV-IALYTAECQKCKFCLSGKTNLCGAVRATQGKGVMPDGTSR 130
           G+V  +G+ V   K GD+  I      C  C++C     + C            P+    
Sbjct: 75  GVVVGMGENVKGWKIGDYAGIKWLNGSCMACEYCEKSNESNC------------PEADLS 122

Query: 131 FHNKKGESLYHFMGCSTFSEYTVVADVSVVAIDQTAPLESVCLLGCGVTTGYGAAVKTAN 190
            +   G          +F +Y     V    I Q   L  V  + C   T Y  A+K+AN
Sbjct: 123 GYTHDG----------SFQQYATADYVQAARIPQGTDLAQVAPILCAGITVY-KALKSAN 171

Query: 191 VQKGDTVAVFG-CGTVGLSVLQGAHQRGASRIIAIDTNDQKKDFCTQFGATDFINPTKDL 249
           +  G+ VA+ G  G +G   +Q A   G  RI+ ID  D+KK    + G   F++ TK  
Sbjct: 172 LNAGEWVAISGAAGGLGSLAVQYAKAMG-YRILGIDGGDEKKALFHELGGEIFVDFTKSK 230

Query: 250 K-ENETIVAKLIEMTDGGLDHTFDCTGNVNVMRSALEACH---KGWGQSVIIGVAAAGQE 305
             E + +VA     T+GG         NV+V  +A+E+     +  G  V++G+ A  + 
Sbjct: 231 NVEQDILVA-----TNGGAHGVI----NVSVSEAAIESSTRYVRSNGTVVLVGLPANAK- 280

Query: 306 ISTRPFQLVTGRVWKGSAFGGVKG-RSEMAGLIEQYKKGELKVDEFITHRRSFNEINEAF 364
            S+  F  V   +   S  G   G R++    ++ + +G +K    I      +E+ E +
Sbjct: 281 CSSDVFNHVVKSI---SIVGSYVGNRADTREALDFFSRGLVKSPIKIA---GLSELPEIY 334

Query: 365 DDLHNGLCL-RTVLSFSK 381
           + +  G  + R V+  SK
Sbjct: 335 EKMEKGQIVGRYVVDTSK 352

>YMR083W Chr13 (434788..435915) [1128 bp, 375 aa] {ON}
           ADH3Mitochondrial alcohol dehydrogenase isozyme III;
           involved in the shuttling of mitochondrial NADH to the
           cytosol under anaerobic conditions and ethanol
           production
          Length = 375

 Score = 90.9 bits (224), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 99/365 (27%), Positives = 155/365 (42%), Gaps = 45/365 (12%)

Query: 24  EQIVVDPPKAHEVRIKIVNTAVCHTDAYTLSGADPEGL-FPCVLGHEGAGIVESVGDGVT 82
           + I V  PK +E+ I +  + VCHTD +   G  P  +  P V GHEGAG+V  +G  V 
Sbjct: 49  KDIPVPEPKPNEILINVKYSGVCHTDLHAWHGDWPLPVKLPLVGGHEGAGVVVKLGSNVK 108

Query: 83  NVKPGDHV-IALYTAECQKCKFCLSGKTNLCGAVRATQGKGVMPDGTSRFHNKKGESLYH 141
             K GD   I      C  C+FC SG  + C            PD     +   G     
Sbjct: 109 GWKVGDLAGIKWLNGSCMTCEFCESGHESNC------------PDADLSGYTHDG----- 151

Query: 142 FMGCSTFSEYTVVADVSVVAIDQTAPLESVCLLGCGVTTGYGAAVKTANVQKGDTVAVFG 201
                +F ++     +    I Q   L  V  + C   T Y  A+K A+++ GD VA+ G
Sbjct: 152 -----SFQQFATADAIQAAKIQQGTDLAEVAPILCAGVTVY-KALKEADLKAGDWVAISG 205

Query: 202 -CGTVGLSVLQGAHQRGASRIIAIDTNDQKKDFCTQFGATDFINPTKDLKENETIVAKLI 260
             G +G   +Q A   G  R++ ID  ++K+    + G   FI+ TK     + +V+ + 
Sbjct: 206 AAGGLGSLAVQYATAMG-YRVLGIDAGEEKEKLFKKLGGEVFIDFTK----TKNMVSDIQ 260

Query: 261 EMTDGGLDHTFDCTGNVNVMRSALEACH---KGWGQSVIIGVAAAGQEISTRPFQLVTGR 317
           E T GG         NV+V  +A+       +  G  V++G+ A     S     +V   
Sbjct: 261 EATKGGPHGVI----NVSVSEAAISLSTEYVRPCGTVVLVGLPANAYVKSEVFSHVVKSI 316

Query: 318 VWKGSAFGGVKGRSEMAGLIEQYKKGELKVDEFITHRRSFNEINEAFDDLHNGLCL-RTV 376
             KGS  G    R++    ++ + +G +K    I      +E+ + +D +  G  L R V
Sbjct: 317 NIKGSYVG---NRADTREALDFFSRGLIKSPIKIV---GLSELPKVYDLMEKGKILGRYV 370

Query: 377 LSFSK 381
           +  SK
Sbjct: 371 VDTSK 375

>AAR084W Chr1 (494021..495178) [1158 bp, 385 aa] {ON} Non-syntenic
           homolog of Saccharomyces cerevisiae YMR303C (ADH2)
          Length = 385

 Score = 90.9 bits (224), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 77/272 (28%), Positives = 120/272 (44%), Gaps = 35/272 (12%)

Query: 18  GKPQVVEQIVVDPPKAHEVRIKIVNTAVCHTDAYTLSGADP-EGLFPCVLGHEGAGIVES 76
           G P    +I V  PK  E+ I +  + VCHTD +   G  P     P V GHEGAG+V +
Sbjct: 53  GGPLEYREIEVPEPKPTELLINVKYSGVCHTDLHAWKGDWPLPTKLPLVGGHEGAGVVVA 112

Query: 77  VGDGVTNVKPGDHV-IALYTAECQKCKFCLSGKTNLCGAVRATQGKGVMPDGTSRFHNKK 135
           +G+ V   + GD   I      C  C+ C  G  + C            P+     +   
Sbjct: 113 MGENVRGWQVGDLAGIKWLNGSCMSCEACEQGHESNC------------PEADLSGYTHD 160

Query: 136 GESLYHFMGCSTFSEYTVVADVSVVAIDQTAPLESVCLLGCGVTTGYGAAVKTANVQKGD 195
           G          +F +Y     V    I     L  V  + C   T Y  A+K+AN++ G+
Sbjct: 161 G----------SFQQYATADAVQAAHIPAGTDLAQVAPILCAGITVY-KALKSANLRAGN 209

Query: 196 TVAVFG-CGTVGLSVLQGAHQRGASRIIAIDTNDQKKDFCTQFGATDFINPTKDLKENET 254
            VA+ G CG +G   +Q A   G  R++ ID  D+K+    + G   F+    D ++++ 
Sbjct: 210 WVAISGACGGLGSLAIQYARAMG-YRVLEIDGGDEKEALFRKLGGEVFV----DFRKSKD 264

Query: 255 IVAKLIEMTDGGLDHTFDCTGNVNVMRSALEA 286
           +VA +++ T GG         NV+V  +A+E+
Sbjct: 265 VVADVVKATGGGAHGVI----NVSVSEAAIES 292

>Smik_13.266 Chr13 (418869..419996) [1128 bp, 375 aa] {ON} YMR083W
           (REAL)
          Length = 375

 Score = 90.1 bits (222), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 99/365 (27%), Positives = 155/365 (42%), Gaps = 45/365 (12%)

Query: 24  EQIVVDPPKAHEVRIKIVNTAVCHTDAYTLSGADPEGL-FPCVLGHEGAGIVESVGDGVT 82
           + I V  PK +E+ I +  + VCHTD +   G  P  +  P V GHEGAG+V  +G  V 
Sbjct: 49  KDIPVPEPKPNEILINVKYSGVCHTDLHAWHGDWPLPVKLPLVGGHEGAGVVVKLGSNVK 108

Query: 83  NVKPGDHV-IALYTAECQKCKFCLSGKTNLCGAVRATQGKGVMPDGTSRFHNKKGESLYH 141
             K GD   I      C  C+FC SG  + C            PD     +   G     
Sbjct: 109 GWKIGDLAGIKWLNGSCMTCEFCESGHESNC------------PDADLSGYTHDG----- 151

Query: 142 FMGCSTFSEYTVVADVSVVAIDQTAPLESVCLLGCGVTTGYGAAVKTANVQKGDTVAVFG 201
                +F ++     +    I Q   L  V  + C   T Y  A+K A+++ GD VA+ G
Sbjct: 152 -----SFQQFATADAIQAAKIQQGTDLAEVAPILCAGVTVY-KALKEADLKAGDWVAISG 205

Query: 202 -CGTVGLSVLQGAHQRGASRIIAIDTNDQKKDFCTQFGATDFINPTKDLKENETIVAKLI 260
             G +G   +Q A   G  R++ ID  ++K+    + G   FI+ TK     + +V+ + 
Sbjct: 206 AAGGLGSLAVQYATAMG-YRVLGIDAGEEKEKLFKKLGGEVFIDFTK----TKDMVSDIQ 260

Query: 261 EMTDGGLDHTFDCTGNVNVMRSALEACH---KGWGQSVIIGVAAAGQEISTRPFQLVTGR 317
           E T GG         NV+V  +A+       +  G  V++G+ A     S     +V   
Sbjct: 261 EATKGGPHGVI----NVSVSEAAISLSTEYVRPTGTVVLVGLPANAYVKSEVFSHVVKSI 316

Query: 318 VWKGSAFGGVKGRSEMAGLIEQYKKGELKVDEFITHRRSFNEINEAFDDLHNGLCL-RTV 376
             KGS  G    R++    ++ + +G +K    I      +E+ + +D +  G  L R V
Sbjct: 317 NIKGSYVG---NRADTREALDFFSRGLIKSPIKIV---GLSELPKVYDLMEKGKILGRYV 370

Query: 377 LSFSK 381
           +  SK
Sbjct: 371 VDTSK 375

>Suva_15.81 Chr15 complement(132739..133785) [1047 bp, 348 aa] {ON}
           YOL086C (REAL)
          Length = 348

 Score = 89.0 bits (219), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 96/359 (26%), Positives = 151/359 (42%), Gaps = 41/359 (11%)

Query: 13  VAYEAGKPQVVEQIVVDPPKAHEVRIKIVNTAVCHTDAYTLSGADPEGL-FPCVLGHEGA 71
           + YE+      + I V  PKA+E+ I +  + VCHTD +   G  P  +  P V GHEGA
Sbjct: 11  IFYESHGKLEYKDIPVPTPKANELLINVKYSGVCHTDLHAWHGDWPLPVKLPLVGGHEGA 70

Query: 72  GIVESVGDGVTNVKPGDHV-IALYTAECQKCKFCLSGKTNLCGAVRATQGKGVMPDGTSR 130
           G+V ++G+ V     GD   I      C  C++C  G  + C     +   G   DG   
Sbjct: 71  GVVVAMGENVKGWNIGDFAGIKWLNGSCMACEYCELGNESNCPHADLS---GYTHDG--- 124

Query: 131 FHNKKGESLYHFMGCSTFSEYTVVADVSVVAIDQTAPLESVCLLGCGVTTGYGAAVKTAN 190
                           +F +Y     V    I +   L     + C   T Y  A+K+AN
Sbjct: 125 ----------------SFQQYATADSVQAAHIPKGTDLAECAPVLCAGITVY-KALKSAN 167

Query: 191 VQKGDTVAVFG-CGTVGLSVLQGAHQRGASRIIAIDTNDQKKDFCTQFGATDFINPTKDL 249
           +  G  VA+ G  G +G   +Q A   G  R++ ID  + K++     G   FI    D 
Sbjct: 168 LSAGQWVAISGAAGGLGSLAVQYAKAMG-YRVVGIDGGEGKEELFRSIGGEVFI----DF 222

Query: 250 KENETIVAKLIEMTDGGLDHTFDCTGNVNVMRSALEACH---KGWGQSVIIGVAAAGQEI 306
              + IV  +I+ TDGG         NV+V  +A+EA     +  G +V++G+ A  +  
Sbjct: 223 TTEKDIVGAVIKATDGGAHGII----NVSVSEAAIEASTRYCRANGTTVLVGMPAGAKCC 278

Query: 307 STRPFQLVTGRVWKGSAFGGVKGRSEMAGLIEQYKKGELKVDEFITHRRSFNEINEAFD 365
           S    Q+V      GS  G    R++    ++ + +G +K    +    +  EI E  +
Sbjct: 279 SDVFNQVVKSISIVGSYVG---NRADTREALDFFARGLVKSPIKVVGLSTLPEIYEKME 334

>Kwal_26.7799 s26 complement(515580..516743) [1164 bp, 387 aa] {ON}
           YMR083W (ADH3) - 1:1 [contig 55] FULL
          Length = 387

 Score = 89.4 bits (220), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 103/383 (26%), Positives = 157/383 (40%), Gaps = 45/383 (11%)

Query: 6   PIECLAAVAYEAGKPQVVEQIVVDPPKAHEVRIKIVNTAVCHTDAYTLSGADPEGL-FPC 64
           P      + YE G     + + V  PK +E+ I +  + VCHTD +   G  P  +  P 
Sbjct: 43  PTTQKGVIFYEHGGELQYKDLPVPKPKPNEILINVKYSGVCHTDLHAWKGDWPLDVKLPL 102

Query: 65  VLGHEGAGIVESVGDGVTNVKPGDHV-IALYTAECQKCKFCLSGKTNLCGAVRATQGKGV 123
           V GHEGAG+V + G+ VTN + GD   I      C  C+ C  G    C     +   G 
Sbjct: 103 VGGHEGAGVVVAKGENVTNFEIGDLAGIKWLNGSCMSCELCEQGHEPNCEHADLS---GY 159

Query: 124 MPDGTSRFHNKKGESLYHFMGCSTFSEYTVVADVSVVAIDQTAPLESVCLLGCGVTTGYG 183
             DG                   +F +Y     V    + +   L  V  + C   T Y 
Sbjct: 160 THDG-------------------SFQQYATADAVQAAQLPKGINLAEVAPILCAGVTVY- 199

Query: 184 AAVKTANVQKGDTVAVFG-CGTVGLSVLQGAHQRGASRIIAIDTNDQKKDFCTQFGATDF 242
            A+KTA++  G  VA+ G  G +G   +Q A   G  R++ ID  D+KK+   + G   F
Sbjct: 200 KALKTADLIPGQWVAISGAAGGLGSLAVQYAKAMGL-RVLGIDGGDEKKELFHKLGGEIF 258

Query: 243 INPTKDLKENETIVAKLIEMTDGGLDHTFDCTGNVNVMRSALEACH---KGWGQSVIIGV 299
           I    D    + +V  + E T GG         NV+V  +A+       +  G  V++G+
Sbjct: 259 I----DYTTTKDMVGAIQEATQGGPQGVI----NVSVSEAAISLSTQYVRPTGSVVLVGL 310

Query: 300 AAAGQEISTRPFQLVTGRVWKGSAFGGVKGRSEMAGLIEQYKKGELKVDEFITHRRSFNE 359
            A     S     +V     KGS  G    R++    I+ + +G +K    I      +E
Sbjct: 311 PANAYVKSEVFSHVVKSISIKGSYVG---NRADTREAIDFFNRGLIKAPIKII---GLSE 364

Query: 360 INEAFDDLHNGLCL-RTVLSFSK 381
           + +A+  +  G  L R V+  SK
Sbjct: 365 LPQAYKMMEAGKILGRYVVDTSK 387

>KNAG0K01040 Chr11 complement(204636..205811) [1176 bp, 391 aa] {ON}
           
          Length = 391

 Score = 89.4 bits (220), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 69/266 (25%), Positives = 110/266 (41%), Gaps = 39/266 (14%)

Query: 62  FPCVLGHEGAGIVESVGDGVTNVKPGDHVIALYTAEC--------------QKCKFCLSG 107
            P  +GHE AGIV  VG GVT  K GDHV    T  C              +KC  C  G
Sbjct: 67  LPQAMGHEMAGIVREVGSGVTQFKVGDHVSVEPTGTCRDRYRWPEAPGVNKEKCAACKRG 126

Query: 108 KTNLCGAVRATQGKGVMPDGTSRFHNKKGESLYHFMGCSTFSEYTVVADVSVVAIDQTAP 167
             N+C  +    G GV   G                    F+E  V+ +     +    P
Sbjct: 127 MYNVCSHL-GLIGNGVQSGG--------------------FAERVVINESHCYKLPNHIP 165

Query: 168 LESVCLLGCGVTTGYGAAVKTANVQKGDTVAVFGCGTVGLSVLQGAHQRGASRIIAIDTN 227
           +E V L+     + +  AV+ +  + G +V + G G +GLS +   +  G + I+  +  
Sbjct: 166 MEVVALVQPIAVSWH--AVRVSKFKPGSSVLILGGGPIGLSTILALNGHGCTEIVVSEPA 223

Query: 228 DQKKDFCTQFGATDFINPTKDLKENETIVAKLIEMTDGGLDHTFDCTGNVNVMRSALEAC 287
             ++D   + GA  + +P +   E      + +     G D+ FDC+G    +RS++E C
Sbjct: 224 KIRRDLAEKMGAVVY-DPMQHSYEENIKYLRALAPDKDGFDYCFDCSGTPATLRSSIE-C 281

Query: 288 HKGWGQSVIIGVAAAGQEISTRPFQL 313
               G +V + + A G+ I   P  +
Sbjct: 282 LTFRGTAVNVAMWATGKPIDFFPMDI 307

>Skud_13.240 Chr13 (408909..410036) [1128 bp, 375 aa] {ON} YMR083W
           (REAL)
          Length = 375

 Score = 89.0 bits (219), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 99/376 (26%), Positives = 156/376 (41%), Gaps = 45/376 (11%)

Query: 13  VAYEAGKPQVVEQIVVDPPKAHEVRIKIVNTAVCHTDAYTLSGADPEGL-FPCVLGHEGA 71
           + YE       + I V  PK +E+ I +  + VCHTD +   G  P  +  P V GHEGA
Sbjct: 38  IFYENNGKLHYKDIPVPQPKPNEILINVKYSGVCHTDLHAWHGDWPLAVKLPLVGGHEGA 97

Query: 72  GIVESVGDGVTNVKPGDHV-IALYTAECQKCKFCLSGKTNLCGAVRATQGKGVMPDGTSR 130
           G+V  +G  V   K GD   I      C  C+FC SG  + C            P+    
Sbjct: 98  GVVVKLGSNVKGWKVGDLAGIKWLNGSCMTCEFCESGHESNC------------PEADLS 145

Query: 131 FHNKKGESLYHFMGCSTFSEYTVVADVSVVAIDQTAPLESVCLLGCGVTTGYGAAVKTAN 190
            +   G          +F ++     +    I     L  V  + C   T Y  A+K AN
Sbjct: 146 GYTHDG----------SFQQFATADAIQAAKIQPGTDLAEVAPILCAGVTVY-KALKEAN 194

Query: 191 VQKGDTVAVFG-CGTVGLSVLQGAHQRGASRIIAIDTNDQKKDFCTQFGATDFINPTKDL 249
           ++ GD VA+ G  G +G   +Q A   G  R++ ID  ++K+    Q G   FI    D 
Sbjct: 195 LKAGDWVAISGAAGGLGSLAVQYATAMG-YRVLGIDAGEEKEKLFKQLGGEVFI----DF 249

Query: 250 KENETIVAKLIEMTDGGLDHTFDCTGNVNVMRSALEACH---KGWGQSVIIGVAAAGQEI 306
            + + +V+ + E T GG         NV+V  +A+       +  G  V++G+ A     
Sbjct: 250 TKTKDMVSDIQEATKGGPHGVI----NVSVSEAAISLSTEYVRPTGTVVLVGLPANSYVK 305

Query: 307 STRPFQLVTGRVWKGSAFGGVKGRSEMAGLIEQYKKGELKVDEFITHRRSFNEINEAFDD 366
           S     +V     KGS  G    R++    ++ + +G +K    I      +E+ + +D 
Sbjct: 306 SEVFSHVVKSINIKGSYVG---NRADTREALDFFTRGLIKSPIKIV---GLSELPKVYDL 359

Query: 367 LHNGLCL-RTVLSFSK 381
           +  G  L R V+  +K
Sbjct: 360 MEQGKILGRYVVDTNK 375

>NDAI0H02160 Chr8 (528551..529696) [1146 bp, 381 aa] {ON} Anc_2.480
          Length = 381

 Score = 89.0 bits (219), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 104/378 (27%), Positives = 157/378 (41%), Gaps = 45/378 (11%)

Query: 11  AAVAYEAGKPQVVEQIVVDPPKAHEVRIKIVNTAVCHTDAYTLSGADP-EGLFPCVLGHE 69
           A V YE G P   + I V  PKA+E+ I +  + VCHTD +   G  P     P V GHE
Sbjct: 42  AVVFYENGGPLHYKDIPVPKPKANEILINVKYSGVCHTDLHAWKGDWPLPTKLPLVGGHE 101

Query: 70  GAGIVESVGDGVTNVKPGDHV-IALYTAECQKCKFCLSGKTNLCGAVRATQGKGVMPDGT 128
           G+G+V  VG+ V   K GD   I      C  C+ C +G  + C     +   G   DG 
Sbjct: 102 GSGVVMQVGENVKGWKVGDLAGIKWLNGSCMACELCETGNESNCEHADLS---GYTHDG- 157

Query: 129 SRFHNKKGESLYHFMGCSTFSEYTVVADVSVVAIDQTAPLESVCLLGCGVTTGYGAAVKT 188
                             +F +Y     V    I +   L  V  + C   T Y  A+K 
Sbjct: 158 ------------------SFQQYATADAVQAARIPEGTNLAEVAPILCAGITVY-KALKE 198

Query: 189 ANVQKGDTVAVFG-CGTVGLSVLQGAHQRGASRIIAIDTNDQKKDFCTQFGATDFINPTK 247
           A+++ G  V + G  G +G   +Q A   G  R+I ID    K++     G   FI+ TK
Sbjct: 199 ADLKAGQWVCISGAAGGLGSLAVQYAKAMG-YRVIGIDGGKAKEELFKSMGGEVFIDFTK 257

Query: 248 DLKENETIVAKLIEMTDGGLDHTFDCTGNVNVMRSALEACH---KGWGQSVIIGVAAAGQ 304
               ++ +V  + E T GG         NV+V  +A+       +  G  V++G+ A   
Sbjct: 258 ----SKDMVKDIQEATKGGPQGVI----NVSVSEAAISLSTQYVRPTGTVVLVGLPAHAY 309

Query: 305 EISTRPFQLVTGRVWKGSAFGGVKGRSEMAGLIEQYKKGELKVDEFITHRRSFNEINEAF 364
             S     +V     KGS  G    R++    ++ + +G +K    I      +E+ + +
Sbjct: 310 VKSEVFSHVVKSINIKGSYVG---NRADTREALDFFARGLIKSPIKIV---GLSELPKVY 363

Query: 365 DDLHNGLCL-RTVLSFSK 381
           D +  G  L R V+  SK
Sbjct: 364 DLMEKGQILGRYVVDTSK 381

>TDEL0C00390 Chr3 (53995..55056) [1062 bp, 353 aa] {ON} Anc_8.16
           YLR070C
          Length = 353

 Score = 88.6 bits (218), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 98/347 (28%), Positives = 146/347 (42%), Gaps = 49/347 (14%)

Query: 34  HEVRIKIVNTAVCHTDAYTLSGADPEGLF----PCVLGHEGAGIVESVGDGVTNVKPGDH 89
           H+V+I+I  T +C +D +  +     G F    P VLGHE AG+V  VGD V++VK GD 
Sbjct: 29  HDVKIQIKATGICGSDVHYFTQGS-IGDFVVKSPLVLGHESAGVVVEVGDAVSSVKVGDR 87

Query: 90  VIALYTAECQKCKFCLSGKTNLCG--AVRATQGKGVMPDGT-SRFHNKKGESLYHFMGCS 146
           V        +  K  +SG  NLC   A  AT       DGT  +++    + +Y      
Sbjct: 88  VAVEPGVPSRYSKETMSGHYNLCPHMAFAATPPY----DGTLVKYYLSPEDFVYKLADHI 143

Query: 147 TFSEYTVVADVSVVAIDQTAPLESVCLLGCGVTTGYGAAVKTANVQKGDTVAVFGCGTVG 206
           +F E  VV  +SV                         A + AN   G  V V G G VG
Sbjct: 144 SFEEGAVVEPLSVAV----------------------HANRLANTAFGQAVLVLGAGPVG 181

Query: 207 LSVLQGAHQRGASRIIAIDTNDQKKDFCTQFGATDFINPTKDLKENETIVAKLIEMTDGG 266
           L     A   GA+ ++ +D  + K +   QFGAT  +    D  EN+ +   L+  + GG
Sbjct: 182 LLAGAVAKAFGATDVVFVDIFESKLEKAKQFGATRTVLFKPDSDENDLV--SLVTKSLGG 239

Query: 267 L--DHTFDCTGNVNVMRSALEACHKGWGQSVIIGVAAAGQEISTRPFQLVTGRVWKGSAF 324
           L  D  F+C+G    +R+A+++  +G G  V +G+           F        K + F
Sbjct: 240 LHPDVVFECSGAEKCIRAAVKSVKRG-GTFVQVGMGKDNINFPINEFS------QKEATF 292

Query: 325 GGVKGRSE--MAGLIEQYKKGELKVDEFITHRRSFNEINEAFDDLHN 369
            G     E      ++    G++ V   IT    F +  EA+   HN
Sbjct: 293 KGCFRYYEGDFDDAVKLLSTGKVNVKPLITKVFPFEQAVEAYK--HN 337

>ZYRO0G03388g Chr7 complement(265952..267064) [1113 bp, 370 aa] {ON}
           similar to uniprot|P07246 Saccharomyces cerevisiae
           YMR083W
          Length = 370

 Score = 88.6 bits (218), Expect = 8e-19,   Method: Compositional matrix adjust.
 Identities = 95/373 (25%), Positives = 157/373 (42%), Gaps = 39/373 (10%)

Query: 13  VAYEAGKPQVVEQIVVDPPKAHEVRIKIVNTAVCHTDAYTLSGADP-EGLFPCVLGHEGA 71
           + YE+G     + + V  P+ +E+ + +  + VCHTD +   G  P +   P V GHEGA
Sbjct: 33  IFYESGGKLHYKDLAVPKPRNNEILVNVKYSGVCHTDLHAWKGDWPLDTKLPLVGGHEGA 92

Query: 72  GIVESVGDGVTNVKPGDHV-IALYTAECQKCKFCLSGKTNLCGAVRATQGKGVMPDGTSR 130
           G+V + G+ V N + GD   I      CQ C+ C  G  + C     +   G   DG   
Sbjct: 93  GVVVAKGENVKNFEIGDLAGIKWLNGSCQSCEMCEMGHESNCAHADLS---GYTHDG--- 146

Query: 131 FHNKKGESLYHFMGCSTFSEYTVVADVSVVAIDQTAPLESVCLLGCGVTTGYGAAVKTAN 190
                           TF +Y     +    I +   L  V  + C   T Y  A++++ 
Sbjct: 147 ----------------TFQQYATADAIQAAHIPKGTDLAGVAPILCAGVTVY-KALRSSG 189

Query: 191 VQKGDTVAVFG-CGTVGLSVLQGAHQRGASRIIAIDTNDQKKDFCTQFGATDFINPTKDL 249
            + G+ VA+ G  G +G    Q A   G  R++ ID  + K       G   FI+ TK+ 
Sbjct: 190 ARPGEWVAISGAAGGLGSLATQYARAMGL-RVVGIDGGEDKAKLFKSLGGEIFIDFTKE- 247

Query: 250 KENETIVAKLIEMTDGGLDHTFDCTGNVNVMRSALEACHKGWGQSVIIGVAAAGQEISTR 309
              + I A ++E T GG     + + +   M  ++E   +  G  V++G+ A     S  
Sbjct: 248 ---KDIPAAILEATQGGAHGVINVSVSEKAMSQSVEYV-RPQGTVVLVGLPANAVIKSNV 303

Query: 310 PFQLVTGRVWKGSAFGGVKGRSEMAGLIEQYKKGELKVDEFITHRRSFNEINEAFDDLHN 369
              +V     KGS  G    R++    +E + +G +K    I      +E+ + ++ +  
Sbjct: 304 FNHVVKSFSIKGSYVG---NRADSREAVEFFSRGLVKSPIKIV---GLSELPKIYELMEA 357

Query: 370 GLCL-RTVLSFSK 381
           G  L R V+  SK
Sbjct: 358 GKILGRYVVDTSK 370

>CAGL0D00198g Chr4 (27559..28710) [1152 bp, 383 aa] {ON} similar to
           uniprot|P39714 Saccharomyces cerevisiae YAL060w FUN49 or
           uniprot|P39713 Saccharomyces cerevisiae YAL061w FUN50
          Length = 383

 Score = 88.6 bits (218), Expect = 8e-19,   Method: Compositional matrix adjust.
 Identities = 96/379 (25%), Positives = 154/379 (40%), Gaps = 73/379 (19%)

Query: 28  VDPPKA---HEVRIKIVNTAVCHTD----------------AYTLSGADPEGLFPCVLGH 68
           +D PK    HE+ I +    +C TD                 + LSG D     P  +GH
Sbjct: 18  IDTPKINNDHELMIDVAWCGICGTDLHEFLEGPIFMPKDGDTHYLSGLD----LPLPMGH 73

Query: 69  EGAGIVESVGDGVTNVKPGDHVIALYTAEC--------------QKCKFCLSGKTNLCGA 114
           E +GIV+ VG GVT  KPGD V+   T  C              + C  C  G  N C  
Sbjct: 74  EMSGIVKEVGKGVTRFKPGDRVVIEATTSCGDTHRWPKSKVAKGELCPACEMGLPNCC-T 132

Query: 115 VRATQGKGVMPDGTSRFHNKKGESLYHFMGCSTFSEYTVVADVSVVAIDQTAPLESVCLL 174
             + QG G +  G                    F+E  VV +  VV I    PL+   L+
Sbjct: 133 HGSFQGLGSVGGG--------------------FAEQVVVGEKHVVKIPDKLPLDVAALV 172

Query: 175 GCGVTTGYGAAVKTANVQKGDTVAVFGCGTVGLSVLQGAHQRGASRIIAIDTNDQKKDFC 234
              ++  + AA + A  ++G    V G G +GL+++       A +I+  +    +++  
Sbjct: 173 E-PLSVAWHAA-RLAEFKEGSNALVLGSGPIGLAMILALKGMKAGKIVVSEPAKLRRELA 230

Query: 235 TQFGATDFINPTKDLKENETIVAKLIEMTDGGLDHTFDCTGNVNVMRSALE-ACHKGWGQ 293
            +     F NPT    +N     K +   D G D+TFDC+G  +   +A++ AC +G   
Sbjct: 231 EKLNVVVF-NPTHTRAQNAIEKLKELSPKDHGFDYTFDCSGVQDTFNAAVKAACIQGH-- 287

Query: 294 SVIIGVAAAG-QEISTRPFQLVTGRVWKGSAFGGVKGRSEMAGLIEQYKKGELKVDE--- 349
             I+ VA  G + ++  P  +  G        G V    +   +++   KG + ++E   
Sbjct: 288 --IVNVAIWGPKPVAFHPMDMTYGEKKLTGTMGYV--TRDFEEVVDAIDKGYISIEECKL 343

Query: 350 FITHRRSFNE-INEAFDDL 367
            IT R    + + + F +L
Sbjct: 344 LITGRVKLEDGMEKGFHEL 362

>Suva_10.154 Chr10 complement(275737..276807) [1071 bp, 356 aa] {ON}
           YLR070C (REAL)
          Length = 356

 Score = 88.2 bits (217), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 96/358 (26%), Positives = 159/358 (44%), Gaps = 60/358 (16%)

Query: 28  VDPPK---AHEVRIKIVNTAVCHTDAYTLSGADPEGLF---PCVLGHEGAGIVESVGDGV 81
           V+ PK   A++V ++I  T +C +D +  +           P VLGHE +G+V  +GD V
Sbjct: 23  VNIPKISDANDVIVQIKATGICGSDIHYYTHGRISHFVVKSPMVLGHESSGVVVLIGDNV 82

Query: 82  TNVKPGDHVIAL-------YTAECQKCKFCLSGKTNLCGAVRATQGKGVMPDGT-SRFHN 133
             +K GD V AL       +++E ++ ++ L                    DGT ++++ 
Sbjct: 83  KTLKVGDRV-ALEPGFPNRFSSELKEGRYNLDPDLKFAATPPY--------DGTLTKYYR 133

Query: 134 KKGESLYHFMGCSTFSEYTVVADVSVVAIDQTAPLESVCLLGCGVTTGYGAAVKTANVQK 193
              + +Y      +F E  ++  +SV                         A + A ++ 
Sbjct: 134 APKDFVYKIPDHVSFEEGALMEPLSVAV----------------------HANRLAKMRF 171

Query: 194 GDTVAVFGCGTVGLSVLQGAHQRGASRIIAIDTNDQKKDFCTQFGATDFINPTKDLKEN- 252
           G    VFG G VGL   + A   GA+ ++ +D ++ K +   QFGAT  +N + DL +  
Sbjct: 172 GARCVVFGAGPVGLLTGKVASVFGATDVVFVDLSETKLERAKQFGATHMVN-SGDLPQGV 230

Query: 253 --ETIVAKLIEMTDGGLDHTFDCTGNVNVMRSALEACHKGWGQSVIIGVAAAGQEISTRP 310
             ET++ K I     G D  F+C+G    +R+ +E C  G G  V +G+   GQE    P
Sbjct: 231 SAETVIRKAI--GKKGADVVFECSGAQPCIRTGIEVCKAG-GTYVQVGM---GQEEIQFP 284

Query: 311 FQLVTGR--VWKGSAFGGVKGRSEMAGLIEQYKKGELKVDEFITHRRSFNEINEAFDD 366
              +  +   ++GS F   +G  + +  IE    G+L +   IT R  F E  EAFD+
Sbjct: 285 ISKIPAKEITFQGS-FRYCQG--DYSDSIELVSSGKLSLKPLITRRYQFKEAIEAFDE 339

>Suva_12.260 Chr12 (427406..428479) [1074 bp, 357 aa] {ON} YJR159W
           (REAL)
          Length = 357

 Score = 86.7 bits (213), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 107/375 (28%), Positives = 155/375 (41%), Gaps = 56/375 (14%)

