Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
CAGL0K05709g1.52ON1103110351470.0
Suva_2.6871.52ON1128115926520.0
Skud_4.7831.52ON1135117126230.0
YDR507C (GIN4)1.52ON1142116826190.0
Smik_4.7891.52ON1136115825950.0
KAFR0D041001.52ON1117115925840.0
TDEL0C064901.52ON1153116924830.0
KNAG0F002901.52ON1125116024260.0
NCAS0B086001.52ON1117116724210.0
Kpol_2002.461.52ON1123116224110.0
ZYRO0F17402g1.52ON1189120623550.0
NDAI0A006601.52ON1022113423320.0
TPHA0E036401.52ON1137117923110.0
KLLA0C01650g1.52ON1112114422610.0
AFR696C1.52ON1142117522370.0
Skud_3.391.52ON1017112519400.0
Smik_3.541.52ON1032112619250.0
Suva_3.1901.52ON1024111719040.0
KLTH0F01672g1.52ON116457117820.0
SAKL0C01716g1.52ON121560317750.0
Ecym_10581.52ON116457417280.0
TBLA0A071501.52ON139148215870.0
Kwal_33.132251.52ON96497514920.0
YCL024W (KCC4)1.52ON103737213901e-174
SAKL0E02860g2.479ON13773979841e-113
Ecym_73922.479ON14343729781e-111
KLTH0D05566g2.479ON11283509451e-109
ABL034W2.479ON14253509561e-109
KLLA0F13552g2.479ON12673559421e-107
Kwal_26.77882.479ON12673719361e-107
TDEL0A025502.479ON13693909351e-106
YKL101W (HSL1)2.479ON15183899361e-105
Smik_11.1392.479ON15343899351e-105
NCAS0A057702.479ON14613819291e-105
Suva_11.1232.479ON15263899291e-104
KNAG0A065402.479ON14323789231e-104
Skud_11.1262.479ON15183879251e-104
TBLA0I011502.479ON17453839181e-102
KAFR0D032002.479ON14483789081e-102
ZYRO0G03366g2.479ON16163969111e-102
Kpol_431.92.479ON15524009071e-101
CAGL0K08514g2.479ON14893998991e-101
NDAI0D027502.479ON15152988231e-90
TPHA0G032002.479ON15343277743e-84
Kwal_33.13222singletonOFF1481205352e-62
CAGL0M08910g5.611ON6122825646e-61
TPHA0C004705.611ON6312735603e-60
Suva_2.6515.611ON6332825569e-60
Smik_4.7545.611ON6322825542e-59
Skud_4.7515.611ON6342825533e-59
Kpol_1018.655.611ON6012685504e-59
YDR477W (SNF1)5.611ON6332685514e-59
NCAS0A080805.611ON6232745497e-59
Kwal_47.182335.611ON5982715452e-58
KLLA0A03806g5.611ON6022715442e-58
Kpol_495.145.611ON6242695453e-58
KAFR0C058605.611ON6442685463e-58
AEL230W5.611ON6082745424e-58
NDAI0H009405.611ON6852875474e-58
TBLA0E033605.611ON6542685437e-58
SAKL0G06952g5.611ON5992685399e-58
TPHA0D028405.611ON6342675411e-57
KLTH0G05698g5.611ON5972715381e-57
KNAG0B032305.611ON6412735392e-57
Ecym_55885.611ON6132685363e-57
TDEL0A047805.611ON6212685354e-57
ZYRO0A05544g5.611ON6312685303e-56
KNAG0J015908.654ON8053164931e-50
Kwal_26.87098.654ON8292974932e-50
ZYRO0F06842g8.654ON8432934888e-50
KLTH0D10714g8.654ON8722914881e-49
Kpol_1072.298.654ON8933004862e-49
TPHA0G017108.654ON8052834833e-49
NDAI0E023208.654ON9322914853e-49
NCAS0C015908.654ON8642874817e-49
TDEL0A060008.654ON7902844762e-48
SAKL0H07084g8.654ON9192864782e-48
NDAI0J012508.279ON11763104812e-48
YPL141C (FRK1)8.654ON8652984738e-48
CAGL0M02519g8.654ON7562974681e-47
NDAI0B020708.279ON12583634751e-47
Smik_6.3398.654ON8652954702e-47
Skud_16.1408.654ON8652954692e-47
Suva_16.1698.654ON8582984692e-47
CAGL0M02299g8.668ON8932804641e-46
NCAS0B050908.279ON12102994671e-46
NDAI0E012908.654ON7292934591e-46
TBLA0C046008.279ON13152894672e-46
TPHA0D011408.654ON6222974532e-46
CAGL0M11396g8.279ON11922884652e-46
Smik_4.3678.279ON10662834624e-46
KAFR0H025408.654ON8173354575e-46
Skud_12.1648.279ON11602884617e-46
CAGL0J03872g8.654ON6612954517e-46
AGR058W8.279ON10712944608e-46
Smik_12.1558.279ON11622884591e-45
TPHA0J008208.279ON12182954591e-45
Suva_2.2838.279ON10892834581e-45
KNAG0G021108.279ON11923094581e-45
KLTH0G13288g8.279ON11423644582e-45
TDEL0F040608.279ON11262894572e-45
SAKL0H16632g8.279ON10622944572e-45
Kpol_1066.468.279ON12252834582e-45
Kpol_1012.68.654ON6282934462e-45
YLR096W (KIN2)8.279ON11472884563e-45
YDR122W (KIN1)8.279ON10642834544e-45
Smik_15.4178.654ON8062904495e-45
NCAS0B037408.279ON10492894535e-45
Skud_4.3838.279ON10652834535e-45
Ecym_42918.279ON11452904535e-45
NCAS0B014708.654ON7273044466e-45
Suva_10.1808.279ON11592884536e-45
TBLA0B039708.654ON12082844511e-44
Skud_15.3998.654ON8072914461e-44
Ecym_83398.654ON9202844481e-44
KLLA0F19536g8.279ON11042954491e-44
KAFR0A037308.654ON7882934442e-44
Suva_8.2848.654ON8082914442e-44
KAFR0B028008.279ON10952864482e-44
YOR233W (KIN4)8.654ON8002914415e-44
ZYRO0F07194g8.668ON9383304436e-44
NCAS0C016708.668ON8962774418e-44
KNAG0A030408.654ON6443044331e-43
SAKL0H06754g8.668ON8842764382e-43
CAGL0B01925g8.279ON9442944382e-43
NDAI0E023908.668ON8833424373e-43
ACR119W8.654ON9312904364e-43
TBLA0C017508.654ON9812904355e-43
ZYRO0D06776g8.279ON12042834341e-42
KLLA0D07348g8.654ON9092904302e-42
Kpol_1072.198.668ON8962764241e-41
Ecym_24058.668ON8552804231e-41
ACR133C8.668ON8512804193e-41
KLTH0D11044g8.668ON8492714184e-41
TBLA0B038608.668ON9882804179e-41
Kwal_26.87518.668ON8482754141e-40
KLLA0F11319g8.668ON8432754104e-40
KNAG0J016708.668ON10092744115e-40
TDEL0A061408.668ON8613594096e-40
TPHA0G016308.668ON8712814088e-40
KNAG0H031408.279ON9362844062e-39
KNAG0D010906.222ON3722763842e-39
KNAG0I014801.374ON4402773882e-39
Skud_16.1328.668ON9243524043e-39
NDAI0G053001.374ON4372743865e-39
YPL150W8.668ON9012813981e-38
CAGL0F04741g1.374ON4422983803e-38
Ecym_12751.374ON4512683794e-38
Smik_6.3478.668ON9172813944e-38
TDEL0B063201.374ON4442843785e-38
Suva_16.1608.668ON9182933901e-37
YFR014C (CMK1)1.374ON4462763742e-37
SAKL0D07656g1.374ON4323003723e-37
NCAS0A088801.374ON4222723713e-37
Smik_6.3508.676ON8223103863e-37
AAR009W1.374ON4532673733e-37
CAGL0L07326g2.352ON5063113753e-37
Kwal_0.961.374ON4272683704e-37
TPHA0O011201.374ON4292983671e-36
Smik_7.3191.374ON4462763672e-36
KLTH0H11396g1.374ON4372743662e-36
YPL153C (RAD53)8.676ON8213103802e-36
Kpol_1069.131.374ON4272773652e-36
KAFR0C044801.374ON4352853662e-36
Skud_16.1298.676ON8273103783e-36
CAGL0K10604g1.374ON4462763653e-36
NCAS0D006301.374ON4272763643e-36
Suva_16.1578.676ON8323153783e-36
Suva_6.781.374ON4452763611e-35
TBLA0D050101.374ON4342753591e-35
TBLA0A020506.222ON4342753591e-35
Skud_6.891.374ON4462763582e-35
KAFR0H025108.668ON8793653712e-35
Kpol_1065.36.222ON3762743532e-35
NDAI0H035201.374ON4582713565e-35
ZYRO0E05588g1.374ON4712763575e-35
Suva_4.1452.352ON5143263586e-35
Skud_15.1441.374ON4492743556e-35
YDL101C (DUN1)2.352ON5132963587e-35
KAFR0H024308.676ON7842803641e-34
AFL188C2.352ON4723283541e-34
KLLA0F23155g1.374ON4272673511e-34
CAGL0M02233g8.676ON7672943631e-34
Smik_4.1352.352ON5132973551e-34
KAFR0I020101.374ON4322783502e-34
Suva_15.1551.374ON4523003512e-34
YOL016C (CMK2)1.374ON4473003512e-34
Kwal_56.237178.279ON8581863632e-34
KLLA0F11143g8.676ON8132753604e-34
SAKL0E05984g2.352ON5052913506e-34
Smik_15.1531.374ON4423003476e-34
NCAS0D021006.31ON7262673568e-34
KAFR0K002806.222ON3602323401e-33
Skud_4.1542.352ON5132973481e-33
SAKL0H06534g8.676ON8042793542e-33
Kwal_56.224766.31ON6973083522e-33
NDAI0F016006.222ON4122273403e-33
Kwal_26.87968.676ON7962783533e-33
KLLA0E01585g2.352ON5122933453e-33
TBLA0B004906.31ON7873183523e-33
KLTH0C10912g6.31ON6972883504e-33
NDAI0E021108.676ON9032863534e-33
TDEL0A062208.676ON7942793524e-33
KLTH0D11242g8.676ON7952773524e-33
TPHA0E028206.222ON3842273375e-33
Ecym_56242.352ON4542953405e-33
KAFR0K024502.352ON5112963436e-33
Kpol_1004.192.352ON4942913426e-33
KNAG0J017008.676ON8202823507e-33
ACR142W8.676ON8372843481e-32
Kpol_1033.506.214ON3842573331e-32
Kwal_56.240916.222ON3812203322e-32
Skud_13.1546.31ON7052903452e-32
NCAS0C013708.676ON7992773462e-32
YMR001C (CDC5)6.31ON7052903442e-32
TBLA0A020306.214ON4032733332e-32
Suva_13.1636.31ON7053233433e-32
NCAS0B059102.352ON5172963373e-32
Kpol_1037.206.31ON7042933424e-32
Kpol_1072.168.676ON7952803434e-32
Smik_13.1596.31ON7052903424e-32
ACL006W6.31ON7082883424e-32
KAFR0B054108.279ON5392833374e-32
AFL101C6.222ON3672853285e-32
Suva_7.1061.390ON5233133365e-32
Ecym_30356.31ON7402103416e-32
TBLA0B073302.352ON5383053366e-32
NCAS0B044906.222ON3492253257e-32
Skud_10.501.182ON3972703287e-32
Kwal_56.240596.214ON3532523258e-32
KNAG0E008506.31ON7112973408e-32
TBLA0B038408.676ON8582793419e-32
SAKL0E01584g6.31ON6953113381e-31
KLTH0H04180g6.214ON3532523241e-31
CAGL0E05720g6.222ON3582713241e-31
YJL164C (TPK1)1.182ON3972703261e-31
TPHA0J004206.31ON7072963371e-31
TPHA0G016008.676ON8452793392e-31
Ecym_23978.676ON8722793392e-31
KLTH0H03982g6.222ON3982223252e-31
SAKL0C05368g1.182ON4182933262e-31
CAGL0J11638g6.31ON7462683372e-31
ZYRO0A07546g2.352ON4942953302e-31
Smik_10.661.182ON3972703242e-31
KNAG0A056702.352ON5182953303e-31
KAFR0K003306.214ON3733243223e-31
NDAI0A009601.182ON4082573234e-31
Suva_6.2451.182ON3942733234e-31
KLLA0C06138g6.31ON7082323344e-31
TDEL0G028202.352ON4972943275e-31
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0K05709g
         (1103 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0K05709g Chr11 complement(556732..560043) [3312 bp, 1103 aa]...  1987   0.0  
Suva_2.687 Chr2 complement(1215095..1218481) [3387 bp, 1128 aa] ...  1026   0.0  
Skud_4.783 Chr4 complement(1382552..1385959) [3408 bp, 1135 aa] ...  1014   0.0  
YDR507C Chr4 complement(1462358..1465786) [3429 bp, 1142 aa] {ON...  1013   0.0  
Smik_4.789 Chr4 complement(1385209..1388619) [3411 bp, 1136 aa] ...  1004   0.0  
KAFR0D04100 Chr4 complement(809681..813034) [3354 bp, 1117 aa] {...   999   0.0  
TDEL0C06490 Chr3 complement(1191461..1194922) [3462 bp, 1153 aa]...   961   0.0  
KNAG0F00290 Chr6 (31750..35127) [3378 bp, 1125 aa] {ON} Anc_1.52...   939   0.0  
NCAS0B08600 Chr2 (1649375..1652728) [3354 bp, 1117 aa] {ON} Anc_...   937   0.0  
Kpol_2002.46 s2002 (95107..98478) [3372 bp, 1123 aa] {ON} (95107...   933   0.0  
ZYRO0F17402g Chr6 complement(1445685..1449254) [3570 bp, 1189 aa...   911   0.0  
NDAI0A00660 Chr1 (121773..124841) [3069 bp, 1022 aa] {ON} Anc_1.52    902   0.0  
TPHA0E03640 Chr5 complement(769962..773375) [3414 bp, 1137 aa] {...   894   0.0  
KLLA0C01650g Chr3 (128119..131457) [3339 bp, 1112 aa] {ON} simil...   875   0.0  
AFR696C Chr6 complement(1722130..1725558) [3429 bp, 1142 aa] {ON...   866   0.0  
Skud_3.39 Chr3 (66201..69254) [3054 bp, 1017 aa] {ON} YCL024W (R...   751   0.0  
Smik_3.54 Chr3 (80309..83407) [3099 bp, 1032 aa] {ON} YCL024W (R...   746   0.0  
Suva_3.190 Chr3 (288639..288813,288870..291766) [3072 bp, 1024 a...   738   0.0  
