Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
CAGL0K10230g5.440ON44644615400.0
YOR123C (LEO1)5.440ON4643539591e-125
Suva_8.1755.440ON4533509571e-125
Smik_15.3005.440ON4632749411e-123
NCAS0H020805.440ON4353549361e-122
Skud_15.2855.440ON4873539011e-116
NDAI0C015905.440ON4702748961e-116
KAFR0D050505.440ON4192738691e-112
ZYRO0F10164g5.440ON4233478631e-111
SAKL0G02662g5.440ON4793508661e-111
TDEL0D026105.440ON4403598591e-111
KNAG0B042105.440ON4632258521e-109
Ecym_45115.440ON4612658051e-102
ACL167C5.440ON4392767941e-101
TBLA0A064905.440ON4282847931e-101
Kpol_1062.265.440ON4573677911e-100
KLLA0E02311g5.440ON4172217812e-99
Kwal_55.214085.440ON4362227822e-99
TPHA0E017305.440ON4692887695e-97
KLTH0F15928g5.440ON4232237551e-95
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0K10230g
         (446 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0K10230g Chr11 complement(996303..997643) [1341 bp, 446 aa] ...   597   0.0  
YOR123C Chr15 complement(553176..554570) [1395 bp, 464 aa] {ON} ...   374   e-125
Suva_8.175 Chr8 complement(310977..312338) [1362 bp, 453 aa] {ON...   373   e-125
Smik_15.300 Chr15 complement(514294..515685) [1392 bp, 463 aa] {...   367   e-123
NCAS0H02080 Chr8 complement(404035..405342) [1308 bp, 435 aa] {O...   365   e-122
Skud_15.285 Chr15 complement(509624..511087) [1464 bp, 487 aa] {...   351   e-116
NDAI0C01590 Chr3 complement(340050..341462) [1413 bp, 470 aa] {O...   349   e-116
KAFR0D05050 Chr4 complement(993511..994770) [1260 bp, 419 aa] {O...   339   e-112
ZYRO0F10164g Chr6 complement(821488..822759) [1272 bp, 423 aa] {...   337   e-111
SAKL0G02662g Chr7 complement(218969..220408) [1440 bp, 479 aa] {...   338   e-111
TDEL0D02610 Chr4 (500294..501616) [1323 bp, 440 aa] {ON} Anc_5.4...   335   e-111
KNAG0B04210 Chr2 (801346..802737) [1392 bp, 463 aa] {ON} Anc_5.4...   332   e-109
Ecym_4511 Chr4 complement(1020312..1021697) [1386 bp, 461 aa] {O...   314   e-102
ACL167C Chr3 complement(63134..64453) [1320 bp, 439 aa] {ON} Syn...   310   e-101
TBLA0A06490 Chr1 (1595241..1596527) [1287 bp, 428 aa] {ON} Anc_5...   310   e-101
Kpol_1062.26 s1062 (58970..60343) [1374 bp, 457 aa] {ON} (58970....   309   e-100
KLLA0E02311g Chr5 complement(214032..215285) [1254 bp, 417 aa] {...   305   2e-99
Kwal_55.21408 s55 (823660..824970) [1311 bp, 436 aa] {ON} YOR123...   305   2e-99
TPHA0E01730 Chr5 (350455..351864) [1410 bp, 469 aa] {ON} Anc_5.4...   300   5e-97
KLTH0F15928g Chr6 (1295609..1296880) [1272 bp, 423 aa] {ON} simi...   295   1e-95

>CAGL0K10230g Chr11 complement(996303..997643) [1341 bp, 446 aa]
           {ON} similar to uniprot|P38439 Saccharomyces cerevisiae
           YOR123c LEO1 extremely hydrophilic protein
          Length = 446

 Score =  597 bits (1540), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 315/446 (70%), Positives = 315/446 (70%)

Query: 1   MSEEEKHNMSEEQVXXXXXXXXXXXXXDSVEDGKDQXXXXXXXXXXXXXXXXXXXXXXXX 60
           MSEEEKHNMSEEQV             DSVEDGKDQ                        
Sbjct: 1   MSEEEKHNMSEEQVELAPEEPPKEEAEDSVEDGKDQEETMPEKEEEMDDLFGDDEDDEDE 60

Query: 61  XXIXXXXXXXXXXXISXXXXXXXXXGITXXXXXXXXXXXXXXXXXAKEQEMYTRKFYGED 120
             I           IS         GIT                 AKEQEMYTRKFYGED
Sbjct: 61  EEITTGRGRNGTTGISDDEEDDDEEGITRRSREREDYDMEDYDDEAKEQEMYTRKFYGED 120

Query: 121 AVNYSDDDEPHTFKESNVDLIRHIIPYKTRTTNNEHDEIFYAKVPAFLTIDPVPFDPQTF 180
           AVNYSDDDEPHTFKESNVDLIRHIIPYKTRTTNNEHDEIFYAKVPAFLTIDPVPFDPQTF
Sbjct: 121 AVNYSDDDEPHTFKESNVDLIRHIIPYKTRTTNNEHDEIFYAKVPAFLTIDPVPFDPQTF 180

Query: 181 EATVDERLSKSASKEDQLGDRLIDENTIRWRYSRDAEQHVFKESNAQIVQWSDGSFSLKL 240
           EATVDERLSKSASKEDQLGDRLIDENTIRWRYSRDAEQHVFKESNAQIVQWSDGSFSLKL
Sbjct: 181 EATVDERLSKSASKEDQLGDRLIDENTIRWRYSRDAEQHVFKESNAQIVQWSDGSFSLKL 240

Query: 241 GDEYTDIIVNDTDNTFLTVSHDQQELMQCYDGGEITKTMMFIPTSTNSKIHQKLSKAVSR 300
           GDEYTDIIVNDTDNTFLTVSHDQQELMQCYDGGEITKTMMFIPTSTNSKIHQKLSKAVSR
Sbjct: 241 GDEYTDIIVNDTDNTFLTVSHDQQELMQCYDGGEITKTMMFIPTSTNSKIHQKLSKAVSR 300

Query: 301 RNARQNLGPGSYIIKQDPEIEKKELEKLQGXXXXXXXXXXXXXXXTRENAENGFAETGEF 360
           RNARQNLGPGSYIIKQDPEIEKKELEKLQG               TRENAENGFAETGEF
Sbjct: 301 RNARQNLGPGSYIIKQDPEIEKKELEKLQGQIIRERRKRQQKEIETRENAENGFAETGEF 360

Query: 361 KRGNTPSRSSRQNEYXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXADRLRNAKRQGEH 420
           KRGNTPSRSSRQNEY                                ADRLRNAKRQGEH
Sbjct: 361 KRGNTPSRSSRQNEYEDDGFLVDDEDEEDFIDDGEEEEEEEEDDDLDADRLRNAKRQGEH 420

Query: 421 AFTXXXXXXXXNKRRKTAIISSEEDD 446
           AFT        NKRRKTAIISSEEDD
Sbjct: 421 AFTEDDDEEDDNKRRKTAIISSEEDD 446