Query: 22  VVEQ----IVVDPPKAHEVRIKIVNTAVCHTDA-YTLSGADPEGLF--PCVLGHEGAGIV 74
           VVEQ    I+ DP   H V+I I  T +C +D  Y  SG   + +   P VLGHE +G V
Sbjct: 18  VVEQRPVPIIEDP---HYVKIAIKATGICGSDIHYYRSGGIGKYILKAPMVLGHESSGQV 74

Query: 75  ESVGDGVTNVKPGDHVIALYTAECQKCKFCLSGKTNLCGAVRATQGKGVMPDGTSRFHNK 134
             VG  VT VK GD V        +       G+ NLC  +       +  DGT      
Sbjct: 75  VEVGSAVTRVKVGDRVAIEPGVPSRYSDETKEGRYNLCPHMAFAATPPI--DGT------ 126

Query: 135 KGESLYHFMGCSTFSEYTVVADVSVVAIDQTAPLESVCL--LGCGVTTGYGAAVKTANVQ 192
                           Y    D  V   +  +  E  C+  L  GV +      K A V+
Sbjct: 127 ------------LVKYYLSPEDFLVKLPEGVSYEEGACVEPLSVGVHSN-----KLAGVR 169

Query: 193 KGDTVAVFGCGTVGLSVLQGAHQRGASRIIAIDTNDQKKDFCTQFGATDFINPTKDLKEN 252
            G  V VFG G VGL     A   GAS ++ ID  D K D   +FGAT   N +K   + 
Sbjct: 170 FGSRVVVFGAGPVGLLTGAVARAFGASDVVFIDVFDNKLDRAKEFGATHTFNSSKFPADK 229

Query: 253 ETIVAKLIEMTDGG--LDHTFDCTGNVNVMRSALEACHKGWGQSVIIGVAAAGQEISTRP 310
              +A  +E    G   D  F+C+G    + + ++    G G  V IG+   G+  +  P
Sbjct: 230 TQELADEVEKLLSGHHADIVFECSGADACIDAGVKITKVG-GTMVQIGM---GKNYTNFP 285

Query: 311 FQLVTGRVWK-----GSAFGGVKGRSEMAGLIEQYKKGELKVDEFITHRRSFNEINEAFD 365
              V+G+  K       +FG  +   ++         G++ V   ITHR  F +  +A+D
Sbjct: 286 IAEVSGKEMKLIGCFRYSFGDYRDAVKLVA------SGKVNVKAMITHRFKFEDAAKAYD 339

Query: 366 --DLHNGLCLRTVLS 378
               H G  ++T+++
Sbjct: 340 FNIAHGGEVVKTIIA 354

>Skud_15.68 Chr15 complement(118795..119841) [1047 bp, 348 aa] {ON}
           YOL086C (REAL)
          Length = 348

 Score = 86.7 bits (213), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 95/359 (26%), Positives = 153/359 (42%), Gaps = 41/359 (11%)

Query: 13  VAYEAGKPQVVEQIVVDPPKAHEVRIKIVNTAVCHTDAYTLSGADP-EGLFPCVLGHEGA 71
           + YE+      + I V  PKA+E+ I +  + VCHTD +   G  P     P V GHEGA
Sbjct: 11  IFYESHGKLEYKDIPVPKPKANELLINVKYSGVCHTDLHAWHGDWPLPTKLPLVGGHEGA 70

Query: 72  GIVESVGDGVTNVKPGDHV-IALYTAECQKCKFCLSGKTNLCGAVRATQGKGVMPDGTSR 130
           G+V ++G+ V     GD   I      C  C++C  G  + C     +   G   DG   
Sbjct: 71  GVVVAMGENVKGWNIGDFAGIKWLNGSCMACEYCELGNESNCPHADLS---GYTHDG--- 124

Query: 131 FHNKKGESLYHFMGCSTFSEYTVVADVSVVAIDQTAPLESVCLLGCGVTTGYGAAVKTAN 190
                           +F +Y     V    +     L  V  + C   T Y  A+K+AN
Sbjct: 125 ----------------SFQQYATADAVQAAHVAPGTDLAEVAPVLCAGITVY-KALKSAN 167

Query: 191 VQKGDTVAVFG-CGTVGLSVLQGAHQRGASRIIAIDTNDQKKDFCTQFGATDFINPTKDL 249
           +  G  VA+ G  G +G   +Q A   G  R+I ID  + K++     G   F++ TK+ 
Sbjct: 168 LMAGHWVAISGAAGGLGSLAVQYAKAMG-YRVIGIDGGEGKEELFRSIGGEVFVDFTKE- 225

Query: 250 KENETIVAKLIEMTDGGLDHTFDCTGNVNVMRSALEACH---KGWGQSVIIGVAAAGQEI 306
              + IV  +++ T+GG         NV+V  +A+EA     +  G +V++G+ A  +  
Sbjct: 226 ---KDIVGAVLKATNGGAHGVI----NVSVSEAAIEASTRYVRANGTTVLVGMPANAKCC 278

Query: 307 STRPFQLVTGRVWKGSAFGGVKGRSEMAGLIEQYKKGELKVDEFITHRRSFNEINEAFD 365
           S    Q+V      GS  G    R++    ++ + +G +K    +    +  EI E  +
Sbjct: 279 SDVFNQVVKSISIVGSYVG---NRADTREALDFFSRGLVKSPIKVVGLSTLPEIYEKME 334

>SAKL0E02838g Chr5 (226264..227397) [1134 bp, 377 aa] {ON}
           uniprot|Q6XQ71 Saccharomyces kluyveri ADH4 Alcohol
           dehydrogenase 4
          Length = 377

 Score = 86.3 bits (212), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 100/376 (26%), Positives = 156/376 (41%), Gaps = 45/376 (11%)

Query: 13  VAYEAGKPQVVEQIVVDPPKAHEVRIKIVNTAVCHTDAYTLSGADP-EGLFPCVLGHEGA 71
           + YE+G     + I V  PK +E+ I +  + VCHTD +   G  P     P V GHEGA
Sbjct: 40  IFYESGGKLEYKDIPVPKPKPNEILINVKYSGVCHTDLHAWKGDWPLPTKLPLVGGHEGA 99

Query: 72  GIVESVGDGVTNVKPGDHV-IALYTAECQKCKFCLSGKTNLCGAVRATQGKGVMPDGTSR 130
           G+V + G+ V N + GD   I      C  C+ C  G  + C          +  D +  
Sbjct: 100 GVVVAKGENVMNFEIGDLAGIKWLNGSCMACELCEQGHESNC----------LHADLSGY 149

Query: 131 FHNKKGESLYHFMGCSTFSEYTVVADVSVVAIDQTAPLESVCLLGCGVTTGYGAAVKTAN 190
            H+             +F +Y     V    I +   L  V  + C   T Y  A+KTA+
Sbjct: 150 THD------------GSFQQYATADAVQAAQIPKGTDLAEVAPILCAGVTVY-KALKTAD 196

Query: 191 VQKGDTVAVFG-CGTVGLSVLQGAHQRGASRIIAIDTNDQKKDFCTQFGATDFINPTKDL 249
           ++ G  VA+ G  G +G   +Q A   G  RI+ ID    K++     G   FI    D 
Sbjct: 197 LKPGQWVAISGAAGGLGSLAVQYAKAMGL-RILGIDGGPGKEELFKSLGGEVFI----DF 251

Query: 250 KENETIVAKLIEMTDGGLDHTFDCTGNVNVMRSALEACH---KGWGQSVIIGVAAAGQEI 306
            + + IV+ + E T GG         NV+V  +A+       +  G  V++G+ A     
Sbjct: 252 TKTKDIVSAIQEATKGGPHGVI----NVSVSEAAISTSTQYVRPTGTVVLVGLPANAYVK 307

Query: 307 STRPFQLVTGRVWKGSAFGGVKGRSEMAGLIEQYKKGELKVDEFITHRRSFNEINEAFDD 366
           S     +V     KGS  G    R++    ++ + +G +K    I      +E+ E +  
Sbjct: 308 SEVFSHVVKSINIKGSYVG---NRADTREALDFFSRGLVKSPIKIV---GLSELPEVYGL 361

Query: 367 LHNGLCL-RTVLSFSK 381
           +  G  L R V+  +K
Sbjct: 362 MEKGKILGRYVVDTAK 377

>ZYRO0C12562g Chr3 (993434..994480) [1047 bp, 348 aa] {ON} highly
           similar to uniprot|P00331 Saccharomyces cerevisiae
           YMR303C ADH2 Glucose-repressible alcohol dehydrogenase
           II involved in the production of certain carboxylate
           esters
          Length = 348

 Score = 85.5 bits (210), Expect = 8e-18,   Method: Compositional matrix adjust.
 Identities = 105/378 (27%), Positives = 153/378 (40%), Gaps = 45/378 (11%)

Query: 11  AAVAYEAGKPQVVEQIVVDPPKAHEVRIKIVNTAVCHTDAYTLSGADP-EGLFPCVLGHE 69
           A +  E   P   + I V  PK +E+ I +  + VCHTD +   G  P     P V GHE
Sbjct: 9   AVIFSENNGPLEYKDIPVPKPKPNEILIHVRYSGVCHTDLHAWKGDWPLPTKLPLVGGHE 68

Query: 70  GAGIVESVGDGVTNVKPGDHV-IALYTAECQKCKFCLSGKTNLCGAVRATQGKGVMPDGT 128
           GAG V ++G  V N K GD   I      C  C+ C     + C            PD  
Sbjct: 69  GAGEVVALGSDVKNWKIGDLAGIKWLNGSCMSCEACEQSHESNC------------PDAD 116

Query: 129 SRFHNKKGESLYHFMGCSTFSEYTVVADVSVVAIDQTAPLESVCLLGCGVTTGYGAAVKT 188
              +   G          +F +Y     V    I     L  V  + C   T Y  A+K+
Sbjct: 117 LSGYTHDG----------SFQQYATADAVQAAHIPAGTNLAEVAPVLCAGITVY-KALKS 165

Query: 189 ANVQKGDTVAVFG-CGTVGLSVLQGAHQRGASRIIAIDTNDQKKDFCTQFGATDFINPTK 247
           AN++ G  VA+ G  G +G   +Q A   G  R++ ID    K++     G   FI+ TK
Sbjct: 166 ANLKAGQWVAISGAAGGLGSLAVQYARAMGL-RVLGIDGGPGKEELFKTLGGECFIDFTK 224

Query: 248 DLKENETIVAKLIEMTDGGLDHTFDCTGNVNVMRSALEACHK---GWGQSVIIGVAAAGQ 304
           +      I   +I+ T+GG         NV+V   A+ A  K     G SV++G+ A   
Sbjct: 225 E----HDIAEAVIKATNGGAHGVI----NVSVSEGAISASTKYVRSCGTSVLVGMPAGAI 276

Query: 305 EISTRPFQLVTGRVWKGSAFGGVKGRSEMAGLIEQYKKGELKVDEFITHRRSFNEINEAF 364
             S    Q+V      GS  G    R++    ++ + +G +K    I    +  EI   F
Sbjct: 277 CKSEVFDQVVRSTKIVGSYVG---NRADTREALDFFARGLVKAPIKIVGLSTLPEI---F 330

Query: 365 DDLHNGLCL-RTVLSFSK 381
           + +  GL   R V+  SK
Sbjct: 331 EKMEKGLIAGRYVVDTSK 348

>Kpol_431.8 s431 (21043..22185) [1143 bp, 380 aa] {ON}
           (21043..22185) [1143 nt, 381 aa]
          Length = 380

 Score = 85.5 bits (210), Expect = 9e-18,   Method: Compositional matrix adjust.
 Identities = 80/282 (28%), Positives = 124/282 (43%), Gaps = 38/282 (13%)

Query: 26  IVVDPPKAHEVRIKIVNTAVCHTDAYTLSGADPEGL-FPCVLGHEGAGIVESVGDGVTNV 84
           I V  PK++E+ I +  + VCHTD +   G  P  +  P V GHEGAG+V  +G+ V   
Sbjct: 56  IPVPTPKSNEILINVKYSGVCHTDLHAWKGDWPLAVKLPLVGGHEGAGVVVGIGENVKGW 115

Query: 85  KPGDHV-IALYTAECQKCKFCLSGKTNLCGAVRATQGKGVMPDGTSRFHNKKGESLYHFM 143
           K GD   I      C  C+ C +G    C         G   DG                
Sbjct: 116 KLGDLAGIKWLNGSCMSCELCETGHEANC---EHADLSGYTHDG---------------- 156

Query: 144 GCSTFSEYTVVADVSVVAIDQTAPLESVCLLGCGVTTGYGAAVKTANVQKGDTVAVFG-C 202
              +F +Y     V    I + + L  +  + C   T Y  A+KTAN++ G+ VA+ G  
Sbjct: 157 ---SFQQYATADAVQAARIPEGSDLAQIAPILCAGITVY-KALKTANLKPGEWVAISGAA 212

Query: 203 GTVGLSVLQGAHQRGASRIIAIDTNDQKKDFCTQFGATDFINPTKDLKENETIVAKLIEM 262
           G +G   +Q A   G  R++ ID  ++K+      G   F+    D  +++ IVA +   
Sbjct: 213 GGLGSLAVQYAKAMG-YRVVGIDGGEEKEKLFRSLGGEVFV----DFTKSKDIVADIQNA 267

Query: 263 TDGGLDHTFDCTGNVNVMRSAL-EACH--KGWGQSVIIGVAA 301
           T GG         NV+V  +A+ ++ H  +  G  V++G+ A
Sbjct: 268 TKGGPQGVI----NVSVSEAAITQSTHYVRPTGTVVLVGLPA 305

>ZYRO0F02552g Chr6 (203037..204092) [1056 bp, 351 aa] {ON} similar
           to uniprot|Q07786 Saccharomyces cerevisiae YDL246C SOR2
           Protein of unknown function computational analysis of
           large-scale protein-protein interaction data suggests a
           possible role in fructose or mannose metabolism
          Length = 351

 Score = 85.1 bits (209), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 105/375 (28%), Positives = 165/375 (44%), Gaps = 52/375 (13%)

Query: 19  KPQVVEQIVVDPPK---AHEVRIKIVNTAVCHTDA-YTLSGADPEGLF----PCVLGHEG 70
           KP V+     D P+    H V++ I  T +C +D  Y   GA   G F    P VLGHE 
Sbjct: 11  KPGVITVDKRDVPEIKDPHYVKLHIKATGICGSDVHYYTQGAI--GQFVVKSPMVLGHES 68

Query: 71  AGIVESVGDGVTNVKPGDHVIALYTAECQKCKFCLSGKTNLCGAVRATQGKGVMPDGT-S 129
           +GIV  VG  VTNVK GD V        +     +SG  NLC  +          DGT +
Sbjct: 69  SGIVAEVGSAVTNVKVGDRVAIEPGIPSRYSDETMSGNYNLCPHMVFAATPPY--DGTLT 126

Query: 130 RFHNKKGESLYHFMGCSTFSEYTVVADVSVVAIDQTAPLESVCLLGCGVTTGYGAAVKTA 189
           +++    + +Y      +F E  +   +SV                 GV      A K A
Sbjct: 127 KYYLAPEDFVYKMPDHLSFEEGALAEPMSV-----------------GVH-----ANKLA 164

Query: 190 NVQKGDTVAVFGCGTVGLSVLQGAHQR--GASRIIAIDTNDQKKDFCTQFGATDFINPTK 247
             + G  V V G G VGL  L GA  R  GA+ ++ +D  ++K +   QFGAT  ++ + 
Sbjct: 165 GTRFGSKVLVSGAGPVGL--LAGAVARAFGATEVVFVDIAEEKLERSKQFGATHTVSSSS 222

Query: 248 DLKENETIVAKLIEMTDGGLDH-TFDCTGNVNVMRSALEACHKGWGQSVIIGVAAAGQEI 306
           D    E  V+++ ++  G L +   +C+G    +R  ++AC K  G  V +G+   G++ 
Sbjct: 223 D---EERFVSEVSKVLGGDLPNIVLECSGAQPAIRCGVKAC-KAGGHYVQVGM---GKDD 275

Query: 307 STRPFQLVTGR-VWKGSAFGGVKGRSEMAGLIEQYKKGELKVDEFITHRRSFNEINEA-- 363
              P   V  + +     F   KG  + A  +     G +     I+HR +F++  EA  
Sbjct: 276 VNFPISAVGSKEITFHGCFRYKKG--DFADSVALLSSGRINGKPLISHRFAFDKAPEAYK 333

Query: 364 FDDLHNGLCLRTVLS 378
           F+  H    ++T+++
Sbjct: 334 FNAEHGNEVVKTIIT 348

>YLR070C Chr12 complement(274141..275211) [1071 bp, 356 aa] {ON}
           XYL2Xylitol dehydrogenase, converts xylitol to
           D-xylulose; expression induced by xylose, even though
           this pentose sugar is not well utilized by S.
           cerevisiae; null mutant has cell wall defect
          Length = 356

 Score = 84.7 bits (208), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 95/354 (26%), Positives = 154/354 (43%), Gaps = 56/354 (15%)

Query: 27  VVDPPKAHEVRIKIVNTAVCHTDAYTLSGADPEGLF---PCVLGHEGAGIVESVGDGVTN 83
           + DP   +EV I+I  T +C +D +  +           P VLGHE +GIV  +G+ V  
Sbjct: 28  ISDP---NEVIIQIKATGICGSDIHYYTHGRIANYVVESPMVLGHESSGIVALIGENVKT 84

Query: 84  VKPGDHVIAL-------YTAECQKCKFCLSGKTNLCGAVRATQGKGVMPDGT-SRFHNKK 135
           +K GD V AL       ++ E ++ ++ L                    DGT ++++   
Sbjct: 85  LKVGDRV-ALEPGIPDRFSPEMKEGRYNLDPNLKFAATPPF--------DGTLTKYYKTM 135

Query: 136 GESLYHFMGCSTFSEYTVVADVSVVAIDQTAPLESVCLLGCGVTTGYGAAVKTANVQKGD 195
            + +Y      +F E  ++  +SV                         A K A ++ G 
Sbjct: 136 KDFVYKLPDDVSFEEGALIEPLSVAI----------------------HANKLAKIKFGA 173

Query: 196 TVAVFGCGTVGLSVLQGAHQRGASRIIAIDTNDQKKDFCTQFGATDFINPTKDLKENETI 255
              VFG G +GL   + A   GA+ ++ +D  + K +   QFGAT  +N + DL    T 
Sbjct: 174 RCVVFGAGPIGLLAGKVASVFGAADVVFVDLLENKLETARQFGATHIVN-SGDLPHGVT- 231

Query: 256 VAKLIEMTDG--GLDHTFDCTGNVNVMRSALEACHKGWGQSVIIGVAAAGQEISTRPFQL 313
           V  +I+   G  G D  F+C+G    +R+ +E C  G G  V +G+   GQE    P  +
Sbjct: 232 VDSVIKKAIGKKGADVVFECSGAEPCVRAGIEVCKAG-GTIVQVGM---GQEEIQFPISI 287

Query: 314 V-TGRVWKGSAFGGVKGRSEMAGLIEQYKKGELKVDEFITHRRSFNEINEAFDD 366
           + T  +     F   +G  + +  IE     +L +  FITHR SF +  EAF++
Sbjct: 288 IPTKELTFQGCFRYCQG--DYSDSIELVSSRKLSLKPFITHRYSFKDAVEAFEE 339

>ZYRO0B05940g Chr2 (480279..481418) [1140 bp, 379 aa] {ON} highly
           similar to uniprot|P00330 Saccharomyces cerevisiae
           YOL086C ADH1 Alcohol dehydrogenase involved in the
           production of certain carboxylate esters
          Length = 379

 Score = 84.7 bits (208), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 84/292 (28%), Positives = 121/292 (41%), Gaps = 38/292 (13%)

Query: 16  EAGKPQVVEQIVVDPPKAHEVRIKIVNTAVCHTDAYTLSGADP-EGLFPCVLGHEGAGIV 74
           E+  P   ++I V  PK +E+ I +  + VCHTD +   G  P     P V GHEGAG V
Sbjct: 45  ESNGPLEYKEIPVPTPKPNEILIHVRYSGVCHTDLHAWKGDWPLPTKLPLVGGHEGAGEV 104

Query: 75  ESVGDGVTNVKPGDHV-IALYTAECQKCKFCLSGKTNLCGAVRATQGKGVMPDGTSRFHN 133
            ++G  V N K GD   I      C  C+ C     + C            PD     + 
Sbjct: 105 IALGSNVKNWKVGDLAGIKWLNGSCMSCESCEQSNESNC------------PDADLSGYT 152

Query: 134 KKGESLYHFMGCSTFSEYTVVADVSVVAIDQTAPLESVCLLGCGVTTGYGAAVKTANVQK 193
             G          +F +Y     V    I     L  V  + C   T Y  A+K+AN++ 
Sbjct: 153 HDG----------SFQQYATADAVQAAHIPPGTDLAEVAPVLCAGITVY-KALKSANLKA 201

Query: 194 GDTVAVFG-CGTVGLSVLQGAHQRGASRIIAIDTNDQKKDFCTQFGATDFINPTKDLKEN 252
           G  VA+ G  G +G   +Q A   G  R++ ID    K++     G   FI    D ++ 
Sbjct: 202 GQWVAISGAAGGLGSLAVQFAKAMGL-RVVGIDGGPGKEELFKTLGGEVFI----DFQKE 256

Query: 253 ETIVAKLIEMTDGGLDHTFDCTGNVNVMRSALEACHK---GWGQSVIIGVAA 301
             IV  ++  T+GG         NV+V   A+ A  K     G SV++G+ A
Sbjct: 257 SDIVGAVVNATNGGAHGVV----NVSVSEGAISASTKYVRACGTSVLVGMPA 304

>TDEL0D05050 Chr4 (921065..922120) [1056 bp, 351 aa] {ON} Anc_3.118
           YBR145W
          Length = 351

 Score = 84.3 bits (207), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 95/364 (26%), Positives = 151/364 (41%), Gaps = 44/364 (12%)

Query: 13  VAYEAGKPQVVEQIVVDPPKAHEVRIKIVNTAVCHTDAYTLSGADPEGL-FPCVLGHEGA 71
           + YE       + I V  P  +E+ I +  + VCHTD +   G  P  +  P V GHEGA
Sbjct: 14  IFYENNGTLEYKDIPVPKPAPNELLINVKYSGVCHTDLHAWKGDWPLPVKLPLVGGHEGA 73

Query: 72  GIVESVGDGVTNVKPGDHV-IALYTAECQKCKFCLSGKTNLCGAVRATQGKGVMPDGTSR 130
           G+V ++G  V N K GD+  I      C  C+ C  G  + C     +   G   DG   
Sbjct: 74  GVVVALGSNVKNWKVGDYAGIKWLNGCCMSCEDCELGNESNCPQADLS---GYTHDG--- 127

Query: 131 FHNKKGESLYHFMGCSTFSEYTVVADVSVVAIDQTAPLESVCLLGCGVTTGYGAAVKTAN 190
                           +F +Y     V    I     L  V  + C   T Y  A+K+A 
Sbjct: 128 ----------------SFQQYATTDAVQAAKISPGTDLAEVAPVLCAGLTVY-KALKSAE 170

Query: 191 VQKGDTVAVFG-CGTVGLSVLQGAHQRGASRIIAIDTNDQKKDFCTQFGATDFINPTKDL 249
           ++ G  VA+ G CG +G   +Q A   G  R++ ID  D+K     + G   FI    D 
Sbjct: 171 LEAGQWVAISGACGGLGSLAVQYAKAMG-YRVLGIDGGDEKAKMFKELGGEYFI----DF 225

Query: 250 KENETIVAKLIEMTDGGLDHTFDCTGNVNVMRSALEAC---HKGWGQSVIIGVAAAGQEI 306
            + + I+ ++++ T+GG         NV+V  +A+ A     +  G  V++G+ A     
Sbjct: 226 TKCKDIIGEVVKATNGGAHGVI----NVSVSEAAISASTRYARANGTVVLVGLPAGAYCK 281

Query: 307 STRPFQLVTGRVWKGSAFGGVKGRSEMAGLIEQYKKGELKVDEFITHRRSFNEINEAFDD 366
           S    Q+V      GS  G    R++    ++ + +G +K    +    +  EI   +D 
Sbjct: 282 SEVFNQVVKSIKIVGSYVG---NRADTREALDFFNRGLVKAPIKVVGLSTLPEI---YDK 335

Query: 367 LHNG 370
           +  G
Sbjct: 336 MIKG 339

>NCAS0A07780 Chr1 (1548197..1549318) [1122 bp, 373 aa] {ON}
           Anc_2.480
          Length = 373

 Score = 84.7 bits (208), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 84/295 (28%), Positives = 124/295 (42%), Gaps = 38/295 (12%)

Query: 13  VAYEAGKPQVVEQIVVDPPKAHEVRIKIVNTAVCHTDAYTLSGADPEGL-FPCVLGHEGA 71
           + YE G P   + I V  PKA+E+ I +  + VCHTD +   G  P     P V GHEG+
Sbjct: 36  IFYETGGPLHYKDIPVPKPKANEILINVKYSGVCHTDLHAWKGDWPLATKLPLVGGHEGS 95

Query: 72  GIVESVGDGVTNVKPGDHV-IALYTAECQKCKFCLSGKTNLCGAVRATQGKGVMPDGTSR 130
           G V ++G+ V   K GD   I      C  C+ C SG  + C     +   G   DG   
Sbjct: 96  GEVVAMGENVKGWKIGDLAGIKWLNGSCMSCELCESGHESNCEHADLS---GYTHDG--- 149

Query: 131 FHNKKGESLYHFMGCSTFSEYTVVADVSVVAIDQTAPLESVCLLGCGVTTGYGAAVKTAN 190
                           +F +Y     V    I +   +  V  + C   T Y  A+K A+
Sbjct: 150 ----------------SFQQYATADAVQAARIPKGTNMAEVAPILCAGITVY-KALKEAD 192

Query: 191 VQKGDTVAVFG-CGTVGLSVLQGAHQRGASRIIAIDTNDQKKDFCTQFGATDFINPTKDL 249
           ++ G  V + G  G +G   +Q A   G  R+I ID    K++     G   F+    D 
Sbjct: 193 MRAGQWVCISGAAGGLGSLAVQYAKAMG-YRVIGIDGGPGKEELFKSLGGEIFV----DF 247

Query: 250 KENETIVAKLIEMTDGGLDHTFDCTGNVNVMRSALEACHK---GWGQSVIIGVAA 301
            + + IVA++ E T GG         NV+V  +A+    K     G  V++G+ A
Sbjct: 248 TKTKDIVAEIQEATRGGPQGVI----NVSVSEAAISLSTKYVRPTGTVVLVGLPA 298

>Kpol_1036.19 s1036 (51276..52337) [1062 bp, 353 aa] {ON}
           (51276..52337) [1062 nt, 354 aa]
          Length = 353

 Score = 84.3 bits (207), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 82/278 (29%), Positives = 119/278 (42%), Gaps = 37/278 (13%)

Query: 13  VAYEAGKPQVVEQIVVDPPKAHEVRIKIVNTAVCHTDAYTLSGADP-EGLFPCVLGHEGA 71
           + YE       + + V  PK  E+ I ++ + VCHTD +   G  P +   P V GHEGA
Sbjct: 16  IFYENNGELQYKDLPVPQPKPTELLIHVLYSGVCHTDLHAWKGDWPLDTKLPLVGGHEGA 75

Query: 72  GIVESVGDGVTNVKPGDHV-IALYTAECQKCKFC-LSGKTNLCGAVRATQGKGVMPDGTS 129
           G+V  +G  V   K GD   I      C  C+ C LS ++N              P+   
Sbjct: 76  GVVVGMGSSVKGWKMGDLAGIKWLNGSCMNCEECELSNESNC-------------PEADL 122

Query: 130 RFHNKKGESLYHFMGCSTFSEYTVVADVSVVAIDQTAPLESVCLLGCGVTTGYGAAVKTA 189
             +   G          +F +Y     V    I Q A +  V  + C   T Y  A+K+A
Sbjct: 123 SGYTHDG----------SFQQYATADAVQAAHIPQGADMAEVAPILCAGVTVY-KALKSA 171

Query: 190 NVQKGDTVAVFG-CGTVGLSVLQGAHQRGASRIIAIDTNDQKKDFCTQFGATDFINPTKD 248
            ++ GD VA+ G  G +G   +Q A   G  R++ ID  D+K+ F    G   F+    D
Sbjct: 172 ELKAGDWVAISGAAGGLGSLAVQYAKAMG-YRVLGIDGGDEKEKFFKSMGGEVFV----D 226

Query: 249 LKENETIVAKLIEMTDGGLDHTFDCTGNVNVMRSALEA 286
               + IV  + E T+GG      C  NV+V   A+EA
Sbjct: 227 FMTCKDIVGAVKEATNGG---AHGCI-NVSVSEKAIEA 260

>TDEL0A02560 Chr1 complement(462053..463174) [1122 bp, 373 aa] {ON}
           Anc_2.480 YMR083W
          Length = 373

 Score = 84.0 bits (206), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 80/295 (27%), Positives = 127/295 (43%), Gaps = 38/295 (12%)

Query: 13  VAYEAGKPQVVEQIVVDPPKAHEVRIKIVNTAVCHTDAYTLSGADPEGL-FPCVLGHEGA 71
           + YE G     + I V  PK +E+ I I  + VCHTD +   G  P  +  P V GHEGA
Sbjct: 36  IFYENGGELHYKDIAVPKPKPNEILINIKYSGVCHTDLHAWKGDWPLPVKLPLVGGHEGA 95

Query: 72  GIVESVGDGVTNVKPGDHV-IALYTAECQKCKFCLSGKTNLCGAVRATQGKGVMPDGTSR 130
           G+V + G  VTN + GD   +    + C  C++C  G  + C     +   G   DG   
Sbjct: 96  GVVVAKGKDVTNFEIGDLAGVKWLNSSCMACEYCELGHESNCAKADLS---GYTHDG--- 149

Query: 131 FHNKKGESLYHFMGCSTFSEYTVVADVSVVAIDQTAPLESVCLLGCGVTTGYGAAVKTAN 190
                           +F +Y     +    I +   L  V  + C   T Y  A+KT+ 
Sbjct: 150 ----------------SFQQYATADAIQAAPIPKDTDLAEVAPILCAGVTVY-KALKTSG 192

Query: 191 VQKGDTVAVFG-CGTVGLSVLQGAHQRGASRIIAIDTNDQKKDFCTQFGATDFINPTKDL 249
            + G  VA+ G  G +G   +Q A   G  R++ ID  + K++     G   F+    D 
Sbjct: 193 AKPGQWVAISGAAGGLGSLAVQYATAMGL-RVLGIDGGEGKEELFKSLGGEVFV----DF 247

Query: 250 KENETIVAKLIEMTDGGLDHTFDCTGNVNVMRSALEACH---KGWGQSVIIGVAA 301
            + + +V+ + E T+GG         NV+V  +A++      +  G  V++G+ A
Sbjct: 248 TKTKDMVSAIQEATNGGPHAVV----NVSVSEAAIQQSTEYVRPTGTVVLVGLPA 298

>Skud_20.2 Chr20 (1588..2661) [1074 bp, 357 aa] {ON} YJR159W (REAL)
          Length = 357

 Score = 84.0 bits (206), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 99/364 (27%), Positives = 153/364 (42%), Gaps = 49/364 (13%)

Query: 28  VDPPKAHEVRIKIVNTAVCHTDA-YTLSGADPEGLF--PCVLGHEGAGIVESVGDGVTNV 84
           +D P  H V++ I  T +C +D  Y  SG   + +   P VLGHE +G V  VGD VT V
Sbjct: 27  IDDP--HYVKLAIKATGICGSDVHYYRSGGIGKYILKAPMVLGHESSGQVVEVGDAVTRV 84

Query: 85  KPGDHVIALYTAECQKCKFCLSGKTNLCGAVRATQGKGVMPDGT-SRFHNKKGESLYHFM 143
           K GD V        +       G+ NLC  +       +  DGT  R++    + L    
Sbjct: 85  KIGDRVAIEPGVPGRYSDETKEGRYNLCPHMAFAATPPI--DGTLVRYYLSPEDFLVKLP 142

Query: 144 GCSTFSEYTVVADVSVVAIDQTAPLESVCLLGCGVTTGYGAAVKTANVQKGDTVAVFGCG 203
              ++ E   V  +SV                 GV +      K A V+ G  V VFG G
Sbjct: 143 DGVSYEEGACVEPLSV-----------------GVHSN-----KLAGVRFGTRVVVFGAG 180

Query: 204 TVGLSVLQGAHQRGASRIIAIDTNDQKKDFCTQFGATDFINPTKDLKENETIVAKLIEMT 263
            VGL     AH  GAS +I +D  D +      FGA+   N +K   +    +A  +E  
Sbjct: 181 PVGLLTGAVAHAFGASDVIFVDVFDNRLQRAKDFGASGTFNSSKFSVDEAQQLADEVEKL 240

Query: 264 DGG--LDHTFDCTGNVNVMRSALEACHKGWGQSVIIGVAAAGQEISTRPFQLVTGRVWK- 320
            GG   D  F+C+G    + + ++    G G  V +G+   G+  +  P   V+G+  + 
Sbjct: 241 LGGHHADVVFECSGADVCIDAGVKTTKVG-GTMVQVGM---GKNYTNFPIAEVSGKEMRL 296

Query: 321 ----GSAFGGVKGRSEMAGLIEQYKKGELKVDEFITHRRSFNEINEAFDD--LHNGLCLR 374
                 +FG  +    +         G++ V   ITHR  F +  +A+D    H G  ++
Sbjct: 297 IGCFRYSFGDYRDAVNLVA------SGKVNVKPLITHRFKFEDAAKAYDYNIAHGGDVVK 350

Query: 375 TVLS 378
           T+++
Sbjct: 351 TIIA 354

>Skud_4.2 Chr4 complement(6287..7360) [1074 bp, 357 aa] {ON} YJR159W
           (REAL)
          Length = 357

 Score = 84.0 bits (206), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 99/364 (27%), Positives = 153/364 (42%), Gaps = 49/364 (13%)

Query: 28  VDPPKAHEVRIKIVNTAVCHTDA-YTLSGADPEGLF--PCVLGHEGAGIVESVGDGVTNV 84
           +D P  H V++ I  T +C +D  Y  SG   + +   P VLGHE +G V  VGD VT V
Sbjct: 27  IDDP--HYVKLAIKATGICGSDVHYYRSGGIGKYILKAPMVLGHESSGQVVEVGDAVTRV 84

Query: 85  KPGDHVIALYTAECQKCKFCLSGKTNLCGAVRATQGKGVMPDGT-SRFHNKKGESLYHFM 143
           K GD V        +       G+ NLC  +       +  DGT  R++    + L    
Sbjct: 85  KIGDRVAIEPGVPGRYSDETKEGRYNLCPHMAFAATPPI--DGTLVRYYLSPEDFLVKLP 142