KLTH0F01672g Chr6 (127277..130771) [3495 bp, 1164 aa] {ON} simil...   691   0.0  
SAKL0C01716g Chr3 (143880..147527) [3648 bp, 1215 aa] {ON} simil...   688   0.0  
Ecym_1058 Chr1 (105835..109329) [3495 bp, 1164 aa] {ON} similar ...   670   0.0  
TBLA0A07150 Chr1 (1776160..1780335) [4176 bp, 1391 aa] {ON} Anc_...   615   0.0  
Kwal_33.13225 s33 (127676..130570) [2895 bp, 964 aa] {ON} YFR016...   579   0.0  
YCL024W Chr3 (79162..82275) [3114 bp, 1037 aa] {ON}  KCC4Protein...   540   e-174
SAKL0E02860g Chr5 complement(228726..232859) [4134 bp, 1377 aa] ...   383   e-113
Ecym_7392 Chr7 complement(803240..807544) [4305 bp, 1434 aa] {ON...   381   e-111
KLTH0D05566g Chr4 (498055..501441) [3387 bp, 1128 aa] {ON} weakl...   368   e-109
ABL034W Chr2 (333432..337709) [4278 bp, 1425 aa] {ON} Syntenic h...   372   e-109
KLLA0F13552g Chr6 complement(1252906..1256709) [3804 bp, 1267 aa...   367   e-107
Kwal_26.7788 s26 (511530..515333) [3804 bp, 1267 aa] {ON} YKL101...   365   e-107
TDEL0A02550 Chr1 (457841..461950) [4110 bp, 1369 aa] {ON} Anc_2....   364   e-106
YKL101W Chr11 (248920..253476) [4557 bp, 1518 aa] {ON}  HSL1Nim1...   365   e-105
Smik_11.139 Chr11 (235511..240115) [4605 bp, 1534 aa] {ON} YKL10...   364   e-105
NCAS0A05770 Chr1 (1132854..1137239) [4386 bp, 1461 aa] {ON} Anc_...   362   e-105
Suva_11.123 Chr11 (235064..239644) [4581 bp, 1526 aa] {ON} YKL10...   362   e-104
KNAG0A06540 Chr1 (1002435..1006733) [4299 bp, 1432 aa] {ON} Anc_...   360   e-104
Skud_11.126 Chr11 (235011..239567) [4557 bp, 1518 aa] {ON} YKL10...   360   e-104
TBLA0I01150 Chr9 complement(235187..240424) [5238 bp, 1745 aa] {...   358   e-102
KAFR0D03200 Chr4 (628993..633339) [4347 bp, 1448 aa] {ON} Anc_2....   354   e-102
ZYRO0G03366g Chr7 (261014..265864) [4851 bp, 1616 aa] {ON} simil...   355   e-102
Kpol_431.9 s431 complement(22310..26968) [4659 bp, 1552 aa] {ON}...   353   e-101
CAGL0K08514g Chr11 complement(854143..858612) [4470 bp, 1489 aa]...   350   e-101
NDAI0D02750 Chr4 (639802..644349) [4548 bp, 1515 aa] {ON} Anc_2....   321   1e-90
TPHA0G03200 Chr7 (683296..687900) [4605 bp, 1534 aa] {ON} Anc_2....   302   3e-84
Kwal_33.13222 s33 (127342..127788) [447 bp, 148 aa] {OFF} YDR507...   210   2e-62
CAGL0M08910g Chr13 complement(887703..889541) [1839 bp, 612 aa] ...   221   6e-61
TPHA0C00470 Chr3 (81482..83377) [1896 bp, 631 aa] {ON} Anc_5.611...   220   3e-60
Suva_2.651 Chr2 (1164264..1166165) [1902 bp, 633 aa] {ON} YDR477...   218   9e-60
Smik_4.754 Chr4 (1333667..1335565) [1899 bp, 632 aa] {ON} YDR477...   218   2e-59
Skud_4.751 Chr4 (1332135..1334039) [1905 bp, 634 aa] {ON} YDR477...   217   3e-59
Kpol_1018.65 s1018 (189779..191584) [1806 bp, 601 aa] {ON} (1897...   216   4e-59
YDR477W Chr4 (1412373..1414274) [1902 bp, 633 aa] {ON}  SNF1AMP-...   216   4e-59
NCAS0A08080 Chr1 complement(1594221..1596092) [1872 bp, 623 aa] ...   216   7e-59
Kwal_47.18233 s47 complement(743846..745642) [1797 bp, 598 aa] {...   214   2e-58
KLLA0A03806g Chr1 complement(338807..340615) [1809 bp, 602 aa] {...   214   2e-58
Kpol_495.14 s495 (33810..35684) [1875 bp, 624 aa] {ON} (33810..3...   214   3e-58
KAFR0C05860 Chr3 (1160586..1162520) [1935 bp, 644 aa] {ON} Anc_5...   214   3e-58
AEL230W Chr5 (198401..200227) [1827 bp, 608 aa] {ON} Syntenic ho...   213   4e-58
NDAI0H00940 Chr8 complement(209645..211702) [2058 bp, 685 aa] {O...   215   4e-58
TBLA0E03360 Chr5 complement(838512..840476) [1965 bp, 654 aa] {O...   213   7e-58
SAKL0G06952g Chr7 (570584..572383) [1800 bp, 599 aa] {ON} simila...   212   9e-58
TPHA0D02840 Chr4 (591733..593637) [1905 bp, 634 aa] {ON}              213   1e-57
KLTH0G05698g Chr7 (453530..455323) [1794 bp, 597 aa] {ON} simila...   211   1e-57
KNAG0B03230 Chr2 complement(625072..626997) [1926 bp, 641 aa] {O...   212   2e-57
Ecym_5588 Chr5 complement(1205102..1206943) [1842 bp, 613 aa] {O...   211   3e-57
TDEL0A04780 Chr1 (842715..844580) [1866 bp, 621 aa] {ON} Anc_5.6...   210   4e-57
ZYRO0A05544g Chr1 (450809..452704) [1896 bp, 631 aa] {ON} highly...   208   3e-56
KNAG0J01590 Chr10 (292565..294982) [2418 bp, 805 aa] {ON} Anc_8....   194   1e-50
Kwal_26.8709 s26 (907885..910374) [2490 bp, 829 aa] {ON} YPL141C...   194   2e-50
ZYRO0F06842g Chr6 (561269..563800) [2532 bp, 843 aa] {ON} simila...   192   8e-50
KLTH0D10714g Chr4 (880389..883007) [2619 bp, 872 aa] {ON} simila...   192   1e-49
Kpol_1072.29 s1072 complement(61987..64668) [2682 bp, 893 aa] {O...   191   2e-49
TPHA0G01710 Chr7 complement(350452..352869) [2418 bp, 805 aa] {O...   190   3e-49
NDAI0E02320 Chr5 (480203..483001) [2799 bp, 932 aa] {ON}              191   3e-49
NCAS0C01590 Chr3 (293327..295921) [2595 bp, 864 aa] {ON} Anc_8.654    189   7e-49
TDEL0A06000 Chr1 (1053427..1055799) [2373 bp, 790 aa] {ON} Anc_8...   187   2e-48
SAKL0H07084g Chr8 complement(619288..622047) [2760 bp, 919 aa] {...   188   2e-48
NDAI0J01250 Chr10 complement(291314..294844) [3531 bp, 1176 aa] ...   189   2e-48
YPL141C Chr16 complement(283464..286061) [2598 bp, 865 aa] {ON} ...   186   8e-48
CAGL0M02519g Chr13 complement(290723..292993) [2271 bp, 756 aa] ...   184   1e-47
NDAI0B02070 Chr2 (514024..517800) [3777 bp, 1258 aa] {ON}             187   1e-47
Smik_6.339 Chr6 (538177..540774) [2598 bp, 865 aa] {ON} YPL141C ...   185   2e-47
Skud_16.140 Chr16 complement(255090..257687) [2598 bp, 865 aa] {...   185   2e-47
Suva_16.169 Chr16 complement(292738..295314) [2577 bp, 858 aa] {...   185   2e-47
CAGL0M02299g Chr13 (273725..276406) [2682 bp, 893 aa] {ON} simil...   183   1e-46
NCAS0B05090 Chr2 (946126..949758) [3633 bp, 1210 aa] {ON}             184   1e-46
NDAI0E01290 Chr5 complement(255593..257782) [2190 bp, 729 aa] {O...   181   1e-46
TBLA0C04600 Chr3 (1112043..1115990) [3948 bp, 1315 aa] {ON} Anc_...   184   2e-46
TPHA0D01140 Chr4 (238656..240524) [1869 bp, 622 aa] {ON} Anc_8.6...   179   2e-46
CAGL0M11396g Chr13 (1122109..1125687) [3579 bp, 1192 aa] {ON} si...   183   2e-46
Smik_4.367 Chr4 (655941..659141) [3201 bp, 1066 aa] {ON} YDR122W...   182   4e-46
KAFR0H02540 Chr8 complement(483399..485852) [2454 bp, 817 aa] {O...   180   5e-46
Skud_12.164 Chr12 (315700..319182) [3483 bp, 1160 aa] {ON} YLR09...   182   7e-46
CAGL0J03872g Chr10 (368472..370457) [1986 bp, 661 aa] {ON} simil...   178   7e-46
AGR058W Chr7 (823626..826841) [3216 bp, 1071 aa] {ON} Syntenic h...   181   8e-46
Smik_12.155 Chr12 (312480..315968) [3489 bp, 1162 aa] {ON} YLR09...   181   1e-45
TPHA0J00820 Chr10 (193408..197064) [3657 bp, 1218 aa] {ON} Anc_8...   181   1e-45
Suva_2.283 Chr2 (489490..492759) [3270 bp, 1089 aa] {ON} YDR122W...   181   1e-45
KNAG0G02110 Chr7 (477260..480838) [3579 bp, 1192 aa] {ON} Anc_8....   181   1e-45
KLTH0G13288g Chr7 complement(1139058..1142486) [3429 bp, 1142 aa...   181   2e-45
TDEL0F04060 Chr6 (749896..753276) [3381 bp, 1126 aa] {ON} Anc_8....   180   2e-45
SAKL0H16632g Chr8 complement(1461613..1464801) [3189 bp, 1062 aa...   180   2e-45
Kpol_1066.46 s1066 (82874..86551) [3678 bp, 1225 aa] {ON} (82874...   181   2e-45
Kpol_1012.6 s1012 (11581..13467) [1887 bp, 628 aa] {ON} (11581.....   176   2e-45
YLR096W Chr12 (332590..336033) [3444 bp, 1147 aa] {ON}  KIN2Seri...   180   3e-45
YDR122W Chr4 (694700..697894) [3195 bp, 1064 aa] {ON}  KIN1Serin...   179   4e-45
Smik_15.417 Chr15 (725513..727933) [2421 bp, 806 aa] {ON} YOR233...   177   5e-45
NCAS0B03740 Chr2 complement(668231..671380) [3150 bp, 1049 aa] {...   179   5e-45
Skud_4.383 Chr4 (666354..669551) [3198 bp, 1065 aa] {ON} YDR122W...   179   5e-45
Ecym_4291 Chr4 complement(620549..623986) [3438 bp, 1145 aa] {ON...   179   5e-45
NCAS0B01470 Chr2 (241003..243186) [2184 bp, 727 aa] {ON} Anc_8.654    176   6e-45
Suva_10.180 Chr10 (337364..340843) [3480 bp, 1159 aa] {ON} YLR09...   179   6e-45
TBLA0B03970 Chr2 complement(904167..907793) [3627 bp, 1208 aa] {...   178   1e-44
Skud_15.399 Chr15 (714789..717212) [2424 bp, 807 aa] {ON} YOR233...   176   1e-44
Ecym_8339 Chr8 (684113..686875) [2763 bp, 920 aa] {ON} similar t...   177   1e-44
KLLA0F19536g Chr6 (1808263..1811577) [3315 bp, 1104 aa] {ON} sim...   177   1e-44
KAFR0A03730 Chr1 (761946..764312) [2367 bp, 788 aa] {ON} Anc_8.6...   175   2e-44
Suva_8.284 Chr8 (514891..517317) [2427 bp, 808 aa] {ON} YOR233W ...   175   2e-44
KAFR0B02800 Chr2 (571295..574582) [3288 bp, 1095 aa] {ON} Anc_8....   177   2e-44
YOR233W Chr15 (775846..778248) [2403 bp, 800 aa] {ON}  KIN4Serin...   174   5e-44
ZYRO0F07194g Chr6 complement(581438..584254) [2817 bp, 938 aa] {...   175   6e-44
NCAS0C01670 Chr3 complement(306682..309372) [2691 bp, 896 aa] {O...   174   8e-44
KNAG0A03040 Chr1 complement(372150..374084) [1935 bp, 644 aa] {O...   171   1e-43
SAKL0H06754g Chr8 (594995..597649) [2655 bp, 884 aa] {ON} simila...   173   2e-43
CAGL0B01925g Chr2 (176316..179150) [2835 bp, 944 aa] {ON} simila...   173   2e-43
NDAI0E02390 Chr5 complement(496256..498907) [2652 bp, 883 aa] {O...   172   3e-43
ACR119W Chr3 (560761..563556) [2796 bp, 931 aa] {ON} Syntenic ho...   172   4e-43
TBLA0C01750 Chr3 (412762..415707) [2946 bp, 981 aa] {ON} Anc_8.6...   172   5e-43
ZYRO0D06776g Chr4 complement(583027..586641) [3615 bp, 1204 aa] ...   171   1e-42
KLLA0D07348g Chr4 (626999..629728) [2730 bp, 909 aa] {ON} simila...   170   2e-42
Kpol_1072.19 s1072 (44906..47596) [2691 bp, 896 aa] {ON} (44906....   167   1e-41
Ecym_2405 Chr2 (788655..791222) [2568 bp, 855 aa] {ON} similar t...   167   1e-41
ACR133C Chr3 complement(581468..584023) [2556 bp, 851 aa] {ON} S...   166   3e-41
KLTH0D11044g Chr4 complement(901388..903937) [2550 bp, 849 aa] {...   165   4e-41
TBLA0B03860 Chr2 (887855..890821) [2967 bp, 988 aa] {ON} Anc_8.6...   165   9e-41
Kwal_26.8751 s26 complement(928853..931399) [2547 bp, 848 aa] {O...   164   1e-40
KLLA0F11319g Chr6 (1042436..1044967) [2532 bp, 843 aa] {ON} simi...   162   4e-40
KNAG0J01670 Chr10 complement(304021..307050) [3030 bp, 1009 aa] ...   162   5e-40
TDEL0A06140 Chr1 complement(1074016..1076601) [2586 bp, 861 aa] ...   162   6e-40
TPHA0G01630 Chr7 (336511..339126) [2616 bp, 871 aa] {ON} Anc_8.6...   161   8e-40