>YOR123C Chr15 complement(553176..554570) [1395 bp, 464 aa] {ON}
           LEO1Component of the Paf1 complex; which associates with
           RNA polymerase II and is involved in histone
           methylation; plays a role in regulating Ty1
           transposition; involved in transcription elongation as
           demonstrated by the G-less-based run-on (GLRO) assay
          Length = 464

 Score =  374 bits (959), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 196/353 (55%), Positives = 237/353 (67%), Gaps = 14/353 (3%)

Query: 106 AKEQEMYTRKFYGEDAVNYSDDDEP-HTFKESNVDLIRHIIPYKTRTTNN-EHDEIFYAK 163
           A+EQ MYTRKFYGEDA N+SD DE  HTFKE NV+L+RHIIP K        H+EIFYA+
Sbjct: 113 AEEQAMYTRKFYGEDANNFSDQDETTHTFKEENVELVRHIIPSKANVNETASHNEIFYAR 172

Query: 164 VPAFLTIDPVPFDPQTFEATVDERLSKSASKEDQLGDRLIDENTIRWRYSRDAEQHVFKE 223
           +P FLTIDP+PFDP +FEA V+ER S SAS+EDQL DRLIDENT+RWRYSRD +QHVFKE
Sbjct: 173 IPNFLTIDPIPFDPPSFEAKVNERASNSASREDQLDDRLIDENTVRWRYSRDKDQHVFKE 232

Query: 224 SNAQIVQWSDGSFSLKLGDEYTDIIVNDTDNTFLTVSHDQQELMQCYDGGEITKTMMFIP 283
           SN QIVQWSDG++SLK+G+E TDI+VNDT NTFLTVSHDQQEL+QCY+GGEI KT+MFIP
Sbjct: 233 SNTQIVQWSDGTYSLKVGEECTDILVNDTSNTFLTVSHDQQELIQCYEGGEIKKTLMFIP 292

Query: 284 TSTNSKIHQKLSKAVSRRNARQNLGPGSYIIKQDPEIEKKELEKLQGXXXXXXXXXXXXX 343
           TSTNSKIHQKLSKAV RRN RQ+ GPG+YI+  DPE+EKKELE+ Q              
Sbjct: 293 TSTNSKIHQKLSKAVIRRNQRQSKGPGTYIVSMDPEVEKKELERKQSQILRDRRRRQLKE 352

Query: 344 XXTRENAENGFAETGEFKRGNTPSR--SSRQNEY-----XXXXXXXXXXXXXXXXXXXXX 396
              +E+ +  F ETG F++ N+P+   +SR+NEY                          
Sbjct: 353 KEKQESPDAAF-ETG-FRKQNSPTTYGASRRNEYEEDDFLVDDDEEEEAAFDDEEDDNEE 410

Query: 397 XXXXXXXXXXXADRLRNAKRQGEHAF---TXXXXXXXXNKRRKTAIISSEEDD 446
                      A RLRN KR+G   +             KRR+ A+I  +ED+
Sbjct: 411 EEEEEDADEENASRLRNLKREGAAMYREEEEEEKDRSETKRRRVAVIEDDEDE 463

>Suva_8.175 Chr8 complement(310977..312338) [1362 bp, 453 aa] {ON}
           YOR123C (REAL)
          Length = 453

 Score =  373 bits (957), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 196/350 (56%), Positives = 238/350 (68%), Gaps = 11/350 (3%)

Query: 106 AKEQEMYTRKFYGEDAVNYSDDDEP-HTFKESNVDLIRHIIPYKTRTTNN-EHDEIFYAK 163
           A+EQ MYTRKFYGEDA ++SD DE  HTFKE NV+L+RHIIP K        H+EIFYA+
Sbjct: 105 AEEQAMYTRKFYGEDANDFSDQDEATHTFKEENVELVRHIIPSKANVNETASHNEIFYAR 164

Query: 164 VPAFLTIDPVPFDPQTFEATVDERLSKSASKEDQLGDRLIDENTIRWRYSRDAEQHVFKE 223
           +P FLTIDP+PFDP +FEA V+ER + S SKEDQL DRLIDENT+RWRYSRD +QHVFKE
Sbjct: 165 IPNFLTIDPIPFDPPSFEAKVNERANNSISKEDQLDDRLIDENTVRWRYSRDNDQHVFKE 224

Query: 224 SNAQIVQWSDGSFSLKLGDEYTDIIVNDTDNTFLTVSHDQQELMQCYDGGEITKTMMFIP 283
           SN QIVQWSDGS+SLK+G+EYTDI+VNDT NTFLTVSHDQQELMQCY+GGEI KT+MFIP
Sbjct: 225 SNTQIVQWSDGSYSLKVGEEYTDILVNDTSNTFLTVSHDQQELMQCYEGGEIKKTLMFIP 284

Query: 284 TSTNSKIHQKLSKAVSRRNARQNLGPGSYIIKQDPEIEKKELEKLQGXXXXXXXXXXXXX 343
           TST+SKIHQKLSKAV R+N RQN GPG+YII  DPE+EK+ELEK Q              
Sbjct: 285 TSTSSKIHQKLSKAVVRKNQRQNQGPGTYIINMDPEVEKRELEKKQSQILRDRRKRQLKE 344

Query: 344 XXTRENAENGFAETGEFKRGNTPSR--SSRQNEY---XXXXXXXXXXXXXXXXXXXXXXX 398
              +E+ + GF ET  F++ ++P+   ++R+NEY                          
Sbjct: 345 KEKQESPDVGF-ETA-FRKQSSPTAYGATRRNEYEEDDFLVDDDEEEEAEFDDDDDNEEE 402

Query: 399 XXXXXXXXXADRLRNAKRQGEHAFTXXXXXXXXN--KRRKTAIISSEEDD 446
                    A RLRN KR+G   +         N  KRR+ A+I  +ED+
Sbjct: 403 EEEEADEDNAARLRNLKREGAAMYKEEGGDDDSNESKRRRVAVIEDDEDE 452

>Smik_15.300 Chr15 complement(514294..515685) [1392 bp, 463 aa] {ON}
           YOR123C (REAL)
          Length = 463

 Score =  367 bits (941), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 181/274 (66%), Positives = 215/274 (78%), Gaps = 6/274 (2%)

Query: 106 AKEQEMYTRKFYGEDAVNYSDDDEP-HTFKESNVDLIRHIIPYKTRTTNN-EHDEIFYAK 163
           A+EQ MYTRKFYGED  ++SD DE  HTFKE NV+L+RHIIP K        H+EIFYA+
Sbjct: 107 AEEQAMYTRKFYGEDLNDFSDQDEATHTFKEENVELVRHIIPSKGIVNETASHNEIFYAR 166

Query: 164 VPAFLTIDPVPFDPQTFEATVDERLSKSASKEDQLGDRLIDENTIRWRYSRDAEQHVFKE 223
           +P FLTIDPVPFDP +FEA V+ER S SASKEDQL DRLIDENT+RWRYSRD +QHVFKE
Sbjct: 167 IPNFLTIDPVPFDPPSFEAKVNERTSNSASKEDQLDDRLIDENTVRWRYSRDKDQHVFKE 226