Query: 144 GCSTFSEYTVVADVSVVAIDQTAPLESVCLLGCGVTTGYGAAVKTANVQKGDTVAVFGCG 203
              ++ E   V  +SV                 GV +      K A V+ G  V VFG G
Sbjct: 143 DGVSYEEGACVEPLSV-----------------GVHSN-----KLAGVRFGTRVVVFGAG 180

Query: 204 TVGLSVLQGAHQRGASRIIAIDTNDQKKDFCTQFGATDFINPTKDLKENETIVAKLIEMT 263
            VGL     AH  GAS +I +D  D +      FGA+   N +K   +    +A  +E  
Sbjct: 181 PVGLLTGAVAHAFGASDVIFVDVFDNRLQRAKDFGASGTFNSSKFSVDEAQQLADEVEKL 240

Query: 264 DGG--LDHTFDCTGNVNVMRSALEACHKGWGQSVIIGVAAAGQEISTRPFQLVTGRVWK- 320
            GG   D  F+C+G    + + ++    G G  V +G+   G+  +  P   V+G+  + 
Sbjct: 241 LGGHHADVVFECSGADVCIDAGVKTTKVG-GTMVQVGM---GKNYTNFPIAEVSGKEMRL 296

Query: 321 ----GSAFGGVKGRSEMAGLIEQYKKGELKVDEFITHRRSFNEINEAFDD--LHNGLCLR 374
                 +FG  +    +         G++ V   ITHR  F +  +A+D    H G  ++
Sbjct: 297 IGCFRYSFGDYRDAVNLVA------SGKVNVKPLITHRFKFEDAAKAYDYNIAHGGDVVK 350

Query: 375 TVLS 378
           T+++
Sbjct: 351 TIIA 354

>KLLA0F00506g Chr6 complement(36518..37675) [1158 bp, 385 aa] {ON}
           similar to uniprot|P39714 Saccharomyces cerevisiae
           YAL060W BDH1 NAD-dependent (2R 3R)-2 3-butanediol
           dehydrogenase
          Length = 385

 Score = 83.2 bits (204), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 85/334 (25%), Positives = 144/334 (43%), Gaps = 52/334 (15%)

Query: 57  DPEGL-FPCVLGHEGAGIVESVGDGVTNVKPGDHVIALYTAEC--------------QKC 101
           D  GL  P  +GHE +GIV  VG  VTN+K GDHV+   T  C               +C
Sbjct: 61  DVSGLGLPQAMGHEMSGIVSKVGPKVTNIKAGDHVVVEATGTCLDHYTWPNAAHAKDAEC 120

Query: 102 KFCLSGKTNLCGAVRATQGKGVMPDGTSRFHNKKGESLYHFMGCSTFSEYTVVADVSVVA 161
             C  G  N C  +    G GV   G                    F+E  VV++  VV 
Sbjct: 121 AACQRGFYNCCAHL-GFMGLGVHSGG--------------------FAEKVVVSEKHVVK 159

Query: 162 IDQTAPLESVCLLGCGVTTGYGAAVKTANVQKGDTVAVFGCGTVGLSVLQGAHQRGASRI 221
           I  T PL+   L+     + +  AV+ + +QKG +  V G G +GL+ +      GAS+I
Sbjct: 160 IPNTLPLDVAALVEPISVSWH--AVRISKLQKGQSALVLGAGPIGLATILALQGHGASKI 217

Query: 222 IAIDTNDQKKDFCTQFGATDFINPTKDLKENETIVAKLIEMTDGGLDHTFDCTGNVNVMR 281
           +  +  + +++   + G   F +P++  ++   I+ KL    + G D  +DC+G   V  
Sbjct: 218 VVSEPAEIRRNQAAKLGVETF-DPSEHKEDAVNILKKLAPGGE-GFDFAYDCSG---VKP 272

Query: 282 SALEACHKGWGQSVIIGVAAAGQE-ISTRPFQL-VTGRVWKGSAFGGVKGRSEMAGLIEQ 339
           +     H    + + + +A  G + I  +P  + +  +   GS    +K   +   +++ 
Sbjct: 273 TFDTGVHATTFRGMYVNIAIWGHKPIDFKPMDVTLQEKFVTGSMCYTIK---DFEDVVQA 329

Query: 340 YKKGELKVDE---FITHRRSFNE-INEAFDDLHN 369
              G + +D+    IT R+   +   + FD+L N
Sbjct: 330 LGNGSIAIDKARHLITGRQKIEDGFTKGFDELMN 363

>TBLA0A04290 Chr1 (1063289..1064476) [1188 bp, 395 aa] {ON} Anc_7.3
           YAL060W
          Length = 395

 Score = 83.2 bits (204), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 65/240 (27%), Positives = 101/240 (42%), Gaps = 41/240 (17%)

Query: 62  FPCVLGHEGAGIVESVGDGVTNVKPGDHVIALYTAECQK--------------CKFCLSG 107
            P  +GHE AG+V  VG GV   K GDHV+   T  C+               C  C  G
Sbjct: 67  LPQAMGHEMAGVVSRVGPGVKKFKVGDHVVVEPTGTCKDRYRWKNSPSKNDDMCNACKKG 126

Query: 108 KTNLCGAVRATQGKGVMPDGTSRFHNKKGESLYHFMGCSTFSEYTVVADVSVVAIDQTAP 167
             N+C  +    G GV   G                    F+E  V+ +     +    P
Sbjct: 127 YYNICSKL-GLCGAGVQSGG--------------------FAERVVMNESHCHKVPDDLP 165

Query: 168 LESVCLLGCGVTTGYGAAVKTANVQKGDTVAVFGCGTVGLSVLQGAHQRGASRIIAIDTN 227
           L+   L+       +  A++  N +KG +  V G G +GL ++   H  G + I+  +  
Sbjct: 166 LDIAALIQPIAVCWH--ALRICNFKKGSSALVVGSGPIGLGIILALHGHGCTDIVVSEPA 223

Query: 228 DQKKDFCTQFGATDFINPTKDLKENETIVAKLIEMTDGG--LDHTFDCTGNVNVMRSALE 285
             ++DF  + GAT F +P+  L  +E  +  L  +  GG   D+TFDC+GN     +++E
Sbjct: 224 KIRRDFAKELGATVF-DPSS-LPTHEESIKYLRSIAPGGDGFDYTFDCSGNQYTFNASIE 281

>TDEL0F03190 Chr6 (583849..584904) [1056 bp, 351 aa] {ON}  possible
           pseudogene; NNN added to avoid internal stop codon
          Length = 351

 Score = 82.4 bits (202), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 93/349 (26%), Positives = 146/349 (41%), Gaps = 42/349 (12%)

Query: 24  EQIVVDPPKAHEVRIKIVNTAVCHTDAYTLSGADP-EGLFPCVLGHEGAGIVESVGDGV- 81
           + I V  P+ +E+ I +  + VCHTD +   G  P     P V GHEGAGIV + G  V 
Sbjct: 24  KDIPVPEPQPNELLINVKYSGVCHTDLHAWKGDWPLPTKLPLVGGHEGAGIVVAKGSMVX 83

Query: 82  TNVKPGDHV-IALYTAECQKCKFCLSGKTNLCGAVRATQGKGVMPDGTSRFHNKKGESLY 140
              + GD   I      C  C++C     + C     +   G   DG             
Sbjct: 84  XGWEIGDLAGIKWLNGSCMSCEYCEKANESNCPQADLS---GYTHDG------------- 127

Query: 141 HFMGCSTFSEYTVVADVSVVAIDQTAPLESVCLLGCGVTTGYGAAVKTANVQKGDTVAVF 200
                 +F +Y     V    + +   L  V  + C   T Y  A+K+AN++ G+ VA+ 
Sbjct: 128 ------SFQQYATADAVQAARVPKGTDLAEVAPILCAGITVY-KALKSANLRAGEWVAIS 180

Query: 201 GC-GTVGLSVLQGAHQRGASRIIAIDTNDQKKDFCTQFGATDFINPTKDLKENETIVAKL 259
           G  G +G   +Q A   G  R++ ID  D+K     Q G   FI    D  +++ ++A++
Sbjct: 181 GASGGLGSLAVQYAKAMG-YRVLGIDGGDEKAKLFKQLGGEYFI----DFTKSKDVIAEV 235

Query: 260 IEMTDGGLDHTFDCTGNVNVMRSALEAC---HKGWGQSVIIGVAAAGQEISTRPFQLVTG 316
           I+ TDGG         NV+V   A+ A     +  G  V++G+ A     S    Q+V  
Sbjct: 236 IKATDGGAHGVI----NVSVSEGAISASTRYARANGTVVLVGLPANAYCKSEVFNQVVKS 291

Query: 317 RVWKGSAFGGVKGRSEMAGLIEQYKKGELKVDEFITHRRSFNEINEAFD 365
               GS  G    R++    ++ + +G +K    I    +  EI E  +
Sbjct: 292 VAIVGSYVG---NRADTREALDFFARGLVKSPIKIVGLSTLPEIYEKME 337

>NCAS0J00300 Chr10 (43719..44792) [1074 bp, 357 aa] {ON} Anc_8.16
          Length = 357

 Score = 82.4 bits (202), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 97/356 (27%), Positives = 158/356 (44%), Gaps = 43/356 (12%)

Query: 34  HEVRIKIVNTAVCHTDAYTL---SGADPEGLFPCVLGHEGAGIVESVGDGVTNVKPGDHV 90
           H V+++I  T +C +D +     S  D     P VLGHE +GI+  VG  V  +K GD V
Sbjct: 31  HWVKVQIKATGICGSDVHFYKYGSIGDFVVKSPMVLGHESSGIIAEVGSAVKTLKVGDRV 90

Query: 91  IALYTAECQKCKFCLSGKTNLCGAVRATQGKGVMPDGT-SRFHNKKGESLYHFMGCSTFS 149
                   +  +  +SG  NLC  +          DGT ++++    + +Y      ++ 
Sbjct: 91  ALEPGYPSRYTEATMSGHYNLCPFMHFAATPPC--DGTLTKYYLTPFDFVYKLPDNVSYE 148

Query: 150 EYTVVADVSVVAIDQTAPLESVCLLGCGVTTGYGAAVKTANVQKGDTVAVFGCGTVGLSV 209
           E  ++  +SV                 GV      A K A  + GD V VFG G VGL  
Sbjct: 149 EGALLEPLSV-----------------GVH-----ANKQAGTRFGDKVVVFGAGPVGL-- 184

Query: 210 LQGAHQR--GASRIIAIDTNDQKKDFCTQFGATDFINPTKDLKENETIVAKLIEMTDGGL 267
           L GA  +  GA +++ ID  D+K +    FGAT  IN +K    +E  +A  I+   GG+
Sbjct: 185 LNGAVAKVFGALQVVFIDVVDEKLERAKHFGATAVINSSKLRINDEFELAVAIKEKLGGV 244

Query: 268 DH--TFDCTGNVNVMRSALEACHKGWGQSVIIGVAAAGQEISTRPF-QLVTGRVWKGSAF 324
           D     +CTG    +R+ + A   G G  V +G+   G++ +  P  Q     +     F
Sbjct: 245 DPDIVLECTGAEPCIRAGIRALKTG-GTFVQVGM---GKDDANIPITQFSCREITLKGCF 300

Query: 325 GGVKGRSEMAGLIEQYKKGELKVDEFITHRRSFNEINEA--FDDLHNGLCLRTVLS 378
               G  + A  ++    G++ V   +T R +F+E  +A  F+  H    +++++S
Sbjct: 301 RYCHGDYQNA--LDLVATGKIPVKLLVTRRFTFDEAVKAYMFNAEHAEEVVKSIIS 354

>Kwal_26.6684 s26 (21910..22980) [1071 bp, 356 aa] {ON} YJR159W
           (SOR1) - sorbitol-induced sorbitol dehydrogenase [contig
           381] FULL
          Length = 356

 Score = 82.0 bits (201), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 107/380 (28%), Positives = 158/380 (41%), Gaps = 46/380 (12%)

Query: 1   MTEGKPIECLAAVAYEAGKPQVVEQIVVDPPKAHEVRIKIVNTAVCHTDA-YTLSGADPE 59
           M++  P    A V  + G   +  + V + P  H V++ I  T +C +D  Y  SG+  +
Sbjct: 1   MSQSNP----AVVLRKVGDIGIENRPVPELPNEHYVKVAIKATGICGSDIHYYKSGSIGK 56

Query: 60  GLF--PCVLGHEGAGIVESVGDGVTNVKPGDHVIALYTAECQKCKFCLSGKTNLCGAVRA 117
            +   P VLGHE +G V  VG  V ++K GD V        +       G+ NLC  +  
Sbjct: 57  YVVNQPMVLGHESSGEVVEVGSAVRSIKVGDRVAIEPGVPDRYSDETKQGRYNLCPDMAF 116

Query: 118 TQGKGVMPDGTSRFHNKKGESLYHFMGCSTFSEYTVVADVSVVAIDQTAPLESVCL--LG 175
                +  DGT                      Y   AD  V   D  +  E  C+  L 
Sbjct: 117 AATPPI--DGT------------------LVKYYVSPADFLVKLPDHVSFEEGACIEPLS 156

Query: 176 CGVTTGYGAAVKTANVQKGDTVAVFGCGTVGLSVLQGAHQRGASRIIAIDTNDQKKDFCT 235
            GV      A K A V  G  V VFG G VGL     A   GAS +I +D  D K +   
Sbjct: 157 VGVH-----ANKLAKVHFGSVVVVFGAGPVGLLTGAVAKAFGASEVIYVDVFDNKLERAK 211

Query: 236 QFGATDFINPTKDLK--ENETIVAKLIEMTDGGL-DHTFDCTGNVNVMRSALEACHKGWG 292
            FGAT  IN +K L   E + + A +     G L D  F+C+G    + S + +   G G
Sbjct: 212 GFGATHTIN-SKSLPRGEGDAVSAAVSNYLGGALADVVFECSGAEPCINSGVLSTKNG-G 269

Query: 293 QSVIIGVAAAGQEISTRPFQLVTGRVWKGSAFGGVK-GRSEMAGLIEQYKKGELKVDEFI 351
             V IG+   G+     P   V+G+  + S  G  +    +    +     G+++V + I
Sbjct: 270 TMVQIGM---GKNYINFPLAEVSGK--EMSVIGCFRYSFGDYRDAVRLVATGQVEVKKMI 324

Query: 352 THRRSFNEINEAFD-DLHNG 370
           T+R  F +   A+D ++ NG
Sbjct: 325 TNRFKFEDAAAAYDYNIANG 344

>ZYRO0G03410g Chr7 complement(269170..270291) [1122 bp, 373 aa] {ON}
           similar to uniprot|P07246 Saccharomyces cerevisiae
           YMR083W ADH3
          Length = 373

 Score = 81.6 bits (200), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 96/364 (26%), Positives = 153/364 (42%), Gaps = 41/364 (11%)

Query: 24  EQIVVDPPKAHEVRIKIVNTAVCHTDAYTLSGADP-EGLFPCVLGHEGAGIVESVGDGVT 82
           E + V  P ++EV I +  + VCHTD +T  G  P +   P V GHEGAG+V + G  V 
Sbjct: 45  EDLPVPTPASNEVLINVKYSGVCHTDLHTWKGEIPFKTKLPLVGGHEGAGVVVAKGKDVK 104

Query: 83  NVKPGDHV-IALYTAECQKCKFCLSGKTNLCGAVRATQGKGVMPDGTSRFHNKKGESLYH 141
             + GD   +    + C  C+ C  G    C      +  G   DG              
Sbjct: 105 TFEIGDLAGVKQLVSSCMGCESCEIGHEFGC---EQAEMSGSSHDG-------------- 147

Query: 142 FMGCSTFSEYTVVADVSVVAIDQTAPLESVCLLGCGVTTGYGAAVKTANVQKGDTVAVFG 201
                TF +Y  +  +    +     L +V  + C   + Y  A+K  N+Q    VA+FG
Sbjct: 148 -----TFQQYVAIDALQAPPLPANVDLAAVAPIFCAGVSVY-KALKNGNLQTNQWVAIFG 201

Query: 202 C-GTVGLSVLQGAHQRGASRIIAID-TNDQKKDFCTQFGATDFINPTKDLKENETIVAKL 259
             G +G   +Q A   G  R++ ID   +++K      G   F+    D  + + I A +
Sbjct: 202 ATGGLGSIAVQYAKAMG-YRVLGIDGPGEERKQLFHSLGGEVFL----DYTQVDNIPAAV 256

Query: 260 IEMTDGGLDHTFDCTGNVNVMRSALEACHKGWGQSVIIGVAAAGQEISTRPFQLVT-GRV 318
            + T GG     + T ++      ++ C +  G  V +GV      + T  F +V  G  
Sbjct: 257 KQATQGGAHCVLNVTASLAAYDQTIK-CVRPLGTVVPVGVPPDSGLLKTDIFTIVQHGFS 315

Query: 319 WKGSAFGGVKGRSEMAGLIEQYKKGELKVDEFITHRRSFNEINEAFDDLHNGLCL-RTVL 377
            KGSA G    R++    ++ + +G +K    I      +E+ +AF+ L +G    R VL
Sbjct: 316 IKGSASG---SRADTREAVDFFTRGLIKSPIKIL---GLSELPKAFELLESGQTTGRLVL 369

Query: 378 SFSK 381
             SK
Sbjct: 370 DTSK 373

>KAFR0L02000 Chr12 (378013..379098) [1086 bp, 361 aa] {ON} 
          Length = 361

 Score = 81.6 bits (200), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 70/259 (27%), Positives = 108/259 (41%), Gaps = 31/259 (11%)

Query: 11  AAVAYEAGKPQVVEQIVVDPPKAHEVRIKIVNTAVCHTDAYTLSGADP-EGLFPCVLGHE 69
           A V  E G       I V   KA+E+ I +  + VCH+D Y      P     P V GHE
Sbjct: 22  AMVFSEYGGDLEYRDIPVPTKKANEILINVKYSGVCHSDLYVWKNRTPMTSKLPLVGGHE 81

Query: 70  GAGIVESVGDGVTNVKPGDHV-IALYTAECQKCKFCLSGKTNLCGAVRATQGKGVMPDGT 128
           GAG+V  +G  V N K GD   +    + C  C+ C  G    C     ++  G   +G 
Sbjct: 82  GAGVVVGMGSNVKNWKIGDKAGVKWLNSTCMTCEHCELGNEPSC---LKSEYNGFTRNG- 137

Query: 129 SRFHNKKGESLYHFMGCSTFSEYTVVADVSVVAIDQTAPLESVCLLGCGVTTGYGAAVKT 188
                             +F +Y  V  +    +     L  +    C   T Y  A+K+
Sbjct: 138 ------------------SFQQYVAVDAIHAPRLPDNCDLAELAPASCAGVTVY-KAIKS 178

Query: 189 ANVQKGDTVAVFG-CGTVGLSVLQGAHQRGASRIIAIDTNDQKKDFCTQFGATDFINPTK 247
           AN++ G  +A+ G CG +G   +Q     G  R++ ID  + K +   + G   FI    
Sbjct: 179 ANIRAGQWMAITGACGGLGSVAIQYCKAMG-YRVVGIDAGEAKANLFKELGGEVFI---- 233

Query: 248 DLKENETIVAKLIEMTDGG 266
           D  +++ +VA ++  T+GG
Sbjct: 234 DFTKSKDLVADVVSATNGG 252

>YAL060W Chr1 (35155..36303) [1149 bp, 382 aa] {ON}
           BDH1NAD-dependent (R,R)-butanediol dehydrogenase,
           catalyzes oxidation of (R,R)-2,3-butanediol to
           (3R)-acetoin, oxidation of meso-butanediol to
           (3S)-acetoin, and reduction of acetoin; enhances use of
           2,3-butanediol as an aerobic carbon source
          Length = 382

 Score = 81.3 bits (199), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 65/239 (27%), Positives = 105/239 (43%), Gaps = 39/239 (16%)

Query: 62  FPCVLGHEGAGIVESVGDGVTNVKPGDHVIALYTAEC--------------QKCKFCLSG 107
            P  +GHE +GIV  VG  VT VK GDHV+    + C              + C  C  G
Sbjct: 67  LPLAMGHEMSGIVSKVGPKVTKVKVGDHVVVDAASSCADLHCWPHSKFYNSKPCDACQRG 126

Query: 108 KTNLCGAVRATQGKGVMPDGTSRFHNKKGESLYHFMGCSTFSEYTVVADVSVVAIDQTAP 167
             NLC       G GV+  G                    F+E  VV+   ++ + +  P
Sbjct: 127 SENLCTHA-GFVGLGVISGG--------------------FAEQVVVSQHHIIPVPKEIP 165

Query: 168 LESVCLLGCGVTTGYGAAVKTANVQKGDTVAVFGCGTVGLSVLQGAHQRGASRIIAIDTN 227
           L+   L+     T +  AVK +  +KG +  V G G +GL  +      GAS+I+  +  
Sbjct: 166 LDVAALVEPLSVTWH--AVKISGFKKGSSALVLGAGPIGLCTILVLKGMGASKIVVSEIA 223

Query: 228 DQKKDFCTQFGATDFINPTKDLKENETIVAKLIEMTDGGLDHTFDCTGNVNVMRSALEA 286
           +++ +   + G   F NP+K   ++  I+  L +  D G D+++DC+G      ++L+A
Sbjct: 224 ERRIEMAKKLGVEVF-NPSKHGHKSIEILRGLTKSHD-GFDYSYDCSGIQVTFETSLKA 280

>ABL033C Chr2 complement(337866..338987) [1122 bp, 373 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YMR083W
           (ADH3)
          Length = 373

 Score = 80.5 bits (197), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 97/381 (25%), Positives = 156/381 (40%), Gaps = 41/381 (10%)

Query: 6   PIECLAAVAYEAGKPQVVEQIVVDPPKAHEVRIKIVNTAVCHTDAYTLSG---ADPEGLF 62
           P    A V YE G       I V  PK +E+ + I  + VCHTD +   G     P+   
Sbjct: 29  PTTQKAVVFYEHGGELKYTDIPVPKPKPNEILVNIKYSGVCHTDLHAWKGDWAIKPK--L 86

Query: 63  PCVLGHEGAGIVESVGDGVTNVKPGDHV-IALYTAECQKCKFCLSGKTNLCGAVRATQGK 121
           P V GHEGAG+V + G  VTN + GD+  +      C +C+FC                K
Sbjct: 87  PLVGGHEGAGVVVAKGANVTNFEIGDYAGVKWLGKTCMECEFC---------------QK 131

Query: 122 GVMPDGTSRFHNKKGESLYHFMGCSTFSEYTVVADVSVVAIDQTAPLESVCLLGCGVTTG 181
           G  P       N +  +L  +    TF +Y     +    I     L  V  + C   T 
Sbjct: 132 GFEP-------NCETPTLSGYTHDGTFQQYATADAIHAAHIPPGTDLAKVAPILCAGITV 184

Query: 182 YGAAVKTANVQKGDTVAVFGCGTVGLSVLQGAHQRGASRIIAIDTNDQKKDFCTQFGATD 241
           Y  A+KTA +  G  VA+ G G    S+          R++ ID  ++K+      G   
Sbjct: 185 Y-KALKTAALIPGQWVAISGAGGGLGSLAVQYAVAMGYRVVGIDGGNEKEALFRSLGGET 243

Query: 242 FINPTKDLKENETIVAKLIEMTDGGLDHTFDCTGNVNVMRSALEACHKGWGQSVIIGVAA 301
           F+    D  +N+ IV+ + E T GG     + + + N +  ++E   +  G  V++G+  
Sbjct: 244 FV----DFHKNKDIVSAVREATGGGPHGVVNVSVSTNAILQSVEYV-RPTGTVVLVGLPP 298

Query: 302 AGQEISTRPFQLVTGRVWKGSAFGGVKGRSEMAGLIEQYKKGELKVDEFITHRRSFNEIN 361
                S     ++     KGS  G    R++    IE + +G ++    I      +++ 
Sbjct: 299 DATVKSDVLTHVLKSINIKGSYVG---NRADTKEAIEFFTRGLVQSPIKII---GLSQLE 352

Query: 362 EAFDDLHNGLCL-RTVLSFSK 381
           EA+  +  G  + R V+  S+
Sbjct: 353 EAYKAMEEGTSIGRYVVDTSR 373

>KNAG0E02590 Chr5 complement(513565..514689) [1125 bp, 374 aa] {ON}
           Anc_2.480 YMR083W
          Length = 374

 Score = 80.1 bits (196), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 74/257 (28%), Positives = 108/257 (42%), Gaps = 28/257 (10%)

Query: 13  VAYEAGKPQVVEQIVVDPPKAHEVRIKIVNTAVCHTDAYTLSGADPEGL-FPCVLGHEGA 71
           + YE G     + I V  PK +E+ + +  + VCHTD +   G  P  +  P V GHEGA
Sbjct: 34  IFYEHGGDLHYKDIPVPKPKPNEILVNVKYSGVCHTDLHAWKGDWPLSVKLPLVGGHEGA 93

Query: 72  GIVESVGDGVTNVKPGDHV-IALYTAECQKCKFCLSGKTNLCGAVRATQGKGVMPDGTSR 130
           G+V + G  V N + GD   I      C  C+ C SG  + C     +   G   DG   
Sbjct: 94  GVVVAKGSNVNNFEIGDLAGIKWLNGSCMSCELCESGHESNCEHADLS---GYTHDG--- 147

Query: 131 FHNKKGESLYHFMGCSTFSEYTVVADVSVVAIDQTAPLESVCLLGCGVTTGYGAAVKTAN 190
                           +F +Y     V    I +   L  V  + C   T Y  A+K A+
Sbjct: 148 ----------------SFQQYATADAVQAAKIPEGTNLAEVAPVLCAGITVY-KALKEAS 190

Query: 191 VQKGDTVAVFG-CGTVGLSVLQGAHQRGASRIIAIDTNDQKKDFCTQFGATDFINPTKDL 249
           +  G  V + G  G +G   +Q     G  R+I ID    K++     G   FI+ TK  
Sbjct: 191 LSPGQWVCISGAAGGLGSLAVQYGKAMGL-RVIGIDGGPGKEELFKSLGGEVFIDFTKQ- 248

Query: 250 KENETIVAKLIEMTDGG 266
           K +  +VA + + T+GG
Sbjct: 249 KTDSDMVAAIQKATNGG 265

>KLTH0A00418g Chr1 complement(34685..35755) [1071 bp, 356 aa] {ON}
           similar to uniprot|P00331 Saccharomyces cerevisiae
           YMR303C ADH2 Glucose-repressible alcohol dehydrogenase
           II involved in the production of certain carboxylate
           esters
          Length = 356

 Score = 79.7 bits (195), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 90/354 (25%), Positives = 154/354 (43%), Gaps = 42/354 (11%)

Query: 23  VEQIVVDPPKAHEVRIKIVNTAVCHTDAYTLSGADP-EGLFPCVLGHEGAGIVESVGDGV 81
           ++ I V  PKA+E+ I +  + VCH+D +   G  P +   P V GHEGAGIV ++G  V
Sbjct: 27  LKSIEVQSPKANELLINVKFSGVCHSDLHAWKGDWPTKTKLPLVGGHEGAGIVVAMGASV 86

Query: 82  TNVKPGDHV-IALYTAECQKCKFC-LSGKTNLCGAVRATQGKGVMPDGTSRFHNKKGESL 139
              K GD+  I    + C  C+ C LS + N   A       G   DG            
Sbjct: 87  RGWKIGDYAGIKWLNSCCMSCEQCELSNEPNCAYA----DISGFTRDG------------ 130

Query: 140 YHFMGCSTFSEYTVVADVSVVAIDQTAPLESVCLLGCGVTTGYGAAVKTANVQKGDTVAV 199
                  +F +Y     V    I     L  V  + C   T +  A+KTAN+  G+ VA+
Sbjct: 131 -------SFQQYATADAVQAARIPPGTNLAEVSPVLCAGITVF-KALKTANLTAGNWVAI 182

Query: 200 FG-CGTVGLSVLQGAHQRGASRIIAIDTNDQKKDFCTQFGATDFINPTKDLKENETIVAK 258
            G CG +G   +Q A   G S ++ ID+  +K+      G   F+    D  ++E +V +
Sbjct: 183 SGACGGLGSMAIQYAKAMGYS-VVGIDSGAEKEHLFNDLGGDVFL----DFSKSENLVPE 237

Query: 259 LIEMTDGGLDH--TFDCTGNVNVMRSALEACHKGWGQSVIIGVAAAGQEISTRPFQLVTG 316
           ++  T GG       + + + N + +++  C    G  V++G+ +    +S     +V  
Sbjct: 238 VVSATGGGGGAHGVLNLSASENAINTSVRFCRAN-GVIVLVGIPSGATCVSEVFDHVVKS 296

Query: 317 RVWKGSAFGGVKGRSEMAGLIEQYKKGELKVDEFITHRRSFNEINEAFDDLHNG 370
               GS+ G    R++    ++ Y +G ++    +      +++ + F  + NG
Sbjct: 297 IKIVGSSVG---NRADTREALDFYSRGLIRPAIKVA---GLSQVPQIFKKMDNG 344

>YJR159W Chr10 (736044..737117) [1074 bp, 357 aa] {ON}  SOR1Sorbitol
           dehydrogenase; expression is induced in the presence of
           sorbitol or xylose
          Length = 357

 Score = 79.3 bits (194), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 95/357 (26%), Positives = 150/357 (42%), Gaps = 47/357 (13%)

Query: 34  HEVRIKIVNTAVCHTDA-YTLSGADPEGLF--PCVLGHEGAGIVESVGDGVTNVKPGDHV 90
           H V++ I  T +C +D  Y  SG   + +   P VLGHE +G V  VGD VT VK GD V
Sbjct: 31  HYVKLAIKATGICGSDIHYYRSGGIGKYILKAPMVLGHESSGQVVEVGDAVTRVKVGDRV 90

Query: 91  IALYTAECQKCKFCLSGKTNLCGAVRATQGKGVMPDGT-SRFHNKKGESLYHFMGCSTFS 149
                   +       G+ NLC  +       +  DGT  +++    + L       ++ 
Sbjct: 91  AIEPGVPSRYSDETKEGRYNLCPHMAFAATPPI--DGTLVKYYLSPEDFLVKLPEGVSYE 148

Query: 150 EYTVVADVSVVAIDQTAPLESVCLLGCGVTTGYGAAVKTANVQKGDTVAVFGCGTVGLSV 209
           E   V  +SV                 GV +      K A V+ G  V VFG G VGL  
Sbjct: 149 EGACVEPLSV-----------------GVHSN-----KLAGVRFGTKVVVFGAGPVGLLT 186

Query: 210 LQGAHQRGASRIIAIDTNDQKKDFCTQFGATDFINPTKDLKENETIVAKLIEMTDGG--L 267
              A   GA+ +I +D  D K      FGAT+  N ++   +    +A  ++   GG   
Sbjct: 187 GAVARAFGATDVIFVDVFDNKLQRAKDFGATNTFNSSQFSTDKAQDLADGVQKLLGGNHA 246

Query: 268 DHTFDCTGNVNVMRSALEACHKGWGQSVIIGVAAAGQEISTRPFQLVTGRVWK-----GS 322
           D  F+C+G    + +A++    G G  V +G+   G+  +  P   V+G+  K       
Sbjct: 247 DVVFECSGADVCIDAAVKTTKVG-GTMVQVGM---GKNYTNFPIAEVSGKEMKLIGCFRY 302

Query: 323 AFGGVKGRSEMAGLIEQYKKGELKVDEFITHRRSFNEINEAFDD--LHNGLCLRTVL 377
           +FG  +    +         G++ V   ITH+  F +  +A+D    H G  ++T++
Sbjct: 303 SFGDYRDAVNLVA------TGKVNVKPLITHKFKFEDAAKAYDYNIAHGGEVVKTII 353

>YDL246C Chr4 complement(8683..9756) [1074 bp, 357 aa] {ON}
           SOR2Protein of unknown function; protein sequence is 99%
           identical to the Sor1p sorbitol dehydrogenase;
           computational analysis of large-scale protein-protein
           interaction data also suggests a role in fructose or
           mannose metabolism
          Length = 357

 Score = 79.0 bits (193), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 97/366 (26%), Positives = 152/366 (41%), Gaps = 65/366 (17%)

Query: 34  HEVRIKIVNTAVCHTDA-YTLSGADPEGLF--PCVLGHEGAGIVESVGDGVTNVKPGDHV 90
           H V++ I  T +C +D  Y  SG   + +   P VLGHE +G V  VGD VT VK GD V
Sbjct: 31  HYVKLAIKATGICGSDIHYYRSGGIGKYILKAPMVLGHESSGQVVEVGDAVTRVKVGDRV 90

Query: 91  IALYTAECQKCKFCLSGKTNLCGAVRATQGKGVMPDGTSRFHNKKGESLYHFMGCSTFSE 150
                                           + P   SR+ ++  E  Y+      F+ 
Sbjct: 91  -------------------------------AIEPGVPSRYSDETKEGSYNLCPHMAFAA 119

Query: 151 YTVVADVSVVAIDQTAPLESVCLLGCGVTTGYGAAV----------KTANVQKGDTVAVF 200
            T   D ++V     +P + +  L  GV+   GA V          K A V+ G  V VF
Sbjct: 120 -TPPIDGTLVKY-YLSPEDFLVKLPEGVSYEEGACVEPLSVGVHSNKLAGVRFGTKVVVF 177

Query: 201 GCGTVGLSVLQGAHQRGASRIIAIDTNDQKKDFCTQFGATDFINPTKDLKENETIVAKLI 260
           G G VGL     A   GA+ +I +D  D K      FGAT+  N ++   +    +A  +
Sbjct: 178 GAGPVGLLTGAVARAFGATDVIFVDVFDNKLQRAKDFGATNTFNSSQFSTDKAQDLADGV 237

Query: 261 EMTDGG--LDHTFDCTGNVNVMRSALEACHKGWGQSVIIGVAAAGQEISTRPFQLVTGRV 318
           +   GG   D  F+C+G    + +A++    G G  V +G+   G+  +  P   V+G+ 
Sbjct: 238 QKLLGGNHADVVFECSGADVCIDAAVKTTKVG-GTMVQVGM---GKNYTNFPIAEVSGKE 293

Query: 319 WK-----GSAFGGVKGRSEMAGLIEQYKKGELKVDEFITHRRSFNEINEAFDD--LHNGL 371
            K       +FG  +    +         G++ V   ITH+  F +  +A+D    H G 
Sbjct: 294 MKLIGCFRYSFGDYRDAVNLVA------TGKVNVKPLITHKFKFEDAAKAYDYNIAHGGE 347