KNAG0H03140 Chr8 complement(589553..592363) [2811 bp, 936 aa] {O...   160   2e-39
KNAG0D01090 Chr4 complement(183319..184437) [1119 bp, 372 aa] {O...   152   2e-39
KNAG0I01480 Chr9 (287733..289055) [1323 bp, 440 aa] {ON} Anc_1.3...   154   2e-39
Skud_16.132 Chr16 (239797..242571) [2775 bp, 924 aa] {ON} YPL150...   160   3e-39
NDAI0G05300 Chr7 (1289208..1290521) [1314 bp, 437 aa] {ON} Anc_1...   153   5e-39
YPL150W Chr16 (268188..270893) [2706 bp, 901 aa] {ON} Protein ki...   157   1e-38
CAGL0F04741g Chr6 (478256..479584) [1329 bp, 442 aa] {ON} simila...   150   3e-38
Ecym_1275 Chr1 complement(560481..561836) [1356 bp, 451 aa] {ON}...   150   4e-38
Smik_6.347 Chr6 complement(553316..556069) [2754 bp, 917 aa] {ON...   156   4e-38
TDEL0B06320 Chr2 (1118534..1119868) [1335 bp, 444 aa] {ON} Anc_1...   150   5e-38
Suva_16.160 Chr16 (277393..280149) [2757 bp, 918 aa] {ON} YPL150...   154   1e-37
YFR014C Chr6 complement(172537..173877) [1341 bp, 446 aa] {ON}  ...   148   2e-37
SAKL0D07656g Chr4 complement(627469..628767) [1299 bp, 432 aa] {...   147   3e-37
NCAS0A08880 Chr1 (1756271..1757539) [1269 bp, 422 aa] {ON} Anc_1...   147   3e-37
Smik_6.350 Chr6 (559997..562465) [2469 bp, 822 aa] {ON} YPL153C ...   153   3e-37
AAR009W Chr1 (358947..360308) [1362 bp, 453 aa] {ON} Syntenic ho...   148   3e-37
CAGL0L07326g Chr12 (810529..812049) [1521 bp, 506 aa] {ON} simil...   149   3e-37
Kwal_0.96 s0 complement(46082..47365) [1284 bp, 427 aa] {ON} YOL...   147   4e-37
TPHA0O01120 Chr15 complement(217462..218751) [1290 bp, 429 aa] {...   145   1e-36
Smik_7.319 Chr7 complement(534132..535472) [1341 bp, 446 aa] {ON...   145   2e-36
KLTH0H11396g Chr8 complement(973355..974668) [1314 bp, 437 aa] {...   145   2e-36
YPL153C Chr16 complement(261727..264192) [2466 bp, 821 aa] {ON} ...   150   2e-36
Kpol_1069.13 s1069 complement(27223..28506) [1284 bp, 427 aa] {O...   145   2e-36
KAFR0C04480 Chr3 (894906..896213) [1308 bp, 435 aa] {ON} Anc_1.3...   145   2e-36
Skud_16.129 Chr16 complement(233341..235824) [2484 bp, 827 aa] {...   150   3e-36
CAGL0K10604g Chr11 complement(1030055..1031395) [1341 bp, 446 aa...   145   3e-36
NCAS0D00630 Chr4 complement(107310..108593) [1284 bp, 427 aa] {O...   144   3e-36
Suva_16.157 Chr16 complement(270891..273389) [2499 bp, 832 aa] {...   150   3e-36
Suva_6.78 Chr6 (135988..137325) [1338 bp, 445 aa] {ON} YFR014C (...   143   1e-35
TBLA0D05010 Chr4 complement(1234934..1236238) [1305 bp, 434 aa] ...   142   1e-35
TBLA0A02050 Chr1 (495735..497039) [1305 bp, 434 aa] {ON}              142   1e-35
Skud_6.89 Chr6 (166257..167594) [1338 bp, 446 aa] {ON} YFR014C (...   142   2e-35
KAFR0H02510 Chr8 complement(476574..479213) [2640 bp, 879 aa] {O...   147   2e-35
Kpol_1065.3 s1065 complement(4445..5575) [1131 bp, 376 aa] {ON} ...   140   2e-35
NDAI0H03520 Chr8 (860096..861472) [1377 bp, 458 aa] {ON}              141   5e-35
ZYRO0E05588g Chr5 (430271..431686) [1416 bp, 471 aa] {ON} simila...   142   5e-35
Suva_4.145 Chr4 complement(268826..270370) [1545 bp, 514 aa] {ON...   142   6e-35
Skud_15.144 Chr15 complement(254620..255969) [1350 bp, 449 aa] {...   141   6e-35
YDL101C Chr4 complement(280307..281848) [1542 bp, 513 aa] {ON}  ...   142   7e-35
KAFR0H02430 Chr8 complement(464446..466800) [2355 bp, 784 aa] {O...   144   1e-34
AFL188C Chr6 complement(88793..90211) [1419 bp, 472 aa] {ON} Syn...   140   1e-34
KLLA0F23155g Chr6 (2157146..2158429) [1284 bp, 427 aa] {ON} simi...   139   1e-34
CAGL0M02233g Chr13 complement(267332..269635) [2304 bp, 767 aa] ...   144   1e-34
Smik_4.135 Chr4 complement(256861..258402) [1542 bp, 513 aa] {ON...   141   1e-34
KAFR0I02010 Chr9 complement(411589..412887) [1299 bp, 432 aa] {O...   139   2e-34
Suva_15.155 Chr15 complement(267680..269038) [1359 bp, 452 aa] {...   139   2e-34
YOL016C Chr15 complement(294777..296120) [1344 bp, 447 aa] {ON} ...   139   2e-34
Kwal_56.23717 s56 complement(674222..676798) [2577 bp, 858 aa] {...   144   2e-34
KLLA0F11143g Chr6 complement(1026129..1028570) [2442 bp, 813 aa]...   143   4e-34
SAKL0E05984g Chr5 complement(485895..487391,487462..487482) [151...   139   6e-34
Smik_15.153 Chr15 complement(261920..263248) [1329 bp, 442 aa] {...   138   6e-34
NCAS0D02100 Chr4 (385878..388058) [2181 bp, 726 aa] {ON} Anc_6.31     141   8e-34
KAFR0K00280 Chr11 complement(64906..65988) [1083 bp, 360 aa] {ON...   135   1e-33
Skud_4.154 Chr4 complement(275783..277324) [1542 bp, 513 aa] {ON...   138   1e-33
SAKL0H06534g Chr8 complement(575439..577853) [2415 bp, 804 aa] {...   140   2e-33
Kwal_56.22476 s56 complement(145039..147132) [2094 bp, 697 aa] {...   140   2e-33
NDAI0F01600 Chr6 complement(392424..393662) [1239 bp, 412 aa] {O...   135   3e-33
Kwal_26.8796 s26 (946406..948796) [2391 bp, 796 aa] {ON} YPL153C...   140   3e-33
KLLA0E01585g Chr5 (149305..149370,149488..150960) [1539 bp, 512 ...   137   3e-33
TBLA0B00490 Chr2 complement(94755..97118) [2364 bp, 787 aa] {ON}...   140   3e-33
KLTH0C10912g Chr3 (898372..900465) [2094 bp, 697 aa] {ON} highly...   139   4e-33
NDAI0E02110 Chr5 complement(430989..433700) [2712 bp, 903 aa] {O...   140   4e-33
TDEL0A06220 Chr1 (1088622..1091006) [2385 bp, 794 aa] {ON} Anc_8...   140   4e-33
KLTH0D11242g Chr4 (918232..920619) [2388 bp, 795 aa] {ON} simila...   140   4e-33
TPHA0E02820 Chr5 complement(589816..590970) [1155 bp, 384 aa] {O...   134   5e-33
Ecym_5624 Chr5 (1256658..1258022) [1365 bp, 454 aa] {ON} similar...   135   5e-33
KAFR0K02450 Chr11 (504087..504131,504190..505680) [1536 bp, 511 ...   136   6e-33
Kpol_1004.19 s1004 (36090..36101,36217..37689) [1485 bp, 494 aa]...   136   6e-33
KNAG0J01700 Chr10 (309962..312424) [2463 bp, 820 aa] {ON}             139   7e-33
ACR142W Chr3 (597519..600032) [2514 bp, 837 aa] {ON} Syntenic ho...   138   1e-32
Kpol_1033.50 s1033 complement(126043..127197) [1155 bp, 384 aa] ...   132   1e-32
Kwal_56.24091 s56 (845680..846825) [1146 bp, 381 aa] {ON} YPL209...   132   2e-32
Skud_13.154 Chr13 complement(255263..257380) [2118 bp, 705 aa] {...   137   2e-32
NCAS0C01370 Chr3 complement(250693..253092) [2400 bp, 799 aa] {O...   137   2e-32
YMR001C Chr13 complement(269019..271136) [2118 bp, 705 aa] {ON} ...   137   2e-32
TBLA0A02030 Chr1 complement(491365..492576) [1212 bp, 403 aa] {O...   132   2e-32
Suva_13.163 Chr13 complement(259136..261253) [2118 bp, 705 aa] {...   136   3e-32
NCAS0B05910 Chr2 (1120092..1121645) [1554 bp, 517 aa] {ON} Anc_2...   134   3e-32
Kpol_1037.20 s1037 (41658..43772) [2115 bp, 704 aa] {ON} (41658....   136   4e-32
Kpol_1072.16 s1072 complement(37585..39972) [2388 bp, 795 aa] {O...   136   4e-32
Smik_13.159 Chr13 complement(260249..262366) [2118 bp, 705 aa] {...   136   4e-32
ACL006W Chr3 (344395..346521) [2127 bp, 708 aa] {ON} Syntenic ho...   136   4e-32
KAFR0B05410 Chr2 complement(1111152..1112771) [1620 bp, 539 aa] ...   134   4e-32
AFL101C Chr6 complement(249144..250247) [1104 bp, 367 aa] {ON} S...   130   5e-32
Suva_7.106 Chr7 (202969..204540) [1572 bp, 523 aa] {ON} YGL158W ...   134   5e-32
Ecym_3035 Chr3 complement(70391..72613) [2223 bp, 740 aa] {ON} s...   135   6e-32
TBLA0B07330 Chr2 complement(1745229..1746821,1746990..1747013) [...   134   6e-32
NCAS0B04490 Chr2 (814474..815523) [1050 bp, 349 aa] {ON} Anc_8.141    129   7e-32
Skud_10.50 Chr10 complement(84697..85890) [1194 bp, 397 aa] {ON}...   130   7e-32
Kwal_56.24059 s56 complement(829673..830734) [1062 bp, 353 aa] {...   129   8e-32
KNAG0E00850 Chr5 complement(158992..161127) [2136 bp, 711 aa] {O...   135   8e-32
TBLA0B03840 Chr2 complement(881914..884490) [2577 bp, 858 aa] {O...   135   9e-32
SAKL0E01584g Chr5 complement(121830..123917) [2088 bp, 695 aa] {...   134   1e-31
KLTH0H04180g Chr8 (381111..382172) [1062 bp, 353 aa] {ON} highly...   129   1e-31
CAGL0E05720g Chr5 (569265..570341) [1077 bp, 358 aa] {ON} simila...   129   1e-31
YJL164C Chr10 complement(109966..111159) [1194 bp, 397 aa] {ON} ...   130   1e-31
TPHA0J00420 Chr10 complement(96445..98568) [2124 bp, 707 aa] {ON...   134   1e-31
TPHA0G01600 Chr7 complement(329313..331850) [2538 bp, 845 aa] {O...   135   2e-31
Ecym_2397 Chr2 complement(771343..773961) [2619 bp, 872 aa] {ON}...   135   2e-31
KLTH0H03982g Chr8 complement(363432..364628) [1197 bp, 398 aa] {...   129   2e-31
SAKL0C05368g Chr3 complement(510576..511832) [1257 bp, 418 aa] {...   130   2e-31
CAGL0J11638g Chr10 complement(1130744..1132984) [2241 bp, 746 aa...   134   2e-31
ZYRO0A07546g Chr1 complement(619278..620747,620833..620847) [148...   131   2e-31
Smik_10.66 Chr10 complement(108043..109236) [1194 bp, 397 aa] {O...   129   2e-31
KNAG0A05670 Chr1 complement(847460..849016) [1557 bp, 518 aa] {O...   131   3e-31
KAFR0K00330 Chr11 (74162..75283) [1122 bp, 373 aa] {ON} Anc_6.21...   128   3e-31
NDAI0A00960 Chr1 complement(197205..198431) [1227 bp, 408 aa] {O...   129   4e-31
Suva_6.245 Chr6 (438131..439315) [1185 bp, 394 aa] {ON} YJL164C ...   129   4e-31
KLLA0C06138g Chr3 (540409..542535) [2127 bp, 708 aa] {ON} simila...   133   4e-31
TDEL0G02820 Chr7 complement(543911..545377,545450..545476) [1494...   130   5e-31
ZYRO0F07370g Chr6 (595931..598219) [2289 bp, 762 aa] {ON} simila...   133   5e-31
SAKL0A04466g Chr1 (413816..414937) [1122 bp, 373 aa] {ON} highly...   127   6e-31
TDEL0G04380 Chr7 (792278..794446) [2169 bp, 722 aa] {ON} Anc_6.3...   132   6e-31
ZYRO0E07018g Chr5 (531316..532419) [1104 bp, 367 aa] {ON} simila...   127   6e-31
CAGL0G09020g Chr7 (860266..861351) [1086 bp, 361 aa] {ON} highly...   127   6e-31
NDAI0C02680 Chr3 complement(621951..624203) [2253 bp, 750 aa] {O...   132   6e-31
KNAG0C02080 Chr3 complement(404332..405588) [1257 bp, 418 aa] {O...   128   7e-31
Ecym_2194 Chr2 complement(381633..382733) [1101 bp, 366 aa] {ON}...   127   8e-31
TPHA0E02840 Chr5 (594381..595589) [1209 bp, 402 aa] {ON} Anc_6.2...   127   9e-31
KAFR0F01800 Chr6 complement(350480..351754) [1275 bp, 424 aa] {O...   128   9e-31
NDAI0B03190 Chr2 complement(815759..817309) [1551 bp, 516 aa] {O...   129   9e-31
NCAS0A01100 Chr1 (218400..219464) [1065 bp, 354 aa] {ON}              126   1e-30
KLLA0B02332g Chr2 complement(206863..207948) [1086 bp, 361 aa] {...   126   1e-30