Query: 224 SNAQIVQWSDGSFSLKLGDEYTDIIVNDTDNTFLTVSHDQQELMQCYDGGEITKTMMFIP 283
           SN QIVQWSDG++SLK+G+E TDI+VNDT NTFLTVSHDQQEL+QCY+GGEI KT+MFIP
Sbjct: 227 SNTQIVQWSDGTYSLKVGEECTDILVNDTSNTFLTVSHDQQELIQCYEGGEIKKTLMFIP 286

Query: 284 TSTNSKIHQKLSKAVSRRNARQNLGPGSYIIKQDPEIEKKELEKLQGXXXXXXXXXXXXX 343
           TSTNSKIHQKLSKAV RRN RQN GPG+YI+  DPE+EK+ELEK Q              
Sbjct: 287 TSTNSKIHQKLSKAVIRRNQRQNKGPGTYIVSMDPEVEKRELEKKQSQILRDRRRRQLKE 346

Query: 344 XXTRENAENGFAETGEFKRGNTPSR--SSRQNEY 375
              +E+ +  F ETG F++ ++P+   +SR+NEY
Sbjct: 347 KEKQESPDAAF-ETG-FRKQSSPTAYGTSRRNEY 378

>NCAS0H02080 Chr8 complement(404035..405342) [1308 bp, 435 aa] {ON}
           Anc_5.440 YOR123C
          Length = 435

 Score =  365 bits (936), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 193/354 (54%), Positives = 239/354 (67%), Gaps = 14/354 (3%)

Query: 107 KEQEMYTRKFYGEDAVN-YSDDDEP--HTFKESNVDLIRHIIPYKTRTTNNEHDEIFYAK 163
           +E+ MYTRKFYG+D  N YS D +   H FKE NV+LIRH++PYKT +   +   ++YAK
Sbjct: 81  EEEAMYTRKFYGDDDYNRYSSDQDNALHHFKEENVELIRHMVPYKTSSEKTDETTVYYAK 140

Query: 164 VPAFLTIDPVPFDPQTFEATVDERLSKSASKEDQLGDRLIDENTIRWRYSRDAEQHVFKE 223
           VP FLTI+PVPFDP  FE+ V +RLS  +SKEDQLGDRLIDENT+RWRYSRDA Q VFKE
Sbjct: 141 VPPFLTINPVPFDPIAFESDVRDRLSNYSSKEDQLGDRLIDENTVRWRYSRDANQRVFKE 200

Query: 224 SNAQIVQWSDGSFSLKLGDEYTDIIVNDTDNTFLTVSHDQQELMQCYDGGEITKTMMFIP 283
           SNAQIVQWSDGSFSLKLGDEYTDI+VN+T+NTFL VSHDQQELMQCY+GGEITKT+MFIP
Sbjct: 201 SNAQIVQWSDGSFSLKLGDEYTDILVNETNNTFLAVSHDQQELMQCYNGGEITKTLMFIP 260

Query: 284 TSTNSKIHQKLSKAVSRRNARQNLGPGSYIIKQDPEIEKKELEKLQGXXXXXXXXXXXXX 343
           TSTNSKIHQ+LSKAV+RRN R++LGPG+ II +DPE+EK+ELEK QG             
Sbjct: 261 TSTNSKIHQQLSKAVTRRNQREHLGPGTMIINRDPEVEKRELEKKQGQIIRDRRRRQLKE 320

Query: 344 XXTRENAENGFAETG--EFKRGNTPSR---SSRQNEY---XXXXXXXXXXXXXXXXXXXX 395
               E+ +     +G  E ++ NTP+    S RQ+EY                       
Sbjct: 321 KELLESPDTTMDVSGGYETRKRNTPNPSLGSRRQDEYEEDDFLVDDEDEEDFIEDDEEEE 380

Query: 396 XXXXXXXXXXXXADRLRNAKRQG---EHAFTXXXXXXXXNKRRKTAIISSEEDD 446
                       A+RLRNAKR G   ++  +        +K+R+ A+I+ +EDD
Sbjct: 381 EEEEEEDNDEEKAERLRNAKRSGYDEDNQESGTENESSSSKKRRVAVINDDEDD 434

>Skud_15.285 Chr15 complement(509624..511087) [1464 bp, 487 aa] {ON}
           YOR123C (REAL)
          Length = 487

 Score =  351 bits (901), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 196/353 (55%), Positives = 233/353 (66%), Gaps = 15/353 (4%)

Query: 106 AKEQEMYTRKFYGEDAVNYSDDDEP-HTFKESNVDLIRHIIPYKTRTTNN-EHDEIFYAK 163
           A+EQ MYTRKFYGEDA +YSD DE  HTFKE N++++RHIIP K        H+EIFYA+
Sbjct: 135 AEEQAMYTRKFYGEDANDYSDQDEAAHTFKEENIEIVRHIIPNKANVNETASHNEIFYAR 194

Query: 164 VPAFLTIDPVPFDPQTFEATVDERLSKSASKEDQLGDRLIDENTIRWRYSRDAEQHVFKE 223
           +P FLTID VPFDP +FEA V+ER   S SKEDQL DRLIDENT+RWRYSRD +QHVFKE
Sbjct: 195 IPNFLTIDAVPFDPPSFEAKVNERAINSTSKEDQLDDRLIDENTVRWRYSRDKDQHVFKE 254

Query: 224 SNAQIVQWSDGSFSLKLGDEYTDIIVNDTDNTFLTVSHDQQELMQCYDGGEITKTMMFIP 283
           SN QIVQWSDGS+SLK+G+E TDI+VNDT NTFLTVSHDQQEL+QCY+GGEI KT+MFIP
Sbjct: 255 SNTQIVQWSDGSYSLKVGEECTDILVNDTSNTFLTVSHDQQELIQCYEGGEIKKTLMFIP 314

Query: 284 TSTNSKIHQKLSKAVSRRNARQNLGPGSYIIKQDPEIEKKELEKLQGXXXXXXXXXXXXX 343
           TSTNSKIHQKLSKAV RRN RQN GPG+YI+  DPE+EKKELEK Q              
Sbjct: 315 TSTNSKIHQKLSKAVIRRNQRQNKGPGTYIVNMDPEVEKKELEKKQSQVLRDRRRRQLKE 374

Query: 344 XXTRENAENGFAETGEFKRGNTPSRS--SRQNEYXXXXXXXXXXXXXXX-------XXXX 394
              +E+ +  F ETG F++ ++P+    SR+NEY                          
Sbjct: 375 REKQESPDAAF-ETG-FRKQSSPTSYGISRRNEYEEDDFLVDDDEEEEAGFDDGDDEEEE 432

Query: 395 XXXXXXXXXXXXXADRLRNAKRQGEHAFTXXXXXXXXN--KRRKTAIISSEED 445
                        A RLRN KR+G   +         N  KRR+ A+I  +ED
Sbjct: 433 EEEEEEEEADQENAARLRNLKREGAAMYKEEEKDDDSNETKRRRVAVIEDDED 485