Query: 372 CLRTVL 377
            ++T++
Sbjct: 348 VVKTII 353

>Smik_48.1 Chr48 complement(1..1074) [1074 bp, 357 aa] {ON} YJR159W
           (REAL)
          Length = 357

 Score = 79.0 bits (193), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 98/360 (27%), Positives = 152/360 (42%), Gaps = 51/360 (14%)

Query: 34  HEVRIKIVNTAVCHTDA-YTLSGADPEGLF--PCVLGHEGAGIVESVGDGVTNVKPGDHV 90
           H V++ I  T +C +D  Y  SG   + +   P VLGHE +G V  VG+ VT VK GD V
Sbjct: 31  HYVKLAIKATGICGSDVHYYRSGGIGKYILKAPMVLGHESSGEVVEVGNAVTRVKVGDRV 90

Query: 91  IALYTAECQKCKFCLSGKTNLCGAVRATQGKGVMPDGT-SRFHNKKGESLYHFMGCSTFS 149
                   +       G+ NLC  +       +  DGT  +++    + L       ++ 
Sbjct: 91  AIEPGVPSRYSDETKEGRYNLCPHMAFAATPPI--DGTLVKYYLSPEDFLVKLPEGVSYE 148

Query: 150 EYTVVADVSVVAIDQTAPLESVCLLGCGVTTGYGAAVKTANVQKGDTVAVFGCGTVGLSV 209
           E   V  +SV                 GV +      K A V+    V VFG G VGL  
Sbjct: 149 EGACVEPLSV-----------------GVHSN-----KLAGVRFSTRVVVFGAGPVGL-- 184

Query: 210 LQGAHQR--GASRIIAIDTNDQKKDFCTQFGATDFINPTKDLKENETIVAKLIEMTDGG- 266
           L GA  R  GAS ++ +D  D K      FGAT+  N +K   +    +A  +E   GG 
Sbjct: 185 LTGAVARAFGASDVVFVDVFDNKLQRAKDFGATNTFNSSKIPTDKAQELASEVEKLLGGN 244

Query: 267 -LDHTFDCTGNVNVMRSALEACHKGWGQSVIIGVAAAGQEISTRPFQLVTGRVWK----- 320
             D  F+C+G    + + ++    G G  V +G+   G+  +  P   V+G+  K     
Sbjct: 245 HADVVFECSGADVCIDAGVKVTKVG-GTMVQVGM---GKNYTNFPIAEVSGKEMKLIGCF 300

Query: 321 GSAFGGVKGRSEMAGLIEQYKKGELKVDEFITHRRSFNEINEAFDD--LHNGLCLRTVLS 378
             +FG  +    +         G++ V   ITHR  F +  +A+D    H G  ++T+++
Sbjct: 301 RYSFGDYRDAVNLVA------TGKVNVKPLITHRFKFEDAAKAYDYNISHGGDVVKTIIA 354

>ABR229C Chr2 complement(831895..832956) [1062 bp, 353 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR070C
           (XYL2)
          Length = 353

 Score = 78.2 bits (191), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 96/359 (26%), Positives = 140/359 (38%), Gaps = 45/359 (12%)

Query: 12  AVAYEAGKPQVVEQIVVDPPKAHEVRIKIVNTAVCHTDA-YTLSGADPEGLF----PCVL 66
           A+ YE     V+E    DP   H V++KI  T +C +D  Y L G+   G F    P VL
Sbjct: 16  AIVYEHRPVPVIE----DP---HYVKVKIEKTGICGSDVHYYLHGSI--GPFVVRSPMVL 66

Query: 67  GHEGAGIVESVGDGVTNVKPGDHVIALYTAECQKCKFCLSGKTNLCGAVRATQGKGVMPD 126
           GHE +G V  VG  VT V+ GD V        +  +   SG  NLC  +R         D
Sbjct: 67  GHESSGTVVEVGSDVTRVRIGDRVAIEPGVPSRYSEETKSGHYNLCREMRFAATPPY--D 124

Query: 127 GTSRFHNKKGESLYHFMGCSTFSEYTVVADVSVVAIDQTAPLESVCLLGCGVTTGYGAAV 186
           G                   T  +Y +  +  +V +  +  LE   L  C        A 
Sbjct: 125 G-------------------TLVKYYISPEDFLVKLPDSVSLEEGAL--CEPLAVAVHAN 163

Query: 187 KTANVQKGDTVAVFGCGTVGLSVLQGAHQRGASRIIAIDTNDQKKDFCTQFGATDFINPT 246
           + A  Q    V VFG G VGL     A   GA+ +  +D +  K       G T  ++ +
Sbjct: 164 RLAGTQFPSRVVVFGAGPVGLLTASVAKAFGATTVAIVDISKHKLCVAPALGVTHPVD-S 222

Query: 247 KDLKENETIVAKLIEMTDGGLDHTFDCTGNVNVMRSALEACHKGWGQSVIIGVAAAGQEI 306
            D    E +  KL       +D  FDC+G    + +A+  C  G G  V +G  ++   +
Sbjct: 223 SDCSSPEALANKLRAELRSDVDIAFDCSGAEICIAAAVLICRPG-GTHVQVG--SSRDYV 279

Query: 307 STRPFQLVTGRVWKGSAFGGVK-GRSEMAGLIEQYKKGELKVDEFITHRRSFNEINEAF 364
           S   F L    V +    G  +    + A  +E      +     +THR  F+   EA+
Sbjct: 280 S---FPLAEATVKQLRILGSFRYAAGDYATAVELLASKRVDAARLVTHRFPFDRAVEAY 335

>Kwal_55.20564 s55 complement(459253..459903) [651 bp, 216 aa] {ON}
           YOL086C (ADH1) - Alcohol dehydrogenase [contig 146] FULL
          Length = 216

 Score = 75.5 bits (184), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 63/217 (29%), Positives = 92/217 (42%), Gaps = 27/217 (12%)

Query: 24  EQIVVDPPKAHEVRIKIVNTAVCHTDAYTLSGADP-EGLFPCVLGHEGAGIVESVGDGVT 82
           + I V  P + E+ I +  + VCHTD +   G  P     P V GHEGAG+V ++G+ V 
Sbjct: 22  KDIPVPKPSSTEILINVKYSGVCHTDLHAWKGDWPLPTKLPLVGGHEGAGVVVALGENVK 81

Query: 83  NVKPGDHV-IALYTAECQKCKFCLSGKTNLCGAVRATQGKGVMPDGTSRFHNKKGESLYH 141
             K GD   I      C  C++C  G  + C     +   G   DG              
Sbjct: 82  GWKVGDLAGIKWLNGSCMACEYCELGNESNCPHADLS---GYTHDG-------------- 124

Query: 142 FMGCSTFSEYTVVADVSVVAIDQTAPLESVCLLGCGVTTGYGAAVKTANVQKGDTVAVFG 201
                +F +Y     V    I Q   L  V  + C   T Y  A+K+A+++ G  VA+ G
Sbjct: 125 -----SFQQYATADAVQAAKIPQGTDLAQVAPILCAGITVY-KALKSADLKAGQWVAISG 178

Query: 202 -CGTVGLSVLQGAHQRGASRIIAIDTNDQKKDFCTQF 237
            CG +G   +Q A   G  R++ ID  D K+    + 
Sbjct: 179 ACGGLGSLAVQYARAMG-YRVLGIDGGDDKRKLFKEL 214

>KLTH0D00616g Chr4 (59883..61031) [1149 bp, 382 aa] {ON} similar to
           uniprot|P39713 Saccharomyces cerevisiae YAL061W putative
           polyol dehydrogenase
          Length = 382

 Score = 77.8 bits (190), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 99/399 (24%), Positives = 157/399 (39%), Gaps = 75/399 (18%)

Query: 10  LAAVAYEAGKPQVVEQIVVDPPKAHE--VRIKIVNTAVCHTD----------------AY 51
           + A+AY   K       +  P  +HE  V I +    VC +D                 +
Sbjct: 1   MRALAYFGQKDIRFTDSLAQPQVSHEDEVEIDVSWCGVCGSDLHEYLDGPIFFPANGKTH 60

Query: 52  TLSGADPEGLFPCVLGHEGAGIVESVGDGVTNVKPGDHVIALYTAECQK----------- 100
            +SG   +GL P  +GHE +GIV  VG  V+ VK GDHV+      C+            
Sbjct: 61  AMSG---QGL-PQAMGHEMSGIVSKVGSDVSKVKVGDHVVVGACCTCEDRARWPDVKHER 116

Query: 101 ---CKFCLSGKTNLCGAVRATQGKGVMPDGTSRFHNKKGESLYHFMGCST--FSEYTVVA 155
              C  C +G  N C  +                        +  +GC +  F+E  V++
Sbjct: 117 EGLCIACKTGNPNCCTDLG-----------------------FCGLGCQSGGFAEKIVLS 153

Query: 156 DVSVVAIDQTAPLESVCLLGCGVTTGYGAAVKTANVQKGDTVAVFGCGTVGLSVLQGAHQ 215
           + +VV I  + PL+   L+     + +  AV+ + +Q G T  V G G +GL+ +     
Sbjct: 154 ERNVVKIPNSLPLDVAALVEPISVSWH--AVRISKLQPGQTALVLGAGPIGLAAVLALQS 211

Query: 216 RGASRIIAIDTNDQKKDFCTQFGATDFINPTKDLKENETIVAKLIEMTDG--GLDHTFDC 273
            GA  II  +  D ++      GA  F NPT   +  + ++  L ++  G  G + ++DC
Sbjct: 212 HGAGTIIVSEPADTRRQKAEALGAQTF-NPT---EHGDNVIEALRKLAPGGEGFNFSYDC 267

Query: 274 TGNVNVMRSALEACHKGWGQSVIIGVAAAG-QEISTRPFQLVTG-RVWKGSAFGGVKGRS 331
            G      + L   H    + V + +A  G + I   P  + T  R   GS     +   
Sbjct: 268 CGTSETFSAGL---HTLTPKGVAVNIAVWGPKPIDFYPMDVTTSERFVTGSICYTTQDFE 324

Query: 332 EMAGLIEQYKKGELKVDEFITHR-RSFNEINEAFDDLHN 369
           E+   +++ K    KV   IT R R  N       DL N
Sbjct: 325 EVVDAMDKGKIDINKVKTMITGRERIENGFENGIMDLIN 363

>Smik_1.6 Chr1 (18115..19263) [1149 bp, 382 aa] {ON} YAL060W (REAL)
          Length = 382

 Score = 77.4 bits (189), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 62/239 (25%), Positives = 105/239 (43%), Gaps = 39/239 (16%)

Query: 62  FPCVLGHEGAGIVESVGDGVTNVKPGDHVIALYTAEC--------------QKCKFCLSG 107
            P  +GHE +GIV  VG  VT VK GDHV+    + C              + C+ C  G
Sbjct: 67  LPLAMGHEMSGIVAEVGPKVTKVKVGDHVVVDAASSCADLHCWPQSKHYSSKPCEACKKG 126

Query: 108 KTNLCGAVRATQGKGVMPDGTSRFHNKKGESLYHFMGCSTFSEYTVVADVSVVAIDQTAP 167
             NLC       G GV+  G                    F+E   V++  ++ + +  P
Sbjct: 127 SENLC-THGGFIGLGVISGG--------------------FAEQVAVSEHHIIPVPKEIP 165

Query: 168 LESVCLLGCGVTTGYGAAVKTANVQKGDTVAVFGCGTVGLSVLQGAHQRGASRIIAIDTN 227
           L+   L+     T +  AVK +  +KG +  V G G +GL  +      GA +I+  +  
Sbjct: 166 LDVAALVEPLSVTWH--AVKISGFKKGSSALVLGAGPIGLCTILVLKGMGAGKIVVSEVA 223

Query: 228 DQKKDFCTQFGATDFINPTKDLKENETIVAKLIEMTDGGLDHTFDCTGNVNVMRSALEA 286
           +++ +     G   F NP+K  +++  ++  L +  D G D+++DC+G      ++L+A
Sbjct: 224 ERRIEMAKNLGVEVF-NPSKHGQKSIEVLRGLTKSHD-GFDYSYDCSGIQVTFETSLKA 280

>TDEL0H04460 Chr8 complement(769988..771136) [1149 bp, 382 aa] {ON}
           Anc_7.2 YAL061W
          Length = 382

 Score = 76.6 bits (187), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 95/369 (25%), Positives = 148/369 (40%), Gaps = 68/369 (18%)

Query: 35  EVRIKIVNTAVCHTDAYTLS----------GADPEG--LFPCVLGHEGAGIVESVGDGVT 82
           EV I++    +C TD +  S          G+ P      P  +GHE +GIV  +G  VT
Sbjct: 28  EVLIEVSWAGICGTDLHEYSDGPIFMPQDGGSHPLSGKKLPQPMGHEMSGIVSKIGSKVT 87

Query: 83  NVKPGDHVIALYTAEC--------------QKCKFCLSGKTNLCGAVRATQGKGVMPDGT 128
            VK GDHV+      C              + C  C  G  N+C     T G G    G 
Sbjct: 88  KVKVGDHVVVEAGCSCMDVKRWKESPLKGGKTCSACEKGLVNICAHACFT-GLGTSGGG- 145

Query: 129 SRFHNKKGESLYHFMGCSTFSEYTVVADVSVVAIDQTAPLESVCLLGCGVTTGYGAAVKT 188
                              F+E   V+    + I +  PL+   L+     T + A  K 
Sbjct: 146 -------------------FAERLTVSQDHCIPIPKDLPLDVAALVEPLSVTWHAA--KV 184

Query: 189 ANVQKGDTVAVFGCGTVGLSVLQGAHQRGASRIIAIDTNDQKKDFCTQFGATDFINPTKD 248
           A  QKG T  V G G +GL+ +      GAS+I+  +    ++D     G   F NP   
Sbjct: 185 AGFQKGQTACVLGAGPIGLATILTLKGLGASKIVVSELAQIRRDMAASMGVEVF-NPA-- 241

Query: 249 LKENETIVAKLIEMTDG--GLDHTFDCTGNVNVMRSALEACHKGWGQSVIIGVAAAGQE- 305
             E++  +A+L ++ +G  G D  FDC+G      +AL   H    + V + +A  G + 
Sbjct: 242 --EHKDAIAELRKIPEGATGFDAAFDCSGVKATFNTAL---HVTTFRGVSVNIAIWGNKP 296

Query: 306 ISTRPFQL-VTGRVWKGSAFGGVKGRSEMAGLIEQYKKGELKVD---EFITHRRSFNE-I 360
           I   P  + +  +   GS    V+   E   ++E    GE+ +D   + IT ++   +  
Sbjct: 297 IDYYPMDITLQEKRLTGSIGYTVQDFKE---VVEAIHTGEIPIDDCRQMITGKQKLEDGW 353

Query: 361 NEAFDDLHN 369
            + F +L N
Sbjct: 354 EKGFVELMN 362

>Skud_1.3 Chr1 (11174..12322) [1149 bp, 382 aa] {ON} YAL060W (REAL)
          Length = 382

 Score = 76.3 bits (186), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 62/239 (25%), Positives = 103/239 (43%), Gaps = 39/239 (16%)

Query: 62  FPCVLGHEGAGIVESVGDGVTNVKPGDHVIALYTAEC--------------QKCKFCLSG 107
            P  +GHE +GI+  VG  VT VK GDHV+    + C              + C+ C  G
Sbjct: 67  LPLAMGHEMSGIIAKVGPRVTKVKVGDHVVVDAGSSCADLHCWPHSKYYNSKPCEACKKG 126

Query: 108 KTNLCGAVRATQGKGVMPDGTSRFHNKKGESLYHFMGCSTFSEYTVVADVSVVAIDQTAP 167
             NLC A     G GV+  G                    F+E  VV++  ++ + +  P
Sbjct: 127 SENLC-AHSGFVGLGVISGG--------------------FAEQVVVSEHHIIPVPKEIP 165

Query: 168 LESVCLLGCGVTTGYGAAVKTANVQKGDTVAVFGCGTVGLSVLQGAHQRGASRIIAIDTN 227
           L+   L+     T +  AVK +  +KG +  V G G +GL  +      GA +I+  +  
Sbjct: 166 LDVAALVEPLSVTWH--AVKLSGFKKGSSALVLGAGPIGLCTILVLKGMGAGKIVVSEVA 223

Query: 228 DQKKDFCTQFGATDFINPTKDLKENETIVAKLIEMTDGGLDHTFDCTGNVNVMRSALEA 286
           +++           F NP +   ++  ++  L E  D G D+++DC+G      ++L+A
Sbjct: 224 ERRLKMAKSLDVEVF-NPAQHGHKSVELLRGLTESHD-GFDYSYDCSGIQATFETSLKA 280

>Kpol_1049.18 s1049 complement(35191..36351) [1161 bp, 386 aa] {ON}
           complement(35191..36351) [1161 nt, 387 aa]
          Length = 386

 Score = 73.2 bits (178), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 65/242 (26%), Positives = 102/242 (42%), Gaps = 42/242 (17%)

Query: 62  FPCVLGHEGAGIVESVGDGVTNVKPGDHVIALYTAEC--------------QKCKFCLSG 107
            P  +GHE +GI+ SVG G    K GDHV+   TA C                C+ C +G
Sbjct: 67  LPQAMGHEISGIISSVGPGCKKFKIGDHVVVEPTATCIDRYRWPNAPNRDTPMCEACRNG 126

Query: 108 KTNLCGAVRATQGKGVMPDGTSRFHNKKGESLYHFMGCSTFSEYTVVADVSVVAIDQTAP 167
             N+C  +  T G GV   G                    F+E  V+ +     I    P
Sbjct: 127 MPNICKYLGLT-GAGVEGGG--------------------FAEKMVINEHHCHKIPHHMP 165

Query: 168 LESVCLLGCGVTTGYGAAVKTANVQKGDTVAVFGCGTVGLSVLQGAHQRGASRIIAIDTN 227
           L+   L+       +  AVK ++ ++G +V + G G +GL  +      G   I+  +  
Sbjct: 166 LDVASLIQPISVCWH--AVKVSHYKQGGSVLIVGGGPIGLGTILALKGFGCEDIVVSEPA 223

Query: 228 DQKKDFCTQFGATDFINPTKDLKENETIVAKLIEMTDG--GLDHTFDCTGNVNVMRSALE 285
             +++   + GA  F +P+    +N   +  L EM  G  G D+TFDC+G    ++ A+E
Sbjct: 224 LIRRELAEKMGARVF-DPSNMSLDNS--IKTLTEMAPGSQGFDYTFDCSGIPATLKVAIE 280

Query: 286 AC 287
            C
Sbjct: 281 CC 282

>SAKL0D14894g Chr4 complement(1230497..1231654) [1158 bp, 385 aa]
           {ON} similar to uniprot|P39713 Saccharomyces cerevisiae
           YAL061W putative polyol dehydrogenase
          Length = 385

 Score = 72.8 bits (177), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 63/241 (26%), Positives = 104/241 (43%), Gaps = 42/241 (17%)

Query: 62  FPCVLGHEGAGIVESVGDGVTNVKPGDHVIALYTAEC--------------QKCKFCLSG 107
            P  +GHE AG+V  +G GV   + GDHV+   T+ C              + C  C  G
Sbjct: 67  LPQAMGHEMAGVVSKIGPGVQGFEVGDHVVVEPTSTCLDRYRFPNSKHSGEEPCAACKRG 126

Query: 108 KTNLCGAVRATQGKGVMPDGTSRFHNKKGESLYHFMGCSTFSEYTVVADVSVVAIDQTAP 167
             N+C  +    G GV   G                    FSE  V+    V+ I +  P
Sbjct: 127 LYNICSHL-GLCGVGVQSGG--------------------FSERVVMNQKHVIKIPKHIP 165

Query: 168 LESVCLLGCGVTTGYGAAVKTANVQKGDTVAVFGCGTVGLSVLQGAHQRGASRIIAIDTN 227
           L+   L+     + +  A++ + +  G +  V G G +GL  +      GAS+I+  +  
Sbjct: 166 LDVAALVQPLAVSWH--AIRISGLTAGKSALVVGGGPIGLGTILALQAYGASKIVVSEPA 223

Query: 228 DQKKDFCTQFGATDFINPTKDLKENETIVAKLIEMTDG--GLDHTFDCTGNVNVMRSALE 285
             +++     GA  F +PT + +E+E  V  L ++  G  G D++FDC+G     R+++ 
Sbjct: 224 KNRRELAKLMGAEVF-DPT-EWEEHEA-VEYLRKVAPGGDGFDYSFDCSGLPVTFRASVH 280

Query: 286 A 286
           A
Sbjct: 281 A 281

>Suva_1.7 Chr1 (12310..13458) [1149 bp, 382 aa] {ON} YAL060W (REAL)
          Length = 382

 Score = 72.0 bits (175), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 60/239 (25%), Positives = 104/239 (43%), Gaps = 39/239 (16%)

Query: 62  FPCVLGHEGAGIVESVGDGVTNVKPGDHVIALYTAEC--------------QKCKFCLSG 107
            P  +GHE +GI+  VG  VT VK GDHV+    + C              + C  C  G
Sbjct: 67  LPQAMGHEMSGIIAKVGPKVTKVKVGDHVVVQAGSSCADLHCWPHSKHYNSKPCDACKKG 126

Query: 108 KTNLCGAVRATQGKGVMPDGTSRFHNKKGESLYHFMGCSTFSEYTVVADVSVVAIDQTAP 167
             NLC       G GV+  G                    F+E  VV++  ++ + +  P
Sbjct: 127 CENLCTHA-GFIGLGVISGG--------------------FAEQVVVSEHHIIPVPKEIP 165

Query: 168 LESVCLLGCGVTTGYGAAVKTANVQKGDTVAVFGCGTVGLSVLQGAHQRGASRIIAIDTN 227
           L+   L+     T +  AV+ +  +KG +  V G G +GL  +      GA +I+  +  
Sbjct: 166 LDVAALVEPLSVTWH--AVRLSGFKKGSSALVLGAGPIGLCTILVLKGMGAGQIVVSEVA 223

Query: 228 DQKKDFCTQFGATDFINPTKDLKENETIVAKLIEMTDGGLDHTFDCTGNVNVMRSALEA 286
           +++ +   + G   F +P K  +++   +  L +  D G D+++DC+G      ++L+A
Sbjct: 224 ERRMELARRLGVEIF-DPRKHGEKSVESLRALTKSHD-GFDYSYDCSGIQATFDASLKA 280

>Kwal_26.6739 s26 (46044..47192) [1149 bp, 382 aa] {ON} YAL060W
           (BDH1) - (2R,3R)-2,3-butanediol dehydrogenase [contig
           44] FULL
          Length = 382

 Score = 71.2 bits (173), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 57/232 (24%), Positives = 102/232 (43%), Gaps = 25/232 (10%)

Query: 62  FPCVLGHEGAGIVESVGDGVTNVKPGDHVIALYTAECQ---KCKFCLSGKTNLCGAVRAT 118
            P  +GHE +G+V  +G GV N+K GDHV+   T  C+   +           C A +  
Sbjct: 67  LPQAMGHEMSGVVAKIGPGVKNIKVGDHVVVETTGTCKDRYRWPDVKHASDEECAACK-- 124

Query: 119 QGKGVMPDGTSRFHNKKGESLYHFMGCST--FSEYTVVADVSVVAIDQTAPLESVCLLGC 176
                       F+N   E  +  +GC +  F+E  V+++  VV + +  PL+   L+  
Sbjct: 125 ----------KDFYNCCSELGFCGLGCHSGGFAEKVVISEKHVVKVPKDIPLDVAALVEP 174

Query: 177 GVTTGYGAAVKTANVQKGDTVAVFGCGTVGLSVLQGAHQRGASRIIAIDTNDQKKDFCTQ 236
              + +  AV+ + ++ G +  + G G +GL+ +      GA  I+  + +  ++     
Sbjct: 175 LAVSWH--AVRISQLKAGQSALILGAGPIGLATVLALQGHGAGTIVVSEPSASRRKQAEA 232

Query: 237 FGATDFINPTKDLKENETIVAKLIEMTDG--GLDHTFDCTGNVNVMRSALEA 286
            GA  F NP       +  V +L ++  G  G D ++DC+G      + L A
Sbjct: 233 LGALTF-NP---FDHGDKAVDELRKIPPGSDGFDFSYDCSGLKATFNTGLYA 280

>NCAS0A07670 Chr1 complement(1527273..1528592) [1320 bp, 439 aa]
           {ON} 
          Length = 439

 Score = 71.2 bits (173), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 60/241 (24%), Positives = 99/241 (41%), Gaps = 39/241 (16%)

Query: 59  EGLFPCVLGHEGAGIVESVGDGVTNVKPGDHVIALYTAEC--------------QKCKFC 104
           EGL P  +GHE AG +   G GVT  K GD V+   T  C              + C  C
Sbjct: 104 EGL-PQAMGHEIAGTIIECGPGVTKFKVGDRVVVEPTGTCKDRYRWPNSPNVDKEPCAAC 162

Query: 105 LSGKTNLCGAVRATQGKGVMPDGTSRFHNKKGESLYHFMGCSTFSEYTVVADVSVVAIDQ 164
             G  N+C  +    G GV   G                    F+E  V+ +     +  
Sbjct: 163 KKGLYNICSNL-GLVGAGVQSGG--------------------FAERLVMNERQCYKVPD 201

Query: 165 TAPLESVCLLGCGVTTGYGAAVKTANVQKGDTVAVFGCGTVGLSVLQGAHQRGASRIIAI 224
              ++   L+     + +  AV+ +  +KG +V + G G +GL  +   +  G S ++  
Sbjct: 202 HMSMDVAALIQPIAVSWH--AVRVSKFKKGASVLIVGAGPIGLGTILALNGHGVSEVVVS 259

Query: 225 DTNDQKKDFCTQFGATDFINPTKDLKENETIVAKLIEMTDGGLDHTFDCTGNVNVMRSAL 284
           +    ++DF  + GA  +    KD  E+   +  +    D G D+ FDC+GN   +++A+
Sbjct: 260 EPAKIRRDFAEKMGAIVYDPSAKDHDESIKYLRSIAPGGD-GFDYAFDCSGNPATLKAAI 318

Query: 285 E 285
           E
Sbjct: 319 E 319

>KLLA0D05511g Chr4 complement(476363..477427) [1065 bp, 354 aa] {ON}
           similar to uniprot|P35497 Saccharomyces cerevisiae
           YJR159W SOR1 Sorbitol dehydrogenase expression is
           induced in the presence of sorbitol
          Length = 354

 Score = 69.3 bits (168), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 95/347 (27%), Positives = 144/347 (41%), Gaps = 42/347 (12%)

Query: 33  AHEVRIKIVNTAVCHTDA-YTLSGADPEGLF--PCVLGHEGAGIVESVGDGVTNVKPGDH 89
           +H V+I +  T +C +D  Y   G+  E +   P VLGHE +G+V  VG  VT V+ GD 
Sbjct: 29  SHYVKIHVKKTGICGSDIHYYTHGSIGEFVVKKPMVLGHESSGVVVEVGKDVTLVQVGDR 88

Query: 90  VIALYTAECQKCKFCLSGKTNLCG--AVRATQGKGVMPDGTSRFHNKKGESLYHFMGCST 147
           V        +      SG  NLC   A  AT       DGT                   
Sbjct: 89  VAIEPGVPSRYSDETKSGHYNLCPHMAFAATPPY----DGT------------------L 126

Query: 148 FSEYTVVADVSVVAIDQTAPLESVCL--LGCGVTTGYGAAVKTANVQKGDTVAVFGCGTV 205
              Y    D  V   D  +  E  C   L  GV      A + A    G  V VFG G V
Sbjct: 127 VKYYLAPEDFLVKLPDHVSFEEGACAEPLAVGV-----HANRLAETSFGKNVVVFGAGPV 181

Query: 206 GLSVLQGAHQRGASRIIAIDTNDQKKDFCTQFGATDFINPTKDLKENETIVAKLIEMTDG 265
           GL     A   GAS ++ +D  + K +    FGAT+ IN TK   E+E       E+   
Sbjct: 182 GLVTGAVAAAFGASAVVYVDVFENKLERSKDFGATNTINSTKYKSEDELTEVIKSELKGE 241

Query: 266 GLDHTFDCTGNVNVMRSALEACHKGWGQSVIIGVAAAGQEISTRPFQLVTGRVWKGSAFG 325
             +   DC+G    +R+A++    G G  V +G+   G++    P  ++  +  +    G
Sbjct: 242 QPEIAIDCSGAEICIRTAIKVLKAG-GSYVQVGM---GKDNINFPIAMIGAKELR--VLG 295

Query: 326 GVKGR-SEMAGLIEQYKKGELKVDEFITHRRSFNEINEAFD-DLHNG 370
             +   ++    ++   +G++ V + ITH   F E  +A++ +L +G
Sbjct: 296 SFRYYFNDYKIAVKLISEGKVNVKKMITHTFKFEEAIDAYNFNLEHG 342

>KAFR0I00160 Chr9 (33043..34200) [1158 bp, 385 aa] {ON} Anc_7.2
           YAL061W
          Length = 385

 Score = 68.9 bits (167), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 66/302 (21%), Positives = 121/302 (40%), Gaps = 43/302 (14%)

Query: 62  FPCVLGHEGAGIVESVGDGVTNVKPGDHVIALYTAECQK--------------CKFCLSG 107
            P  +GHE AG V  +G  VT  K GDHV+      C+               C  C  G
Sbjct: 67  LPQAMGHEIAGTVVKIGPKVTKFKVGDHVVVQPNGTCKDRYRWPHSPHVNKPWCSACKKG 126

Query: 108 KTNLCGAVRATQGKGVMPDGTSRFHNKKGESLYHFMGCSTFSEYTVVADVSVVAIDQTAP 167
             N+C  +    G GV   G +                    E   + +     + +  P
Sbjct: 127 HYNVCSNL-GLIGNGVQSGGCA--------------------ERMCINESHCFKVPKDMP 165

Query: 168 LESVCLLGCGVTTGYGAAVKTANVQKGDTVAVFGCGTVGLSVLQGAHQRGASRIIAIDTN 227
           ++   L+     + +  A+K A  ++G +V V G G +GL  L      G S I+  +  
Sbjct: 166 MDIAALIQPIAVSWH--AIKVARFKRGGSVLVIGGGPIGLCTLLALQGHGCSDIVVSEPA 223

Query: 228 DQKKDFCTQFGATDFINPTKDLKENETIVAKLIEMTDGGLDHTFDCTGNVNVMRSALEAC 287
             +++   + GAT +     + ++N   + K+I   D G D+ FD +G    + +A+E C
Sbjct: 224 KVRRELAERMGATTYDPSQHNTEKNIQNLRKMILGGD-GFDYVFDNSGTPETLETAIE-C 281

Query: 288 HKGWGQSVIIGVAAAGQEISTRPFQLVT-GRVWKGSAFGGVKGRSEMAGLIEQYKKGELK 346
               G +V + +    + +   P  +    +++ GS       + +  G+I+ +++G + 
Sbjct: 282 LTVRGTAVNVAMWPPHKRVEFSPMAVTKEEKIYTGSM---CYTQFDFEGVIDAFERGLID 338

Query: 347 VD 348
            D
Sbjct: 339 KD 340

>SAKL0D14872g Chr4 complement(1226093..1227244) [1152 bp, 383 aa]
           {ON} highly similar to gnl|GLV|KLLA0F00506g
           Kluyveromyces lactis KLLA0F00506g and similar to YAL060W
           uniprot|P39714 Saccharomyces cerevisiae YAL060W BDH1
           NAD- dependent (2R 3R)-2 3-butanediol dehydrogenase a
           zinc- containing medium-chain alcohol dehydrogenase
           produces 2 3- butanediol from acetoin during
           fermentation and allows using 2 3-butanediol as a carbon
           source during aerobic growth
          Length = 383

 Score = 67.8 bits (164), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 63/237 (26%), Positives = 101/237 (42%), Gaps = 34/237 (14%)

Query: 62  FPCVLGHEGAGIVESVGDGVT-NVKPGDHVIALYTAEC---QKCKFCLSGKTNLCGAVRA 117
            P  +GHE +GIV  VG GV  + K GDHV+   T  C    +     S K   C A + 
Sbjct: 67  LPQPMGHEMSGIVSKVGPGVKGDYKVGDHVVVEATCTCLDRYRWPKIESSKLPPCSACK- 125

Query: 118 TQGKGVMPDGTSRFHNKKGESLYHFMGCST------FSEYTVVADVSVVAIDQTAPLESV 171
              +G+                 H   C        FSE  V+++  V+ I +  PL+  
Sbjct: 126 ---RGIY------------NCCTHLGFCGLGAHGGGFSEKVVISEQHVIKIPKEIPLDIA 170

Query: 172 CLLGCGVTTGYGAAVKTANVQKGDTVAVFGCGTVGLSVLQGAHQRGASRIIAIDTNDQKK 231
            L+     + +  AVK +N++ G +  V G G +GL+ +      GA +I+  +    ++
Sbjct: 171 ALVEPISVSWH--AVKISNLKPGQSALVLGAGPIGLATILALQGHGAGKIVVSEPAQIRR 228

Query: 232 DFCTQFGATDFINPTKDLKENETIVAKLIEMTDG--GLDHTFDCTGNVNVMRSALEA 286
           +   + G   F NP    +  E  V +L ++  G  G D +FDC+G      + L A
Sbjct: 229 EQAAKLGVETF-NP---FEHGEKAVEELRKIPPGGDGFDFSFDCSGMKATFDTGLHA 281

>KLLA0F00528g Chr6 complement(40081..41226) [1146 bp, 381 aa] {ON}
           similar to uniprot|P39713 Saccharomyces cerevisiae
           YAL061W putative polyol dehydrogenase
          Length = 381

 Score = 66.2 bits (160), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 73/280 (26%), Positives = 111/280 (39%), Gaps = 53/280 (18%)

Query: 32  KAHEVRIKIVNTAVCHTDAYTLSGADPEGLFP--------------CVLGHEGAGIVESV 77
           K  +V I IV   +C TD + L   D    FP                +GHE AG+V  V
Sbjct: 25  KPDDVLIDIVWCGICGTDLHEL--LDGPNFFPKDGETHEISGRGLPQAMGHEMAGVVSQV 82

Query: 78  GDGVTNVKPGDHVIALYTAECQK----------CKFCLSGKTNLCGAVRATQGKGVMPDG 127
           G  VT  +PGDHV+   T  CQ           CK C  G  N+C  +    G GV   G
Sbjct: 83  GSSVTKFQPGDHVVVEPTGTCQDRERYNTKGETCKACKRGMHNVCVHL-GLCGCGVQSGG 141