KAFR0G02690 Chr7 complement(555573..557714) [2142 bp, 713 aa] {O...   131   1e-30
KLLA0B07205g Chr2 complement(624606..625973) [1368 bp, 455 aa] {...   128   2e-30
ZYRO0C07480g Chr3 (565426..567750) [2325 bp, 774 aa] {ON} highly...   131   2e-30
KNAG0C01820 Chr3 (355604..357376) [1773 bp, 590 aa] {ON}              130   2e-30
YPL203W Chr16 (166256..167398) [1143 bp, 380 aa] {ON}  TPK2cAMP-...   126   2e-30
Skud_16.76 Chr16 (139571..140719) [1149 bp, 382 aa] {ON} YPL203W...   126   2e-30
Kwal_47.17263 s47 complement(321115..324498) [3384 bp, 1127 aa] ...   132   2e-30
Kwal_33.13846 s33 complement(419630..420757) [1128 bp, 375 aa] {...   126   2e-30
Smik_6.408 Chr6 complement(657018..658163) [1146 bp, 381 aa] {ON...   126   2e-30
KNAG0D01140 Chr4 (192308..193495) [1188 bp, 395 aa] {ON}              126   3e-30
TDEL0D03950 Chr4 (720229..721710) [1482 bp, 493 aa] {ON} Anc_3.2...   127   3e-30
CAGL0I09504g Chr9 (909589..911175) [1587 bp, 528 aa] {ON} simila...   128   3e-30
Smik_7.115 Chr7 (201140..202663) [1524 bp, 507 aa] {ON} YGL158W ...   127   4e-30
NCAS0B08280 Chr2 (1579804..1581033) [1230 bp, 409 aa] {ON} Anc_1...   126   4e-30
Suva_16.104 Chr16 (176201..177352) [1152 bp, 383 aa] {ON} YPL203...   125   4e-30
KNAG0J01290 Chr10 complement(230493..232019) [1527 bp, 508 aa] {...   127   4e-30
Skud_7.92 Chr7 complement(169006..170697) [1692 bp, 563 aa] {ON}...   128   4e-30
Ecym_2203 Chr2 (401590..402648) [1059 bp, 352 aa] {ON} similar t...   124   5e-30
Suva_7.83 Chr7 complement(159329..161038) [1710 bp, 569 aa] {ON}...   128   6e-30
Suva_11.56 Chr11 complement(119479..120675) [1197 bp, 398 aa] {O...   125   6e-30
Kpol_1023.26 s1023 (51805..54024) [2220 bp, 739 aa] {ON} (51805....   129   6e-30
TPHA0C04570 Chr3 (985491..987071) [1581 bp, 526 aa] {ON} Anc_2.3...   127   7e-30
KNAG0C02440 Chr3 complement(475652..476857) [1206 bp, 401 aa] {O...   125   7e-30
SAKL0A04246g Chr1 complement(396019..397221) [1203 bp, 400 aa] {...   125   7e-30
NCAS0C04120 Chr3 complement(840008..842755) [2748 bp, 915 aa] {O...   130   8e-30
KLTH0F09988g Chr6 complement(868693..869931) [1239 bp, 412 aa] {...   125   1e-29
ZYRO0A03894g Chr1 (307915..309273) [1359 bp, 452 aa] {ON} simila...   125   1e-29
TDEL0E05310 Chr5 (972769..973893) [1125 bp, 374 aa] {ON} Anc_6.2...   124   1e-29
NDAI0F01650 Chr6 (403635..404738) [1104 bp, 367 aa] {ON} Anc_6.214    124   1e-29
KLTH0F04840g Chr6 complement(427194..428339) [1146 bp, 381 aa] {...   124   1e-29
YGL158W Chr7 (207033..208571) [1539 bp, 512 aa] {ON}  RCK1Protei...   126   1e-29
TPHA0F02430 Chr6 complement(535865..538261) [2397 bp, 798 aa] {O...   128   1e-29
NDAI0B04700 Chr2 complement(1164332..1165918) [1587 bp, 528 aa] ...   126   1e-29
TPHA0A04170 Chr1 (937692..939233) [1542 bp, 513 aa] {ON} Anc_3.2...   126   2e-29
KLLA0D03190g Chr4 (267933..269051) [1119 bp, 372 aa] {ON} highly...   123   2e-29
KLLA0D09328g Chr4 complement(788565..791705) [3141 bp, 1046 aa] ...   129   2e-29
Smik_6.414 Chr6 (666806..667909) [1104 bp, 367 aa] {ON} YPL209C ...   123   2e-29
Skud_11.58 Chr11 complement(120855..122042) [1188 bp, 395 aa] {O...   124   2e-29
TDEL0E05220 Chr5 complement(957515..958597) [1083 bp, 360 aa] {O...   122   2e-29
KAFR0E01040 Chr5 complement(214744..216252) [1509 bp, 502 aa] {O...   125   2e-29
Kpol_2002.75 s2002 complement(168123..169394) [1272 bp, 423 aa] ...   124   2e-29
TDEL0C03710 Chr3 (653934..655169) [1236 bp, 411 aa] {ON} Anc_1.1...   123   3e-29
KNAG0C01060 Chr3 complement(205965..207374) [1410 bp, 469 aa] {O...   124   3e-29
Kpol_1054.2 s1054 complement(4365..7655) [3291 bp, 1096 aa] {ON}...   128   3e-29
NCAS0A10290 Chr1 complement(2051582..2053111) [1530 bp, 509 aa] ...   125   4e-29
CAGL0M08404g Chr13 complement(836791..838179) [1389 bp, 462 aa] ...   124   4e-29
AFL090W Chr6 (274336..275376) [1041 bp, 346 aa] {ON} Syntenic ho...   121   5e-29
Suva_16.97 Chr16 complement(165977..167083) [1107 bp, 368 aa] {O...   122   5e-29
YPL209C Chr16 complement(156490..157593) [1104 bp, 367 aa] {ON} ...   121   6e-29
SAKL0A01254g Chr1 (119884..124560) [4677 bp, 1558 aa] {ON} simil...   127   6e-29
YKL166C Chr11 complement(134509..135705) [1197 bp, 398 aa] {ON} ...   122   7e-29
NDAI0B00210 Chr2 (27983..29185) [1203 bp, 400 aa] {ON} Anc_1.182      122   7e-29
KLLA0C12485g Chr3 (1060167..1062944) [2778 bp, 925 aa] {ON} simi...   126   7e-29
Kwal_23.3590 s23 complement(353755..355254) [1500 bp, 499 aa] {O...   123   9e-29
KLTH0A06776g Chr1 complement(562932..567503) [4572 bp, 1523 aa] ...   127   9e-29
Smik_11.62 Chr11 complement(120153..121346) [1194 bp, 397 aa] {O...   121   9e-29
KAFR0G00480 Chr7 complement(131066..132268) [1203 bp, 400 aa] {O...   121   1e-28
Skud_16.70 Chr16 complement(129918..131021) [1104 bp, 367 aa] {O...   120   1e-28
TBLA0C05830 Chr3 complement(1408930..1410210) [1281 bp, 426 aa] ...   121   1e-28
ZYRO0G18502g Chr7 (1528075..1529265) [1191 bp, 396 aa] {ON} simi...   120   2e-28
Suva_15.65 Chr15 (102271..105513) [3243 bp, 1080 aa] {ON} YOL100...   125   2e-28
Smik_3.173 Chr3 complement(242285..246307) [4023 bp, 1340 aa] {O...   126   2e-28
ZYRO0G08844g Chr7 complement(711678..712766) [1089 bp, 362 aa] {...   120   2e-28
TDEL0D05320 Chr4 complement(965082..968255) [3174 bp, 1057 aa] {...   125   2e-28
YOL100W Chr15 (129237..132482) [3246 bp, 1081 aa] {ON}  PKH2Seri...   125   2e-28
Skud_2.141 Chr2 complement(264097..265677) [1581 bp, 526 aa] {ON...   122   3e-28
KAFR0C04280 Chr3 (848308..849912) [1605 bp, 534 aa] {ON} Anc_1.3...   122   3e-28
Skud_7.114 Chr7 (211645..213153) [1509 bp, 502 aa] {ON} YGL158W ...   122   3e-28
NCAS0I02840 Chr9 (528136..529344) [1209 bp, 402 aa] {ON} Anc_1.2...   120   3e-28
KLLA0F24618g Chr6 complement(2288943..2290613) [1671 bp, 556 aa]...   122   3e-28
Kpol_1033.55 s1033 (138831..140555,140557..140895) [2064 bp, 687...   123   4e-28
Kwal_23.6325 s23 complement(1533223..1537851) [4629 bp, 1542 aa]...   125   4e-28
KLTH0D06006g Chr4 complement(532589..535453) [2865 bp, 954 aa] {...   124   4e-28
CAGL0B04301g Chr2 (420544..422172) [1629 bp, 542 aa] {ON} simila...   122   4e-28
Smik_15.57 Chr15 (92331..95576) [3246 bp, 1081 aa] {ON} YOL100W ...   124   4e-28
KAFR0I02440 Chr9 complement(493668..495128) [1461 bp, 486 aa] {O...   121   5e-28
Skud_3.146 Chr3 complement(227229..231233) [4005 bp, 1334 aa] {O...   124   7e-28
KLTH0E06776g Chr5 complement(622147..625575) [3429 bp, 1142 aa] ...   123   8e-28
TPHA0E03300 Chr5 (703575..704912) [1338 bp, 445 aa] {ON} Anc_1.1...   119   9e-28
NDAI0G03470 Chr7 complement(829975..832455) [2481 bp, 826 aa] {O...   123   9e-28
Kwal_56.22788 s56 complement(281404..282951) [1548 bp, 515 aa] {...   120   9e-28
TPHA0B03850 Chr2 (909219..910841) [1623 bp, 540 aa] {ON} Anc_1.4...   120   1e-27
KAFR0D01220 Chr4 (246927..250094) [3168 bp, 1055 aa] {ON} Anc_7....   123   1e-27
Kpol_1018.162 s1018 (414868..416904) [2037 bp, 678 aa] {ON} (414...   121   1e-27
Skud_15.54 Chr15 (88576..91824) [3249 bp, 1082 aa] {ON} YOL100W ...   122   1e-27
NCAS0C04940 Chr3 (1006185..1009535) [3351 bp, 1116 aa] {ON} Anc_...   122   2e-27
TBLA0C00720 Chr3 (149299..151149) [1851 bp, 616 aa] {ON} Anc_1.4...   120   2e-27
NDAI0K01370 Chr11 (313672..315714) [2043 bp, 680 aa] {ON}             121   2e-27
SAKL0E03608g Chr5 complement(291806..294007) [2202 bp, 733 aa] {...   121   2e-27
Suva_11.99 Chr11 (192143..194197) [2055 bp, 684 aa] {ON} YMR104C...   121   2e-27
TPHA0O01400 Chr15 complement(277678..279258) [1581 bp, 526 aa] {...   119   2e-27
SAKL0H24706g Chr8 (2145552..2149100) [3549 bp, 1182 aa] {ON} sim...   122   2e-27
CAGL0I07513g Chr9 (722045..725275) [3231 bp, 1076 aa] {ON} simil...   122   2e-27
NDAI0K02100 Chr11 complement(469575..472304) [2730 bp, 909 aa] {...   121   3e-27
TDEL0A02220 Chr1 (402496..404565) [2070 bp, 689 aa] {ON} Anc_2.4...   120   3e-27
KAFR0I02100 Chr9 (431876..433258) [1383 bp, 460 aa] {ON} Anc_1.3...   118   3e-27
ABL028W Chr2 (345953..348121) [2169 bp, 722 aa] {ON} Syntenic ho...   120   3e-27
TBLA0B08250 Chr2 complement(1968879..1972922) [4044 bp, 1347 aa]...   122   3e-27
YKL126W Chr11 (205707..207749) [2043 bp, 680 aa] {ON}  YPK1Serin...   120   4e-27
Smik_7.93 Chr7 complement(158441..160132) [1692 bp, 563 aa] {ON}...   119   4e-27
Kwal_26.7861 s26 complement(544126..546993) [2868 bp, 955 aa] {O...   121   4e-27
Ecym_8399 Chr8 (821221..824766) [3546 bp, 1181 aa] {ON} similar ...   121   4e-27
Ecym_8095 Chr8 (205952..207106) [1155 bp, 384 aa] {ON} similar t...   116   4e-27
NCAS0C03690 Chr3 (741930..744881) [2952 bp, 983 aa] {ON}              120   5e-27
ZYRO0G02530g Chr7 (194463..196577) [2115 bp, 704 aa] {ON} highly...   120   6e-27
Kpol_1037.52 s1037 complement(128841..130379) [1539 bp, 512 aa] ...   118   6e-27
Kpol_1018.54 s1018 (163688..166192) [2505 bp, 834 aa] {ON} (1636...   120   6e-27
Skud_11.103 Chr11 (192587..194629) [2043 bp, 680 aa] {ON} YMR104...   119   6e-27
Smik_11.113 Chr11 (191688..193730) [2043 bp, 680 aa] {ON} YMR104...   119   6e-27
NDAI0A07190 Chr1 (1636773..1638380) [1608 bp, 535 aa] {ON} Anc_3...   118   6e-27
NCAS0B07380 Chr2 complement(1396315..1397898) [1584 bp, 527 aa] ...   118   7e-27
TPHA0G02910 Chr7 (624676..626727) [2052 bp, 683 aa] {ON} Anc_2.4...   119   7e-27
KLLA0B12716g Chr2 (1109939..1112089) [2151 bp, 716 aa] {ON} simi...   119   7e-27
TBLA0I02400 Chr9 complement(548975..554167) [5193 bp, 1730 aa] {...   120   8e-27
TDEL0F00930 Chr6 complement(160181..163573) [3393 bp, 1130 aa] {...   120   8e-27
ZYRO0B09196g Chr2 complement(721019..722569) [1551 bp, 516 aa] {...   117   8e-27
AER264C Chr5 complement(1120017..1124468) [4452 bp, 1483 aa] {ON...   120   8e-27
Smik_2.417 Chr2 (735214..736797) [1584 bp, 527 aa] {ON} YBR274W ...   117   9e-27
TPHA0P01050 Chr16 complement(212259..215624) [3366 bp, 1121 aa] ...   120   1e-26
SAKL0D06534g Chr4 complement(538606..540091,540155..540237) [156...   117   1e-26
KAFR0A01760 Chr1 complement(363462..366119) [2658 bp, 885 aa] {O...   119   1e-26
TBLA0I01370 Chr9 complement(294202..296526) [2325 bp, 774 aa] {O...   119   1e-26