>NDAI0C01590 Chr3 complement(340050..341462) [1413 bp, 470 aa] {ON}
           Anc_5.440 YOR123C
          Length = 470

 Score =  349 bits (896), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 183/274 (66%), Positives = 213/274 (77%), Gaps = 8/274 (2%)

Query: 108 EQEMYTRKFYGEDAVNYSDDDE-PHTFKESNVDLIRHIIPYKTRTTNNEHDEIFYAKVPA 166
           E+ MYTRKFYG D   YSD++E  H FKE+NV++IRH++PYKT +++     I+YAKVP 
Sbjct: 118 EEAMYTRKFYG-DTDKYSDNEEDAHDFKEANVEIIRHMVPYKT-SSDQADTTIYYAKVPP 175

Query: 167 FLTIDPVPFDPQTFEATVDERLSKSASKEDQLGDRLIDENTIRWRYSRDAEQHVFKESNA 226
           FLTIDP+PFDP +FE  V +RL+  +S+EDQLGDRLIDENTIRWRYSRD  Q VFKESNA
Sbjct: 176 FLTIDPIPFDPVSFETKVKDRLADYSSREDQLGDRLIDENTIRWRYSRDQNQRVFKESNA 235

Query: 227 QIVQWSDGSFSLKLGDEYTDIIVNDTDNTFLTVSHDQQELMQCYDGGEITKTMMFIPTST 286
           QIVQWSDGSFSLKLGDEYTDI+VNDTDNTFLTVSHDQQELMQCY+GGEITKTMMFIPTST
Sbjct: 236 QIVQWSDGSFSLKLGDEYTDILVNDTDNTFLTVSHDQQELMQCYNGGEITKTMMFIPTST 295

Query: 287 NSKIHQKLSKAVSRRNARQNLGPGSYIIKQDPEIEKKELEKLQGXXXXXXXXXXXXXXXT 346
           NSKIHQ+LSKAV+RRN RQNLGPG+ II++DPE+EKKELEK QG                
Sbjct: 296 NSKIHQQLSKAVTRRNQRQNLGPGTMIIEKDPELEKKELEKKQGQILRERRKRQLKEREI 355

Query: 347 RENAENGFAETGEFK---RGNTPS--RSSRQNEY 375
           +E+ +  F   G      R   PS  R SRQ+EY
Sbjct: 356 QESPDTTFDVRGSASSKNRSPAPSSYRGSRQDEY 389

>KAFR0D05050 Chr4 complement(993511..994770) [1260 bp, 419 aa] {ON}
           Anc_5.440 YOR123C
          Length = 419

 Score =  339 bits (869), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 167/273 (61%), Positives = 204/273 (74%), Gaps = 5/273 (1%)

Query: 107 KEQEMYTRKFYGEDAVNYSDDDEPHTFKESNVDLIRHIIPYKTRTTNNEHDEIFYAKVPA 166
           +E+ MY RKFYGE+  + SD +E   FKE++V+L+RH++PYKT   N +   I+Y KVPA
Sbjct: 67  EEEAMYNRKFYGEEGSDMSDHEEEALFKEADVELVRHVVPYKTFPENEDDKTIYYTKVPA 126

Query: 167 FLTIDPVPFDPQTFEATVDERLSKSASKEDQLGDRLIDENTIRWRYSRDAEQHVFKESNA 226
           FL+IDP+PFDP +FE  V ER S  +S EDQLGDRLIDENTIRWRYSRDAEQ VFKESNA
Sbjct: 127 FLSIDPLPFDPPSFENKVKERTSNFSSVEDQLGDRLIDENTIRWRYSRDAEQRVFKESNA 186

Query: 227 QIVQWSDGSFSLKLGDEYTDIIVNDTDNTFLTVSHDQQELMQCYDGGEITKTMMFIPTST 286
           QIVQWSDGS+SLKLG EYTDI+VN TDNTFLTVSHDQQELMQC DGG+I KT++FIPTST
Sbjct: 187 QIVQWSDGSYSLKLGAEYTDILVNGTDNTFLTVSHDQQELMQCVDGGQINKTLIFIPTST 246

Query: 287 NSKIHQKLSKAVSRRNARQNLGPGSYIIKQDPEIEKKELEKLQGXXXXXXXXXXXXXXXT 346
           NSKIHQ+LSKA++RR+ R + GPG+ I+  DPE+EK+ELEK Q                 
Sbjct: 247 NSKIHQRLSKAIARRDQRVHSGPGTMIVNLDPEVEKRELEKKQTQIIRERRRRQMKEQER 306

Query: 347 RENAENGFAETGEFKRGNTPS----RSSRQNEY 375
            E+ E G A +   +R  TPS    R+ R++EY
Sbjct: 307 LESPELG-AFSHSNRRSQTPSQGYERTHREDEY 338

>ZYRO0F10164g Chr6 complement(821488..822759) [1272 bp, 423 aa] {ON}
           similar to uniprot|P38439 Saccharomyces cerevisiae
           YOR123C LEO1 Component of the Paf1 complex which
           associates with RNA polymerase II and is involved in
           histone methylation
          Length = 423

 Score =  337 bits (863), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 179/347 (51%), Positives = 222/347 (63%), Gaps = 15/347 (4%)

Query: 106 AKEQEMYTRKFYGEDAVNYSDDDEPHTFKESNVDLIRHIIPYKTRTTNNEHDEIFYAKVP 165
           A+E  MYTRKFYGED    SD++E   F+E +V+L+RHI+PY+  T   +   ++YAK+P
Sbjct: 86  AEEHAMYTRKFYGEDVDRVSDEEEAQEFREEDVELVRHIVPYRA-TQGTDKPVLYYAKIP 144

Query: 166 AFLTIDPVPFDPQTFEATVDERLSKSASKEDQLGDRLIDENTIRWRYSRDAEQHVFKESN 225
            FLTIDPVPFDP +FEA+V ERL   ASKEDQLGDRLIDENT+RWRYSRDA Q VFKESN
Sbjct: 145 EFLTIDPVPFDPPSFEASVKERLGNKASKEDQLGDRLIDENTVRWRYSRDANQQVFKESN 204

Query: 226 AQIVQWSDGSFSLKLGDEYTDIIVNDTDNTFLTVSHDQQELMQCYDGGEITKTMMFIPTS 285
           AQIVQWSDG+FSLKLGDEYTDI+ NDTDNTF  VSHDQQELMQCY+GGE+TKT+MFIPTS
Sbjct: 205 AQIVQWSDGTFSLKLGDEYTDILSNDTDNTFFAVSHDQQELMQCYEGGEVTKTLMFIPTS 264

Query: 286 TNSKIHQKLSKAVSRRNARQNLGPGSYIIKQDPEIEKKELEKLQGXXXXXXXXXXXXXXX 345
           T+S++HQKL+KAV RR+ +Q  GPG+YI+++DPE+E+ ELEK Q                
Sbjct: 265 TSSRMHQKLTKAVMRRDHKQAAGPGTYIVQKDPELERGELEKKQQQVVRERRRRQVKEME 324