Query: 128 TSRFHNKKGESLYHFMGCSTFSEYTVVADVSVVAIDQTAPLESVCLLGCGVTTGYGAAVK 187
                               F+E  V+ +     +    PL+   L+       +  AVK
Sbjct: 142 --------------------FAEKVVIGEKHCFKVPSWIPLDVAALIQPLAVCWH--AVK 179

Query: 188 TANVQKGDTVAVFGCGTVGLSVLQGAHQRGASRIIAIDTNDQKKDFCTQFGATDFINPTK 247
              V++G +  + G G +GL ++      G + I+  +    ++D   + GA   ++   
Sbjct: 180 LGAVKEGQSALILGGGPIGLGIIMALQHFGCTDIVVSEPAKIRRDLAEKMGA--IVSNPM 237

Query: 248 DLKENETIVAKLIEMTDG--GLDHTFDCTGNVNVMRSALE 285
           D K NE  +  L  ++    G D TFDC+G      S+++
Sbjct: 238 DFKTNEENIKNLCSLSPNGEGYDFTFDCSGISVTFESSIK 277

>KNAG0D00110 Chr4 (3538..4626) [1089 bp, 362 aa] {ON} 
          Length = 362

 Score = 65.9 bits (159), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 79/334 (23%), Positives = 135/334 (40%), Gaps = 30/334 (8%)

Query: 35  EVRIKIVNTAVCHTDAYTLSGADPEGLFPCVLGHEGAGIVESVGDGVTN-VKPGDHV-IA 92
           ++ +KI    VC +D +  SG   +   P ++GHE  G V  VG   T+ VK GD V + 
Sbjct: 35  DIDVKIECCGVCGSDVHCASGHWGDIAKPLIVGHEIVGHVVKVGPNCTSGVKVGDRVGLG 94

Query: 93  LYTAECQKCKFCLSGKTNLCGAVRATQGKGVMPDGTSRFHNKKGESLYHFMGCSTFSEYT 152
                C KCK CL+G  + C            P+    +     +    ++    +++Y 
Sbjct: 95  AQALSCMKCKRCLNGNESYC------------PNAIQTYSTPYEDG---YVSKGGYADYV 139

Query: 153 VVADVSVVAIDQTAPLESVCLLGCGVTTGYGAAVKTANVQKGDTVAVFGCGTVGLSVLQG 212
            V +   V I +  P      L CG  T +   ++      G  VA+ G G +G   +  
Sbjct: 140 RVHEQFTVPIPENIPSHLAAPLMCGGLTVFSPLLRNG-CGPGKKVAILGIGGIGHMGVLL 198

Query: 213 AHQRGASRIIAIDTNDQKKDFCTQFGATDFINPTKDLKENETIVAKLIEMTDGGLDHTFD 272
           A   GA  + AI     KK+   + GA  FI   ++   +E    +        LD    
Sbjct: 199 AKAMGA-EVYAISRTSSKKEDAMKLGADHFIATKEEPDWHEKYFDE--------LDLVVV 249

Query: 273 CTGNV-NVMRSALEACHKGWGQSVIIGVAAAGQEISTRPFQLVTGRVWKGSAFGGVKGRS 331
           C G+V ++  + L       G+ V I +    + +  +PF LV G     S  G ++   
Sbjct: 250 CAGSVTDIDFNTLPKIIAVGGRIVSIAIPEMSEVLELKPFGLV-GVSIANSLLGSMEELK 308

Query: 332 EMAGLIEQYKKGELKVDEFITHRRSFNEINEAFD 365
           ++  L+ + K  ++ V+      +  +E+ E  D
Sbjct: 309 QLLKLVSE-KDIKIWVETVPISEKGVHEVFERMD 341

>NDAI0H02050 Chr8 complement(500914..502071) [1158 bp, 385 aa] {ON} 
          Length = 385

 Score = 64.7 bits (156), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 57/242 (23%), Positives = 102/242 (42%), Gaps = 42/242 (17%)

Query: 62  FPCVLGHEGAGIVESVGDGVTNVKPGDHVIALYTAECQK-----------------CKFC 104
            P  +GHE +G V+++G  VT V+ GD V+      C+                  C  C
Sbjct: 67  LPQPMGHEFSGFVKAIGSNVTKVEVGDKVVVEAGCGCKDVHRWPDSKLYEKRKDTFCSAC 126

Query: 105 LSGKTNLCGAVRATQGKGVMPDGTSRFHNKKGESLYHFMGCSTFSEYTVVADVSVVAIDQ 164
            +G  N C     T G GV+                       F+E  VV +  +V + +
Sbjct: 127 ENGIDNCCENYDFT-GLGVV--------------------GGAFAERVVVGERHIVKLPE 165

Query: 165 TAPLESVCLLGCGVTTGYGAAVKTANVQKGDTVAVFGCGTVGLSVLQGAHQRGASRIIAI 224
             P +   L+   ++  +  AV+ +  +KG +  + G G +GL+ +      GAS+I+  
Sbjct: 166 EVPTDVGALVE-PISVAW-HAVRVSKFEKGKSALILGAGPIGLAAILALKAHGASKIVVS 223

Query: 225 DTNDQKKDFCTQFGATDFINPTKDLKENETIVAKLIEMTDGGLDHTFDCTGNVNVMRSAL 284
           +  ++++   ++ G   F +P+K   +N     + I     G D+ FDC+G      +AL
Sbjct: 224 ELAERRRILASKMGVEVF-DPSKH-GDNAVTELRNIPRGQHGFDYAFDCSGVKATFNTAL 281

Query: 285 EA 286
           +A
Sbjct: 282 KA 283

>YAL061W Chr1 (33448..34701) [1254 bp, 417 aa] {ON}  BDH2Putative
           medium-chain alcohol dehydrogenase with similarity to
           BDH1; transcription induced by constitutively active
           PDR1 and PDR3
          Length = 417

 Score = 63.9 bits (154), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 67/302 (22%), Positives = 116/302 (38%), Gaps = 44/302 (14%)

Query: 62  FPCVLGHEGAGIVESVGDGVTNVKPGDHVIALYTAECQK--------------CKFCLSG 107
            P  +GHE AG V  VG GV N+K GD V+   T  C+               C  C  G
Sbjct: 67  LPQAMGHEMAGTVLEVGPGVKNLKVGDKVVVEPTGTCRDRYRWPLSPNVDKEWCAACKKG 126

Query: 108 KTNLCGAVRATQGKGVMPDGTSRFHNKKGESLYHFMGCSTFSEYTVVADVSVVAIDQTAP 167
             N+C  +    G GV   G                    F+E  V+ +     +    P
Sbjct: 127 YYNICSYL-GLCGAGVQSGG--------------------FAERVVMNESHCYKVPDFVP 165

Query: 168 LESVCLLGCGVTTGYGAAVKTANVQKGDTVAVFGCGTVGLSVLQGAHQRGASRIIAIDTN 227
           L+   L+       +  A++    + G T  + G G +GL  +   +  G   I+  +  
Sbjct: 166 LDVAALIQPLAVCWH--AIRVCEFKAGSTALIIGAGPIGLGTILALNAAGCKDIVVSEPA 223

Query: 228 DQKKDFCTQFGATDFINPTKDLKENETIVAKLIEMTDGGLDHTFDCTGNVNVMRSALEAC 287
             +++   + GA  + +PT    +      + I     G D+TFDC+G    + +A++ C
Sbjct: 224 KVRRELAEKMGARVY-DPTAHAAKESIDYLRSIADGGDGFDYTFDCSGLEVTLNAAIQ-C 281

Query: 288 HKGWGQSVIIGVAAAGQEISTRPFQL-VTGRVWKGSAFGGVKGRSEMAGLIEQYKKGELK 346
               G +V + +     +I   P  + +  R + GS         +   +IE  ++G + 
Sbjct: 282 LTFRGTAVNLAMWGH-HKIQFSPMDITLHERKYTGSM---CYTHHDFEAVIEALEEGRID 337

Query: 347 VD 348
           +D
Sbjct: 338 ID 339

>Suva_1.6 Chr1 (10591..11844) [1254 bp, 417 aa] {ON} YAL061W (REAL)
          Length = 417

 Score = 63.9 bits (154), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 55/228 (24%), Positives = 87/228 (38%), Gaps = 38/228 (16%)

Query: 62  FPCVLGHEGAGIVESVGDGVTNVKPGDHVIALYTAECQK--------------CKFCLSG 107
            P  +GHE AG V  VG GVT  K GD V+   T  C+               C  C  G
Sbjct: 67  LPQAMGHEMAGTVAKVGPGVTQFKVGDKVVVEPTGTCRDRYRWPTSPNVDKEWCAACKRG 126

Query: 108 KTNLCGAVRATQGKGVMPDGTSRFHNKKGESLYHFMGCSTFSEYTVVADVSVVAIDQTAP 167
             N+C  +    G GV   G                    F+E  V+ +     + +  P
Sbjct: 127 LYNICSYL-GLCGAGVQSGG--------------------FAERVVINESHCYKVPEFVP 165

Query: 168 LESVCLLGCGVTTGYGAAVKTANVQKGDTVAVFGCGTVGLSVLQGAHQRGASRIIAIDTN 227
           L+   L+       +  A+   + + G T  + G G +GL  +   +  G S I   +  
Sbjct: 166 LDVAALIQPLAVCWH--AISVCDFKAGSTALIIGAGPIGLGTILALNAAGCSDIAVSEPA 223

Query: 228 DQKKDFCTQFGATDFINPTKDLKENETIVAKLIEMTDGGLDHTFDCTG 275
             +++   + GA  F +PT    ++     + +     G D+TFDC+G
Sbjct: 224 KVRRELAEKMGARVF-DPTAHAAKDSIDYLRSVAPGGDGYDYTFDCSG 270

>YBR046C Chr2 complement(330507..331511) [1005 bp, 334 aa] {ON}
           ZTA1NADPH-dependent quinone reductase, GFP-tagged
           protein localizes to the cytoplasm and nucleus; has
           similarity to E. coli quinone oxidoreductase and to
           human zeta-crystallin
          Length = 334

 Score = 62.4 bits (150), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 69/249 (27%), Positives = 103/249 (41%), Gaps = 63/249 (25%)

Query: 34  HEVRIKIVNTAVCHTDAYTLSGADPEGLFPC----VLGHEGAGIVESVGDGVTNVKPGDH 89
            E+ IK   T V + ++Y       +G++PC    VLG E +G V + G GVTN + GD 
Sbjct: 36  EELLIKNKYTGVNYIESYFR-----KGIYPCEKPYVLGREASGTVVAKGKGVTNFEVGDQ 90

Query: 90  VIALYTAECQKCKFCLSGKTNLCGAVRATQGKGVMPDGTSRFHNKKGESLYHFMGCSTFS 149
           V     A      F    K +  G V        +P GTS                    
Sbjct: 91  V-----AYISNSTFAQYSKISSQGPVMK------LPKGTS-------------------- 119

Query: 150 EYTVVADVSVVAIDQTAPLESVCLLGCGVTTGYGAAVKTANVQKGDTVAVF-GCGTVGLS 208
                        D+   L +  LL   V T      +  +V+KGD V +F   G VGL 
Sbjct: 120 -------------DEELKLYAAGLLQ--VLTALSFTNEAYHVKKGDYVLLFAAAGGVGLI 164

Query: 209 VLQGAHQRGASRIIAIDTNDQKKDFCTQFGATDFINPTKDLKENETIVAKLIEMTDG-GL 267
           + Q    +GA   IA+ + D+K     ++GA   IN +K     E I+ ++++ T+G G+
Sbjct: 165 LNQLLKMKGA-HTIAVASTDEKLKIAKEYGAEYLINASK-----EDILRQVLKFTNGKGV 218

Query: 268 DHTFDCTGN 276
           D +FD  G 
Sbjct: 219 DASFDSVGK 227

>Smik_2.170 Chr2 complement(312211..313215) [1005 bp, 334 aa] {ON}
           YBR046C (REAL)
          Length = 334

 Score = 60.8 bits (146), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 64/251 (25%), Positives = 107/251 (42%), Gaps = 71/251 (28%)

Query: 35  EVRIKIVNTAVCHTDAYTLSGADPEGLFPC----VLGHEGAGIVESVGDGVTNVKPGDHV 90
           ++ IK   T V + ++Y       +GL+PC    +LG E AG + + G  VTN + GD V
Sbjct: 37  DLLIKNKYTGVNYIESYF-----RKGLYPCEKPYILGREAAGTIVAKGKDVTNFEIGDKV 91

Query: 91  IALYTAECQKCKFCLSGKTNLCGAVRATQGKGVMPDGTSRFHNKKGESLYHFMGCSTFSE 150
                                                              ++  STF++
Sbjct: 92  --------------------------------------------------AYISNSTFAQ 101

Query: 151 YT-VVADVSVVAIDQTAPLESVCLLGCGVTTGYGAAVKT---ANVQKGDTVAVF-GCGTV 205
           YT   ++ +V+ + +    E + L   G+     A   T    +V+KGD + +F   G V
Sbjct: 102 YTKFPSEGTVMKLSKETNDEELKLYAAGLLQALTALSFTNEAYHVRKGDYILLFAAAGGV 161

Query: 206 GLSVLQGAHQRGASRIIAIDTNDQKKDFCTQFGATDFINPTKDLKENETIVAKLIEMTDG 265
           GL + Q    +GA   IA+ + D+K +   ++GA   IN +K     E I+ K++E+T+G
Sbjct: 162 GLILNQLLRMKGA-HAIAVASTDEKLEIAKEYGAEYLINSSK-----EDILKKVLEITNG 215

Query: 266 -GLDHTFDCTG 275
            G+D +FD  G
Sbjct: 216 EGVDASFDSVG 226

>NCAS0A07660 Chr1 complement(1525755..1526915) [1161 bp, 386 aa]
           {ON} 
          Length = 386

 Score = 61.2 bits (147), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 81/331 (24%), Positives = 130/331 (39%), Gaps = 53/331 (16%)

Query: 62  FPCVLGHEGAGIVESVGDGVTNVKPGDHVIALYTAEC--------------QKCKFCLSG 107
            P  +GHE  G V+++G+ VT V  GD V+      C              ++C  C  G
Sbjct: 67  LPQPMGHEFCGFVKAIGNKVTKVAVGDKVVVEAGCGCKDVHRWPQSHVYGKEQCTACRKG 126

Query: 108 KTNLCGAVRATQGKGVMPDGTSRFHNKKGESLYHFMGCSTFSEYTVVADVSVVAIDQTAP 167
             N C     T G GV+                       F+E  VV +  VV + +  P
Sbjct: 127 FDNCCTHAGFT-GLGVV--------------------GGAFAEQVVVGERHVVKLPEEVP 165

Query: 168 LESVCLLGCGVTTGYGAAVKTANVQKGD--TVAVFGCGTVGLSVLQGAHQRGASRIIAID 225
            +   L+       +  AVK A  +KG      V G G +GL+ +      GAS+I+  +
Sbjct: 166 TDVGALVEPLSVAWH--AVKVAGFEKGSGKNALVLGAGPIGLATILALKAHGASKIVVSE 223

Query: 226 TNDQKKDFCTQFGATDFINPTKDLKENETIVAKLIEMTD--GGLDHTFDCTGNVNVMRSA 283
               +++   + G   F +P+K   E + I  KL E+ +   G D  FDC+G      +A
Sbjct: 224 LAAIRRELALKMGVEVF-DPSKHGDEKQGI-KKLREIPEDHDGFDFAFDCSGVETTFNTA 281

Query: 284 LEACHKGWGQSVIIGVAAAG-QEISTRPFQLVTGRVWKGSAFGGVKGRSEMAGLIEQYKK 342
           L   H    +   + VA  G   I   P  +         + G V    +   +++   K
Sbjct: 282 L---HSLTFRGTAVNVAIWGPHPIDYYPMDITLQEKKLTGSIGYV--VQDFEEVVDALHK 336

Query: 343 GELKVDE---FITHRRSF-NEINEAFDDLHN 369
           G++ ++E    IT R+   N   + F +L N
Sbjct: 337 GDISIEECKHLITGRQKLENGWEKGFMELMN 367

>Kwal_47.17532 s47 (444594..445715) [1122 bp, 373 aa] {ON} YMR318C
           (ADH6) - NADPH-dependent alcohol dehydrogenase [contig
           207] FULL
          Length = 373

 Score = 60.8 bits (146), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 82/327 (25%), Positives = 121/327 (37%), Gaps = 50/327 (15%)

Query: 31  PKA---HEVRIKIVNTAVCHTDAYTLSGADPEGLFPC----------VLGHEGAGIVESV 77
           PKA   H+V I++    +C ++ + L          C          V+GHE  G V +V
Sbjct: 28  PKAFGPHDVDIEVECCGICASELFALKNEWGHAPLACLSSKYGPKTQVVGHEVVGKVVAV 87

Query: 78  GDGVTNVKPGDHV-IALYTAECQKCKFCLSGKTNLCGAVRATQGKGVMPDGTSRFHNKKG 136
           G  V+    GD V +    + C +C  C SG    C    +T  K   PDG         
Sbjct: 88  GPQVSLCNVGDRVGLGAQASACMQCSRCNSGNEQYCPNAISTYCK-PYPDG--------- 137

Query: 137 ESLYHFMGCSTFSEYTVVADVSVVAIDQTAPLESVCLLGCGVTTGYGAAVKTANVQKGDT 196
                ++    ++ +    +     I    P E V  L CG  T +    +    +    
Sbjct: 138 -----YVSQGGYASHVRAHEQFCFPIPPEIPSELVAPLQCGGLTVFSPIKRNLQGKHDPK 192

Query: 197 VAVFGCGTVGLSVLQGAHQRGASRIIAIDTNDQKKDFCTQFGATDFINPTKDLKENETIV 256
           VAV G G +G   +  A   GA  + A      K+D   + GA  F+  T D   N    
Sbjct: 193 VAVIGIGGLGHMAIMIARALGA-EVYAFSRGHSKRDDALKMGAHHFVA-TGDADWN---- 246

Query: 257 AKLIEMTDGGLDHTFDCTGNVNVMRSALE-----ACHKGWGQSVIIGVAAAGQEISTRPF 311
                    GLD TFD   N     S+L+      C K     V +G+    +E+S +PF
Sbjct: 247 --------AGLDDTFDLILNCASSTSSLDLNAMLPCLKVNCNFVSVGLPHIDEELSVKPF 298

Query: 312 QLVTGRVWKGSAFGGVKGRSEMAGLIE 338
                    GS+  G   RSE   L++
Sbjct: 299 SFFKNGCNIGSSKLG--SRSEAIELMQ 323

>Skud_1.2 Chr1 (9513..10766) [1254 bp, 417 aa] {ON} YAL061W (REAL)
          Length = 417

 Score = 61.2 bits (147), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 54/238 (22%), Positives = 90/238 (37%), Gaps = 38/238 (15%)

Query: 62  FPCVLGHEGAGIVESVGDGVTNVKPGDHVIALYTAECQK--------------CKFCLSG 107
            P  +GHE AG V  VG GV ++K GD V+   T  C+               C  C  G
Sbjct: 67  LPQAMGHEMAGTVLEVGPGVAHLKVGDKVVVEPTGTCRDRYRWPNSPNVSKEWCAACKKG 126

Query: 108 KTNLCGAVRATQGKGVMPDGTSRFHNKKGESLYHFMGCSTFSEYTVVADVSVVAIDQTAP 167
             N+C  +    G GV   G                    F+E  V+ +     +    P
Sbjct: 127 YYNICSYL-GLCGAGVQSGG--------------------FAERVVMNESHCYKVPDFVP 165

Query: 168 LESVCLLGCGVTTGYGAAVKTANVQKGDTVAVFGCGTVGLSVLQGAHQRGASRIIAIDTN 227
           L+   L+       +  A+     + G T  + G G +GL  +      G   I+  +  
Sbjct: 166 LDVAALIQPLAVCWH--AISVCEFKAGSTALIIGAGPIGLGTILALDAAGCKDIVVSEPA 223

Query: 228 DQKKDFCTQFGATDFINPTKDLKENETIVAKLIEMTDGGLDHTFDCTGNVNVMRSALE 285
             +++   + GA  + +PT+   +      + I     G D+TFDC+G    + +A++
Sbjct: 224 KLRRELAEKMGARVY-DPTEHAAKESIDYLRSIAEGGDGFDYTFDCSGLEITLNAAIQ 280

>Smik_1.5 Chr1 (16385..17638) [1254 bp, 417 aa] {ON} YAL061W (REAL)
          Length = 417

 Score = 60.8 bits (146), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 53/238 (22%), Positives = 90/238 (37%), Gaps = 38/238 (15%)

Query: 62  FPCVLGHEGAGIVESVGDGVTNVKPGDHVIALYTAECQK--------------CKFCLSG 107
            P  +GHE AG V  VG GV ++K GD V+   T  C+               C  C  G
Sbjct: 67  LPQAMGHEMAGTVLEVGPGVAHLKVGDKVVVEPTGTCRDRYRWPESPNVDKEWCAACKKG 126

Query: 108 KTNLCGAVRATQGKGVMPDGTSRFHNKKGESLYHFMGCSTFSEYTVVADVSVVAIDQTAP 167
             N+C  +    G GV   G                    F+E  V+ +     +    P
Sbjct: 127 YYNICSYL-GLCGAGVQSGG--------------------FAERVVMNESHCYKVPDFVP 165

Query: 168 LESVCLLGCGVTTGYGAAVKTANVQKGDTVAVFGCGTVGLSVLQGAHQRGASRIIAIDTN 227
           L+   L+       +  A+     + G T  + G G +GL  +   +  G   I+  +  
Sbjct: 166 LDVAALIQPLAVCWH--AISVCEFKAGSTALIIGAGPIGLGTILALNAAGCRDIVVSEPA 223

Query: 228 DQKKDFCTQFGATDFINPTKDLKENETIVAKLIEMTDGGLDHTFDCTGNVNVMRSALE 285
             +++   + GA  + +PT+          + +     G D+TFDC+G    + +A++
Sbjct: 224 KLRRELAEKMGARVY-DPTEHAARESIDYLRSVAEGGDGFDYTFDCSGLEVTLNAAIQ 280

>KNAG0I00120 Chr9 (9352..10497) [1146 bp, 381 aa] {ON} 
          Length = 381

 Score = 60.5 bits (145), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 71/293 (24%), Positives = 118/293 (40%), Gaps = 28/293 (9%)

Query: 63  PCVLGHEGAGIVESVGDGVTNVKPGDHVIALYTAECQKCKFCLSGKTNLCGAVRATQGKG 122
           P  +GHE +G V  VG  VT VK GD V+   T  C         K     A  A + + 
Sbjct: 68  PQAMGHEFSGYVAKVGPKVTKVKVGDRVVVEATCSCVDLHRWPESKHYKTPACNACKDRC 127

Query: 123 VMPDGTSRFHNKKGESLYHFMGCST----FSEYTVVADVSVVAIDQTAPLESVCLLGCGV 178
              D    +          FMG       F+E  V  +  VV +    P++   L+   +
Sbjct: 128 ---DNCCEYAG--------FMGLGVVGGAFAERIVTIEHHVVKLPDGFPMDVAALIE-PL 175

Query: 179 TTGYGAAVKTANVQKGDTVAVFGCGTVGLSVLQGAHQRGASRIIAIDTNDQKKDFCTQFG 238
           +  + AA + +    G +  V G G +GL+++     +GAS+II  +    +++   +  
Sbjct: 176 SVAWHAA-RVSKFPPGKSALVLGAGPIGLAMILVLKAQGASKIIVSEPATMRRELADRMH 234

Query: 239 ATDFINPTKDLKENETIVAKLIEMTDG-GLDHTFDCTGNVNVMRSALEACHKGWGQSVII 297
              F   T   K    + +K     DG G D  FDC+G      + L+A H    +  + 
Sbjct: 235 VETFDPSTHGDKSVAMLRSKTF---DGKGFDFAFDCSGVPATFNTGLQAAHY---RGTLC 288

Query: 298 GVAAAGQEISTRPFQL-VTGRVWKGSAFGGVKGRSEMAGLIEQYKKGELKVDE 349
            VA  G      P  + +  +   GS    V+   + A + E +K G++ ++E
Sbjct: 289 NVAIWGSGFDFNPMGITLLEKDVTGSIGYTVQ---DFAEVTEAFKDGKIDIEE 338

>TPHA0J00170 Chr10 (40911..41996) [1086 bp, 361 aa] {ON} 
          Length = 361

 Score = 59.7 bits (143), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 82/344 (23%), Positives = 136/344 (39%), Gaps = 40/344 (11%)

Query: 34  HEVRIKIVNTAVCHTDAYTLSGADPEGLFPCVLGHEGAGIVESVGDGVT-NVKPGDHV-I 91
            +V IK++   VC +D +  +G        CV+GHE  G V  VG   T  VK GD V +
Sbjct: 34  RDVDIKVIACGVCGSDVHCAAGRHLPLFEDCVVGHEIIGEVVKVGPKCTAGVKVGDRVGV 93

Query: 92  ALYTAECQKCKFCLSGKTNLCGAVRATQGKGVMPDGTSRFHNKKGESLYHFMGCSTFSEY 151
              +  C +C+ C++G    C          + PDG+                   F  +
Sbjct: 94  GAQSLSCLECESCIAGNEQYCKKNTVYTIASIYPDGSK--------------AQGGFGSH 139

Query: 152 TVVADVSVVAIDQTAPLESVCLLGCGVTTGYGAAVKTANVQKGDTVAVFGCGTVGLSVLQ 211
               +  V  I +     +   L CG  T +   ++   V  G TV + G G +G   + 
Sbjct: 140 VRTHEYFVHPIPKELDTVNAAPLLCGGITAFSPLLR-GQVGPGKTVGIVGIGGIGHIAIL 198

Query: 212 GAHQRGASRIIAIDTNDQKKDFCTQFGATDFINPTK--DLKENETIVAKLIEMTDGGLDH 269
            A   GA ++IAI  +  KK+ C + GA ++I   +  D K+             G +D 
Sbjct: 199 FAKAMGA-KVIAISRSASKKEDCLKLGADEYIASAEGDDWKQKFA----------GSIDF 247

Query: 270 TFDCTGNVNVMR-SALEACHKGWGQSVIIGVAAAGQEISTRPFQLVTGRVWKGSAFGGVK 328
              C  + +     +L +  K  G+   IG+      +S  P  L+  +      F  + 
Sbjct: 248 MLLCNSSFSKSNFDSLFSLIKLGGEVCSIGIPDMSYRLSISPLSLLGIKF----GFSALG 303

Query: 329 GRSEMAGLIEQYKKGELK--VDEFITHRRSFNEINEAFDDLHNG 370
            R+E   + E  KK  +K  V+      +    ++EAF+ + NG
Sbjct: 304 SRNEFQKMFELVKKNNIKLWVETLPIGEKG---LHEAFERVENG 344

>KNAG0E04200 Chr5 complement(837232..838389) [1158 bp, 385 aa] {ON} 
          Length = 385

 Score = 58.9 bits (141), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 76/319 (23%), Positives = 126/319 (39%), Gaps = 60/319 (18%)

Query: 35  EVRIKIVNTAVCHTDAYTLSGADPEGLFPC--------------VLGHEGAGIVESVGDG 80
           E+ + IV   +C TD + L+  D    FP                +GHE AGIV +VG G
Sbjct: 28  ELLVDIVYCGICGTDLHELT--DGPIFFPLDNERNEISGNGLPQAMGHEMAGIVTAVGSG 85

Query: 81  VTNVKPGDHVIALYTAECQK--------------CKFCLSGKTNLCGAVRATQGKGVMPD 126
           V   + GDHV    T  C+               C  C  G  N C  +    G GV   
Sbjct: 86  VKKFQVGDHVAIEPTGTCRDRYRWPDAPDAKKPVCTSCQRGMYNCCDYL-GLIGNGVQSG 144

Query: 127 GTSRFHNKKGESLYHFMGCSTFSEYTVVADVSVVAIDQTAPLESVCLLGCGVTTGYGAAV 186
           G                    F+E  VV +          P E   L+       +  A+
Sbjct: 145 G--------------------FAERIVVNESHCYKCPDNLPWEVAALIQPIAVCWH--AI 182

Query: 187 KTANVQKGDTVAVFGCGTVGLSVLQGAHQRGASRIIAIDTNDQKKDFCTQFGATDFINPT 246
             A  + G +V + G G +GL  +   +  G + II  +    ++D+  + GA  + +P 
Sbjct: 183 NIAQFKPGSSVLILGGGPIGLGTILALNGHGCTEIIVSEPVKLRRDYAEKMGAVVY-DPL 241

Query: 247 KDLKENETIVAKLIEMTDG--GLDHTFDCTGNVNVMRSALEACHKGWGQSVIIGVAAAGQ 304
           +    +E  +  L +M  G  G D+ FDC+G    +++++E C    G +V + + A  +
Sbjct: 242 Q--CSHEQSIPNLRKMAPGADGFDYCFDCSGTPATLKASIE-CLTFRGTAVNVAMWATNK 298

Query: 305 EISTRPFQLVTG-RVWKGS 322
            ++  P  +    +++ GS
Sbjct: 299 AVNFYPMDITKQEKIYTGS 317

>Kwal_56.22985 s56 complement(357501..358541) [1041 bp, 346 aa] {ON}
           YBR046C (ZTA1) - 1:1 [contig 184] FULL
          Length = 346

 Score = 57.4 bits (137), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 89/369 (24%), Positives = 145/369 (39%), Gaps = 79/369 (21%)

Query: 16  EAGKPQVV--EQIVVDPP-KAHEVRIKIVNTAVCHTDAYTLSGADPEGLFPCVLGHEGAG 72
           E G P+V+  EQ    P    +E+ IK   T +   ++Y   G  P    P VLG E +G
Sbjct: 26  ETGGPEVIRYEQDYPVPELNDNEILIKNKYTGINFIESYFRKGIYPSQK-PYVLGREASG 84

Query: 73  IVESVGDGVTNVKPGDHVIALYTAECQKCKFCLSGKTNLCGAVRATQGKGVMPDGTSRFH 132
            V + G  V+                   KF L+ K                        
Sbjct: 85  TVVAKGKAVS-------------------KFNLADKV----------------------- 102

Query: 133 NKKGESLYHFMGCSTFSEYTVVADVSVVA------IDQTAPLESVCLLGCGVTTGYGAAV 186
                    ++   TF++YT +A+   ++       D+   L +  L    V T    A 
Sbjct: 103 --------AYLSAGTFAQYTKIAETGHISKLPENTTDKQLELYAASL--VQVLTALTFAK 152

Query: 187 KTANVQKGDTVAVFGC-GTVGLSVLQGAHQRGASRIIAIDTNDQKKDFCTQFGATDFINP 245
           +   V+KGD V ++   G VGL+  Q   + GA   IA+ + D+K     +FGA   +N 
Sbjct: 153 EAYTVKKGDFVLLYAAAGGVGLAFNQILKRLGA-HTIAVASTDEKLQLAKEFGAEYLVNS 211

Query: 246 TKDLKENETIVAKLIEMTDG-GLDHTFDCTGNVNVMRSALEACHKGWGQSVIIGVAAAG- 303
           +K     E ++A+++E+T G G+D  +D  G  +   + L A  +  G  V  G A+   
Sbjct: 212 SK-----EDVLARVLEITQGQGVDVAYDSIGK-DTFETTLSALRRK-GTFVSFGNASGPV 264

Query: 304 QEISTRPFQLVTGRVWKGSAFGGVKGRSEMA----GLIEQYKKGELKVDEFITHRRSFNE 359
             I+         ++ + + FG +  + E A     LI+     E KV   IT      E
Sbjct: 265 PPIAISRLSPKNIKILRPTLFGYIASQEEWAYYSEELIKLLHSEEFKV--LITKIYPLEE 322

Query: 360 INEAFDDLH 368
             +A ++L 
Sbjct: 323 YRKATEELE 331

>NDAI0H02950 Chr8 complement(718762..719853) [1092 bp, 363 aa] {ON} 
          Length = 363

 Score = 57.0 bits (136), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 83/334 (24%), Positives = 133/334 (39%), Gaps = 29/334 (8%)

Query: 34  HEVRIKIVNTAVCHTDAYTLSGADPEGLFPCVLGHEGAGIVESVGDGVTNVKPGDHV-IA 92
           ++V +KI    VC +D +T SG   E   P V+GHE  G V  +G     +K GD V I 
Sbjct: 38  YDVEVKIECCGVCGSDIHTASGHWGETKKPLVVGHEIIGTVTQIGSQCNELKVGDRVGIG 97

Query: 93  LYTAECQKCKFCLSGKTNLCGAVRATQGKGVMPDGTSRFHNKKGESLYHFMGCSTFSEYT 152
                C +C  C S     C     T  K    D T  +++K G           +++Y 
Sbjct: 98  AQVFSCLECDRCKSDNEPYCPKTVNTYRK----DYTDGYNSKGG-----------YADYI 142

Query: 153 VVADVSVVAIDQTAPLESVCLLGCGVTTGYGAAVKTANVQKGDTVAVFGCGTVGLSVLQG 212
            + +   V I +  P      L CG  T +   ++      G  V + G G +G   L  
Sbjct: 143 RLHEHFAVPIPENIPSHLAAPLMCGGVTAFSPLLRNG-CGPGKKVGIMGIGGIGHMGLIF 201

Query: 213 AHQRGASRIIAIDTNDQKKDFCTQFGATDFINPTKDLKENETIVAKLIEMTDGGLDHTFD 272
           A   GA    AI  +  KK+   + GA  FI      KE      K  +      D    
Sbjct: 202 AKAMGA-ETFAISRSSAKKEDAIKMGADHFIA----TKEEPDWATKYFDT----FDLIVV 252

Query: 273 CTGNV-NVMRSALEACHKGWGQSVIIGVAAAGQEISTRPFQLVTGRVWKGSAFGGVKGRS 331
           C+ ++ ++  + +    K  G+ V I V    + ++ +PF L+ G     SA GG+    
Sbjct: 253 CSNSLTDIDFNVVPRTMKVGGKIVSICVPEQHEVMNLKPFGLI-GVSISNSALGGINEIK 311

Query: 332 EMAGLIEQYKKGELKVDEFITHRRSFNEINEAFD 365
           +M  L+ + K  ++ V+      +   E+ E  +
Sbjct: 312 QMLDLVSK-KNLKIWVETIPISEKGVKEVFERME 344

>KAFR0C00580 Chr3 (113544..114548) [1005 bp, 334 aa] {ON} Anc_3.253
           YBR046C
          Length = 334

 Score = 56.6 bits (135), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 85/335 (25%), Positives = 126/335 (37%), Gaps = 78/335 (23%)