AEL115C Chr5 complement(405062..406222) [1161 bp, 386 aa] {ON} S...   115   1e-26
TPHA0G03290 Chr7 (702953..705874) [2922 bp, 973 aa] {ON} Anc_2.4...   119   1e-26
TPHA0D02740 Chr4 (566279..568819) [2541 bp, 846 aa] {ON} Anc_5.5...   119   1e-26
NCAS0A04360 Chr1 (880768..882822) [2055 bp, 684 aa] {ON} Anc_2.446    118   1e-26
NDAI0H02340 Chr8 complement(568767..570887) [2121 bp, 706 aa] {O...   119   1e-26
AEL083W Chr5 (470964..472574) [1611 bp, 536 aa] {ON} Syntenic ho...   117   1e-26
CAGL0F00913g Chr6 (97023..100643) [3621 bp, 1206 aa] {ON} simila...   119   2e-26
CAGL0B03509g Chr2 complement(349638..351431) [1794 bp, 597 aa] {...   117   2e-26
ZYRO0B01166g Chr2 complement(97168..100059) [2892 bp, 963 aa] {O...   119   2e-26
Kwal_56.22693 s56 complement(239982..242936) [2955 bp, 984 aa] {...   119   2e-26
TBLA0I01800 Chr9 complement(401728..403617) [1890 bp, 629 aa] {O...   117   2e-26
KNAG0D00390 Chr4 (53459..58429) [4971 bp, 1656 aa] {ON} Anc_6.34...   119   2e-26
CAGL0F00649g Chr6 (71961..73505) [1545 bp, 514 aa] {ON} similar ...   116   2e-26
Smik_4.767 Chr4 complement(1353354..1355630) [2277 bp, 758 aa] {...   118   3e-26
KLTH0C08932g Chr3 (749308..750867) [1560 bp, 519 aa] {ON} simila...   116   3e-26
YDR490C Chr4 complement(1431968..1434268) [2301 bp, 766 aa] {ON}...   118   3e-26
Suva_2.666 Chr2 complement(1183839..1186133) [2295 bp, 764 aa] {...   117   3e-26
TBLA0E02290 Chr5 complement(563483..567385) [3903 bp, 1300 aa] {...   118   4e-26
CAGL0K02673g Chr11 complement(241338..244085) [2748 bp, 915 aa] ...   118   4e-26
YBR274W Chr2 (749594..751177) [1584 bp, 527 aa] {ON}  CHK1Serine...   115   4e-26
Suva_14.402 Chr14 (690198..692915) [2718 bp, 905 aa] {ON} YNR047...   117   4e-26
TDEL0D04460 Chr4 complement(813075..815816) [2742 bp, 913 aa] {O...   117   4e-26
TPHA0C00160 Chr3 complement(17339..19603) [2265 bp, 754 aa] {ON}...   117   4e-26
NDAI0G04290 Chr7 complement(1030530..1033871) [3342 bp, 1113 aa]...   117   5e-26
Kpol_541.49 s541 complement(156530..159514) [2985 bp, 994 aa] {O...   117   5e-26
KAFR0B02140 Chr2 (417972..420662) [2691 bp, 896 aa] {ON} Anc_8.1...   117   5e-26
TPHA0H02630 Chr8 complement(614048..618151) [4104 bp, 1367 aa] {...   118   5e-26
Suva_3.110 Chr3 complement(160016..164146) [4131 bp, 1376 aa] {O...   118   5e-26
Smik_14.377 Chr14 (666338..669025) [2688 bp, 895 aa] {ON} YNR047...   117   6e-26
KLTH0C09548g Chr3 (792218..795199) [2982 bp, 993 aa] {ON} simila...   117   6e-26
YMR104C Chr13 complement(473420..475453) [2034 bp, 677 aa] {ON} ...   116   7e-26
TDEL0D02040 Chr4 (395555..397138) [1584 bp, 527 aa] {ON} Anc_1.3...   115   7e-26
Skud_3.165 Chr3 (258916..261066) [2151 bp, 716 aa] {ON} YCR091W ...   116   7e-26
YNR047W Chr14 (708523..711204) [2682 bp, 893 aa] {ON}  FPK1Ser/T...   117   7e-26
NCAS0F01460 Chr6 complement(290441..292465) [2025 bp, 674 aa] {O...   116   7e-26
CAGL0K07458g Chr11 complement(737165..739279) [2115 bp, 704 aa] ...   116   7e-26
CAGL0K03399g Chr11 complement(311316..313427) [2112 bp, 703 aa] ...   116   7e-26
SAKL0D08294g Chr4 (692455..693966) [1512 bp, 503 aa] {ON} some s...   114   8e-26
ZYRO0A05214g Chr1 complement(418443..421268) [2826 bp, 941 aa] {...   117   8e-26
TPHA0O01030 Chr15 complement(191875..193890) [2016 bp, 671 aa] {...   115   9e-26
KLLA0E03587g Chr5 complement(323764..325707) [1944 bp, 647 aa] {...   115   9e-26
KAFR0J02620 Chr10 complement(502187..504265) [2079 bp, 692 aa] {...   116   9e-26
KAFR0D03020 Chr4 (596365..598398) [2034 bp, 677 aa] {ON} Anc_2.4...   115   1e-25
KNAG0I01360 Chr9 complement(262712..264556) [1845 bp, 614 aa] {O...   115   1e-25
CAGL0C05005g Chr3 complement(467626..470856) [3231 bp, 1076 aa] ...   116   1e-25
Skud_14.379 Chr14 (677081..679774) [2694 bp, 897 aa] {ON} YNR047...   116   1e-25
KAFR0C01440 Chr3 complement(295468..298755) [3288 bp, 1095 aa] {...   116   1e-25
KLTH0H10318g Chr8 complement(888661..890128,890228..890316) [155...   114   1e-25
Ecym_3586 Chr3 complement(1112070..1115303) [3234 bp, 1077 aa] {...   116   1e-25
Kpol_265.1 s265 (4826..7099) [2274 bp, 757 aa] {ON} (4826..7099)...   115   2e-25
Suva_2.157 Chr2 complement(275484..277064) [1581 bp, 526 aa] {ON...   114   2e-25
KLLA0F07623g Chr6 (720246..723935) [3690 bp, 1229 aa] {ON} simil...   116   2e-25
Kwal_26.7635 s26 (451306..453381) [2076 bp, 691 aa] {ON} YKL126W...   115   2e-25
Ecym_2499 Chr2 complement(976395..981020) [4626 bp, 1541 aa] {ON...   116   2e-25
KLTH0D04818g Chr4 (439491..441566) [2076 bp, 691 aa] {ON} simila...   115   2e-25
SAKL0B12364g Chr2 (1060853..1063021) [2169 bp, 722 aa] {ON} high...   115   2e-25
KLLA0C08525g Chr3 (744554..749209) [4656 bp, 1551 aa] {ON} simil...   116   2e-25
Smik_13.290 Chr13 complement(457921..459951) [2031 bp, 676 aa] {...   114   2e-25
NCAS0J00960 Chr10 (157010..159121) [2112 bp, 703 aa] {ON}             115   2e-25
Skud_2.406 Chr2 (718522..720105) [1584 bp, 527 aa] {ON} YBR274W ...   113   2e-25
Skud_4.764 Chr4 complement(1351725..1353995) [2271 bp, 756 aa] {...   115   2e-25
KAFR0B06980 Chr2 (1452754..1455081) [2328 bp, 775 aa] {ON} Anc_4...   115   2e-25
YCR073C Chr3 complement(242588..246583) [3996 bp, 1331 aa] {ON} ...   115   3e-25
Smik_7.92 Chr7 (155049..157742) [2694 bp, 897 aa] {ON} YGL180W (...   115   3e-25
NCAS0A05050 Chr1 complement(1002107..1004788) [2682 bp, 893 aa] ...   115   3e-25
KLLA0F01276g Chr6 complement(120001..121560) [1560 bp, 519 aa] {...   113   3e-25
ZYRO0B06512g Chr2 complement(521075..524410) [3336 bp, 1111 aa] ...   115   3e-25
NDAI0H02470 Chr8 complement(597707..601942) [4236 bp, 1411 aa] {...   115   3e-25
CAGL0L06006g Chr12 complement(672704..675532) [2829 bp, 942 aa] ...   115   3e-25
TBLA0I00280 Chr9 (42870..46820) [3951 bp, 1316 aa] {ON} Anc_2.49...   115   3e-25
TDEL0H03640 Chr8 complement(600211..603924) [3714 bp, 1237 aa] {...   115   3e-25
Kwal_0.155 s0 (84856..86619) [1764 bp, 587 aa] {ON} YLR248W (RCK...   113   3e-25
Ecym_3547 Chr3 complement(1034494..1036107) [1614 bp, 537 aa] {O...   113   3e-25
Suva_13.281 Chr13 complement(455094..457136) [2043 bp, 680 aa] {...   114   4e-25
KNAG0K00680 Chr11 (120919..124206) [3288 bp, 1095 aa] {ON} Anc_3...   115   4e-25
Kpol_1028.40 s1028 (95617..100392) [4776 bp, 1591 aa] {ON} (9561...   115   4e-25
KNAG0E01390 Chr5 (275055..276776) [1722 bp, 573 aa] {ON} Anc_1.4...   113   4e-25
ZYRO0G00506g Chr7 complement(38488..40854) [2367 bp, 788 aa] {ON...   114   4e-25
KNAG0I02830 Chr9 (549811..554358) [4548 bp, 1515 aa] {ON} Anc_1....   115   4e-25
TDEL0A07860 Chr1 (1365985..1368498) [2514 bp, 837 aa] {ON} Anc_6...   114   5e-25
TPHA0H00410 Chr8 (79426..82197) [2772 bp, 923 aa] {ON} Anc_8.141...   114   5e-25
KNAG0M00190 Chr13 complement(25224..27602) [2379 bp, 792 aa] {ON...   114   5e-25
KLLA0C04191g Chr3 (384198..386591) [2394 bp, 797 aa] {ON} weakly...   114   5e-25
TPHA0M01840 Chr13 complement(380953..385818) [4866 bp, 1621 aa] ...   114   5e-25
NDAI0D04110 Chr4 (966439..967560) [1122 bp, 373 aa] {ON} Anc_4.192    109   6e-25
ZYRO0G19052g Chr7 (1576638..1580033) [3396 bp, 1131 aa] {ON} sim...   114   6e-25
YLR248W Chr12 (634252..636084) [1833 bp, 610 aa] {ON}  RCK2Prote...   112   6e-25
NCAS0F01580 Chr6 complement(313801..317949) [4149 bp, 1382 aa] {...   114   7e-25
AFR377C Chr6 complement(1116589..1118769) [2181 bp, 726 aa] {ON}...   113   7e-25
Suva_7.82 Chr7 (156049..158751) [2703 bp, 900 aa] {ON} YGL180W (...   114   7e-25
Smik_12.321 Chr12 (579087..580919) [1833 bp, 610 aa] {ON} YLR248...   112   7e-25
TBLA0D04420 Chr4 complement(1097314..1099356) [2043 bp, 680 aa] ...   113   7e-25
KLTH0D17204g Chr4 complement(1426818..1429085) [2268 bp, 755 aa]...   113   8e-25
KNAG0D04810 Chr4 (867817..872139) [4323 bp, 1440 aa] {ON} Anc_7....   114   8e-25
Kpol_1037.6 s1037 (12601..15534) [2934 bp, 977 aa] {ON} (12601.....   114   9e-25
TPHA0G02480 Chr7 (509815..511860) [2046 bp, 681 aa] {ON} Anc_2.4...   112   9e-25
KNAG0D00210 Chr4 complement(22721..25222) [2502 bp, 833 aa] {ON}...   113   9e-25
ZYRO0E05170g Chr5 complement(390866..392593) [1728 bp, 575 aa] {...   112   9e-25
Kwal_47.16761 s47 (100315..102549) [2235 bp, 744 aa] {ON} YHR205...   113   1e-24
KNAG0A06290 Chr1 (958438..960516) [2079 bp, 692 aa] {ON} Anc_2.4...   112   1e-24
NDAI0D03420 Chr4 (806856..809261) [2406 bp, 801 aa] {ON} Anc_4.384    113   1e-24
CAGL0M10153g Chr13 complement(1010688..1013291) [2604 bp, 867 aa...   113   1e-24
Skud_12.329 Chr12 (580813..582645) [1833 bp, 610 aa] {ON} YLR248...   112   1e-24
TDEL0A07560 Chr1 complement(1316498..1321225) [4728 bp, 1575 aa]...   114   1e-24
TBLA0A10690 Chr1 (2642723..2645632) [2910 bp, 969 aa] {ON} Anc_4...   113   1e-24
ACL053C Chr3 complement(273163..276708) [3546 bp, 1181 aa] {ON} ...   113   1e-24
ZYRO0G19074g Chr7 complement(1580648..1583413) [2766 bp, 921 aa]...   112   1e-24
Sklu_YGOB_Anc_2.496 Chr5 (185447..187306) [1860 bp, 619 aa] {ON}...   111   2e-24
Ecym_7473 Chr7 (963826..966045) [2220 bp, 739 aa] {ON} similar t...   112   2e-24
TDEL0D00330 Chr4 complement(55638..57872) [2235 bp, 744 aa] {ON}...   112   2e-24
NDAI0A03870 Chr1 (867910..870597) [2688 bp, 895 aa] {ON} Anc_2.496    112   2e-24
YGL180W Chr7 (160065..162758) [2694 bp, 897 aa] {ON}  ATG1Protei...   112   2e-24
NDAI0G03450 Chr7 (822716..825562) [2847 bp, 948 aa] {ON} Anc_8.141    112   2e-24
KLLA0F12188g Chr6 (1122745..1124385) [1641 bp, 546 aa] {ON} some...   111   2e-24
KNAG0B05350 Chr2 complement(1034166..1036676) [2511 bp, 836 aa] ...   112   2e-24
TDEL0B05820 Chr2 complement(1031136..1032863) [1728 bp, 575 aa] ...   111   2e-24
Kpol_1055.24 s1055 complement(57430..60243) [2814 bp, 937 aa] {O...   112   2e-24
NCAS0A06440 Chr1 (1270771..1273020) [2250 bp, 749 aa] {ON} Anc_4...   112   2e-24
Suva_15.411 Chr15 (716095..718542) [2448 bp, 815 aa] {ON} YHR205...   112   2e-24
Kwal_26.7154 s26 (237387..241028) [3642 bp, 1213 aa] {ON} YOL045...   112   2e-24
KLTH0H12650g Chr8 (1072961..1074592) [1632 bp, 543 aa] {ON} simi...   110   2e-24
NCAS0A08770 Chr1 complement(1733181..1734890) [1710 bp, 569 aa] ...   110   2e-24