Query: 346 TRENAENGFAETGEFKRGNTPSRSSRQNEYXXXXXXXXX------XXXXXXXXXXXXXXX 399
           +RE A               P  + R+NEY                              
Sbjct: 325 SRE-ASGDPDRRAAISAEAEPMGNIRRNEYEQDDFLVDDDDEEEYASGSGEEGEEEEEED 383

Query: 400 XXXXXXXXADRLRNAKRQGEHAFTXXXXXXXXNKRRKTAIISSEEDD 446
                   A+RLR  KR+G + +          KRR+ A+I  EED+
Sbjct: 384 EGNVSDEGAERLRRLKREGANNY-------EERKRRRVAVIDDEEDE 423

>SAKL0G02662g Chr7 complement(218969..220408) [1440 bp, 479 aa] {ON}
           similar to uniprot|P38439 Saccharomyces cerevisiae
           YOR123C LEO1 Component of the Paf1 complex which
           associates with RNA polymerase II and is involved in
           histone methylation
          Length = 479

 Score =  338 bits (866), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 177/350 (50%), Positives = 229/350 (65%), Gaps = 13/350 (3%)

Query: 108 EQEMYTRKFYGEDAVNYSD-DDEPHTFKESNVDLIRHIIPYKTRTTNNEHDEIFYAKVPA 166
           EQ MY RKFYG+D  N SD +D    FKE++V++ +HI+PYKT T+N++  E++YAKVP 
Sbjct: 131 EQAMYNRKFYGDDVDNDSDAEDSQREFKEADVEIAKHIVPYKT-TSNSQDKEVYYAKVPQ 189

Query: 167 FLTIDPVPFDPQTFEATVDERLSKSASKEDQLGDRLIDENTIRWRYSRDAEQHVFKESNA 226
           FLTIDPVPFDP +F+  V+ RL++ +SKEDQL DRLIDENTIRWRYSRD++Q VFKESNA
Sbjct: 190 FLTIDPVPFDPPSFKRNVEGRLAQFSSKEDQLDDRLIDENTIRWRYSRDSKQQVFKESNA 249

Query: 227 QIVQWSDGSFSLKLGDEYTDIIVNDTDNTFLTVSHDQQELMQCYDGGEITKTMMFIPTST 286
           QI+QWSDG+FSL+LGDE++D+++NDTDNTFLTVSH+QQELMQC +GGEITKTMMFIPTST
Sbjct: 250 QIIQWSDGTFSLRLGDEFSDVLINDTDNTFLTVSHEQQELMQCVEGGEITKTMMFIPTST 309

Query: 287 NSKIHQKLSKAVSRRNARQNLGPGSYIIKQDPEIEKKELEKLQGXXXXXXXXXXXXXXXT 346
           +SKIHQ+LSKAV RR  R++LGP +YI+++DPE+E++ELEK Q                 
Sbjct: 310 SSKIHQRLSKAVVRREQREHLGPNTYIVRKDPELEQRELEKKQDQIVRERRKRQLKEQLE 369

Query: 347 RENAENGFAETGEFKRGNTPSRSSRQNEYXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 406
           +EN  +     G  K   +     R+NEY                               
Sbjct: 370 KEN-RDSVEPLGVRKSATSSFGVGRRNEYEEDDFLVDDEEEEEEGGISGEEEEEAEEEDD 428

Query: 407 ------XADRLRNAKRQG----EHAFTXXXXXXXXNKRRKTAIISSEEDD 446
                  A+RLR  KR+G    E            +KRRK A++  EE+D
Sbjct: 429 DDEDDLNAERLRQLKREGAAQYEQKDEESGSEESSHKRRKIAVLDDEEED 478

>TDEL0D02610 Chr4 (500294..501616) [1323 bp, 440 aa] {ON} Anc_5.440
           YOR123C
          Length = 440

 Score =  335 bits (859), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 187/359 (52%), Positives = 221/359 (61%), Gaps = 19/359 (5%)

Query: 106 AKEQEMYTRKFYGEDAVNYSDDDE-PHTFKESNVDLIRHIIPYKTRTTN-NEHDEIFYAK 163
           A+E  MYTRKFYGEDA N SD +E  + F E NV+L+RHI+PYKT     +E   I+YAK
Sbjct: 83  AQEHAMYTRKFYGEDADNMSDQEESANHFTEENVELVRHIVPYKTVGEGADEKSTIYYAK 142

Query: 164 VPAFLTIDPVPFDPQTFEATVDERLSKSASKEDQLGDRLIDENTIRWRYSRDAEQHVFKE 223
           VP FLTIDPVPFDP +FE+ V ERL+ S+S+EDQLGDRLIDENTIRWRYSRD  Q V+KE
Sbjct: 143 VPEFLTIDPVPFDPPSFESKVKERLN-SSSREDQLGDRLIDENTIRWRYSRDENQQVYKE 201

Query: 224 SNAQIVQWSDGSFSLKLGDEYTDIIVNDTDNTFLTVSHDQQELMQCYDGGEITKTMMFIP 283
           SNAQIVQWSDG  SLKLG EYTDI+VNDTDNTF  VSHD+QELMQC  GGE+TK++MFIP
Sbjct: 202 SNAQIVQWSDGGLSLKLGTEYTDILVNDTDNTFFAVSHDEQELMQCSQGGEVTKSLMFIP 261

Query: 284 TSTNSKIHQKLSKAVSRRNARQNLGPGSYIIKQDPEIEKKELEKLQGXXXXXXXXXXXXX 343
           TSTNSK+HQKL+KAV RR+ RQ  GPG Y + +DPE+EK ELEK Q              
Sbjct: 262 TSTNSKMHQKLTKAVIRRDQRQTKGPGVYFVNKDPELEKNELEKKQQQVVRERRKRQLKE 321

Query: 344 XXTRENAENGFAETGEFKRGNTPS-------RSSRQNEYXX--------XXXXXXXXXXX 388
             +R + +      G  K   T S        SS++NEY                     
Sbjct: 322 IESRNSPDISTGLNGYRKTPVTASDEQDSYYGSSKRNEYEQDDFLVDDDEEEEAGYSEED 381

Query: 389 XXXXXXXXXXXXXXXXXXXADRLRNAKRQGEHAFTX-XXXXXXXNKRRKTAIISSEEDD 446
                              A+RLR  KRQG   +T          KRRK AII  E+D+
Sbjct: 382 DVLDDNNDDQEAEDEEDAKAERLRQLKRQGTERYTEPEPESDPSTKRRKVAIIDDEDDE 440

>KNAG0B04210 Chr2 (801346..802737) [1392 bp, 463 aa] {ON} Anc_5.440
           YOR123C
          Length = 463

 Score =  332 bits (852), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 156/225 (69%), Positives = 186/225 (82%), Gaps = 3/225 (1%)

Query: 108 EQEMYTRKFYGEDAVNYSDDDEP-HTFKESNVDLIRHIIPYKTRTTNN-EHDEIFYAKVP 165
           E+EMY RKFYGED V+ SD ++  H FKE+NV+L++HI+PYK    +    ++I+ AKVP
Sbjct: 99  EEEMYNRKFYGED-VDMSDTEQAEHEFKEANVELVKHIVPYKLVPDDAIGTNDIYVAKVP 157