Query: 35  EVRIKIVNTAVCHTDAYTLSGADPEGLFPCVLGHEGAGIVESVGDGVTNVKPGDHVIALY 94
           EV IK   T V + ++Y   G  P  L P VLG E  G V ++G  V ++K GD V    
Sbjct: 37  EVIIKNRYTGVNYIESYFRKGIYPAEL-PYVLGREAVGTVVAIGKSVRDLKVGDKV---- 91

Query: 95  TAECQKCKFCLSGKTNLCGAVRATQGKGVMPDGTSRFHNKKGESLYHFMGCSTFSEYTVV 154
                                                          ++  +TF+++T V
Sbjct: 92  ----------------------------------------------SYIAGATFAQFTKV 105

Query: 155 ADVS-VVAIDQTAPLESVCLLGCGVTTGYGAAV---KTANVQKGDTVAVFGC-GTVGLSV 209
            + + V  +  T   E + L   G+  G  A     +  +V+KGD V ++   G VGL  
Sbjct: 106 PNSTHVFKLPDTTSTEQLKLYAAGMIQGLTALTFVNEAYDVKKGDYVLLYAAAGGVGLIF 165

Query: 210 LQGAHQRGASRIIAIDTNDQKKDFCTQFGATDFINPTKDLKENETIVAKLIEMTDG-GLD 268
            Q    RGA  I    TN +K     + GA   IN  +D      I+ K+ ++T G G+D
Sbjct: 166 NQLLRMRGAHTIAVASTN-EKLSLAKENGAEFLINSKED-----NILEKVQQITKGNGVD 219

Query: 269 HTFDCTGNVNVMRSALEACHKGWGQSVIIGVAAAGQEISTRPFQLV-----TGRVWKGSA 323
             FD  G  +   + L +C K  G  V  G A+        PF L        R+ +   
Sbjct: 220 VAFDSVGK-DTFETTL-SCLKRKGTFVSYGNASG----PVPPFPLSRLSPKNIRLLRPQL 273

Query: 324 FGGVKGRSEM----AGLIEQYKKGELKVDEFITHR 354
           FG V    E       LI     G+L +  F  ++
Sbjct: 274 FGYVAQADEFRHYTEELISLIDSGKLNIKLFKIYQ 308

>KAFR0I00170 Chr9 (34519..35664) [1146 bp, 381 aa] {ON} Anc_7.3
           YAL060W
          Length = 381

 Score = 56.6 bits (135), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 72/280 (25%), Positives = 111/280 (39%), Gaps = 45/280 (16%)

Query: 62  FPCVLGHEGAGIVESVGDGVTNVKPGDHVIALYTAEC--------------QKCKFCLSG 107
            P  +GHE +GIV  VG  VT VK GD V+   ++ C              +KC  C  G
Sbjct: 67  LPLAMGHEMSGIVREVGKNVTKVKKGDKVVVEASSACSDVHRFATGKHYGEEKCPNCARG 126

Query: 108 KTNLCGAVRATQGKGVMPDGTSRFHNKKGESLYHFMGCSTFSEYTVVADVSVVAIDQTAP 167
             N C A     G G +  G                    F+E  +V +  +V I    P
Sbjct: 127 YDNCC-AYAGFTGLGFIGGG--------------------FAEQILVGEQHIVRIPDEIP 165

Query: 168 LESVCLLGCGVTTGYGAAVKTANVQKGDTVAVFGCGTVGLSVLQGAHQRGASRIIAIDTN 227
           L+   L+     T + A  K     KG T  + G G +GL+++      GAS+I+  +  
Sbjct: 166 LDVAALVEPLSVTWHAA--KVGKFVKGSTALILGSGPIGLAMILVLKALGASKIVVSEVA 223

Query: 228 DQKKDFCTQFGATDFINPTKDLKENETIVAKLIEMTDGGLDHTFDCTGNVNVMRSALEAC 287
             ++    +     F +P+   K     +  L E  D G D  FDC+G    M +A+   
Sbjct: 224 QVRRKLAEKMKVEVF-DPSVHGKNTSNELRLLTENKD-GFDFAFDCSGLEVTMNTAI--- 278

Query: 288 HKGWGQSVIIGVAAAGQEISTRPFQLVTGRVWKGSAFGGV 327
           H    +  I+ VA  G   ST  F ++   + + +  G +
Sbjct: 279 HATKCRGTIVNVAVWG---STMEFNMMDITLQEKTLIGSI 315

>TDEL0D03720 Chr4 (683833..684840) [1008 bp, 335 aa] {ON} Anc_3.253
           YBR046C
          Length = 335

 Score = 55.8 bits (133), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 62/252 (24%), Positives = 98/252 (38%), Gaps = 69/252 (27%)

Query: 34  HEVRIKIVNTAVCHTDAYTLSGADPEGLFPCVLGHEGAGIVESVGDGVTNVKPGDHVIAL 93
           +E+ IK     +   +AY   G  P  L P +LG E  G+V + G  V N   GD V   
Sbjct: 37  NELLIKNKYAGINFIEAYFRKGIYPVQL-PQILGREATGVVVAKGQSVKNFDIGDKV--- 92

Query: 94  YTAECQKCKFCLSGKTNLCGAVRATQGKGVMPDGTSRFHNKKGESLYHFMGCSTFSEYTV 153
                                                           +M  STF++YT 
Sbjct: 93  -----------------------------------------------AYMSSSTFAQYTK 105

Query: 154 VADVSVVAI-------DQTAPLESVCLLGCGVTTGYGAAVKTANVQKGDTVAVFGC-GTV 205
            +   +++        DQ     +  + G    T    A K   V++GD + ++   G V
Sbjct: 106 YSSSGLISKLPSETTDDQLKVYAAALIQGLTALTFLDEAYK---VKEGDYILLYAAAGGV 162

Query: 206 GLSVLQGAHQRGASRIIAIDTNDQKKDFCTQFGATDFINPTKDLKENETIVAKLIEMT-D 264
           GL + Q   +RGA   IA+ + ++K++   +FGA   IN +K     E I+ + +E+T D
Sbjct: 163 GLLMDQLLKERGA-HAIAVVSTEEKEELAKKFGAEYVINSSK-----EDILKRALEITND 216

Query: 265 GGLDHTFDCTGN 276
            G+D  FD  G 
Sbjct: 217 KGVDAVFDSVGK 228

>NCAS0D01220 Chr4 (223821..224909) [1089 bp, 362 aa] {ON} 
          Length = 362

 Score = 55.8 bits (133), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 88/360 (24%), Positives = 133/360 (36%), Gaps = 73/360 (20%)

Query: 34  HEVRIKIVNTAVCHTDAYTLSGADPEGLFPCVLGHEGAGIVESVGDGVTN-VKPGDHV-I 91
           H+++IK+    VC +D +  SG       P V+GHE  G V  VGD   N +K GD V +
Sbjct: 34  HDIQIKVECCGVCGSDIHAASGHWGNIPTPLVVGHEIVGRVVKVGDRCDNGLKVGDRVGV 93

Query: 92  ALYTAECQKCKFCLSGKTNLCGAVRATQGKGVMPDGTSRFHNKKGESLYHFMGCSTFSEY 151
                 C +C  C +   + C    AT G G  PDG              ++    ++++
Sbjct: 94  GAQVFSCLECNRCKTDNESYCPKWVATYG-GEYPDG--------------YISKGGYADF 138

Query: 152 TVVADVSVVAIDQTAPLESVCLLGCGVTTGYGAAVKTANVQKGDTVAVFGCGTVGLSVLQ 211
             V +  VV I +  P E    L CG  T +   ++             GCG      + 
Sbjct: 139 VRVHEHFVVPIPENIPSEYAAPLLCGGLTVFSPLLRN------------GCGPGKKVGIV 186

Query: 212 G-----------AHQRGASRIIAIDTNDQKKDFCTQFGATDFI----NP---TKDLKENE 253
           G           A+  GA  + AI    +KKD   + GA  FI     P   TK     +
Sbjct: 187 GIGGIGHQGVIFANAMGA-EVYAISRTSKKKDDAFKLGAHHFIATKEEPDWGTKYYDTFD 245

Query: 254 TIVAKLIEMTDGGLD---HTFDCTGNVNVMRSALEACHKGWGQSVIIGVAAAGQEISTRP 310
            IV     +TD   D   HT    G +                 V I +    Q +  +P
Sbjct: 246 LIVVCANSLTDIDFDVVPHTMKIGGRI-----------------VSISIPEMSQVLKLKP 288

Query: 311 FQLVTGRVWKGSAFGGVKGRSEMAGLIEQYKKGELKVDEFITHRRSFNEINEAFDDLHNG 370
           F L  G     S  G +K    +  L+ + K   + ++      +    ++EAFD +  G
Sbjct: 289 FGL-KGVSISNSHLGSIKELKTLLKLVSE-KNLRIWIETIPIGEKG---VHEAFDRMDKG 343

>KLLA0A10549g Chr1 (921022..922083) [1062 bp, 353 aa] {ON} highly
           similar to uniprot|P38230 Saccharomyces cerevisiae
           YBR046C
          Length = 353

 Score = 55.8 bits (133), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 60/192 (31%), Positives = 86/192 (44%), Gaps = 27/192 (14%)

Query: 190 NVQKGDTVAVFGC-GTVGLSVLQGAHQRGASRIIAIDTNDQKKDFCTQFGATDFINPTKD 248
           NVQKGD + V+   G VGL   Q    RGA R IA+ + D+K     ++GA   IN TKD
Sbjct: 164 NVQKGDFILVYAAAGGVGLIFDQLLKARGA-RTIAVASTDEKLQLAKEYGAEFLINSTKD 222

Query: 249 LKENETIVAKLIEMTDG-GLDHTFDCTGNVNVMRSALEACHKGWGQSVIIGVAAAG---- 303
                 IV K+ E T+G G+   FD  G  +   + L+   +  G  V  G A+      
Sbjct: 223 -----DIVEKVKEFTNGEGVAAAFDSIGK-DTFETTLQVVKRK-GTIVSFGNASGAVPPF 275

Query: 304 --QEISTRPFQLVTGRVWKGSAFGGVKGRSEM----AGLIEQYKKGELKVDEFITHRRSF 357
               +S +  +LV  ++     F  V   SE     + LI     GELK+   I+     
Sbjct: 276 SINRLSPKNLKLVRPQL-----FAYVADPSEWEHYSSELIRLIDSGELKIT--ISKVYPL 328

Query: 358 NEINEAFDDLHN 369
            +  EA +DL +
Sbjct: 329 KDYKEATEDLES 340

>NDAI0G04880 Chr7 complement(1175518..1176603) [1086 bp, 361 aa]
           {ON} 
          Length = 361

 Score = 55.5 bits (132), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 87/339 (25%), Positives = 135/339 (39%), Gaps = 38/339 (11%)

Query: 34  HEVRIKIVNTAVCHTDAYTLSGADPEGLFPCVLGHEGAGIVESVGDGVTN-VKPGDHV-I 91
           H++ IKI    VC +D +T SG   +   P V+GHE  G V  +GD  T+ +K GD V +
Sbjct: 35  HDIDIKIECCGVCGSDIHTASGHWGDITKPLVVGHEIIGTVVRLGDKCTSGLKLGDRVGV 94

Query: 92  ALYTAECQKCKFCLSGKTNLCGAVRATQGKGVMPDGTSRFHNKKGESLYHFMGCSTFSEY 151
                 C +C  C S     C     T       DG    +N KG           +++Y
Sbjct: 95  GAQAFSCLECGRCKSDNEPYCTKSVWTYSTN-YEDG----YNSKG----------GYADY 139

Query: 152 TVVADVSVVAIDQTAPLESVCLLGCGVTTGYGAAVKTANVQKGDTVAVFGCGTVGLSVLQ 211
             + +   + I +  P      L CG  T +   ++     +G  V + G G +G   L 
Sbjct: 140 IRLHEHFAIPIPENIPSHLAAPLMCGGITAFSPLLRNG-CGRGKKVGIMGIGGIGHMALI 198

Query: 212 GAHQRGASRIIAIDTNDQKKDFCTQFGATDFINPTKDLKENETIVAKLIEMTDGGLDHTF 271
            A   GA  + AI     KKD   + GA  FI      KE      K  +        TF
Sbjct: 199 FAKAMGA-EVYAISRTSAKKDDSIKMGADHFIA----TKEEPDWATKYFD--------TF 245

Query: 272 D----CTGNV-NVMRSALEACHKGWGQSVIIGVAAAGQEISTRPFQLVTGRVWKGSAFGG 326
           D    C+ ++ ++    +    K  G+ V I      + I+ +PF L+ G     SA GG
Sbjct: 246 DLIVVCSNSLTDINFDVVPRTMKVGGKIVSICAPEQNEVINLKPFGLL-GVSISNSALGG 304

Query: 327 VKGRSEMAGLIEQYKKGELKVDEFITHRRSFNEINEAFD 365
           +    +M  L+ + K  ++ V+      +   E+ E  D
Sbjct: 305 INEIKQMLDLVSK-KDLKIWVETVPISEKGVKEVFERMD 342

>ABL090W Chr2 (230699..231703) [1005 bp, 334 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YBR046C (ZTA1)
          Length = 334

 Score = 55.1 bits (131), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 74/297 (24%), Positives = 115/297 (38%), Gaps = 75/297 (25%)

Query: 6   PIECLAAVAYEAGKPQVV---EQIVVDPPKAHEVRIKIVNTAVCHTDAYTLSGADPEGLF 62
           P E    +  E G P+V+   E   V   +  ++ IK     V   + Y  +G     L+
Sbjct: 5   PTEQKVVLIRETGGPEVLRYEEDYPVPEVRGSDILIKNRYAGVNFIETYFRTG-----LY 59

Query: 63  PC----VLGHEGAGIVESVGDGVTNVKPGDHVIALYTAECQKCKFCLSGKTNLCGAVRAT 118
           PC    VLG E  G+V ++G  V   K GD V             CLS            
Sbjct: 60  PCEKPYVLGREAVGVVAAIGADVRRFKVGDRVA------------CLS------------ 95

Query: 119 QGKGVMPDGTSRFHNKKGESLYHFMGCSTFSEYTVVADVS-VVAID---QTAPLESVCLL 174
                                       TF++YT V++ S V+ +    Q   L++V   
Sbjct: 96  --------------------------SGTFAQYTAVSEKSNVLKLPDDIQDGELQAVAGS 129

Query: 175 GCGVTTGYGAAVKTANVQKGDTVAVFGC-GTVGLSVLQGAHQRGASRIIAIDTNDQKKDF 233
                T      +    Q G+ V V+   G VG  ++Q  H R   R+IA+ + D+K   
Sbjct: 130 LVNGLTALTLVDEAYKPQVGEIVLVYAAAGGVGQLLIQLLHARSV-RVIAVASTDEKLQI 188

Query: 234 CTQFGATDFINPTKDLKENETIVAKLIEMTDG-GLDHTFDCTGNVNVMRSALEACHK 289
               GA   IN ++     E IVAK++E TDG G+  ++D  G  +   + L++  +
Sbjct: 189 AKSRGAEFLINSSR-----EDIVAKVLEFTDGEGVGASYDSVGK-DTFETTLQSVKR 239

>NDAI0H02060 Chr8 complement(502872..504071) [1200 bp, 399 aa] {ON} 
          Length = 399

 Score = 55.5 bits (132), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 72/311 (23%), Positives = 124/311 (39%), Gaps = 42/311 (13%)

Query: 59  EGLFPCVLGHEGAGIVESVGDGVTNVKPGDHVIALYTAEC--------------QKCKFC 104
           EGL P  +GHE AGIV  +G  V   + GD V+   T  C              ++C  C
Sbjct: 65  EGL-PQAMGHEIAGIVSEIGPKVKKFQVGDRVVVEPTGTCKDRYRWPDAPNANQEECAAC 123

Query: 105 LSGKTNLCGAVRATQGKGVMPDGTSRFHNKKGESLYHFMGCSTFSEYTVVADVSVVAIDQ 164
             G  N+C  +    G GV   G                    F+E  V+ +     I +
Sbjct: 124 KKGLYNICSNL-GLVGCGVQSGG--------------------FAERMVMNEAKCYKIPE 162

Query: 165 TAPLESVCLLGCGVTTGYGAAVKTANVQKGDTVAVFGCGTVGLSVLQGAHQRGASRIIAI 224
              ++   L+     + +  AV+ +  + G +V + G G +GL  +   +  G + ++  
Sbjct: 163 HLTMDVAALIQPIAVSWH--AVRVSKFKPGSSVLIIGGGPIGLGTILALNGHGVTEVVVS 220

Query: 225 DTNDQKKDFCTQFGATDFINPTKDLKENETIVAKLIEMTDGGLDHTFDCTGNVNVMRSAL 284
           +    ++D   + GA  +   T+D  E+   +  +    D G D+TFDC+GN   +++A+
Sbjct: 221 EPAKIRRDLAEKMGAVVYDPMTRDHDESIKYLRSIAPGGD-GFDYTFDCSGNPATLKAAI 279

Query: 285 EACHKGWGQSVIIGVAAAGQEISTRPFQLV-TGRVWKGSAFGGVKGRSEMAGLIEQYKKG 343
           E C    G +V + +      +S  P  L    + + GS          +    E+ +  
Sbjct: 280 E-CLTFRGTAVNVAIWGK-NPVSFLPMDLTHQEKSYTGSMCYTYHDFEAVIKAFEERRID 337

Query: 344 ELKVDEFITHR 354
           E K    IT R
Sbjct: 338 EEKAKHMITGR 348

>SAKL0H22088g Chr8 (1934171..1935301) [1131 bp, 376 aa] {ON} similar
           to uniprot|Q04894 Saccharomyces cerevisiae YMR318C ADH6
           NADPH-dependent cinnamyl alcohol dehydrogenase family
           member with broad substrate specificity may be involved
           in fusel alcohol synthesis or in aldehyde tolerance
          Length = 376

 Score = 55.1 bits (131), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 75/323 (23%), Positives = 117/323 (36%), Gaps = 47/323 (14%)

Query: 32  KAHEVRIKIVNTAVCHTDAYTLSGADPEGLFPC----------VLGHEGAGIVESVGDGV 81
           +AH+V I++    +C ++ ++L          C          V+GHE  G V +VG  V
Sbjct: 34  EAHDVDIEVECCGICASELFSLKNEWKHEPLACLSSSYGPKSQVVGHEVVGKVVAVGSNV 93

Query: 82  TNVKPGDHV-IALYTAECQKCKFCLSGKTNLCGAVRATQGKGVMPDGTSRFHNKKGESLY 140
           T    GD V +      C KC  C SG    C     T          SR+ +       
Sbjct: 94  TLCNIGDRVGLGAQAFSCMKCSRCNSGNEQYCPQAVGTY--------CSRYADG------ 139

Query: 141 HFMGCSTFSEYTVVADVSVVAIDQTAPLESVCLLGCGVTTGYGAAVKTANVQKGDTVAVF 200
            ++    ++ +    +     I    P E V  L CG  T Y    +     K   VA+ 
Sbjct: 140 -YISQGGYASHVRAHEQFCFPIPDDIPSELVAPLQCGGLTVYSPIKRNIEGVKDPKVAII 198

Query: 201 GCGTVGLSVLQGAHQRGASRIIAIDTNDQKKDFCTQFGATDFINPTKDLKENETIVAKLI 260
           G G +G   +  +   GA  + A      KK+   + GA  FI             A   
Sbjct: 199 GIGGLGHMAIMISKALGA-EVTAFSRGYSKKEDALKMGAHHFI-------------ATGE 244

Query: 261 EMTDGGLDHTFDCTGNVNVMRSALE-----ACHKGWGQSVIIGVAAAGQEISTRPFQLVT 315
           E  + GL+ TFD   N     ++L+      C K     + +G+    ++   +PF   +
Sbjct: 245 EGWESGLNDTFDLILNCASSTTSLDLNKLLPCLKINRNFISVGLPHVDEDFKVKPFSFFS 304

Query: 316 GRVWKGSAFGGVKGRSEMAGLIE 338
                GS+  G   R E   L+E
Sbjct: 305 NGCCIGSSKLG--SREEAIELME 325

>TPHA0H03100 Chr8 complement(736924..738102) [1179 bp, 392 aa] {ON}
           Anc_7.3 YAL060W
          Length = 392

 Score = 55.5 bits (132), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 61/240 (25%), Positives = 98/240 (40%), Gaps = 38/240 (15%)

Query: 62  FPCVLGHEGAGIVESVGDGVTNVKPGDHVIALYTAECQK--------------CKFCLSG 107
            P  +GHE +G+VE VG G    K GDHV+   T  C+               C  C  G
Sbjct: 67  LPQAMGHEISGVVEKVGKGCKTFKVGDHVVVEPTGTCKDRYRWPESQNANKPMCSACSIG 126

Query: 108 KTNLCGAVRATQGKGVMPDGTSRFHNKKGESLYHFMGCSTFSEYTVVADVSVVAIDQTAP 167
            TN+C  + A  G G+   G                    F+E  V+ +  V  I    P
Sbjct: 127 MTNICAHL-ALCGAGLESGG--------------------FAERLVINEAHVHKIPDHMP 165

Query: 168 LESVCLLGCGVTTGYGAAVKTANVQKGDTVAVFGCGTVGLSVLQGAHQRGASRIIAIDTN 227
           L+   L+       +  AVK A+ +KG +  + G G +GL  +      G   I+  +  
Sbjct: 166 LDIGALIQPISVCWH--AVKVAHYKKGGSALIIGGGPIGLGTILALKGFGCEYIVLSEPA 223

Query: 228 DQKKDFCTQFGATDFINPTKDLKENETIVAKLIEMTDGGLDHTFDCTGNVNVMRSALEAC 287
             ++++  + GA  + +PT    +      + +     G D+TFDC+G    + +A+E C
Sbjct: 224 TIRREYAGKMGAKVY-DPTGVPFDESVKTLREMGPNGDGFDYTFDCSGLPITLNAAIECC 282

>Suva_4.279 Chr4 complement(495380..496384) [1005 bp, 334 aa] {ON}
           YBR046C (REAL)
          Length = 334

 Score = 53.5 bits (127), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 58/227 (25%), Positives = 93/227 (40%), Gaps = 66/227 (29%)

Query: 59  EGLFPC----VLGHEGAGIVESVGDGVTNVKPGDHVIALYTAECQKCKFCLSGKTNLCGA 114
           +GL+PC    VLG E  G V + G  V N + GD V                        
Sbjct: 56  KGLYPCEKPYVLGREATGTVVAKGKDVNNFQIGDQV------------------------ 91

Query: 115 VRATQGKGVMPDGTSRFHNKKGESLYHFMGCSTFSEYTVVADV-SVVAIDQTAPLESVCL 173
                                      ++  STF++YT  +   +V+ + +    E + L
Sbjct: 92  --------------------------AYISHSTFAQYTKFSSKGNVMRLPKCTSDEKMKL 125

Query: 174 LGCGVTTGYGAAVKT---ANVQKGDTVAVF-GCGTVGLSVLQGAHQRGASRIIAIDTNDQ 229
              G+     A   T    +V+KGD + V+   G VGL + Q    +GA   IA+ + D+
Sbjct: 126 YAAGLLQALTALSFTNEAYHVKKGDYILVYAAAGGVGLILNQLLKMKGA-HAIAVASTDE 184

Query: 230 KKDFCTQFGATDFINPTKDLKENETIVAKLIEMTDG-GLDHTFDCTG 275
           K D   + GA   IN +K     E ++ +++E+T+G G+D +FD  G
Sbjct: 185 KLDIAKKNGAEYLINSSK-----EDVLERVLEITNGEGVDSSFDSIG 226

>KLTH0C07854g Chr3 (673945..675021) [1077 bp, 358 aa] {ON} similar
           to uniprot|P38230 Saccharomyces cerevisiae YBR046C ZTA1
           Zeta-crystallin homolog
          Length = 358

 Score = 53.5 bits (127), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 67/348 (19%), Positives = 134/348 (38%), Gaps = 74/348 (21%)

Query: 34  HEVRIKIVNTAVCHTDAYTLSGADPEGLFPCVLGHEGAGIVESVGDGVTNVKPGDHVIAL 93
           +E+ IK     + + ++Y   G  P    P VLG E +G+V + GD VT     D V   
Sbjct: 59  NEILIKNKYAGINYIESYFRKGIYPSKK-PYVLGREASGVVVAKGDAVTKFDVNDKV--- 114

Query: 94  YTAECQKCKFCLSGKTNLCGAVRATQGKGVMPDGTSRFHNKKGESLYHFMGCSTFSEYTV 153
                                                           ++  +TF++YT 
Sbjct: 115 -----------------------------------------------AYLSSNTFAQYTK 127

Query: 154 VADVSVVA-IDQTAPLESVCLLGCGVT---TGYGAAVKTANVQKGDTVAVFGCGTVGLSV 209
           +++   V+ + Q +  E + L    +    T      +   V+KGD + ++         
Sbjct: 128 ISEAGTVSKVPQDSTDEQLKLYAGSLVQALTSLAFVREAYPVKKGDYILLYAAAGGAGLA 187

Query: 210 LQGAHQRGASRIIAIDTNDQKKDFCTQFGATDFINPTKDLKENETIVAKLIEMTDG-GLD 268
                ++  +  IA+ + D+K     ++GA   IN +KD      ++A+++E+T+G G++
Sbjct: 188 FNQFLKKAGAHTIAVASTDEKLQLAKEYGAEFLINSSKD-----DVLARVLEITNGQGVE 242

Query: 269 HTFDCTGNVNVMRSALEACHKGWGQSVIIGVAAAGQEISTRPFQLVTG---RVWKGSAFG 325
             FD  G  +   ++L+A  +   +  ++    A   +      ++T    ++ + S FG
Sbjct: 243 AAFDSVGK-DTFETSLKALKR---KGTLVSFGNASGPVPPVAINILTPKNIKLLRPSLFG 298

Query: 326 GVKGRSEM----AGLIEQYKKGELKVDEFITHRRSFNEINEAFDDLHN 369
            +    E     + L +    G LK+   I+      E N+A + L +
Sbjct: 299 YIATHEEWESYSSELFDLLHSGALKI--LISKTYPLEEYNQAAEQLES 344

>SAKL0D14938g Chr4 complement(1235542..1236678) [1137 bp, 378 aa]
           {ON} similar to uniprot|Q04894 Saccharomyces cerevisiae
           YMR318C ADH6 NADPH-dependent cinnamyl alcohol
           dehydrogenase family member with broad substrate
           specificity may be involved in fusel alcohol synthesis
           or in aldehyde tolerance
          Length = 378

 Score = 53.1 bits (126), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 74/327 (22%), Positives = 121/327 (37%), Gaps = 50/327 (15%)

Query: 30  PPKAHEVRIKIVNTAVCHTDAYTLSGADPEGLFPC----------VLGHEGAGIVESVGD 79
           P    +V I+I    +C ++ + L     +    C          V+GHE  G V +VG+
Sbjct: 34  PMSDFDVDIEIECCGICGSELHALQNNWSDEPLACLSAKIGPKSQVVGHEIVGHVVNVGN 93

Query: 80  GVTNVKPGDHV-IALYTAECQKCKFCLSGKTNLCGAVRATQGKGVMPDGTSRFHNKKGES 138
            VT    G+ V +      C KC  C++G    C     T      PDG           
Sbjct: 94  KVTKFHKGERVAMGAQCGSCMKCNRCINGYEQFCTGCIETYCSE-YPDG----------- 141

Query: 139 LYHFMGCSTFSEYTVVADVSVVAIDQTAPLESVCLLGCGVTTGYGAAVKTAN--VQKGDT 196
              ++    ++ +    +  +V +      + V  L CG  T Y    +       K   
Sbjct: 142 ---YVSQGGYASHVRAHEHYIVHVPPQLDSKHVAPLQCGGLTVYSPIKRALKDVTDKKPR 198

Query: 197 VAVFGCGTVGLSVLQGAHQRGASRIIAIDTNDQKKDFCTQFGATDFINPT-KDLKENETI 255
           VA+ G G +G   +  +       + A+ T+D KK+   + GA  F+N T KD+      
Sbjct: 199 VAIIGIGGLGHMAIMISKALDC-EVWALSTSDSKKEDAKKMGADHFVNTTEKDVW----- 252

Query: 256 VAKLIEMTDGGLDHTF----DCTGNVNVMR-SALEACHKGWGQSVIIGVAAAGQEISTRP 310
                    GGL  TF     CT +   +   +L       G+ + +G+ +  Q +   P
Sbjct: 253 ---------GGLQDTFHLILSCTISYTKLPFESLLGTLVATGKFISVGLPSKDQPLEIHP 303

Query: 311 FQLVT-GRVWKGSAFGGVKGRSEMAGL 336
            QL   G  +  S  G +K   E+  L
Sbjct: 304 MQLAAHGVSFSASHLGSIKELEELLAL 330

>Skud_2.162 Chr2 complement(299642..300646) [1005 bp, 334 aa] {ON}
           YBR046C (REAL)
          Length = 334

 Score = 52.0 bits (123), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 63/247 (25%), Positives = 99/247 (40%), Gaps = 63/247 (25%)

Query: 35  EVRIKIVNTAVCHTDAYTLSGADPEGLFPC----VLGHEGAGIVESVGDGVTNVKPGDHV 90
           ++ IK   T V + ++Y       +GL+PC    VLG E  G++ + G  VTN + GD V
Sbjct: 37  DILIKNKYTGVNYIESYFR-----KGLYPCEKPYVLGREATGVIVAKGKDVTNFETGDQV 91

Query: 91  IALYTAECQKCKFCLSGKTNLCGAVRATQGKGVMPDGTSRFHNKKGESLYHFMGCSTFSE 150
                A      F    K    G +        +P GTS                     
Sbjct: 92  -----AYISNSTFAQYTKFPSEGTIMK------LPSGTS--------------------- 119

Query: 151 YTVVADVSVVAIDQTAPLESVCLLGCGVTTGYGAAVKTANVQKGDTVAVF-GCGTVGLSV 209
                       D+   L +  LL     T      +  +V+KGD + V+   G VGL +
Sbjct: 120 ------------DEKMKLYAAGLLQA--LTALSFTNEAYHVKKGDYILVYAAAGGVGLIL 165

Query: 210 LQGAHQRGASRIIAIDTNDQKKDFCTQFGATDFINPTKDLKENETIVAKLIEMTDG-GLD 268
            Q    + A   IA+ +  +K +    +GA   I+ +K     E I+ +++E+TDG G+D
Sbjct: 166 NQLLRMKDA-HAIAVASTYEKLETAKDYGAEFLIDSSK-----EDILTRVLEITDGKGVD 219

Query: 269 HTFDCTG 275
            +FD  G
Sbjct: 220 ASFDSVG 226

>SAKL0D03872g Chr4 (316127..317173) [1047 bp, 348 aa] {ON} highly
           similar to uniprot|P38230 Saccharomyces cerevisiae
           YBR046C
          Length = 348

 Score = 52.0 bits (123), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 87/371 (23%), Positives = 139/371 (37%), Gaps = 83/371 (22%)

Query: 16  EAGKPQVV---EQIVVDPPKAHEVRIKIVNTAVCHTDAYTLSGADPEGLFPCVLGHEGAG 72
           E G P+V+   E   V    A EV IK   + +   ++Y   G  P    P VLG E AG
Sbjct: 29  EVGGPEVLRFEEDFPVPNINADEVLIKNKFSGINFIESYFRKGLYPSQK-PYVLGREAAG 87

Query: 73  IVESVGDGVTNVKPGDHVIALYTAECQKCKFCLSGKTNLCGAVRATQGKGVMPDGTSRFH 132
            V + GD V+    GD V                                          
Sbjct: 88  TVVAKGDAVSKFNIGDKV------------------------------------------ 105

Query: 133 NKKGESLYHFMGCSTFSEYTVVADV-SVVAIDQTAPLESVCLLGCGVTTGYGAAV---KT 188
                    ++   TF++YT   +   ++ + +    E +      +  G  A       
Sbjct: 106 --------AYLSPGTFAQYTKYPENGKILKLPKETTDEQLKFYAGSLVQGLTALTFVNDA 157

Query: 189 ANVQKGDTVAVFGC-GTVGLSVLQGAHQRGASRIIAIDTNDQKKDFCTQFGATDFINPTK 247
            +V+KGD + ++   G  GL   Q    +GA   IA+ + D+K     ++GA   IN +K
Sbjct: 158 YDVKKGDYILLYAAAGGAGLIFNQLLKLKGA-HTIAVASTDEKLKLAREYGAEYVINSSK 216

Query: 248 DLKENETIVAKLIEMTDG-GLDHTFDCTGNVNVMRSALEACHKGWGQSVIIGVAAAGQEI 306
           D       ++K++E+T+G G+   FD  G  +    +L+A  +  G  V  G A+     
Sbjct: 217 D-----DTLSKVLEITNGEGVAAAFDSIGK-DTFEISLQAIKRK-GTLVSFGNASG---- 265

Query: 307 STRPFQL-----VTGRVWKGSAFGGVKGRSEM----AGLIEQYKKGELKVDEFITHRRSF 357
              PF +        +V +   FG +    E     + LIE    G+LKV  FI+     
Sbjct: 266 PVPPFSINRLSSKNLKVLRPQVFGYITTSEEWNHYASKLIELLSSGDLKV--FISGTYPL 323

Query: 358 NEINEAFDDLH 368
           +E   A + L 
Sbjct: 324 SEYRAATEALE 334

>NCAS0C03020 Chr3 complement(593785..594873) [1089 bp, 362 aa] {ON} 
          Length = 362

 Score = 51.6 bits (122), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 92/372 (24%), Positives = 139/372 (37%), Gaps = 71/372 (19%)

Query: 24  EQIVVDPPKA--HEVRIKIVNTAVCHTDAYTLSGADPEGLFPCVLGHEGAGIVESVGDGV 81
           +++  DP K   H++ IK+    VC +D +  SG   +   P V+GHE  G V  +G+  
Sbjct: 24  KKVQFDPRKLYDHDIEIKVECCGVCGSDIHAASGNWGDLTKPLVVGHEIIGTVVRLGENC 83

Query: 82  TN-VKPGDHV-IALYTAECQKCKFCLSGKTNLCGAVRATQGKGVMPDGTSRFHNKKGESL 139
            + +K GD V +      C  C+ C +     C     T G+   PDG S   +K G   
Sbjct: 84  NSGLKLGDRVGVGAQVFSCLDCERCKNDNEPYCEGFVTTYGQD-YPDGYS---SKGG--- 136

Query: 140 YHFMGCSTFSEYTVVADVSVVAIDQTAPLESVCLLGCGVTTGYGAAVKTANVQKGDTVAV 199
                   +++Y  V +   V I +  P      L CG  T Y   V+            
Sbjct: 137 --------YADYFRVHEHFAVPIPENIPSHLAAPLMCGGLTVYSPLVRN----------- 177