CAGL0K02167g Chr11 complement(192297..195785) [3489 bp, 1162 aa]...   112   2e-24
CAGL0F09075g Chr6 (894761..897001) [2241 bp, 746 aa] {ON} simila...   111   2e-24
KAFR0K00700 Chr11 complement(153981..158126) [4146 bp, 1381 aa] ...   112   3e-24
NDAI0I00340 Chr9 (65047..70557) [5511 bp, 1836 aa] {ON} Anc_6.341     112   3e-24
CAGL0K11550g Chr11 (1118971..1120587) [1617 bp, 538 aa] {ON} sim...   110   3e-24
NDAI0G03030 Chr7 (704910..708269) [3360 bp, 1119 aa] {ON}             112   3e-24
ADL389W Chr4 (27641..29776) [2136 bp, 711 aa] {ON} Syntenic homo...   111   3e-24
Ecym_6307 Chr6 (578677..580227) [1551 bp, 516 aa] {ON} similar t...   110   3e-24
KNAG0E00360 Chr5 (54187..55563) [1377 bp, 458 aa] {ON}                109   3e-24
NDAI0H03460 Chr8 complement(836849..838726) [1878 bp, 625 aa] {O...   110   3e-24
Skud_13.262 Chr13 complement(448758..450791) [2034 bp, 677 aa] {...   111   3e-24
SAKL0D09240g Chr4 (764130..765761) [1632 bp, 543 aa] {ON} some s...   110   3e-24
Kpol_1014.8 s1014 (13007..14368) [1362 bp, 453 aa] {ON} (13007.....   109   3e-24
TPHA0H00760 Chr8 complement(152442..155384) [2943 bp, 980 aa] {O...   112   3e-24
Smik_3.94 Chr3 (128344..130155) [1812 bp, 603 aa] {ON} YCR008W (...   110   3e-24
Smik_2.146 Chr2 complement(275270..276850) [1581 bp, 526 aa] {ON...   110   3e-24
CAGL0L03520g Chr12 complement(403100..407443) [4344 bp, 1447 aa]...   112   3e-24
YCR091W Chr3 (274404..276566) [2163 bp, 720 aa] {ON}  KIN82Putat...   111   3e-24
Kwal_47.17252 s47 (318148..320766) [2619 bp, 872 aa] {ON} YGL180...   111   4e-24
YAL017W Chr1 (120225..124295) [4071 bp, 1356 aa] {ON}  PSK1One o...   112   4e-24
TPHA0H00420 Chr8 complement(82575..85691) [3117 bp, 1038 aa] {ON...   111   4e-24
TBLA0B01630 Chr2 (360963..364850) [3888 bp, 1295 aa] {ON} Anc_3....   112   4e-24
Suva_4.535 Chr4 (921278..922861) [1584 bp, 527 aa] {ON} YBR274W ...   109   4e-24
SAKL0H24750g Chr8 complement(2152673..2155420) [2748 bp, 915 aa]...   111   4e-24
KAFR0F03970 Chr6 (777047..778201) [1155 bp, 384 aa] {ON} Anc_4.1...   107   5e-24
NCAS0D04710 Chr4 complement(901442..903856) [2415 bp, 804 aa] {O...   110   5e-24
KLLA0B13607g Chr2 (1191592..1194561) [2970 bp, 989 aa] {ON} simi...   111   5e-24
Ecym_2744 Chr2 complement(1442759..1444465) [1707 bp, 568 aa] {O...   109   5e-24
TDEL0A02720 Chr1 complement(491618..494365) [2748 bp, 915 aa] {O...   110   6e-24
TBLA0C02940 Chr3 complement(706091..711022) [4932 bp, 1643 aa] {...   111   6e-24
TPHA0M02080 Chr13 (426966..429635) [2670 bp, 889 aa] {ON} Anc_6....   110   6e-24
KLLA0E11947g Chr5 complement(1060048..1061892) [1845 bp, 614 aa]...   109   6e-24
YCR008W Chr3 (128470..130281) [1812 bp, 603 aa] {ON}  SAT4Ser/Th...   109   6e-24
CAGL0G04609g Chr7 complement(437162..440059) [2898 bp, 965 aa] {...   110   6e-24
YHR205W Chr8 (509363..511837) [2475 bp, 824 aa] {ON}  SCH9AGC fa...   110   7e-24
NCAS0A05370 Chr1 complement(1061671..1066197) [4527 bp, 1508 aa]...   111   7e-24
SAKL0E03344g Chr5 (272024..273754) [1731 bp, 576 aa] {ON} simila...   109   7e-24
Suva_14.385 Chr14 complement(661987..666732) [4746 bp, 1581 aa] ...   111   7e-24
Skud_14.362 Chr14 complement(648801..653540) [4740 bp, 1579 aa] ...   111   8e-24
Smik_8.295 Chr8 (484074..486548) [2475 bp, 824 aa] {ON} YHR205W ...   110   8e-24
YGL179C Chr7 complement(163409..165091) [1683 bp, 560 aa] {ON}  ...   108   8e-24
SAKL0B09856g Chr2 complement(830531..834355) [3825 bp, 1274 aa] ...   110   8e-24
KLLA0F14190g Chr6 (1311121..1315137) [4017 bp, 1338 aa] {ON} uni...   110   9e-24
Smik_8.42 Chr8 complement(74075..76894) [2820 bp, 939 aa] {ON} Y...   110   9e-24
NCAS0A12350 Chr1 complement(2446237..2447236,2447319..2448559) [...   110   9e-24
Skud_7.91 Chr7 (165681..168374) [2694 bp, 897 aa] {ON} YGL180W (...   110   9e-24
Skud_8.39 Chr8 complement(76730..79501) [2772 bp, 923 aa] {ON} Y...   110   9e-24
KNAG0A06750 Chr1 (1053919..1056294) [2376 bp, 791 aa] {ON} Anc_2...   110   9e-24
Skud_3.73 Chr3 (110742..112556) [1815 bp, 604 aa] {ON} YCR008W (...   109   9e-24
TBLA0D02240 Chr4 complement(561856..566547) [4692 bp, 1563 aa] {...   110   9e-24
KLTH0E06754g Chr5 (619163..621784) [2622 bp, 873 aa] {ON} simila...   110   1e-23
KNAG0K01240 Chr11 (243154..246096) [2943 bp, 980 aa] {ON} Anc_3....   110   1e-23
Suva_3.33 Chr3 (42176..44020) [1845 bp, 614 aa] {ON} YCR008W (REAL)   108   1e-23
YHL007C Chr8 complement(95118..97937) [2820 bp, 939 aa] {ON}  ST...   110   1e-23
Kpol_1028.16 s1028 complement(45186..47825) [2640 bp, 879 aa] {O...   109   1e-23
YBR028C Chr2 complement(294425..296002) [1578 bp, 525 aa] {ON}  ...   108   1e-23
CAGL0H06259g Chr8 (615045..619055) [4011 bp, 1336 aa] {ON} simil...   110   1e-23
TDEL0B04700 Chr2 (834336..836996) [2661 bp, 886 aa] {ON} Anc_8.1...   109   1e-23
KLLA0B03586g Chr2 complement(326871..329075) [2205 bp, 734 aa] {...   109   1e-23
NCAS0A08610 Chr1 complement(1700839..1702704) [1866 bp, 621 aa] ...   108   1e-23
YNR031C Chr14 complement(680694..685433) [4740 bp, 1579 aa] {ON}...   110   1e-23
Skud_1.44 Chr1 (95573..99643) [4071 bp, 1356 aa] {ON} YAL017W (R...   110   2e-23
NDAI0G05190 Chr7 complement(1258638..1260452) [1815 bp, 604 aa] ...   108   2e-23
Smik_3.189 Chr3 (273885..276044) [2160 bp, 719 aa] {ON} YCR091W ...   108   2e-23
TBLA0C01320 Chr3 complement(289223..290626) [1404 bp, 467 aa] {O...   107   2e-23
CAGL0C03509g Chr3 complement(350846..353533) [2688 bp, 895 aa] {...   109   2e-23
SAKL0C09174g Chr3 complement(833618..836833) [3216 bp, 1071 aa] ...   109   2e-23
Skud_8.272 Chr8 (478199..480706) [2508 bp, 835 aa] {ON} YHR205W ...   109   2e-23
KAFR0D03100 Chr4 complement(610106..611635) [1530 bp, 509 aa] {O...   107   2e-23
Skud_5.249 Chr5 complement(400867..404310) [3444 bp, 1147 aa] {O...   109   2e-23
Kpol_487.14 s487 complement(56520..58394) [1875 bp, 624 aa] {ON}...   108   2e-23
KAFR0C03010 Chr3 (598970..601342) [2373 bp, 790 aa] {ON} Anc_8.1...   108   2e-23
KNAG0I02670 Chr9 complement(524008..526734) [2727 bp, 908 aa] {O...   109   2e-23
KAFR0F04340 Chr6 (848844..853628) [4785 bp, 1594 aa] {ON} Anc_6....   109   2e-23
KLTH0H11858g Chr8 (1013677..1015374) [1698 bp, 565 aa] {ON} some...   107   2e-23
Smik_14.360 Chr14 complement(638655..643406) [4752 bp, 1583 aa] ...   109   2e-23
KLTH0D01386g Chr4 (129448..130053,130132..130974) [1449 bp, 482 ...   106   2e-23
Smik_1.50 Chr1 (103132..107205) [4074 bp, 1357 aa] {ON} YAL017W ...   109   3e-23
ZYRO0E04246g Chr5 complement(322215..324035) [1821 bp, 606 aa] {...   107   3e-23
Kpol_1040.20 s1040 (57057..60950) [3894 bp, 1297 aa] {ON} (57057...   108   3e-23
Ecym_2434 Chr2 complement(843308..846676) [3369 bp, 1122 aa] {ON...   108   4e-23
ZYRO0D05500g Chr4 (473262..477050) [3789 bp, 1262 aa] {ON} weakl...   108   4e-23
Suva_8.47 Chr8 complement(91615..94557) [2943 bp, 980 aa] {ON} Y...   108   4e-23
ZYRO0D17468g Chr4 (1439376..1441958) [2583 bp, 860 aa] {ON} weak...   108   4e-23
NDAI0K01480 Chr11 complement(337108..338706) [1599 bp, 532 aa] {...   106   4e-23
TPHA0L00500 Chr12 (83710..86589) [2880 bp, 959 aa] {ON} Anc_7.86...   108   4e-23
KAFR0C00930 Chr3 complement(186877..189687) [2811 bp, 936 aa] {O...   108   4e-23
KLTH0A07458g Chr1 (620459..623080) [2622 bp, 873 aa] {ON} simila...   108   4e-23
Suva_1.50 Chr1 (96474..100556) [4083 bp, 1360 aa] {ON} YAL017W (...   108   4e-23
Suva_10.345 Chr10 (601536..603365) [1830 bp, 609 aa] {ON} YLR248...   107   5e-23
Suva_4.223 Chr4 complement(395869..397719) [1851 bp, 616 aa] {ON...   107   5e-23
ZYRO0D04752g Chr4 complement(397364..398215,398290..398907) [147...   105   5e-23
TBLA0D02230 Chr4 (557816..561280) [3465 bp, 1154 aa] {ON} Anc_8....   108   5e-23
TBLA0F00240 Chr6 complement(45510..49256) [3747 bp, 1248 aa] {ON...   108   5e-23
KAFR0C05130 Chr3 (1018035..1019402) [1368 bp, 455 aa] {ON} Anc_7...   105   6e-23
Kwal_33.13112 s33 (76807..78324) [1518 bp, 505 aa] {ON} YDR523C ...   105   6e-23
SAKL0C08844g Chr3 (811712..813307) [1596 bp, 531 aa] {ON} simila...   106   6e-23
Kwal_23.6458 s23 (1592349..1594955) [2607 bp, 868 aa] {ON} YNR04...   107   6e-23
NCAS0C04100 Chr3 (834997..837714) [2718 bp, 905 aa] {ON} Anc_8.141    107   7e-23
ACR281C Chr3 complement(864528..868307) [3780 bp, 1259 aa] {ON} ...   107   8e-23
Kpol_1044.3 s1044 (4910..5845,5849..7711) [2799 bp, 932 aa] {ON}...   107   8e-23
KLTH0B09042g Chr2 (736520..738112) [1593 bp, 530 aa] {ON} simila...   105   8e-23
AFR335C Chr6 complement(1046756..1049857) [3102 bp, 1033 aa] {ON...   107   9e-23
Kpol_1050.13 s1050 (34788..36578) [1791 bp, 596 aa] {ON} (34788....   105   9e-23
TPHA0I00920 Chr9 (204753..209057) [4305 bp, 1434 aa] {ON} Anc_1....   107   1e-22
NDAI0K02390 Chr11 (537260..539920) [2661 bp, 886 aa] {ON} Anc_6....   107   1e-22
SAKL0C00946g Chr3 (84995..86689) [1695 bp, 564 aa] {ON} similar ...   105   1e-22
Kpol_1007.17 s1007 (32671..32687,32861..33767) [924 bp, 307 aa] ...   101   1e-22
CAGL0L07810g Chr12 complement(859653..861443) [1791 bp, 596 aa] ...   105   1e-22
KNAG0F00170 Chr6 (13778..15409) [1632 bp, 543 aa] {ON} Anc_1.24 ...   105   1e-22
SAKL0D05522g Chr4 (437018..441442) [4425 bp, 1474 aa] {ON} simil...   107   1e-22
Skud_4.225 Chr4 complement(400160..401992) [1833 bp, 610 aa] {ON...   105   1e-22
KAFR0C04590 Chr3 complement(917915..922321) [4407 bp, 1468 aa] {...   107   1e-22
Kpol_541.48 s541 (152877..153692,153695..156046) [3168 bp, 1055 ...   106   1e-22
KLLA0C17160g Chr3 (1498959..1501454) [2496 bp, 831 aa] {ON} simi...   106   1e-22
TPHA0O00670 Chr15 (125331..127088) [1758 bp, 585 aa] {ON} Anc_1....   105   1e-22
NCAS0I02060 Chr9 (386630..388573) [1944 bp, 647 aa] {ON} Anc_3.1...   105   1e-22
NCAS0D04600 Chr4 (875553..880604) [5052 bp, 1683 aa] {ON} Anc_6....   107   1e-22
ADR379C Chr4 complement(1386598..1388076) [1479 bp, 492 aa] {ON}...   104   1e-22
TDEL0H04100 Chr8 complement(706443..707306,707369..707974) [1470...   104   2e-22
TPHA0C01780 Chr3 complement(407048..407965) [918 bp, 305 aa] {ON...   101   2e-22
Skud_1.72 Chr1 (141337..144261) [2925 bp, 974 aa] {ON} YAR019C (...   106   2e-22