Query: 166 AFLTIDPVPFDPQTFEATVDERLSKSASKEDQLGDRLIDENTIRWRYSRDAEQHVFKESN 225
            FL IDP PFDP +FE  V +RL  S SKED+LGDRLIDENT+RWRYSRD  Q VFKESN
Sbjct: 158 PFLMIDPAPFDPTSFEGKVADRLDGSLSKEDRLGDRLIDENTVRWRYSRDTNQSVFKESN 217

Query: 226 AQIVQWSDGSFSLKLGDEYTDIIVNDTDNTFLTVSHDQQELMQCYDGGEITKTMMFIPTS 285
            QIVQWSDGS+SLKLG+EYTDI++NDTDNTFLTVSHDQQELMQC +GG + KT+MFIPTS
Sbjct: 218 TQIVQWSDGSYSLKLGNEYTDILINDTDNTFLTVSHDQQELMQCVEGGLVNKTLMFIPTS 277

Query: 286 TNSKIHQKLSKAVSRRNARQNLGPGSYIIKQDPEIEKKELEKLQG 330
           T+SKIHQKLSKAV+RRN  Q+ GPG+YI+  DPEIEKKELE+ QG
Sbjct: 278 TSSKIHQKLSKAVARRNVMQSAGPGTYIVSVDPEIEKKELERKQG 322

>Ecym_4511 Chr4 complement(1020312..1021697) [1386 bp, 461 aa] {ON}
           similar to Ashbya gossypii ACL167C
          Length = 461

 Score =  314 bits (805), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 155/265 (58%), Positives = 200/265 (75%), Gaps = 5/265 (1%)

Query: 108 EQEMYTRKFYGEDA--VNY-SDDDEPHTFKESNVDLIRHIIPYKTRTTNNEHDEIFYAKV 164
           EQEMY RKFYG+D    +Y SD +E    KE+NV +++H++PY T   + +   ++YAKV
Sbjct: 86  EQEMYNRKFYGDDLKKTSYESDVEEEREIKEANVQIMKHVVPYYTTNASEKDSSLYYAKV 145

Query: 165 PAFLTIDPVPFDPQTFEATVDERLSKSASKEDQLGDRLIDENTIRWRYSRDAEQHVFKES 224
           P FLTIDP+PFDP  F++ +++RL + +SKEDQLGDRLIDENTIRWRYSR A Q VFKES
Sbjct: 146 PQFLTIDPIPFDPPGFQSQIEQRLKRFSSKEDQLGDRLIDENTIRWRYSRGANQQVFKES 205

Query: 225 NAQIVQWSDGSFSLKLGDEYTDIIVNDTDNTFLTVSHDQQELMQCYDGGEITKTMMFIPT 284
           NAQI+QWSDG+FSLKLGDE++DI++ND +NT++TVSH+Q+ELMQC +GGEI K+M+FIPT
Sbjct: 206 NAQIIQWSDGTFSLKLGDEFSDILINDIENTYMTVSHEQEELMQCVEGGEIKKSMLFIPT 265

Query: 285 STNSKIHQKLSKAVSRRNARQNLGPGSYIIKQDPEIEKKELEKLQGXXXXXXXXXXXXXX 344
           STNSK HQ+LS A++RR AR++ GP +YI++ DPE+EKKELEK                 
Sbjct: 266 STNSKTHQRLSAAIARREAREHSGPSTYIVRMDPELEKKELEKKHDQVIRERRKRQLKEQ 325

Query: 345 XTRENAENGFAETG--EFKRGNTPS 367
             RENAE G  ETG   FK+GN  S
Sbjct: 326 MDRENAEGGIVETGYFGFKKGNGRS 350

>ACL167C Chr3 complement(63134..64453) [1320 bp, 439 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOR123C
           (LEO1)
          Length = 439

 Score =  310 bits (794), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 143/276 (51%), Positives = 201/276 (72%), Gaps = 7/276 (2%)

Query: 107 KEQEMYTRKFYGED---AVNYSDDDEPHTFKESNVDLIRHIIPYKTRTTNNEHDEIFYAK 163
           +EQEMY RKFYG+D   A + SD+DE    KE++++L++H++P            ++Y K
Sbjct: 80  EEQEMYNRKFYGDDLQQASDLSDEDEAREIKEADLELVKHVVPLLYNKPLEGKRLLYYTK 139

Query: 164 VPAFLTIDPVPFDPQTFEATVDERLSKSASKEDQLGDRLIDENTIRWRYSRDAEQHVFKE 223
           VP FLTIDPVPFDP +F+  +++R+++ +SKEDQLGD LIDENTIRWRYSR ++Q VFKE
Sbjct: 140 VPQFLTIDPVPFDPPSFQGQIEKRMARFSSKEDQLGDSLIDENTIRWRYSRGSDQRVFKE 199

Query: 224 SNAQIVQWSDGSFSLKLGDEYTDIIVNDTDNTFLTVSHDQQELMQCYDGGEITKTMMFIP 283
           SNAQ+++WSDG+ SLKLGDEYTDI+ N+ +NT+LTVSH+QQE+MQC +GG I+ +M+FIP
Sbjct: 200 SNAQVIEWSDGTLSLKLGDEYTDILTNEIENTYLTVSHEQQEIMQCVEGGTISNSMLFIP 259

Query: 284 TSTNSKIHQKLSKAVSRRNARQNLGPGSYIIKQDPEIEKKELEKLQGXXXXXXXXXXXXX 343
           TSTNSKIH++L+KA++RR AR++ GP +YI+++DPE+EK+EL+K                
Sbjct: 260 TSTNSKIHKRLTKAIARREAREHSGPSTYIVRKDPELEKRELQKKHDQVLRERRKRQLKE 319

Query: 344 XXTRENAENGFAETG-EFKRG---NTPSRSSRQNEY 375
              R+N E G A+   EFK+      P   S ++EY
Sbjct: 320 QLDRDNLEGGLAQGSFEFKKAAGRAAPYSRSMEDEY 355

>TBLA0A06490 Chr1 (1595241..1596527) [1287 bp, 428 aa] {ON}
           Anc_5.440 YOR123C
          Length = 428

 Score =  310 bits (793), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 157/284 (55%), Positives = 200/284 (70%), Gaps = 18/284 (6%)

Query: 107 KEQEMYTRKFYGEDAVNYSDDDE-PHTFKESNVDLIRHIIPYKTRTTNNE---HDEIFYA 162
           +++ MY +KFYGED  N SDDD+  + +KES+++L+RHI+PYKTR +N E   H E++YA
Sbjct: 54  QDKAMYEKKFYGEDGFNRSDDDDNEYEYKESDIELVRHIVPYKTRPSNKELDKHRELYYA 113