Query: 200 FGCG----TVGLSVLQGAHQ------RGASRIIAIDTNDQKKDFCTQFGATDFI----NP 245
            GCG       + +    HQ         + + AI     KK+   + GA  FI     P
Sbjct: 178 -GCGPNKKVGIVGIGGIGHQGLLFAKAMGAEVYAISRTSAKKEDAMKLGADHFIATKEEP 236

Query: 246 ---TKDLKENETIVAKLIEMTDGGLDHTFDCTGNVNVMRSALEACHKGWGQSVIIGVAAA 302
              TK     + IV     +TD       D     N M+          G  V I V   
Sbjct: 237 DWGTKYFDTFDLIVVCASSLTD------VDFNTVPNTMKIG--------GSIVSISVPEQ 282

Query: 303 GQEISTRPFQLVTGRVWKGSAFGGVKGRSEMAGLIEQYKKGELK--VDEFITHRRSFNEI 360
            + +S +PF L  G     SA G +   SEM  L++   +  +K  V+      +    +
Sbjct: 283 NETLSLKPFGL-KGVSISNSALGSI---SEMRDLLKLVSENNIKLWVETIPIGEKG---V 335

Query: 361 NEAFDDLHNGLC 372
            EAF+ +  G C
Sbjct: 336 KEAFERMDKGDC 347

>KLTH0E07964g Chr5 (735214..736338) [1125 bp, 374 aa] {ON} similar
           to uniprot|P25377 Saccharomyces cerevisiae YCR105W ADH7
           NADPH-dependent cinnamyl alcohol dehydrogenase family
           member with broad substrate specificity may be involved
           in fusel alcohol synthesis
          Length = 374

 Score = 50.8 bits (120), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 60/255 (23%), Positives = 93/255 (36%), Gaps = 35/255 (13%)

Query: 65  VLGHEGAGIVESVGDGVTNVKPGDHV-IALYTAECQKCKFCLSGKTNLCGAVRATQGKGV 123
           V+GHE  G V +VG  V+  K GD V +    + C +C  C S     C     T     
Sbjct: 75  VVGHEVVGKVVAVGPEVSLCKVGDRVGLGAQASACMQCSRCQSSNEQYCAQSIGTYCN-P 133

Query: 124 MPDGTSRFHNKKGESLYHFMGCSTFSEYTVVADVSVVAIDQTAPLESVCLLGCGVTTGYG 183
            PDG              ++    ++ +    +     I    P E V  L CG  T + 
Sbjct: 134 YPDG--------------YVSQGGYASHVRAHEQFCFPIPPEIPSELVAPLQCGGLTVFS 179

Query: 184 AAVKTANVQKGDTVAVFGCGTVGLSVLQGAHQRGASRIIAIDTNDQKKDFCTQFGATDFI 243
              +    +K   VA+ G G +G   +  +   GA  + A+     K+D   + GA  FI
Sbjct: 180 PIKRNIQGKKNPRVAIIGIGGLGHMAIMISKALGA-EVSAVSRGYSKRDDALKMGADHFI 238

Query: 244 NPTKDLKENETIVAKLIEMTDGGLDHTFDCTGNVNVMRSALE-----ACHKGWGQSVIIG 298
             ++                + GLD TFD   N     S+L+      C K     V +G
Sbjct: 239 ATSE-------------PNWNAGLDDTFDLILNCASSTSSLDLNALLPCLKVNCNFVSVG 285

Query: 299 VAAAGQEISTRPFQL 313
           +    ++   +PF  
Sbjct: 286 LPHIDEDFKVKPFSF 300

>NDAI0H02940 Chr8 complement(717073..718158) [1086 bp, 361 aa] {ON} 
          Length = 361

 Score = 50.1 bits (118), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 87/330 (26%), Positives = 132/330 (40%), Gaps = 44/330 (13%)

Query: 20  PQVVEQIVVDPPKA---HEVRIKIVNTAVCHTDAYTLSGADPEGLFPCVLGHEGAGIVES 76
           PQ VE     PPK     +V IKI    VC +D +  SG   +   P ++GHE  G V  
Sbjct: 22  PQRVEF----PPKPFHDRDVDIKIECCGVCGSDIHAASGHWGDIEKPLIVGHEIIGTVVK 77

Query: 77  VGDGVTN-VKPGDHV-IALYTAECQKCKFCLSGKTNLCGAVRATQGKGVMPDGTSRFHNK 134
           +G    N +K GD V +      C KC  CL+   + C     T G    PDG   + +K
Sbjct: 78  LGSKCENGLKLGDRVGMGAQCYSCLKCDRCLNNNESYCQHFVTTYGMN-YPDG---YASK 133

Query: 135 KGESLYHFMGCSTFSEYTVVADVSVVAIDQTAPLESVCLLGCGVTTGYGAAVKTANVQKG 194
            G           ++E+  V +  V+ I +  P      L CG  T +    +      G
Sbjct: 134 GG-----------YAEFVRVHEHFVIPIPENIPSHLAAPLMCGGNTIFSPLTRNG-CGPG 181

Query: 195 DTVAVFGCGTVGLSVLQGAHQRGASRIIAIDTNDQKKDFCTQFGATDFINPTKDLKENET 254
             V + G G +G   L  A+  GA  + AI    +K++   + GA  FI      KE   
Sbjct: 182 KKVGIMGIGGIGHMGLIFANALGA-EVYAISRTSKKREDAKKLGAHHFIA----TKEEPD 236

Query: 255 IVAKLIEMTDGGLDHTFD----CTGNV-NVMRSALEACHKGWGQSVIIGVAAAGQEISTR 309
              K  +        TFD    C  ++ ++  + +    K  G+ V I V    + ++ +
Sbjct: 237 WGTKYFD--------TFDLIVVCASSLSDIDFNVVPKTMKIGGKIVSICVPDENEVLALK 288

Query: 310 PFQLVTGRVWKGSAFGGVKGRSEMAGLIEQ 339
           PF L+ G     S  G V    +M  L+ +
Sbjct: 289 PFGLL-GVSISNSHLGSVAEIKQMLKLVSE 317

>KAFR0A08730 Chr1 complement(1747657..1748739) [1083 bp, 360 aa]
           {ON} 
          Length = 360

 Score = 48.5 bits (114), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 65/217 (29%), Positives = 90/217 (41%), Gaps = 20/217 (9%)

Query: 34  HEVRIKIVNTAVCHTDAYTLSGADPEGLFPCVLGHEGAGIVESVGDGVTN-VKPGDHV-I 91
           +++ IKI    VC +D +  SG   +   P V+GHE  G V  VG   T+ +K GD V +
Sbjct: 34  NDIDIKIEACGVCGSDVHMASGNWGDVKKPLVVGHEIVGTVVKVGSKCTSGMKVGDRVGV 93

Query: 92  ALYTAECQKCKFCLSGKTNLCGAVRATQGKGVMPDGTSRFHNKKGESLYHFMGCSTFSEY 151
                 C  C  C +     C  V  T G    PDG    +N KG           ++ Y
Sbjct: 94  GAQVHSCLTCDRCNNDNEQYCPNVVFTYGFD-YPDG----YNGKG----------GYANY 138

Query: 152 TVVADVSVVAIDQTAPLESVCLLGCGVTTGYGAAVKTANVQKGDTVAVFGCGTVGLSVLQ 211
             V +   V I +  P      L CG  T Y   ++      G  V + G G +G   + 
Sbjct: 139 IRVHEHFAVPIPENIPTHLAAPLLCGGITVYSPLLRNG-CGPGKKVGILGIGGIGHMGII 197

Query: 212 GAHQRGASRIIAIDTNDQKKDFCTQFGATDFINPTKD 248
            A   GA  + AI  +D KK+   + GA  FI  TKD
Sbjct: 198 FAKSMGA-EVYAISRSDAKKEDAFKLGADHFI-ATKD 232

>NDAI0A06320 Chr1 (1438393..1439442) [1050 bp, 349 aa] {ON}
           Anc_3.253
          Length = 349

 Score = 47.8 bits (112), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 42/167 (25%), Positives = 76/167 (45%), Gaps = 11/167 (6%)

Query: 114 AVRATQGKGVMPDGTSRFHNKKGESLYHFMGCSTFSEYTVVADVSVVAIDQTAPLESVCL 173
           A+   +  GV+ D  +   N +      ++G  + +++T + +  ++ +   +  E + L
Sbjct: 81  AILGREASGVVVDKGTNIKNFEIGDKVAYIGNCSMAQFTKIDNSMIMKLSSDSTNEDLKL 140

Query: 174 LGCGVTTGYGA---AVKTANVQKGDTVAVFGC-GTVGLSVLQGAHQRGASRIIAIDTNDQ 229
              G+  G  A     +   V+KGD + V+   G  GL   Q    RGA  +IA+ ++D+
Sbjct: 141 YAAGILQGLTALSFVTEAYEVKKGDYILVYAAAGGAGLIFDQLIKARGA-HVIAVCSSDE 199

Query: 230 KKDFCTQFGATDFINPTKDLKENETIVAKLIEMTDG-GLDHTFDCTG 275
           K     + GA   IN   D      I+ K++E+TD  G+   FD  G
Sbjct: 200 KLQLAKENGAEYLINSKTD-----DILTKVMEITDNKGVQAAFDSVG 241

>Ecym_1093 Chr1 complement(195854..197005) [1152 bp, 383 aa] {ON}
           similar to Saccharomyces cerevisiae YMR318C ADH6 /
           YCR105W ADH7
          Length = 383

 Score = 47.8 bits (112), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 75/320 (23%), Positives = 127/320 (39%), Gaps = 36/320 (11%)

Query: 33  AHEVRIKIVNTAVCHTDAYTLSGADPEGLFPCVLGHEGAGIVESVGDGVTN-VKPGDHV- 90
           A ++ +K+    VC +D +  +G       P V+GHE  G V  VG G    +K GD V 
Sbjct: 56  ARDIVLKVEACGVCGSDIHCAAGHWGPRNNPLVVGHEIIGRVIEVGSGCKEGLKVGDRVG 115

Query: 91  IALYTAECQKCKFCLSGKTNLCGAVRATQGKGVMPDGTSRFHNKKGESLYHFMGCSTFSE 150
           +      C +C  C S     C  +  T      PDG              ++    ++ 
Sbjct: 116 VGAQALSCLECSRCESENEQYCSNMTGTYNFP-YPDG--------------YISQGGYAS 160

Query: 151 YTVVADVSVVAIDQTAPLESVCLLGCGVTTGYGAAVKTANVQKGDTVAVFGCGTVGLSVL 210
           + +V +   + I    P      L CG  T +   +++ NV  G +V V G G +G   +
Sbjct: 161 HVIVHEHFAIPIPDNIPSHLAAPLMCGGITAFSPLLRS-NVGPGTSVGVVGIGGIGHMAV 219

Query: 211 QGAHQRGASRIIAIDTNDQKKDFCTQFGATDFINPTKDLKENETIVAKLIEMTDGGLDHT 270
             A   GA+ + AI     KKD   + GA  +I   +D   ++T            LD  
Sbjct: 220 IFAKALGAN-VTAISRRSNKKDDALKLGADVYIAAVEDKDWHKTYA--------NTLDLI 270

Query: 271 FDCTGNVNVMR-SALEACHKGWGQSVIIGVAAAGQEISTRPFQLVTGRVWKGSAFGG--V 327
             C+ ++  +    + +  K  G+ + I +  A + +  RP  L      KG + G   +
Sbjct: 271 VVCSSSLTELDFDRIPSLLKVGGKVLSIAIPEASERLVLRPLLL------KGISIGTSVI 324

Query: 328 KGRSEMAGLIEQYKKGELKV 347
              +E+  L++   K  LK+
Sbjct: 325 GSPAEIKKLLDFVSKKNLKI 344

>ZYRO0A03366g Chr1 (271779..272828) [1050 bp, 349 aa] {ON} highly
           similar to uniprot|P38230 Saccharomyces cerevisiae
           YBR046C ZTA1 Zeta-crystallin homolog
          Length = 349

 Score = 47.4 bits (111), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 55/219 (25%), Positives = 99/219 (45%), Gaps = 22/219 (10%)

Query: 142 FMGCSTFSEYTVV-ADVSVVAIDQTAPLESVCLLGCGVTTGYGAAV---KTANVQKGDTV 197
           ++  S F++YT V A   VV + + A  E++ L   G+     A     +  NV+KGD +
Sbjct: 109 YLSGSAFAQYTKVDAAGKVVKLPKDANDETLKLYAAGLLQSLTALTFIDEAYNVKKGDFI 168

Query: 198 AVF-GCGTVGLSVLQGAHQRGASRIIAIDTNDQKKDFCTQFGATDFINPTKDLKENETIV 256
             +   G VGL + Q   +RGA   IA+ + ++K +   + GA   I  +K     E IV
Sbjct: 169 LNYAAAGGVGLILDQLLKERGA-HTIAVVSTEEKLELAKKHGAEYGIISSK-----EDIV 222

Query: 257 AKLIEMTDG-GLDHTFDCTGNVNVMRSALEACHKGWGQSVIIGVAAAGQEISTRPFQLVT 315
            ++ E+T+  G+D  FD  G  +   + + A  +   +   +    A   +S  P   +T
Sbjct: 223 TRVKEITNNQGVDAAFDSIGK-DTFETTISALKR---KGTFVSYGNASGPVSPFPLTKLT 278

Query: 316 G--RVWKGSAFGGVKGRSEMAGLIEQY----KKGELKVD 348
           G  ++ + S F  +    E      ++      G+LK++
Sbjct: 279 GNIKILRPSLFSYIATSEEWKHYSREFVSLVSSGKLKIN 317

>KNAG0K02680 Chr11 complement(531173..532252) [1080 bp, 359 aa] {ON}
           
          Length = 359

 Score = 45.8 bits (107), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 67/284 (23%), Positives = 110/284 (38%), Gaps = 28/284 (9%)

Query: 34  HEVRIKIVNTAVCHTDAYTLSGADPEGLFPCVLGHEGAGIVESVGDGVTN-VKPGDHV-I 91
           H++ IKI    VC +D +  SG   +   P V+GHE  G +  +G    +  K GD V +
Sbjct: 34  HDIDIKIEACGVCGSDVHCASGNWGDTPKPLVVGHEIIGTIVKMGPKCNSGYKIGDRVGM 93

Query: 92  ALYTAECQKCKFCLSGKTNLCGAVRATQGKGVMPDGTSRFHNKKGESLYHFMGCSTFSEY 151
                 C +C  C++     C  V  T         +SR                 ++ Y
Sbjct: 94  GAQAMSCLECDRCINDNEPYCAKVVCTYANPYEDGYSSR---------------GGYANY 138

Query: 152 TVVADVSVVAIDQTAPLESVCLLGCGVTTGYGAAVKTANVQKGDTVAVFGCGTVGLSVLQ 211
             V +   V I ++ P      L CG  T + + +K      G  V + G G +G   + 
Sbjct: 139 VRVHEHFAVPIPESIPSHLAAPLMCGGLTVF-SPLKRNGCGPGKKVGIIGIGGIGHMGII 197

Query: 212 GAHQRGASRIIAIDTNDQKKDFCTQFGATDFINPTKDLKENETIVAKLIEMTDGGLDHTF 271
            A   GA  + AI    +K+D   + GA  FI   ++   ++    K        LD   
Sbjct: 198 LAKAMGA-EVYAISRTSKKRDDAMKLGADHFIAIKEEPDWHKEYFDK--------LDLVV 248

Query: 272 DCTGNV-NVMRSALEACHKGWGQSVIIGVAAAGQEISTRPFQLV 314
            C G++ ++  + L       G+ V I +    + +  +PF LV
Sbjct: 249 ICAGSLTDIDFNTLPNILTVGGRIVSIAIPEQHEVLKMKPFGLV 292

>KLLA0F00638g Chr6 (51849..52997) [1149 bp, 382 aa] {ON} weakly
           similar to uniprot|P53912 Saccharomyces cerevisiae or
           YLR460C uniprot|P54007 Saccharomyces cerevisiae YLR460C
           Hypothetical ORFs
          Length = 382

 Score = 45.4 bits (106), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 59/259 (22%), Positives = 99/259 (38%), Gaps = 55/259 (21%)

Query: 25  QIVVDPP-----KAHEVRIKIVNTAVCHTDAYTLSGADPEGLFPCVLGHEGAGIVESVGD 79
           +++ D P     K +E+ IK     + H D  +         FP V G E +GIV   G+
Sbjct: 60  KLLTDLPVPQKLKPYEILIKNKYIGLNHVDWKSKKYRFSIYSFPWVNGRESSGIVVRRGE 119

Query: 80  GVTNVKPGDHVIALYTAECQKCKFCLSGKTNLCGAVRATQGKGVMPDGTSRFHNKKGESL 139
            V                  + KF L G+  +                            
Sbjct: 120 KV-----------------DEEKFPLGGEVFIASTT------------------------ 138

Query: 140 YHFMGCSTFSEYTVVADVSVVAIDQTAPLESVCLLGCGVTTGYGAAVKTANV----QKGD 195
           Y  +  STF EYTV     V  + +   L+    +G  + T   A     NV    ++  
Sbjct: 139 YRDLRTSTFQEYTVFDSRLVWRVPERIGLDFASGIGVSLVTAGAALASKRNVKVQPEEKK 198

Query: 196 TVAVFGCGT-VGLSVLQGAHQRGASRIIAIDTNDQKKDFCTQFGATDFINPTKDLKENET 254
           ++ ++G  T VG+ V+Q A   G ++II I T+ + + +    GAT  I+     ++ E 
Sbjct: 199 SIVIWGGSTGVGIFVVQLAKSLGFTKIITI-TSKKHEQYLLSLGATHIIHRE---EKTED 254

Query: 255 IVAKLIEMTDGGLDHTFDC 273
           IV ++ ++   G+ H  D 
Sbjct: 255 IVNEIKKICPNGVSHGVDL 273

>KLTH0B04972g Chr2 (408153..409235) [1083 bp, 360 aa] {ON} highly
           similar to uniprot|Q04894 Saccharomyces cerevisiae
           YMR318C ADH6 NADPH-dependent cinnamyl alcohol
           dehydrogenase family member with broad substrate
           specificity may be involved in fusel alcohol synthesis
           or in aldehyde tolerance
          Length = 360

 Score = 45.4 bits (106), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 81/331 (24%), Positives = 128/331 (38%), Gaps = 38/331 (11%)

Query: 24  EQIVVDPPK--AHEVRIKIVNTAVCHTDAYTLSGADPEGLFPCVLGHEGAGIVESVGDGV 81
           ++I  +P K   ++V ++I    +C +D +  SG       P V+GHE  G V  VG   
Sbjct: 22  KKISYEPKKFDDYDVDVEIEACGICGSDTHCASGNWGPKSLPLVVGHEVIGRVVRVGPKC 81

Query: 82  -TNVKPGDHV-IALYTAECQKCKFCLSGKTNLCGAVRATQGKGVMPDGTSRFHNKKGESL 139
            T VK GD V +    + C  C  C S     C     T  +   PDG    +  +G   
Sbjct: 82  HTGVKVGDRVGVGAQVSSCLDCDRCNSDFEPYCAEFITTYSQP-YPDG----YVSQGGYA 136

Query: 140 YHFMGCSTFSEYTVVADVSVVAIDQTAPLESVCLLGCGVTTGYGAAVKT--ANVQKGDTV 197
            H      F          V+ I +  P      L CG  T +   +       +K   V
Sbjct: 137 SHIRAHEHF----------VIPIPEKIPTHLAAPLLCGGITVFSPLINNDCGPNKKVGIV 186

Query: 198 AVFGCGTVGLSVLQGAHQRGASRIIAIDTNDQKKDFCTQFGATDFINPTKDLKENETIVA 257
            + G G +GL   +       + + AI  +  KK+   + GA  FI  TK+  + E   A
Sbjct: 187 GIGGIGHMGLIFAKAL----GAEVYAISRSSAKKEDAMKLGADHFIA-TKEEPDWEKKYA 241

Query: 258 KLIEMTDGGLDHTFDCTGNV-NVMRSALEACHKGWGQSVIIGVAAAGQEISTRPFQLVTG 316
                    LD    C  ++  +    L    +  G+ + I V    +E++ +PFQL +G
Sbjct: 242 -------STLDLVIVCASSLTEINLEQLIKTMRIKGRIISICVPKETEELNLKPFQL-SG 293

Query: 317 RVWKGSAFGGVKGRSEMAGLIEQYKKGELKV 347
                S  G    R E+  L++     +LK+
Sbjct: 294 ITIGNSQLG---SRKELIQLLQLVADKDLKI 321

>CAGL0M14047g Chr13 complement(1386775..1387854) [1080 bp, 359 aa]
           {ON} highly similar to uniprot|Q04894 Saccharomyces
           cerevisiae YMR318c or uniprot|P25377 Saccharomyces
           cerevisiae YCR105w
          Length = 359

 Score = 44.3 bits (103), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 86/337 (25%), Positives = 133/337 (39%), Gaps = 45/337 (13%)

Query: 20  PQVVEQIVVDPPKAHEVRIKIVNTAVCHTDAYTLSGADPEGLFPCVLGHEGAGIVESVGD 79
           P+ VE     P   ++V IKI    VC +D +  +G   +   P V+GHE  G V  VG 
Sbjct: 20  PKKVE-FPAKPFYDNDVDIKIEACGVCGSDIHCAAGNWGQKQTPLVVGHEIIGKVVKVGP 78

Query: 80  GV-TNVKPGDHV-IALYTAECQKCKFCLSGKTNLCGAVRATQGKGVMPDGTSRFHNKKGE 137
              T +K GD V +      C +C+ C +     C     T             +++  E
Sbjct: 79  KCKTGLKIGDRVGVGAQVFSCLECERCKNDNEPYCARFVTT-------------YSQPYE 125

Query: 138 SLYHFMGCSTFSEYTVVADVSVVAIDQTAPLESVCLLGCGVTTGYGAAVKTANVQKGDTV 197
             Y   G   ++ Y  V +   V I +  P E    L CG  T Y   ++      G  V
Sbjct: 126 DGYVSQG--GYANYVRVHEHFAVPIPENIPSEYAAPLLCGGLTVYSPLLRNG-CGPGKKV 182

Query: 198 AVFGCGTVGLSVLQGAHQRGASRIIAIDTNDQKKDFCTQFGATDFI----NP---TKDLK 250
            + G G +G   +  A   GA  + AI  ++ KK+   + GA  +I     P   TK   
Sbjct: 183 GILGIGGIGHMGILFAKAMGA-EVYAISRSNAKKEDSLKLGADHYIATKEEPDWGTKYFD 241

Query: 251 ENETIVAKLIEMTDGGLDHTFDCTGNVNVMRSALEACHKGWGQSVIIGVAAAGQEISTRP 310
             + IV     +TD   D          VM  A+    K  G+ V I V    + ++ +P
Sbjct: 242 TFDLIVVCASSLTDVDFD----------VMPKAM----KVGGRIVSISVPEQDEVLTMKP 287

Query: 311 FQLVTGRVWKGSAFGGVKGRSEMAGLIEQYKKGELKV 347
           F L+ G     S  G +   +EM  L++   +  +K+
Sbjct: 288 FGLI-GVSIANSILGSI---AEMKQLLKLVSENNIKI 320

>CAGL0H09944g Chr8 complement(971519..972520) [1002 bp, 333 aa] {ON}
           similar to uniprot|P38230 Saccharomyces cerevisiae
           YBR046c ZTA1
          Length = 333

 Score = 43.1 bits (100), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 71/297 (23%), Positives = 117/297 (39%), Gaps = 71/297 (23%)

Query: 35  EVRIKIVNTAVCHTDAYTLSGADPEGLFPCVLGHEGAGIVESVGDGVTNVKPGDHVIALY 94
           +V +K     V   +AY   G  P  L P VLG E +G V  VG  V + K GD V    
Sbjct: 36  DVLVKNKYAGVNFIEAYFRKGYYPCEL-PYVLGREASGEVVQVGSEVKDFKIGDKV---- 90

Query: 95  TAECQKCKFCLSGKTNLCGAVRATQGKGVMPDGTSRFHNKKGESLYHFMGCSTFSEYTVV 154
                                                          ++G STF++YT  
Sbjct: 91  ----------------------------------------------AYLGGSTFAQYTKK 104

Query: 155 A-DVSVVAIDQTAPLESVCLLGCGVT---TGYGAAVKTANVQKGDTVAVFGC-GTVGLSV 209
           + +  ++ + Q+ P E + L G  +    T      +   V +GD + V+   G VG  +
Sbjct: 105 STENHIMNLGQSCPDEDLKLYGSSLVQCLTAISFIDEAYKVMEGDYILVYAASGGVGSIL 164

Query: 210 LQGAHQRGASRIIAIDTNDQKKDFCTQFGATDFINPTKDLKENETIVAKLIEMTDG-GLD 268
            Q   QR A  +IA+ ++ +K     + GA   IN  +D      I+ K+++ T+G G+ 
Sbjct: 165 CQLISQRKA-HVIAVASSAEKLAMAKENGAEFLINYAED-----DILEKVMQYTNGKGVH 218

Query: 269 HTFDCTGNVNVMRSALEACHKGWGQSVIIGVAA------AGQEISTRPFQLVTGRVW 319
             FD  G  +   + L A  +  G  V  G A+      A  ++S +  +L+  +V+
Sbjct: 219 AAFDSIGK-DTFETDLAALRRK-GTLVSFGNASGMVPPFAINKLSPKNLKLLRPQVY 273

>Smik_13.535 Chr13 complement(893727..894809) [1083 bp, 360 aa] {ON}
           YMR318C (REAL)
          Length = 360

 Score = 43.1 bits (100), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 78/348 (22%), Positives = 129/348 (37%), Gaps = 41/348 (11%)

Query: 1   MTEGKPIECLAAVAYEAGKPQVVEQIVVDPPKAHEVRIKIVNTAVCHTDAYTLSGADPEG 60
           M+  +  E +A  ++E  K     +    P   H+V IKI    VC +D +  +G     
Sbjct: 1   MSYPEKFEGIAIQSHEDWKNPKKTKYDPKPFYDHDVDIKIEACGVCGSDVHCAAGHWGNM 60

Query: 61  LFPCVLGHEGAGIVESVGDGVTN-VKPGDHV-IALYTAECQKCKFCLSGKTNLCGAVRAT 118
             P V+GHE  G V  +GD   + +K G  V +      C +C  C S     C     T
Sbjct: 61  KMPLVVGHEIVGKVVRLGDKSNSGLKVGQRVGVGAQVFSCLECDRCKSDNEPYCTKFVTT 120

Query: 119 QGKGVMPDGTSRFHNKKGESLYHFMGCSTFSEYTVVADVSVVAIDQTAPLESVCLLGCGV 178
             +    DG              ++    ++ Y  V +  +V I +  P      L CG 
Sbjct: 121 YSQP-YEDG--------------YISQGGYANYVRVHEHFIVPIPENVPSHLAAPLLCGG 165

Query: 179 TTGYGAAVKTA-----NVQKGDTVAVFGCGTVGLSVLQGAHQRGASRIIAIDTNDQKKDF 233
            T Y   V+        V       +   GT+ +S   GA     SR      + +KK+ 
Sbjct: 166 LTVYSPLVRNGCGPGKKVGIVGLGGIGSMGTL-ISKAMGAETYVISR------SSKKKED 218

Query: 234 CTQFGATDFINPTK--DLKENETIVAKLIEMTDGGLDHTFDCTGNVNVMRSALEACHKGW 291
             + GA  +I   +  D  E       LI +    L        + N+M  A+    K  
Sbjct: 219 AIKMGADHYIATLEEGDWGEKYFDTFDLIVVCASSLTDI-----DFNIMPKAM----KVG 269

Query: 292 GQSVIIGVAAAGQEISTRPFQLVTGRVWKGSAFGGVKGRSEMAGLIEQ 339
           G+ V I +    + ++ +P+ L    +   SA G +K   ++  L+ +
Sbjct: 270 GRIVSISIPEQHEMLTLKPYGLKAVSI-SYSALGSIKELKQLLALVSE 316

>CAGL0H06853g Chr8 complement(680184..681266) [1083 bp, 360 aa] {ON}
           highly similar to uniprot|Q04894 Saccharomyces
           cerevisiae YMR318c
          Length = 360

 Score = 42.7 bits (99), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 80/340 (23%), Positives = 123/340 (36%), Gaps = 64/340 (18%)

Query: 20  PQVVEQIVVDPPKAHEVRIKIVNTAVCHTDAYTLSGADPEGLFPCVLGHEGAGIVESVGD 79
           P+ VE     P   H++ IKI    VC +D +  +G   +   P V+GHE  G V  +G 
Sbjct: 21  PKKVE-FPAKPFYDHDIDIKIDACGVCGSDIHCAAGNWGKKQTPLVVGHEIIGKVVKIGP 79

Query: 80  GV-TNVKPGDHV-IALYTAECQKCKFCLSGKTNLCGAVRATQGKGVMPDGTSRFHNKKGE 137
              T +K GD V +      C +C  C +     C     T             +++  E
Sbjct: 80  KCNTGLKVGDRVGVGAQVFSCLECDRCKNDNEPYCPKFVTT-------------YSQPYE 126

Query: 138 SLYHFMGCSTFSEYTVVADVSVVAIDQTAPLESVCLLGCGVTTGYGAAVKTANVQKGDTV 197
             Y   G   ++ Y  V +   V I +  P      L CG  T Y   ++          
Sbjct: 127 DGYVSQG--GYANYVRVHEHFAVKIPENIPDHLAAPLLCGGITVYSPLLRN--------- 175

Query: 198 AVFGCGTVGLSV-----------LQGAHQRGASRIIAIDTNDQKKDFCTQFGATDFINPT 246
              GCG                 L  A   GA  + AI  ++ KK+   + GA  +I   
Sbjct: 176 ---GCGPGKKVGIVGIGGIGHMGLLFAKAMGA-EVYAISRSNAKKEDSLKLGADHYIATK 231

Query: 247 KDLKENET-------IVAKLIEMTDGGLDHTFDCTGNVNVMRSALEACHKGWGQSVIIGV 299
           ++    E        IV     +TD   D          VM  A+    K  G+ V I +
Sbjct: 232 EEPNWGEKYFDTFDLIVVCASSLTDVDFD----------VMPKAM----KVGGRIVSISI 277

Query: 300 AAAGQEISTRPFQLVTGRVWKGSAFGGVKGRSEMAGLIEQ 339
               Q ++ +PF L+ G     SA G +K   ++  L+ +
Sbjct: 278 PDEDQTLTMKPFGLL-GVSIANSALGSIKEIEQLLKLVSE 316

>KLLA0E19889g Chr5 (1770061..1771161) [1101 bp, 366 aa] {ON} similar
           to uniprot|Q04894 Saccharomyces cerevisiae YMR318C ADH6
           NADPH-dependent cinnamyl alcohol dehydrogenase family
           member with broad substrate specificity may be involved
           in fusel alcohol synthesis or in aldehyde tolerance
          Length = 366

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 57/233 (24%), Positives = 90/233 (38%), Gaps = 21/233 (9%)

Query: 16  EAGKPQVVEQIVVDPPK---AHEVRIKIVNTAVCHTDAYTLSGADPEGLFPCVLGHEGAG 72
           ++ K  +  + VV P K     +V I+I    VC +D +   G   E   P V+GHE  G
Sbjct: 14  DSHKKWLSPEKVVYPAKQFNPRDVDIEIEACGVCGSDVHCAKGNWGEMKLPLVVGHEIIG 73

Query: 73  IVESVGDGV-TNVKPGDHV-IALYTAECQKCKFCLSGKTNLCGAVRATQGKGVMPDGTSR 130
            V  +GD   T +K GD V +    + C  C  C +     C     T  +    DG   
Sbjct: 74  KVVRLGDKCDTGLKVGDRVGVGAQVSACLDCNRCNNDNEQYCPKFVTTYSQPYFEDG--- 130

Query: 131 FHNKKGESLYHFMGCSTFSEYTVVADVSVVAIDQTAPLESVCLLGCGVTTGYGAAVKTAN 190
                      ++G   ++ +  V +  V+ I ++    +V  L CG  T Y    +   
Sbjct: 131 -----------YVGQGGYASHIRVHEHFVIPIPESLETNNVAPLLCGGATVYSPLKRNGC 179

Query: 191 VQKGDTVAVFGCGTVGLSVLQGAHQRGASRIIAIDTNDQKKDFCTQFGATDFI 243
                   V   G   + +L  A   GA  + AI  +  K++   Q GA  +I
Sbjct: 180 GPGKKVGIVGIGGIGHMGILL-AKAMGA-EVYAISRSHAKEETSKQLGADHYI 230

>Suva_13.513 Chr13 complement(894394..895476) [1083 bp, 360 aa] {ON}
           YMR318C (REAL)
          Length = 360

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 81/346 (23%), Positives = 138/346 (39%), Gaps = 37/346 (10%)

Query: 1   MTEGKPIECLAAVAYEAGKPQVVEQIVVDPPK--AHEVRIKIVNTAVCHTDAYTLSGADP 58
           M+  +  E +A  ++E  K    ++I  DP     H+V IKI    VC +D +  +G   
Sbjct: 1   MSYPEKFEGIAIQSHEDWKNP--KKIKYDPKPFYDHDVDIKIEACGVCGSDIHCAAGNWG 58

Query: 59  EGLFPCVLGHEGAGIVESVGDGVTN-VKPGDHV-IALYTAECQKCKFCLSGKTNLCGAVR 116
           +   P V+GHE  G V  +G    + ++ G  V +      C +C  C S     C    
Sbjct: 59  KKKMPLVVGHEIVGTVVKLGSKSNSGLQVGQRVGMGAQVFSCLECDRCKSDNEPYCTKFV 118

Query: 117 ATQGKGVMPDGTSRFHNKKGESLYHFMGCSTFSEYTVVADVSVVAIDQTAPLESVCLLGC 176
            T G+    DG              ++    +++Y  V +  VV I +  P      L C
Sbjct: 119 TTYGQP-YEDG--------------YVSQGGYADYVRVHEHFVVPIPENIPSHLAAPLLC 163

Query: 177 GVTTGYGAAVKT--ANVQKGDTVAVFGCGTVGLSVLQGAHQRGASRIIAIDTNDQKKDFC 234
           G  T Y   V+      +K   V   G G++G  +   A   GA   + I  + +K++  
Sbjct: 164 GGLTAYSPLVRNGCGPGKKVGIVGFGGIGSMGTLI---AKAMGAETYV-ISRSSKKREDA 219