ZYRO0B07854g Chr2 complement(613992..616007) [2016 bp, 671 aa] {...   105   2e-22
Ecym_6040 Chr6 complement(77854..80544) [2691 bp, 896 aa] {ON} s...   106   2e-22
KNAG0D02140 Chr4 complement(362745..365357) [2613 bp, 870 aa] {O...   105   2e-22
KLLA0C18568g Chr3 (1639958..1642282) [2325 bp, 774 aa] {ON} simi...   105   2e-22
TDEL0E01710 Chr5 complement(330667..332706) [2040 bp, 679 aa] {O...   105   2e-22
Kwal_56.23841 s56 (732202..733500) [1299 bp, 432 aa] {ON} YLR113...   103   2e-22
TBLA0A04720 Chr1 (1168895..1172683) [3789 bp, 1262 aa] {ON} Anc_...   106   2e-22
NCAS0E02230 Chr5 (429499..430176,430250..431104) [1533 bp, 510 a...   104   2e-22
YOL045W Chr15 (243497..246802) [3306 bp, 1101 aa] {ON}  PSK2One ...   106   2e-22
Smik_15.122 Chr15 (209665..212970) [3306 bp, 1101 aa] {ON} YOL04...   105   2e-22
NDAI0G05060 Chr7 complement(1227369..1229495) [2127 bp, 708 aa] ...   105   2e-22
TPHA0B00240 Chr2 complement(44468..46525) [2058 bp, 685 aa] {ON}...   105   3e-22
ZYRO0B04906g Chr2 (395546..398089) [2544 bp, 847 aa] {ON} simila...   105   3e-22
KLLA0C00979g Chr3 (73295..74746) [1452 bp, 483 aa] {ON} similar ...   103   3e-22
Kwal_55.20326 s55 complement(351010..353262) [2253 bp, 750 aa] {...   105   3e-22
KLTH0G12738g Chr7 complement(1085500..1086804) [1305 bp, 434 aa]...   102   3e-22
AAL029W Chr1 (289989..291593) [1605 bp, 534 aa] {ON} Syntenic ho...   103   3e-22
Kpol_1042.20 s1042 (45090..47261) [2172 bp, 723 aa] {ON} (45090....   105   3e-22
Kwal_26.7355 s26 (326867..331207) [4341 bp, 1446 aa] {ON} YJL095...   105   3e-22
KNAG0G01250 Chr7 complement(280791..283364) [2574 bp, 857 aa] {O...   105   3e-22
CAGL0M11748g Chr13 (1168856..1170199) [1344 bp, 447 aa] {ON} hig...   102   4e-22
KLTH0E16126g Chr5 complement(1427208..1429814) [2607 bp, 868 aa]...   105   4e-22
KAFR0D04950 Chr4 (971956..974982) [3027 bp, 1008 aa] {ON} Anc_5....   105   4e-22
YDL025C Chr4 complement(405344..407206) [1863 bp, 620 aa] {ON}  ...   104   4e-22
Ecym_2640 Chr2 complement(1232617..1236594) [3978 bp, 1325 aa] {...   105   4e-22
Ecym_2457 Chr2 (888054..890165) [2112 bp, 703 aa] {ON} similar t...   104   4e-22
Kpol_463.8 s463 complement(18696..23039) [4344 bp, 1447 aa] {ON}...   105   5e-22
TBLA0A08290 Chr1 complement(2039328..2041376) [2049 bp, 682 aa] ...   103   6e-22
KNAG0A02310 Chr1 complement(216545..217453) [909 bp, 302 aa] {ON...   100   6e-22
KLLA0F23507g Chr6 complement(2198603..2200066) [1464 bp, 487 aa]...   102   6e-22
AER195C Chr5 complement(1005431..1006945) [1515 bp, 504 aa] {ON}...   102   6e-22
ZYRO0G15290g Chr7 complement(1237119..1241582) [4464 bp, 1487 aa...   104   6e-22
Smik_1.79 Chr1 complement(149839..152763) [2925 bp, 974 aa] {ON}...   104   7e-22
Skud_15.519 Chr15 complement(932720..934216) [1497 bp, 498 aa] {...   102   7e-22
Smik_4.209 Chr4 complement(385530..386995,387230..387623) [1860 ...   103   7e-22
KLTH0D02486g Chr4 (247566..251237) [3672 bp, 1223 aa] {ON} simil...   104   7e-22
KNAG0G02300 Chr7 (528489..529748) [1260 bp, 419 aa] {ON} Anc_8.3...   101   7e-22
Skud_15.112 Chr15 (202308..205613) [3306 bp, 1101 aa] {ON} YOL04...   104   7e-22
Kpol_2001.30 s2001 (87817..90093) [2277 bp, 758 aa] {ON} (87817....   103   8e-22
KAFR0C04780 Chr3 (948771..951131) [2361 bp, 786 aa] {ON} Anc_6.3...   103   8e-22
ACL054W Chr3 (269703..272621) [2919 bp, 972 aa] {ON} Syntenic ho...   103   8e-22
NCAS0A05570 Chr1 (1093653..1096409) [2757 bp, 918 aa] {ON} Anc_6...   103   9e-22
YAR019C Chr1 complement(172211..175135) [2925 bp, 974 aa] {ON}  ...   103   9e-22
ABL055C Chr2 complement(295495..297105) [1611 bp, 536 aa] {ON} S...   102   9e-22
Suva_8.405 Chr8 complement(730738..732348) [1611 bp, 536 aa] {ON...   102   9e-22
ADR167W Chr4 (994581..997202) [2622 bp, 873 aa] {ON} Syntenic ho...   103   1e-21
Kpol_543.55 s543 (126256..127533) [1278 bp, 425 aa] {ON} (126256...   100   1e-21
CAGL0L12474g Chr12 complement(1347340..1348248) [909 bp, 302 aa]...    99   1e-21
KAFR0A05090 Chr1 (1011918..1013924) [2007 bp, 668 aa] {ON}            102   1e-21
Kpol_183.1 s183 (158..2257) [2100 bp, 699 aa] {ON} (158..2257) [...   103   1e-21
Suva_6.169 Chr6 complement(300200..304654) [4455 bp, 1484 aa] {O...   103   1e-21
ZYRO0D08184g Chr4 (706856..711601) [4746 bp, 1581 aa] {ON} simil...   103   1e-21
KLTH0D03454g Chr4 (327039..331340) [4302 bp, 1433 aa] {ON} simil...   103   1e-21
TBLA0F00820 Chr6 (209607..211844) [2238 bp, 745 aa] {ON} Anc_3.1...   103   1e-21
KLTH0F00946g Chr6 (73412..74950) [1539 bp, 512 aa] {ON} similar ...   102   1e-21
TDEL0D04560 Chr4 (835822..837885) [2064 bp, 687 aa] {ON} Anc_3.1...   102   1e-21
NCAS0B04580 Chr2 (831695..835255) [3561 bp, 1186 aa] {ON} Anc_8....   103   1e-21
ZYRO0C06776g Chr3 complement(508813..511485) [2673 bp, 890 aa] {...   103   1e-21
Kwal_27.9763 s27 (54483..57089) [2607 bp, 868 aa] {ON} YAR019C (...   103   1e-21
KAFR0B02980 Chr2 (623470..624804) [1335 bp, 444 aa] {ON} Anc_8.3...   100   1e-21
Suva_15.124 Chr15 (215781..219101) [3321 bp, 1106 aa] {ON} YOL04...   103   1e-21
Smik_15.535 Chr15 complement(940569..942050) [1482 bp, 493 aa] {...   101   2e-21
YJL095W Chr10 (247255..251691) [4437 bp, 1478 aa] {ON}  BCK1Mito...   103   2e-21
NCAS0C03380 Chr3 complement(664012..665310) [1299 bp, 432 aa] {O...   100   2e-21
NDAI0A06630 Chr1 complement(1514165..1515943) [1779 bp, 592 aa] ...   102   2e-21
TDEL0E01820 Chr5 complement(348423..349403) [981 bp, 326 aa] {ON...    99   2e-21
Suva_5.250 Chr5 (392904..396323) [3420 bp, 1139 aa] {ON} YER129W...   103   2e-21
Smik_5.275 Chr5 (426176..429601) [3426 bp, 1141 aa] {ON} YER129W...   103   2e-21
SAKL0G06402g Chr7 (535632..537986) [2355 bp, 784 aa] {ON} simila...   102   2e-21
SAKL0A00484g Chr1 complement(57938..60544) [2607 bp, 868 aa] {ON...   102   2e-21
Smik_4.207 Chr4 complement(381159..383456) [2298 bp, 765 aa] {ON...   102   2e-21
TPHA0H01630 Chr8 (371333..374443) [3111 bp, 1036 aa] {ON} Anc_5....   102   2e-21
Suva_11.108 Chr11 complement(207520..209070) [1551 bp, 516 aa] {...   101   2e-21
TBLA0B02310 Chr2 (539362..541821) [2460 bp, 819 aa] {ON} Anc_3.9...   102   2e-21
YKL116C Chr11 complement(221344..222900) [1557 bp, 518 aa] {ON} ...   101   2e-21
KAFR0D03390 Chr4 (667896..670292) [2397 bp, 798 aa] {ON} Anc_2.4...   102   2e-21
KNAG0C06060 Chr3 (1183766..1186654) [2889 bp, 962 aa] {ON} Anc_5...   102   3e-21
Kwal_0.307 s0 (145676..147145) [1470 bp, 490 aa] {OFF} YCR008W (...   100   3e-21
KLTH0E11220g Chr5 (1005953..1005969,1006040..1006931) [909 bp, 3...    97   3e-21
TBLA0E02790 Chr5 complement(693136..695562) [2427 bp, 808 aa] {O...   102   3e-21
Kpol_1035.17 s1035 complement(39908..41503) [1596 bp, 531 aa] {O...   100   3e-21
Kwal_YGOB_0.307 s0 (145676..147175) [1500 bp, 500 aa] {ON} ANNOT...   100   3e-21
KLLA0C03938g Chr3 complement(358851..360632) [1782 bp, 593 aa] {...   100   4e-21
SAKL0H11638g Chr8 complement(994049..994946,995016..995032) [915...    97   4e-21
Suva_10.202 Chr10 (380079..381386) [1308 bp, 435 aa] {ON} YLR113...    99   4e-21
Ecym_4523 Chr4 (1039929..1042070) [2142 bp, 713 aa] {ON} similar...   101   4e-21
Smik_12.173 Chr12 (351727..353034) [1308 bp, 435 aa] {ON} YLR113...    99   4e-21
SAKL0C07722g Chr3 (717419..720157) [2739 bp, 912 aa] {ON} simila...   101   4e-21
KNAG0B01780 Chr2 (326438..331180) [4743 bp, 1580 aa] {ON} Anc_1....   102   4e-21
Smik_10.65 Chr10 complement(104987..107545) [2559 bp, 852 aa] {O...   101   4e-21
TBLA0F00860 Chr6 (219628..222570) [2943 bp, 980 aa] {ON} Anc_3.1...   101   4e-21
KAFR0A01420 Chr1 (276454..280650) [4197 bp, 1398 aa] {ON} Anc_1....   102   5e-21
KNAG0I00590 Chr9 (100275..102068) [1794 bp, 597 aa] {ON}              100   5e-21
SAKL0H16038g Chr8 complement(1401627..1402931) [1305 bp, 434 aa]...    99   5e-21
Kwal_33.14167 s33 (554863..557379) [2517 bp, 838 aa] {ON} YDL028...   101   6e-21
SAKL0C07348g Chr3 (677348..679933) [2586 bp, 861 aa] {ON} some s...   101   6e-21
KLLA0F20053g Chr6 (1867209..1868543) [1335 bp, 444 aa] {ON} high...    99   6e-21
Skud_12.181 Chr12 (354407..355702) [1296 bp, 431 aa] {ON} YLR113...    99   6e-21
NCAS0I02080 Chr9 (390551..392875) [2325 bp, 774 aa] {ON} Anc_3.162    100   8e-21
TDEL0B06160 Chr2 complement(1086672..1088327) [1656 bp, 551 aa] ...   100   9e-21
NDAI0G05470 Chr7 (1340175..1344842) [4668 bp, 1555 aa] {ON} Anc_...   101   9e-21
NCAS0D00710 Chr4 (122875..124737) [1863 bp, 620 aa] {ON}              100   1e-20
TBLA0H01330 Chr8 complement(297718..299163) [1446 bp, 481 aa] {O...    99   1e-20
AFR092W Chr6 (595092..599363) [4272 bp, 1423 aa] {ON} Syntenic h...   100   1e-20
YOR351C Chr15 complement(995018..996511) [1494 bp, 497 aa] {ON} ...    99   1e-20
Skud_11.113 Chr11 complement(207796..209355) [1560 bp, 519 aa] {...    99   1e-20
NCAS0A09470 Chr1 complement(1883183..1887730) [4548 bp, 1515 aa]...   100   1e-20
NCAS0C02470 Chr3 complement(460460..461378,461483..461499) [936 ...    96   1e-20
SAKL0B05082g Chr2 (436707..438896) [2190 bp, 729 aa] {ON} simila...   100   1e-20
TDEL0B01540 Chr2 complement(272561..273458,273562..273578) [915 ...    96   1e-20
TPHA0N00370 Chr14 (68298..69650) [1353 bp, 450 aa] {ON} Anc_7.41...    98   1e-20
NDAI0B02500 Chr2 (625206..629036) [3831 bp, 1276 aa] {ON} Anc_8....   100   1e-20
Ecym_8400 Chr8 complement(825315..828515) [3201 bp, 1066 aa] {ON...   100   1e-20
TPHA0H02390 Chr8 (561244..563436) [2193 bp, 730 aa] {ON} Anc_6.3...   100   1e-20
CAGL0L11550g Chr12 (1232015..1235233) [3219 bp, 1072 aa] {ON} si...   100   1e-20
Smik_11.60 Chr11 complement(116793..118970) [2178 bp, 725 aa] {O...   100   2e-20
NDAI0C01700 Chr3 complement(367077..370139) [3063 bp, 1020 aa] {...   100   2e-20
YDL028C Chr4 complement(400997..403291) [2295 bp, 764 aa] {ON}  ...    99   2e-20
AFR724C Chr6 complement(1770338..1771660) [1323 bp, 440 aa] {ON}...    97   2e-20
Ecym_2357 Chr2 (700079..701914) [1836 bp, 611 aa] {ON} similar t...    99   2e-20
Skud_4.223 Chr4 complement(395836..398145) [2310 bp, 769 aa] {ON...    99   2e-20
Skud_10.119 Chr10 (215299..219744) [4446 bp, 1481 aa] {ON} YJL09...   100   2e-20