Query: 163 KVPAFLTIDPVPFDPQTFEATVDERLSKSASKEDQLGDRLIDENTIRWRYSRDAEQH--V 220
           KVP FL +DPVPFD   FE+ V ER+  S +++ Q+ DRL DENTIRWRYSRD+  +  V
Sbjct: 114 KVPPFLMVDPVPFDSTNFESAVKERIKNSLNEDTQITDRLRDENTIRWRYSRDSNDNDKV 173

Query: 221 FKESNAQIVQWSDGSFSLKLGDEYTDIIVNDTDNTFLTVSHDQQELMQCYDGGEITKTMM 280
           FK+SNAQI+QWSDGS+SLKLG++YTDI+ N+TDN FLTVSHDQQELMQCY+GGEITKT+M
Sbjct: 174 FKQSNAQIIQWSDGSYSLKLGNDYTDILTNETDNIFLTVSHDQQELMQCYNGGEITKTLM 233

Query: 281 FIPTSTNSKIHQKLSKAVSRRNARQNLGPGSYIIKQDPEIEKKELEKLQGXXXXXXXXXX 340
           FIP+ST SKIHQ+L+ AV  R+ +   GPG  +I  DPEIEKK LEK Q           
Sbjct: 234 FIPSSTKSKIHQRLTAAVQNRDKKTTSGPGMMLINTDPEIEKKLLEKKQWQMMRDRRRKQ 293

Query: 341 XXXXXTRENAENGFAETGEFKRGNTP---------SRSSRQNEY 375
                 REN E     +G  KR N+P         SRS R ++Y
Sbjct: 294 LQE---RENNEVDGITSGFSKRDNSPSINSQSIKGSRSDRNHDY 334

>Kpol_1062.26 s1062 (58970..60343) [1374 bp, 457 aa] {ON}
           (58970..60343) [1374 nt, 458 aa]
          Length = 457

 Score =  309 bits (791), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 182/367 (49%), Positives = 220/367 (59%), Gaps = 27/367 (7%)

Query: 107 KEQEMYTRKFYGEDAVNYSDDDE-PHTFKESNVDLIRHIIPYKTRTTNNEHDE-IFYAKV 164
           +EQ MYTRKFYGED  + SD +E  H F+E +V L RH++P K  +  N+ D  I+YAKV
Sbjct: 91  EEQAMYTRKFYGEDDYDKSDQEEDKHEFREEDVVLTRHVVPTKITSEENDADTTIYYAKV 150

Query: 165 PAFLTIDPVPFDPQTFEATVDERLSKSASKEDQLGDRLIDENTIRWRYSRDAEQHVFKES 224
           P FLTIDP+PFDP TFE  V ERL+   SKE+QL DRLID+NTIRWRYSRD  Q VFKES
Sbjct: 151 PPFLTIDPIPFDPPTFENVVRERLTNGLSKEEQLEDRLIDQNTIRWRYSRDDNQRVFKES 210

Query: 225 NAQIVQWSDGSFSLKLGDEYTDIIVNDTDNTFLTVSHDQQELMQCYDGGEITKTMMFIPT 284
           NA IVQWSDGS+SLKLGDEYTDI++NDTDNTFLTVSHDQQELMQC  GGEI+K+++F+P 
Sbjct: 211 NATIVQWSDGSYSLKLGDEYTDILLNDTDNTFLTVSHDQQELMQCVHGGEISKSLLFVPI 270

Query: 285 STNSKIHQKLSKAVSRRNARQNLGPGSYIIKQDPEIEKKELEKLQGXXXXXXXXXXXXXX 344
           ST SK+HQ+LSKA+ RRNA + +GP S I+  DPE+EKKELEK Q               
Sbjct: 271 STTSKLHQRLSKAIVRRNATETMGPRSMIVNIDPELEKKELEKKQSQVFRERRKKKQKEI 330

Query: 345 XTRENAE-NGFAE---TGEFKRGNTPSR--SSRQNEYXX------------------XXX 380
              E+ E  GF     +   KR  TP     SR++EY                       
Sbjct: 331 EALESLETTGFGNNSYSASRKRSTTPMSYGGSRRDEYEEDDFIVDDEEEEPEYAGEEDDD 390

Query: 381 XXXXXXXXXXXXXXXXXXXXXXXXXXXADRLRNAKRQGEHAFTXXXXXXXXN-KRRKTAI 439
                                      A+RLR  KRQG  A+         + KRRK A+
Sbjct: 391 DLDGFEEEEEEQEEEEEGEDEDADEKRAERLRELKRQGTAAYNDDEKSGSESPKRRKVAV 450

Query: 440 ISSEEDD 446
           I  +EDD
Sbjct: 451 IEDDEDD 457

>KLLA0E02311g Chr5 complement(214032..215285) [1254 bp, 417 aa] {ON}
           similar to uniprot|P38439 Saccharomyces cerevisiae
           YOR123C LEO1 Component of the Paf1 complex which
           associates with RNA polymerase II and is involved in
           histone methylation
          Length = 417

 Score =  305 bits (781), Expect = 2e-99,   Method: Compositional matrix adjust.
 Identities = 143/221 (64%), Positives = 186/221 (84%), Gaps = 3/221 (1%)

Query: 108 EQEMYTRKFYGEDAVNYSDDDEPHTFKESNVDLIRHIIPYKTRTTNNEHDE-IFYAKVPA 166
           EQ MY RKF GED    S+++    +KE +V++++H++PYKT   N   D+ I+YAKVP 
Sbjct: 69  EQAMYNRKFLGEDYEGQSEEEYEKKYKEVDVEIVKHVVPYKT--ANGADDKTIYYAKVPQ 126

Query: 167 FLTIDPVPFDPQTFEATVDERLSKSASKEDQLGDRLIDENTIRWRYSRDAEQHVFKESNA 226
           FLTIDPVPFDP +F+  V++R+SK +SKEDQLGDRLI+ENTIRWRYSRD ++ VFKESNA
Sbjct: 127 FLTIDPVPFDPPSFQKKVEDRVSKYSSKEDQLGDRLIEENTIRWRYSRDKDERVFKESNA 186

Query: 227 QIVQWSDGSFSLKLGDEYTDIIVNDTDNTFLTVSHDQQELMQCYDGGEITKTMMFIPTST 286
           QIV+WSDG+FSLK+GDEYTDI+VN+T+NT+LTVSH++QEL+QC +GGEITK+MMF+PTST
Sbjct: 187 QIVEWSDGTFSLKVGDEYTDILVNNTENTYLTVSHEEQELIQCVEGGEITKSMMFVPTST 246

Query: 287 NSKIHQKLSKAVSRRNARQNLGPGSYIIKQDPEIEKKELEK 327
           NSK+H+ LSKAV+RR+ R   GP +YI + DPE+EK+ELEK
Sbjct: 247 NSKVHKILSKAVARRDERGQHGPNTYITRTDPELEKRELEK 287

>Kwal_55.21408 s55 (823660..824970) [1311 bp, 436 aa] {ON} YOR123C
           (LEO1) - Product of gene unknown [contig 130] FULL
          Length = 436