Query: 235 TQFGATDFINPTKDLKENETIVAKLIEMTDGGLDHTFDCTG-NVNVMRSALEACHKGWGQ 293
            + GA  +I       E E    K  +  D  +      TG + +VM  A+    K  G+
Sbjct: 220 MKMGADHYIATL----EEENWGEKYFDTFDLIVVCASSLTGIDFDVMPKAM----KVGGR 271

Query: 294 SVIIGVAAAGQEISTRPFQLVTGRVWKGSAFGGVKGRSEMAGLIEQ 339
            V I +    + ++ +P+ L    +   SA G +K   ++  L+ +
Sbjct: 272 IVSISIPEQHEVLTLKPYGLKAVSI-SYSALGSIKELKQLLKLVSE 316

>NCAS0I01730 Chr9 (319449..320498) [1050 bp, 349 aa] {ON} Anc_3.253
          Length = 349

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 59/253 (23%), Positives = 101/253 (39%), Gaps = 71/253 (28%)

Query: 33  AHEVRIKIVNTAVCHTDAYTLSGADPEGLFPCVL----GHEGAGIVESVGDGVTNVKPGD 88
           ++E+ IK   + +   +AY       +G++PC L    G E +GIV  VG  V N + GD
Sbjct: 52  SNEMVIKNSYSGINFIEAYF-----RKGIYPCELPYLPGREASGIVAEVGKDVKNFQIGD 106

Query: 89  HVIALYTAECQKCKFCLSGKTNLCGAVRATQGKGVMPDGTSRFHNKKGESLYHFMGCSTF 148
            V  L+                                         GE         T 
Sbjct: 107 KVAYLH-----------------------------------------GE---------TM 116

Query: 149 SEYTVVADVS-VVAIDQTAPLESVCLLGCGVTTGYGAAV---KTANVQKGDTVAVF-GCG 203
           +E+T + +   ++ + + A  E++ L   G+     A     +   V+KG+ V V+   G
Sbjct: 117 AEFTKIKETDPIIKLSKDASDENLKLYAAGLLQSLTAITLINEAHEVKKGEYVLVYAAAG 176

Query: 204 TVGLSVLQGAHQRGASRIIAIDTNDQKKDFCTQFGATDFINPTKDLKENETIVAKLIEMT 263
            VGL + Q    +GA   IA+ +  +K +     GA   IN      + E +V +++E+T
Sbjct: 177 GVGLLLDQLLKMKGA-HTIAVCSTKEKLELAKANGAEFSIN-----SKEENVVQRVMEIT 230

Query: 264 DG-GLDHTFDCTG 275
           +  G+D  +D  G
Sbjct: 231 NNKGVDVAYDSIG 243

>KNAG0B06990 Chr2 (1393058..1394134) [1077 bp, 358 aa] {ON} 
          Length = 358

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 79/340 (23%), Positives = 124/340 (36%), Gaps = 33/340 (9%)

Query: 34  HEVRIKIVNTAVCHTDAYTLSGADPEGLFPCVLGHEGAGIVESVGDGV-TNVKPGDHV-I 91
           H++ I+++   VC +D +  SG   E   P V+GHE  GIV   G    + +K  D V +
Sbjct: 34  HDIDIRVLACGVCGSDIHCASGHWGEIPKPLVVGHEIIGIVVKTGPRCDSGLKVEDRVGV 93

Query: 92  ALYTAECQKCKFCLSGKTNLCGAVRATQGKGVMPDGTSRFHNKKGESLYHFMGCSTFSEY 151
                 C  C  C       C    +T  K    DG              ++    +++Y
Sbjct: 94  GAQALSCLDCDRCTHDNEPYCPNRVSTYAKSYR-DG--------------YVSQGGYADY 138

Query: 152 TVVADVSVVAIDQTAPLESVCLLGCGVTTGYGAAVKTANVQKGDTVAVFGCGTVGLSVLQ 211
             V +   V I ++ P      L CG  T +   ++           +   G   + VL 
Sbjct: 139 VRVHEHFAVLIPESIPSHLAAPLMCGGLTVFSPLLRNGCGPGKKVGILGIGGIGHMGVLL 198

Query: 212 GAHQRGASRIIAIDTNDQKKDFCTQFGATDFINPTKDLKENETIVAKLIEMTDGGLDHTF 271
            A   GA  + AI     KK    + G   FI   ++   +E             LD   
Sbjct: 199 -AKAMGA-EVYAISRTSSKKADAVKLGTDHFIATKEEPDWHEKYFDT--------LDLLV 248

Query: 272 DCTGNV-NVMRSALEACHKGWGQSVIIGVAAAGQEISTRPFQLVTGRVWKGSAFGGVKGR 330
            C G++ +V    L       G+ V I +    + +  +PF LV G     S  G +K  
Sbjct: 249 ICAGSLTDVDFDTLPKIMTVGGRVVSIAIPEQHEILKLKPFGLV-GVSIANSLLGSMK-- 305

Query: 331 SEMAGLIEQYKKGELKVDEFITHRRSFNEINEAFDDLHNG 370
            E+  L+E   K  +K+    T       +NEAF  +  G
Sbjct: 306 -ELKELLELVAKNNIKI-WVETIPIGEKGVNEAFTRMEKG 343

>Skud_13.494 Chr13 complement(884038..885120) [1083 bp, 360 aa] {ON}
           YMR318C (REAL)
          Length = 360

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 79/344 (22%), Positives = 132/344 (38%), Gaps = 33/344 (9%)

Query: 1   MTEGKPIECLAAVAYEAGKPQVVEQIVVDPPKAHEVRIKIVNTAVCHTDAYTLSGADPEG 60
           M+  +  E +A  ++E  K     +    P   H+V IKI    VC +D +  +G     
Sbjct: 1   MSYPEKFEGIAIQSHEDWKNPRKTKYDPKPFYDHDVDIKIEACGVCGSDVHCAAGHWGNK 60

Query: 61  LFPCVLGHEGAGIVESVGDGVTN-VKPGDHV-IALYTAECQKCKFCLSGKTNLCGAVRAT 118
             P V+GHE  G V  +G    + +K G  V +      C +C  C S     C     T
Sbjct: 61  QLPLVVGHEIVGKVVKLGPKSNSGLKIGQRVGVGAQVFSCLECNRCKSDNEPYCTKFVTT 120

Query: 119 QGKGVMPDGTSRFHNKKGESLYHFMGCSTFSEYTVVADVSVVAIDQTAPLESVCLLGCGV 178
             +    DG              ++    ++ Y  V +  VV + +  P      L CG 
Sbjct: 121 YSQP-YEDG--------------YVSQGGYANYVRVHEHFVVPVPKNIPSHLAAPLLCGG 165

Query: 179 TTGYGAAVKT--ANVQKGDTVAVFGCGTVGLSVLQGAHQRGASRIIAIDTNDQKKDFCTQ 236
            T Y   ++      +K   V   G G++G  +   A   GA   + I  + +KK+   +
Sbjct: 166 LTVYSPLIRNGCGPGKKVGIVGFGGIGSMGSLI---AKAMGAETYV-ISRSSKKKEDAMK 221

Query: 237 FGATDFINPTKDLKENETIVAKLIEMTDGGLDHTFDCTG-NVNVMRSALEACHKGWGQSV 295
            GA  +I       E E    K  +  D  +      TG + NVM  A+    K  G+ V
Sbjct: 222 MGADHYIATL----EEEDWGEKYFDTFDLIVVCASSLTGIDFNVMPKAM----KVGGRIV 273

Query: 296 IIGVAAAGQEISTRPFQLVTGRVWKGSAFGGVKGRSEMAGLIEQ 339
            I +    + ++ +P+ L    +   SA G +K   ++  L+ +
Sbjct: 274 SISIPEQHEMLTLKPYGLKAVSI-SYSALGSIKELKQLLKLVSE 316

>SAKL0H00374g Chr8 (45725..47011) [1287 bp, 428 aa] {ON} weakly
           similar to uniprot|P07246 Saccharomyces cerevisiae
           YMR083W ADH3 Alcohol dehydrogenase isoenzyme III, shows
           a high affinity for alcohols with a double bond
           conjugated to the alcohol group
          Length = 428

 Score = 40.0 bits (92), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 80/314 (25%), Positives = 118/314 (37%), Gaps = 50/314 (15%)

Query: 16  EAGKPQVVEQIVVDPPKAHEVRIKIVNTAVCHTDAYTLSGADPEGLFPCVLGHEGAG-IV 74
           E  K + +E   V   K H+  +KI    +CH+D   L G  P       +GHE  G +V
Sbjct: 93  ENNKLEYLENYRVQSLKPHQGLLKIKAVGLCHSDLTILKGGFPASQR-YAMGHEICGELV 151

Query: 75  ESVGDGVTNVKPGDHVIALYT----AECQKCKFCLSGKTNLCGAVRAT-----QGKGVMP 125
           ++  D     +P   V  LYT    A C  C  C  G  + C A         Q  G+  
Sbjct: 152 QTYAD-----EPKYAVGELYTVVGNAPCGGCDSCKKGWESCCTANGEKACGLGQCYGIGR 206

Query: 126 DGTSRFHNKKGESLYHFMGCSTFSEYTVVADVSVVAIDQTAPLESVCLLGCGVTTGYGAA 185
           DG   +       L H +      E     ++  VA D              V T Y A 
Sbjct: 207 DGG--YAEYIAIDLRHLVKVP--KELVNKPEICAVATD-------------AVLTPYHAI 249

Query: 186 VKTANVQKGDT--VAVFGCGTVGLSVLQGAHQRGASRIIAIDTNDQKKDFCTQFGATDFI 243
                  K       V G G +GL+ +Q A+  G SR+I +D  D +    T+ GA    
Sbjct: 250 KNIPGFAKTPDYCTLVIGLGGLGLNGMQVANALG-SRVICVDFKDSQLQKATEMGA---- 304

Query: 244 NPTKDLKENETIVAKLIEMTDGGLDHTFDCTGNVNVMRSALEACHKGWGQSVIIGVAAAG 303
                    E +  +L      G+D   D  G+ + + SA+    K  G   ++G++AAG
Sbjct: 305 ---------EQVFKQLPTDASLGVDAVVDFVGHTSTIASAMFHL-KPHGFLALVGISAAG 354

Query: 304 QEISTRPFQLVTGR 317
            EI       + G+
Sbjct: 355 YEIRFPALSYMLGK 368

>KLTH0C10538g Chr3 complement(873623..874444) [822 bp, 273 aa] {ON}
           conserved hypothetical protein
          Length = 273

 Score = 39.3 bits (90), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 60/230 (26%), Positives = 92/230 (40%), Gaps = 29/230 (12%)

Query: 149 SEYTVVADVSVVAIDQTAPLESVCLLGCGVTTGYGAAVKTANVQKGDTVAVFGC-GTVGL 207
           +EY VV++ +V    +         LG  +TT    A++ A V+  D V+V G  G+VG 
Sbjct: 51  AEYCVVSEDAVALKPKNVTFAQAACLGVPLTTA-SLALQRAAVEPSDCVSVIGASGSVGS 109

Query: 208 SVLQGAHQRGASRIIAIDTNDQKKDFCTQFGATDFINPTKDLKENETIVAKLIEMTDG-G 266
            V+Q A   G   + A        D C              + E+E   A L  +T G G
Sbjct: 110 YVVQLAQSMGCRVLRA--ARQSPTDVC--------------IAEDEEFSA-LTSLTQGRG 152

Query: 267 LDHTFDCTGNVNVMRSALEACHKGWGQSVIIGVAAAGQEISTRPF-----QLVTGRVWKG 321
           +D   D  G   +M++A E    G   +VI     A   I  + F      LV       
Sbjct: 153 VDVVIDTVGMPALMKAAAEKLAHGGRMAVISARYGAELAIHLKDFYRNEKSLVGCNTLSH 212

Query: 322 SAFGGVKGRSEMAGLIEQYKKGELKV-DEFITHRRSFNEINEAFDDLHNG 370
           SA    K   E+A + +  +KG++   DE +  + S  +  EA+     G
Sbjct: 213 SA---PKLAKELAAMSQALEKGDITPEDEKVWTKFSLGQAAEAYRKSEEG 259

>SAKL0C00264g Chr3 complement(17429..18508) [1080 bp, 359 aa] {ON}
           highly similar to uniprot|Q04894 Saccharomyces
           cerevisiae YMR318C ADH6 NADPH-dependent cinnamyl alcohol
           dehydrogenase family member with broad substrate
           specificity may be involved in fusel alcohol synthesis
           or in aldehyde tolerance
          Length = 359

 Score = 39.3 bits (90), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 81/344 (23%), Positives = 121/344 (35%), Gaps = 64/344 (18%)

Query: 24  EQIVVDPPKAHE--VRIKIVNTAVCHTDAYTLSGADPEGLFPCVLGHEGAGIVESVGDGV 81
           ++I  DP   ++  V I+I    VC +D +  +G   +   P V+GHE  G V  VG   
Sbjct: 22  KKIEYDPKPFYDNDVDIEIDACGVCGSDVHCAAGHWGDTQKPLVVGHEVIGRVVRVGPKC 81

Query: 82  -TNVKPGDHV-IALYTAECQKCKFCLSGKTNLCGAVRATQGK----GVMPDGTSRFHNKK 135
            T VK GD V +      C KC  C S     C     T  +    G +  G    H + 
Sbjct: 82  HTGVKIGDRVGVGAQVYSCLKCDRCKSDNEPYCPKFVTTYSQPYEDGYVSQGGYASHIRC 141

Query: 136 GESLYHFMGCSTFSEYTVVADVSVVAIDQTAPLESVCLLGCGVTTGYGAAVKTANVQKGD 195
            E   HF                V+ I +  P      L CG  T Y    +        
Sbjct: 142 HE---HF----------------VIPIPENIPTHLAAPLLCGGITVYSPLSRN------- 175

Query: 196 TVAVFGCGTVGLSV-----------LQGAHQRGASRIIAIDTNDQKKDFCTQFGATDFIN 244
                GCG                 L  A   GA  + AI  +  KK+  ++ GA  FI 
Sbjct: 176 -----GCGPGKKVGIVGIGGIGHMGLIFAKAMGA-EVYAISRSSAKKEDASKLGADHFIA 229

Query: 245 PTKDLKENETIVAKLIEMTDGGLDHTFDCTGNV-NVMRSALEACHKGWGQSVIIGVAAAG 303
                KE E    K  +      D    C  ++ +V    +    K  G+ V I V    
Sbjct: 230 ----TKEEENWSQKYFDT----FDLVVVCASSLTDVDFDKMSRVMKIGGKIVSISVPEQS 281

Query: 304 QEISTRPFQLVTGRVWKGSAFGGVKGRSEMAGLIEQYKKGELKV 347
           + +  +P  L+   +    +  G+  R E+  L++   +  LK+
Sbjct: 282 ERLVLKPLGLLGVSI----SNSGLGSRKEIIQLLQLVSEKNLKI 321

>YMR318C Chr13 complement(911061..912143) [1083 bp, 360 aa] {ON}
           ADH6NADPH-dependent medium chain alcohol dehydrogenase
           with broad substrate specificity; member of the cinnamyl
           family of alcohol dehydrogenases; may be involved in
           fusel alcohol synthesis or in aldehyde tolerance
          Length = 360

 Score = 38.5 bits (88), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 75/348 (21%), Positives = 129/348 (37%), Gaps = 41/348 (11%)

Query: 1   MTEGKPIECLAAVAYEAGKPQVVEQIVVDPPKAHEVRIKIVNTAVCHTDAYTLSGADPEG 60
           M+  +  E +A  ++E  K     +    P   H++ IKI    VC +D +  +G     
Sbjct: 1   MSYPEKFEGIAIQSHEDWKNPKKTKYDPKPFYDHDIDIKIEACGVCGSDIHCAAGHWGNM 60

Query: 61  LFPCVLGHEGAGIVESVGDGVTN-VKPGDHV-IALYTAECQKCKFCLSGKTNLCGAVRAT 118
             P V+GHE  G V  +G    + +K G  V +      C +C  C +     C     T
Sbjct: 61  KMPLVVGHEIVGKVVKLGPKSNSGLKVGQRVGVGAQVFSCLECDRCKNDNEPYCTKFVTT 120

Query: 119 QGKGVMPDGTSRFHNKKGESLYHFMGCSTFSEYTVVADVSVVAIDQTAPLESVCLLGCGV 178
             +    DG              ++    ++ Y  V +  VV I +  P      L CG 
Sbjct: 121 YSQP-YEDG--------------YVSQGGYANYVRVHEHFVVPIPENIPSHLAAPLLCGG 165

Query: 179 TTGYGAAVKTA-----NVQKGDTVAVFGCGTVGLSVLQGAHQRGASRIIAIDTNDQKKDF 233
            T Y   V+        V       +   GT+ +S   GA     SR      + +K++ 
Sbjct: 166 LTVYSPLVRNGCGPGKKVGIVGLGGIGSMGTL-ISKAMGAETYVISR------SSRKRED 218

Query: 234 CTQFGATDFINPTK--DLKENETIVAKLIEMTDGGLDHTFDCTGNVNVMRSALEACHKGW 291
             + GA  +I   +  D  E       LI +    L        + N+M  A++      
Sbjct: 219 AMKMGADHYIATLEEGDWGEKYFDTFDLIVVCASSLTDI-----DFNIMPKAMKVG---- 269

Query: 292 GQSVIIGVAAAGQEISTRPFQLVTGRVWKGSAFGGVKGRSEMAGLIEQ 339
           G+ V I +    + +S +P+ L    +   SA G +K  +++  L+ +
Sbjct: 270 GRIVSISIPEQHEMLSLKPYGLKAVSI-SYSALGSIKELNQLLKLVSE 316

>Suva_6.13 Chr6 (21861..22031,22035..22067) [204 bp, 68 aa] {ON}
           YJR159W (REAL)
          Length = 68

 Score = 34.7 bits (78), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 21/59 (35%), Positives = 29/59 (49%), Gaps = 1/59 (1%)

Query: 185 AVKTANVQKGDTVAVFGCGTVGLSVLQGAHQRGASRIIAIDTNDQKKDFCTQFGATDFI 243
           AV+   V+ GD V V     +GL V     + G  +++ + T D KK    QFG T FI
Sbjct: 11  AVRLPQVKYGDCVVVISVRAIGLLVDAVFREFGVDKVVLMSTQDSKKQ-SEQFGGTGFI 68

>TPHA0M00930 Chr13 complement(180084..181115) [1032 bp, 343 aa] {ON}
           Anc_3.253 YBR046C
          Length = 343

 Score = 37.7 bits (86), Expect = 0.042,   Method: Compositional matrix adjust.
 Identities = 75/338 (22%), Positives = 124/338 (36%), Gaps = 72/338 (21%)

Query: 22  VVEQIVVDPPKAHEVRIKIVNTAVCHTDAYTLSGADPEGLFPC----VLGHEGAGIVESV 77
           V +  V D  K  E+ +K   + V   +AY       +G++PC    +LG E  G V  V
Sbjct: 27  VTDYPVPDDIKDDEILVKNKYSGVNFIEAYF-----RKGIYPCEHPYILGREAVGTVVYV 81

Query: 78  GDGVT-NVKPGDHVIALYTAECQKCKFC-LSGKTNLCGAVRATQGKGVMPDGTSRFHNKK 135
           G  +  + K GD V   Y       +F  +S K+ +    +      +  + T     K 
Sbjct: 82  GRRMAHDYKVGDSV--AYIGNSSMAQFTKVSAKSPIINMSKFY----IEEELTDELFQKY 135

Query: 136 GESLYHFMGCSTFSEYTVVADVSVVAIDQTAPLESVCLLGCGVTTGYGAAVKTANVQKGD 195
             SL + +   TF                                      ++  V+K D
Sbjct: 136 CASLINVLTVMTFIR------------------------------------ESYKVKKND 159

Query: 196 TVAVFGC-GTVGLSVLQGAHQRGASRIIAIDTNDQKKDFCTQFGATDFINPTKDLKENET 254
            + V+   G VGL   Q   + GA+ +IA+ ++D K       GA   IN + D      
Sbjct: 160 NILVYAAAGGVGLIFDQLITKIGAT-VIAVASSDDKLQLAKLHGAKHLINSSTD-----D 213

Query: 255 IVAKLIEMTDG-GLDHTFDCTGNVNVMRSALEACHKGWGQSVIIGVAAAGQEISTRPFQL 313
           IV K+ E T+G G++  FD  G      S      KG      +    A   ++  P   
Sbjct: 214 IVEKVNEYTNGKGVEAVFDSIGKDTFETSMKVLRLKG----TFVSFGNASGPVAPFPLSR 269

Query: 314 VTGRVWKGSAFGGVKGRSEMAGLIEQYKKGELKVDEFI 351
           ++ +V K         R ++ G +++ +  +    EFI
Sbjct: 270 LSPKVLKLV-------RPQLYGYLQEKESWDYYSKEFI 300

>TDEL0F02300 Chr6 complement(421372..422511) [1140 bp, 379 aa] {ON} 
          Length = 379

 Score = 35.4 bits (80), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 62/298 (20%), Positives = 105/298 (35%), Gaps = 46/298 (15%)

Query: 34  HEVRIKIVNTAVCHTDAYTLSGADPEGLFPC----------VLGHEGAGIVESVGDGVTN 83
           H++ I++    +C ++ ++L          C          V+GHE  G V  VG+ VT 
Sbjct: 38  HDIDIEVECCGICASELFSLKNEWSNAPLACLSSSYGPKSQVVGHEVIGKVVKVGEKVTL 97

Query: 84  VKPGDHV-IALYTAECQKCKFCLSGKTNLCGAVRATQGKGVMPDGTSRFHNKKGESLYHF 142
            K G  V +    + C +C  C S     C     T      PDG              +
Sbjct: 98  AKLGQRVGLGAQASSCMQCGRCSSNNEQYCLKSVGTYCSR-YPDG--------------Y 142

Query: 143 MGCSTFSEYTVVADVSVVAIDQTAPLESVCLLGCGVTTGYGAAVKTANVQKGDTVAVFGC 202
           +    ++ +    +     I    P   V  L CG  T Y    +     +   V + G 
Sbjct: 143 VSQGGYASHVRAHEQFCFPIPDDVPSAFVAPLMCGGLTVYSPIKRNIEGVEKPKVGIIGI 202

Query: 203 GTVGLSVLQGAHQRGASRIIAIDTNDQKKDFCTQFGATDFI------NPTKDLKENETIV 256
           G +G   +  A   GA  + A   +++KKD   + GA  F+      N +  L +N  +V
Sbjct: 203 GGLGHMAIMIAKALGA-EVTAFSRSNKKKDDAIKMGAQYFVATGEEENWSSRLADNFHLV 261

Query: 257 AKLIEMTDGGLDHTFDCTGNVNVMRSALEACHKGWGQSVIIGVAAAGQEISTRPFQLV 314
                 T      + D    V++++           Q V +G+   G+     PF  +
Sbjct: 262 LNCASSTT-----SLDLNAFVSILKVNC--------QLVSVGLPEKGETFDLSPFTFI 306

>ZYRO0G10318g Chr7 (831554..832684) [1131 bp, 376 aa] {ON} similar
           to uniprot|Q04894 Saccharomyces cerevisiae YMR318C ADH6
           NADPH-dependent cinnamyl alcohol dehydrogenase family
           member with broad substrate specificity may be involved
           in fusel alcohol synthesis or in aldehyde tolerance
          Length = 376

 Score = 35.0 bits (79), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 24/92 (26%), Positives = 38/92 (41%), Gaps = 11/92 (11%)

Query: 33  AHEVRIKIVNTAVCHTDAYTLSGADPEGLFPC----------VLGHEGAGIVESVGDGVT 82
           AH+V I++    +C ++ ++L          C          V+GHE  G V +VGD V+
Sbjct: 35  AHDVDIEVECCGICASELFSLKNEWSSEPLTCMTSSYGPKSQVVGHEVVGKVVAVGDKVS 94

Query: 83  NVKPGDHV-IALYTAECQKCKFCLSGKTNLCG 113
             K GD + +    + C  C  C       C 
Sbjct: 95  LCKVGDRIGLGAQASSCMSCPRCHGNNEQYCA 126

>Smik_26.3 Chr26 (2136..2513) [378 bp, 125 aa] {ON} YMR318C (REAL)
          Length = 125

 Score = 33.5 bits (75), Expect = 0.30,   Method: Composition-based stats.
 Identities = 23/80 (28%), Positives = 35/80 (43%), Gaps = 2/80 (2%)

Query: 35  EVRIKIVNTAVCHTDAYTLSGADPEGLFPCVLGHEGAGIVESVGDGVTNVKPGDHVIAL- 93
           +V IK+    VC +D +  +G       P V GHE  G +  +G   ++    D  + + 
Sbjct: 35  DVEIKVEACGVCGSDIHCAAGHWGPRNDPLVAGHEIVGRIVRMGSRCSSQLKVDMRVGMG 94

Query: 94  -YTAECQKCKFCLSGKTNLC 112
             T  C KC  C  G+ N C
Sbjct: 95  AITFSCLKCSGCKKGEENYC 114

>Kpol_526.18 s526 (51360..52445) [1086 bp, 361 aa] {ON}
           (51360..52445) [1086 nt, 362 aa]
          Length = 361

 Score = 34.7 bits (78), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 50/211 (23%), Positives = 79/211 (37%), Gaps = 19/211 (9%)

Query: 35  EVRIKIVNTAVCHTDAYTLSGADPEGLFPCVLGHEGAGIVESVGDGV-TNVKPGDHV-IA 92
           +V I+I    VC +D +  SG   E     V+GHE  G V  +G    T +K GD V + 
Sbjct: 35  DVDIEIEACGVCGSDIHCASGDWGERRDKLVVGHEVIGRVIKLGPECHTGLKIGDRVGVG 94

Query: 93  LYTAECQKCKFCLSGKTNLCGAVRATQGKGVMPDGTSRFHNKKGESLYHFMGCSTFSEYT 152
              A C  C+ C       C     T  +   PDG              ++    ++ + 
Sbjct: 95  AQVASCLDCERCEHDNEPYCPKFVTTYNQA-YPDG--------------YISQGGYASHI 139

Query: 153 VVADVSVVAIDQTAPLESVCLLGCGVTTGYGAAVKTANVQKGDTVAVFGCGTVGLSVLQG 212
            V +  V+ + +  P      L CG  T Y   V+           V   G   + +L  
Sbjct: 140 RVHEHFVIPVPEKIPTHLAAPLLCGGITVYSPLVRGGCAPGKKVGIVGIGGIGHMGIL-F 198

Query: 213 AHQRGASRIIAIDTNDQKKDFCTQFGATDFI 243
           A   GA  + A   ++ K++   + GA  +I
Sbjct: 199 AKAMGA-EVYAFSRHENKREDSMKLGADHYI 228

>KLTH0B00506g Chr2 complement(53662..54858) [1197 bp, 398 aa] {ON}
           weakly similar to uniprot|P53912 Saccharomyces
           cerevisiae YNL134C
          Length = 398

 Score = 33.9 bits (76), Expect = 0.61,   Method: Compositional matrix adjust.
 Identities = 59/295 (20%), Positives = 104/295 (35%), Gaps = 64/295 (21%)

Query: 34  HEVRIKIVNTAVCHTDAYTLSGADPEGLFPCVLGHEGAGIVESVGDGVTNVKPGDHVIAL 93
           HE+ I+   T + H D  +         FP + G E +GIV   G               
Sbjct: 72  HEILIRNKYTGLNHVDWKSKKYRFNIHSFPWINGRESSGIVVRRG--------------- 116

Query: 94  YTAECQKCKFCLSGKTNLCGAVRATQGKGVMPDGTSRFHNKKGESLYHFMGCSTFSEYTV 153
             A+  + +F +  +  L                          + Y  +  STF E+TV
Sbjct: 117 --AKVDRDRFPIGAEVFLAS------------------------TCYRELKTSTFQEFTV 150

Query: 154 VADVSVVAIDQTAPLESVCL--LGCGVTTGYGAAVKTA--------------NVQKGDTV 197
                V  + +    +       G     G G  + TA                 +G ++
Sbjct: 151 FDSRLVWRLPREILPDGTTRKRFGLDFAAGVGVPLVTAGSALSSFVDFNEIGKADQGRSL 210

Query: 198 AVFG-CGTVGLSVLQGAHQRGASRIIAIDTNDQKKDFCTQFGATDFINPTKDLKENETIV 256
            V+G   +VG+  +Q A   G  + I   ++ + +D+  + GAT  I+ T     +E +V
Sbjct: 211 VVWGGSSSVGIFTIQLARNLGIFKNIIAVSSLRYEDYLKELGATAVIDRT---LPSEELV 267

Query: 257 AKLIEMTDGGLDHTFDCTGNVNVMRSALEACHKGWG--QSVIIGVAAAGQEISTR 309
            K  E+   G+D+  D           LE    G G  +S++    A G+++  +
Sbjct: 268 QKFQELCPTGVDYGVDVISK-KTAELVLEILKDGKGTKKSLVCLSGAPGEDVRAK 321

>TBLA0C01490 Chr3 complement(343276..345864) [2589 bp, 862 aa] {ON}
           Anc_1.400 YLR176C
          Length = 862

 Score = 32.3 bits (72), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 22/83 (26%), Positives = 35/83 (42%), Gaps = 5/83 (6%)

Query: 86  PGDHVIALYTAECQKCKFCLSGKTNLCGAVRATQGKGVMPDGTSRFHNKKGESLYHFMGC 145
           P   + A Y + C         + +L   +RA     V PD T+R    +G+S YH+ G 
Sbjct: 331 PRGRIFAQYASSCASNSLKPLSQASLGKLIRA-----VFPDLTTRRLGIRGQSKYHYCGL 385

Query: 146 STFSEYTVVADVSVVAIDQTAPL 168
              S+  V  + S+     +AP 
Sbjct: 386 KLLSDEPVPPEESLFPSAFSAPF 408

>TDEL0A00140 Chr1 (23016..24233) [1218 bp, 405 aa] {ON} 
          Length = 405

 Score = 32.3 bits (72), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 39/154 (25%), Positives = 63/154 (40%), Gaps = 24/154 (15%)

Query: 140 YHFMGCSTFSEYTVVADVSVVAIDQTA----------PLESVCLLGCGVTTGYGAAVKT- 188
           Y  +  STF EYTV     V  + Q             LE    +G G+ T  G+A+ + 
Sbjct: 138 YRDLETSTFQEYTVFDSRLVWKLPQYRLPNGRLHKRFDLEFAAGVGVGLVTA-GSAISSL 196

Query: 189 --------ANVQK-GDTVAVFGCGTVGLSVLQGAHQRGASRIIAIDTNDQKKDFCTQFGA 239
                   A+ QK G+ V   G  +VGL V+Q A        I + +  + K++  + GA
Sbjct: 197 VDLSLRDQADHQKLGNIVIWGGSSSVGLYVIQLAKASKMFEKIVVVSASKHKEYLLELGA 256

Query: 240 TDFINPTKDLKENETIVAKLIEMTDGGLDHTFDC 273
           +  I+  +     E I+  ++     G+D   D 
Sbjct: 257 SCIIDRHQS---EEEILDDILSHCPEGIDFGIDV 287

>KNAG0I01300 Chr9 (248944..251364) [2421 bp, 806 aa] {ON} Anc_1.400
           YLR176C
          Length = 806

 Score = 31.2 bits (69), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 20/74 (27%), Positives = 33/74 (44%), Gaps = 5/74 (6%)

Query: 86  PGDHVIALYTAECQKCKFCLSGKTNLCGAVRATQGKGVMPDGTSRFHNKKGESLYHFMGC 145
           P   + A Y + C + +     + +L   +R      V PD T+R    +G+S YH+ G 
Sbjct: 333 PRGRIFAQYASSCSQNELKPLSQASLGKLIRT-----VFPDLTTRRLGTRGQSKYHYCGL 387

Query: 146 STFSEYTVVADVSV 159
              ++    AD SV
Sbjct: 388 KLITDEGEDADDSV 401

>KAFR0H03770 Chr8 complement(715399..716496) [1098 bp, 365 aa] {ON} 
          Length = 365

 Score = 30.4 bits (67), Expect = 7.3,   Method: Compositional matrix adjust.
 Identities = 48/221 (21%), Positives = 84/221 (38%), Gaps = 28/221 (12%)

Query: 31  PKA---HEVRIKIVNTAVCHTDAYTLSGADPEGLFPCVLGHEGAGIVESVGDGV-TNVKP 86
           PKA   H+V I+I    VC +D +T +    E     V+GHE  G +  +G    + +K 
Sbjct: 34  PKAFGPHDVDIEIECCGVCGSDIHTAASHWRELRDKMVVGHEIVGRIVKLGPECDSGLKI 93

Query: 87  GDHV-IALYTAECQKCKFCLSGKTNLCGAVRATQGKGVMPDGTSRFHNKKGESLYHFMGC 145
           GD V +   +  C +C  C       C    +T             +N+  +  Y   G 
Sbjct: 94  GDRVGVGAQSFSCLECDRCKENNEPYCPKFVST-------------YNRPYDDGYISQG- 139

Query: 146 STFSEYTVVADVSVVAIDQTAPLESVCLLGCGVTTGYGAAVKT---ANVQKGDTVAVFGC 202
             ++ +  + +   + +    P E    L CG  T +   ++     N +   +V V   
Sbjct: 140 -GYASHVRLHEHFAIPVPDEIPSELAAPLMCGGITVFSPLLRNGCGPNKKLASSVLV--- 195

Query: 203 GTVGLSVLQGAHQRGASRIIAIDTNDQKKDFCTQFGATDFI 243
             +G+       Q GA  + A    + K++     GA  +I
Sbjct: 196 -VLGIWAYCLLRQVGA-EVYAFSRTNSKREDSVNLGADHYI 234

>NCAS0C03430 Chr3 (672540..687344) [14805 bp, 4934 aa] {ON} Anc_8.295
            YLR106C
          Length = 4934

 Score = 30.8 bits (68), Expect = 7.4,   Method: Composition-based stats.
 Identities = 16/48 (33%), Positives = 25/48 (52%), Gaps = 3/48 (6%)

Query: 320  KGSAFGGVKGRSEMAGLIEQYKKGELKVDEFITHRRSFNEINEAFDDL 367
            KG   GG+ G      L   Y+ G+LK DE +  R   +E++E  D++
Sbjct: 4589 KGDRNGGIYGGERDENL---YEDGDLKTDELLNGREDEDELDELMDEI 4633

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.319    0.135    0.407 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 38,583,227
Number of extensions: 1571495
Number of successful extensions: 4019
Number of sequences better than 10.0: 191
Number of HSP's gapped: 3852
Number of HSP's successfully gapped: 209
Length of query: 381
Length of database: 53,481,399
Length adjustment: 111
Effective length of query: 270
Effective length of database: 40,753,473
Effective search space: 11003437710
Effective search space used: 11003437710
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 67 (30.4 bits)