 Score =  305 bits (782), Expect = 2e-99,   Method: Compositional matrix adjust.
 Identities = 134/222 (60%), Positives = 184/222 (82%), Gaps = 1/222 (0%)

Query: 109 QEMYTRKFYGEDAVNYSDDDEPHTFKESNVDLIRHIIPYKTRTTNNEHDEIFYAKVPAFL 168
           Q MY RKFYG++A + +D+     F+E++VD+++H++PY T  +  +   IFYAKVP FL
Sbjct: 81  QAMYNRKFYGDNAEDSNDEGSQREFREADVDVVKHVVPYSTVPSEGDK-TIFYAKVPQFL 139

Query: 169 TIDPVPFDPQTFEATVDERLSKSASKEDQLGDRLIDENTIRWRYSRDAEQHVFKESNAQI 228
           TIDP+PFDP  F+  +++R ++ +S EDQ+ DRLI+ENT+RWRYSRD++Q VFKESNAQI
Sbjct: 140 TIDPIPFDPPAFQNKIEQRTAQLSSTEDQIDDRLIEENTVRWRYSRDSKQQVFKESNAQI 199

Query: 229 VQWSDGSFSLKLGDEYTDIIVNDTDNTFLTVSHDQQELMQCYDGGEITKTMMFIPTSTNS 288
           VQWSDG+FSL+LGDE+TD+++NDT++T+LTVSHDQQEL+Q   GGE+TK M+FIPTSTNS
Sbjct: 200 VQWSDGTFSLRLGDEFTDVLINDTEDTYLTVSHDQQELIQSVKGGEVTKNMIFIPTSTNS 259

Query: 289 KIHQKLSKAVSRRNARQNLGPGSYIIKQDPEIEKKELEKLQG 330
           K HQ+LSKAV+R+  R++ GP +YI++ DPE+E+KELEK QG
Sbjct: 260 KSHQRLSKAVARKEQREHHGPNTYILRVDPELEQKELEKKQG 301

>TPHA0E01730 Chr5 (350455..351864) [1410 bp, 469 aa] {ON} Anc_5.440
           YOR123C
          Length = 469

 Score =  300 bits (769), Expect = 5e-97,   Method: Compositional matrix adjust.
 Identities = 158/288 (54%), Positives = 199/288 (69%), Gaps = 19/288 (6%)

Query: 107 KEQEMYTRKFYGEDAVN-YSDDDEPHTFKESNVDLIRHIIPYKTRTTNNEH--------D 157
           +E  MYTRKFYG++ VN Y +D+  H FKE++V+L+RHI+PYK     N++        +
Sbjct: 110 EEHAMYTRKFYGDEDVNKYDEDENMHEFKEADVELVRHIVPYKILEQKNDNSKDDATSKN 169

Query: 158 EIFYAKVPAFLTIDPVPFDPQTFEATVDERLSKSASKEDQLGDRLIDENTIRWRYSRDAE 217
             +YA++P FLTIDPVPFDP  FE+ V ERL  + + +D++GDRLIDENTIRWRYSRDA 
Sbjct: 170 STYYARIPPFLTIDPVPFDPPQFESEVKERLENTTNVKDRIGDRLIDENTIRWRYSRDAN 229

Query: 218 QHVFKESNAQIVQWSDGSFSLKLGDEYTDIIVNDTDNTFLTVSHDQQELMQCYDGGEITK 277
           Q VFKESNAQI+QWSDGS+SLKLGD+YTD++VND  NTFLTVSHDQQELMQC DGGEI+K
Sbjct: 230 QTVFKESNAQIIQWSDGSYSLKLGDDYTDLLVNDISNTFLTVSHDQQELMQCVDGGEISK 289

Query: 278 TMMFIPTSTNSKIHQKLSKAVSRRNARQNLGPGSYIIKQDPEIEKKELEKLQGXXXXXXX 337
           + MF+P STNS++HQ+LSKA++RR+      P S II  DPEIEKKELEK Q        
Sbjct: 290 SAMFVPISTNSRLHQRLSKAIARRDQNSTESPRSMIINVDPEIEKKELEKKQSQIFRDRR 349

Query: 338 XXXXXXXXTRENA-------ENGFAETGEFKRGNTPS---RSSRQNEY 375
                   T + A       +  +  +   KRG TPS   R  R +EY
Sbjct: 350 KRKQREIETEQEALDSPGFSQGNYGSSSSRKRGQTPSYDPRRERADEY 397

>KLTH0F15928g Chr6 (1295609..1296880) [1272 bp, 423 aa] {ON} similar
           to uniprot|P38439 Saccharomyces cerevisiae YOR123C LEO1
           Component of the Paf1 complex which associates with RNA
           polymerase II and is involved in histone methylation
          Length = 423

 Score =  295 bits (755), Expect = 1e-95,   Method: Compositional matrix adjust.
 Identities = 131/223 (58%), Positives = 179/223 (80%), Gaps = 2/223 (0%)

Query: 108 EQEMYTRKFYGEDAVNYSDDDEPHTFKESNVDLIRHIIPYKTRTTNNEHDEIFYAKVPAF 167
           EQ MY RKFYG+   + S+D+    F+E+++D+++HI+PY T  +  +   I+Y KVP F
Sbjct: 67  EQAMYNRKFYGDKGED-SNDEGSQEFREADIDIMKHIVPYSTEPSQGDK-TIYYTKVPQF 124

Query: 168 LTIDPVPFDPQTFEATVDERLSKSASKEDQLGDRLIDENTIRWRYSRDAEQHVFKESNAQ 227
           LTIDP+PFDP  F++ ++ER ++  S EDQ+ DRLI+ENT+RWRYSRD  Q VFKESNA 
Sbjct: 125 LTIDPIPFDPPAFQSKIEERAAQRTSVEDQIDDRLIEENTVRWRYSRDKNQRVFKESNAH 184

Query: 228 IVQWSDGSFSLKLGDEYTDIIVNDTDNTFLTVSHDQQELMQCYDGGEITKTMMFIPTSTN 287
           IVQWSDG++SL+LGDEYTD+++NDT++T+L VSHDQQEL+Q   GGE+TK M+FIPTSTN
Sbjct: 185 IVQWSDGTYSLRLGDEYTDVLINDTEDTYLAVSHDQQELIQSVKGGEVTKNMIFIPTSTN 244

Query: 288 SKIHQKLSKAVSRRNARQNLGPGSYIIKQDPEIEKKELEKLQG 330
           SK HQ+LSKAV+R+  +++ GP +YI++ DPE+E+KELEK QG
Sbjct: 245 SKSHQRLSKAVARKEQQEHHGPNTYILRVDPELEQKELEKKQG 287

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.310    0.128    0.357 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 35,318,679
Number of extensions: 1421031
Number of successful extensions: 3160
Number of sequences better than 10.0: 27
Number of HSP's gapped: 3187
Number of HSP's successfully gapped: 30
Length of query: 446
Length of database: 53,481,399
Length adjustment: 113
Effective length of query: 333
Effective length of database: 40,524,141
Effective search space: 13494538953
Effective search space used: 13494538953
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.8 bits)
S2: 67 (30.4 bits)