Kpol_1033.63 s1033 complement(158652..160205) [1554 bp, 517 aa] ...    98   2e-20
Ecym_1030 Chr1 (56043..57365) [1323 bp, 440 aa] {ON} similar to ...    97   2e-20
ZYRO0D06182g Chr4 complement(529121..530416) [1296 bp, 431 aa] {...    97   3e-20
CAGL0B02739g Chr2 complement(262590..264620) [2031 bp, 676 aa] {...    99   3e-20
ABR014W Chr2 (417708..420623) [2916 bp, 971 aa] {ON} Syntenic ho...    99   3e-20
KNAG0B04320 Chr2 complement(821265..824348) [3084 bp, 1027 aa] {...    99   3e-20
NDAI0G02700 Chr7 complement(618268..619611) [1344 bp, 447 aa] {O...    97   3e-20
TBLA0E04970 Chr5 (1272310..1273944) [1635 bp, 544 aa] {ON} Anc_4...    98   3e-20
Smik_4.128 Chr4 (244339..244354,244439..245331) [909 bp, 302 aa]...    94   3e-20
NDAI0I00250 Chr9 (42174..44867) [2694 bp, 897 aa] {ON} Anc_3.177...    99   3e-20
TPHA0P01270 Chr16 complement(254480..257137) [2658 bp, 885 aa] {...    99   3e-20
NDAI0J01990 Chr10 (491491..493758) [2268 bp, 755 aa] {ON} Anc_4....    99   4e-20
YER129W Chr5 (417281..420709) [3429 bp, 1142 aa] {ON}  SAK1Upstr...    99   4e-20
TBLA0H01660 Chr8 complement(377521..380511) [2991 bp, 996 aa] {O...    99   4e-20
TBLA0A03570 Chr1 (892930..895857) [2928 bp, 975 aa] {ON} Anc_5.4...    99   4e-20
YLR362W Chr12 (849866..852019) [2154 bp, 717 aa] {ON}  STE11Sign...    98   4e-20
Kpol_1000.14 s1000 complement(36018..38015) [1998 bp, 665 aa] {O...    98   4e-20
Ecym_4266 Chr4 complement(564935..566329) [1395 bp, 464 aa] {ON}...    97   4e-20
TDEL0F04290 Chr6 (801456..802739) [1284 bp, 427 aa] {ON} Anc_8.3...    96   5e-20
KLTH0G05214g Chr7 (423793..425754) [1962 bp, 653 aa] {ON} weakly...    98   5e-20
SAKL0G01848g Chr7 (154547..157204) [2658 bp, 885 aa] {ON} weakly...    98   5e-20
Smik_10.147 Chr10 (239101..243537) [4437 bp, 1478 aa] {ON} YJL09...    99   5e-20
AEL185C Chr5 complement(291129..292676) [1548 bp, 515 aa] {ON} S...    97   5e-20
Skud_4.146 Chr4 (263181..263196,263281..264173) [909 bp, 302 aa]...    94   5e-20
TDEL0D04600 Chr4 (843530..845917) [2388 bp, 795 aa] {ON} Anc_3.1...    98   5e-20
Ecym_6136 Chr6 complement(248721..250187) [1467 bp, 488 aa] {ON}...    97   6e-20
ZYRO0A06446g Chr1 complement(513126..515957) [2832 bp, 943 aa] {...    98   6e-20
ADR174C Chr4 complement(1008796..1010811) [2016 bp, 671 aa] {ON}...    97   6e-20
ACL104C Chr3 complement(157357..160200) [2844 bp, 947 aa] {ON} S...    98   6e-20
Smik_14.34 Chr14 (53272..55788) [2517 bp, 838 aa] {ON} YNL298W (...    98   6e-20
ZYRO0C02288g Chr3 complement(181604..184327) [2724 bp, 907 aa] {...    98   7e-20
Skud_10.49 Chr10 complement(81651..84206) [2556 bp, 851 aa] {ON}...    98   7e-20
Smik_11.125 Chr11 complement(208208..209764) [1557 bp, 518 aa] {...    97   7e-20
KAFR0F02220 Chr6 (432967..435210) [2244 bp, 747 aa] {ON} Anc_3.1...    97   7e-20
TBLA0B08520 Chr2 complement(2038517..2041321) [2805 bp, 934 aa] ...    98   7e-20
YLR113W Chr12 (371620..372927) [1308 bp, 435 aa] {ON}  HOG1Mitog...    96   7e-20
ZYRO0F08074g Chr6 (654009..654025,654107..655004) [915 bp, 304 a...    93   7e-20
NDAI0A06620 Chr1 complement(1510218..1512461) [2244 bp, 747 aa] ...    97   8e-20
AGL242C Chr7 complement(246896..247790,247838..247854) [912 bp, ...    93   8e-20
ADR317C Chr4 complement(1263080..1265539) [2460 bp, 819 aa] {ON}...    97   8e-20
KAFR0B04630 Chr2 (964764..966302) [1539 bp, 512 aa] {ON} Anc_1.3...    96   8e-20
AGR048C Chr7 complement(807464..808825) [1362 bp, 453 aa] {ON} S...    96   9e-20
KLLA0D11990g Chr4 complement(1022895..1023792,1023928..1023944) ...    93   9e-20
TBLA0I01310 Chr9 (279407..281245) [1839 bp, 612 aa] {ON} Anc_2.4...    97   9e-20
KAFR0H01530 Chr8 complement(283589..284509) [921 bp, 306 aa] {ON...    93   9e-20
Skud_16.251 Chr16 complement(457106..458006,458108..458124) [918...    93   9e-20
KLLA0B13112g Chr2 complement(1146006..1148198) [2193 bp, 730 aa]...    97   9e-20
KLLA0C04213g Chr3 (386815..387999) [1185 bp, 394 aa] {ON} simila...    95   9e-20
Ecym_5241 Chr5 complement(495748..497586) [1839 bp, 612 aa] {ON}...    97   1e-19
KAFR0A08360 Chr1 complement(1677561..1680050) [2490 bp, 829 aa] ...    97   1e-19
Suva_16.286 Chr16 complement(495354..496254,496351..496367) [918...    93   1e-19
Kwal_26.7682 s26 complement(470565..472121) [1557 bp, 518 aa] {O...    96   1e-19
Suva_14.42 Chr14 (65645..68239) [2595 bp, 864 aa] {ON} YNL298W (...    97   1e-19
KLLA0C14278g Chr3 (1240990..1242615) [1626 bp, 541 aa] {ON} simi...    96   1e-19
AEL284C Chr5 complement(106480..107919) [1440 bp, 479 aa] {ON} S...    96   1e-19
TDEL0D01400 Chr4 (269367..273656) [4290 bp, 1429 aa] {ON} Anc_1....    97   1e-19
YDL108W Chr4 (267698..267725,267807..268699) [921 bp, 306 aa] {O...    93   1e-19
KAFR0A06190 Chr1 complement(1251546..1253690) [2145 bp, 714 aa] ...    97   1e-19
Suva_11.65 Chr11 complement(134606..136120) [1515 bp, 504 aa] {O...    96   1e-19
CAGL0K06479g Chr11 (637125..640100) [2976 bp, 991 aa] {ON} some ...    97   2e-19
TPHA0C04650 Chr3 complement(1006190..1007119) [930 bp, 309 aa] {...    92   2e-19
Ecym_6344 Chr6 complement(664647..668840) [4194 bp, 1397 aa] {ON...    97   2e-19
KNAG0F02900 Chr6 (549477..551426) [1950 bp, 649 aa] {ON}               96   2e-19
TBLA0F01550 Chr6 complement(385184..386716) [1533 bp, 510 aa] {O...    95   2e-19
YPL031C Chr16 complement(492018..492918,493021..493037) [918 bp,...    92   2e-19
CAGL0D02244g Chr4 complement(229504..230967) [1464 bp, 487 aa] {...    95   2e-19
ADR313W Chr4 (1255930..1257666) [1737 bp, 578 aa] {ON} Syntenic ...    96   2e-19
CAGL0M03729g Chr13 complement(420316..422901) [2586 bp, 861 aa] ...    96   2e-19
KLTH0F16676g Chr6 complement(1351362..1353998) [2637 bp, 878 aa]...    96   2e-19
NCAS0A02180 Chr1 (410419..411489) [1071 bp, 356 aa] {ON} Anc_4.192     93   2e-19
ZYRO0F12122g Chr6 complement(984069..985910) [1842 bp, 613 aa] {...    96   2e-19
Kwal_27.10004 s27 complement(156153..158360) [2208 bp, 735 aa] {...    96   2e-19
SAKL0C12386g Chr3 complement(1108341..1110923) [2583 bp, 860 aa]...    96   2e-19
NCAS0C01110 Chr3 (207664..209664) [2001 bp, 666 aa] {ON} Anc_8.716     95   3e-19
KLTH0E04334g Chr5 complement(391495..393723) [2229 bp, 742 aa] {...    96   3e-19
NDAI0H01020 Chr8 complement(225366..228566) [3201 bp, 1066 aa] {...    96   3e-19
Skud_14.40 Chr14 (62496..65006) [2511 bp, 836 aa] {ON} YNL298W (...    96   3e-19
Suva_6.246 Chr6 (439815..442373) [2559 bp, 852 aa] {ON} YJL165C ...    96   3e-19
KLTH0D05082g Chr4 complement(457124..458680) [1557 bp, 518 aa] {...    94   3e-19
CAGL0G05720g Chr7 complement(547617..549833) [2217 bp, 738 aa] {...    95   3e-19
KLLA0E06447g Chr5 complement(577669..581154) [3486 bp, 1161 aa] ...    96   3e-19
KAFR0C03020 Chr3 complement(601565..603121) [1557 bp, 518 aa] {O...    94   4e-19
Kwal_55.21545 s55 complement(882294..884891) [2598 bp, 865 aa] {...    96   4e-19
NDAI0A08560 Chr1 complement(1969778..1973731) [3954 bp, 1317 aa]...    96   4e-19
NDAI0B00220 Chr2 (29825..32470) [2646 bp, 881 aa] {ON} Anc_1.180       96   4e-19
KAFR0A03710 Chr1 (758918..760399) [1482 bp, 493 aa] {ON} Anc_8.6...    94   4e-19
Kwal_47.18307 s47 complement(776521..778386) [1866 bp, 621 aa] {...    95   4e-19
NCAS0I02850 Chr9 (529637..532042) [2406 bp, 801 aa] {ON} Anc_1.180     95   4e-19
NCAS0I00470 Chr9 (74336..77584) [3249 bp, 1082 aa] {ON} Anc_7.86       96   4e-19
NCAS0H01940 Chr8 (374913..377960) [3048 bp, 1015 aa] {ON} Anc_5....    96   4e-19
Kwal_23.4276 s23 complement(648061..649626) [1566 bp, 521 aa] {O...    94   4e-19
Suva_4.221 Chr4 complement(391492..393789) [2298 bp, 765 aa] {ON...    95   4e-19
KLTH0A01320g Chr1 (118671..121115) [2445 bp, 814 aa] {ON} simila...    95   5e-19
Suva_4.33 Chr4 complement(63334..65427) [2094 bp, 697 aa] {ON} Y...    95   5e-19
SAKL0H11748g Chr8 complement(1002207..1003541) [1335 bp, 444 aa]...    93   5e-19
Ecym_2531 Chr2 (1034031..1034047,1034135..1035023) [906 bp, 301 ...    91   5e-19
Kpol_1066.45 s1066 complement(76786..79428) [2643 bp, 880 aa] {O...    95   5e-19
TPHA0M00300 Chr13 (59377..61701) [2325 bp, 774 aa] {ON} Anc_3.16...    95   5e-19
YJL165C Chr10 complement(106894..109461) [2568 bp, 855 aa] {ON} ...    95   6e-19
Suva_2.642 Chr2 (1147428..1148865,1149541..1150805) [2703 bp, 90...    95   6e-19
TPHA0A02770 Chr1 complement(597703..600129) [2427 bp, 808 aa] {O...    95   6e-19
TDEL0E02180 Chr5 complement(408232..411195) [2964 bp, 987 aa] {O...    95   6e-19
Kwal_23.5290 s23 complement(1095011..1097470) [2460 bp, 819 aa] ...    95   6e-19
TDEL0A04580 Chr1 (816247..818331) [2085 bp, 694 aa] {ON} Anc_5.5...    94   6e-19
NCAS0B08300 Chr2 (1582859..1584796) [1938 bp, 645 aa] {ON} Anc_1...    94   6e-19
KNAG0A03060 Chr1 complement(375640..377142) [1503 bp, 500 aa] {O...    93   7e-19
Smik_12.450 Chr12 (788896..791106) [2211 bp, 736 aa] {ON} YLR362...    94   7e-19
AGR334W Chr7 (1355098..1356693) [1596 bp, 531 aa] {ON} Syntenic ...    94   7e-19
Ecym_7414 Chr7 (848665..850440) [1776 bp, 591 aa] {ON} similar t...    94   7e-19
NCAS0A04440 Chr1 complement(895181..896935) [1755 bp, 584 aa] {O...    94   7e-19
NDAI0A06130 Chr1 complement(1391744..1394203) [2460 bp, 819 aa] ...    94   7e-19
YNL298W Chr14 (68915..71443) [2529 bp, 842 aa] {ON}  CLA4Cdc42p-...    94   7e-19
Kwal_14.1273 s14 complement(259953..261200) [1248 bp, 415 aa] {O...    92   8e-19
KLTH0F06468g Chr6 (559256..561769) [2514 bp, 837 aa] {ON} simila...    94   9e-19
TDEL0E00690 Chr5 (144269..146770) [2502 bp, 833 aa] {ON} Anc_3.6...    94   9e-19
NDAI0C03900 Chr3 complement(883841..885310) [1470 bp, 489 aa] {O...    93   9e-19
KNAG0C02430 Chr3 complement(472213..474804) [2592 bp, 863 aa] {O...    94   9e-19
TPHA0L01240 Chr12 (263357..264814) [1458 bp, 485 aa] {ON} Anc_8....    93   9e-19
Kpol_1072.31 s1072 complement(67104..68684) [1581 bp, 526 aa] {O...    93   9e-19
Kpol_1045.46 s1045 complement(106567..108372) [1806 bp, 601 aa] ...    94   1e-18
KLLA0E21693g Chr5 complement(1936438..1939488) [3051 bp, 1016 aa...    94   1e-18
NDAI0E03760 Chr5 (817014..818765) [1752 bp, 583 aa] {ON} Anc_7.41      93   1e-18
YKL168C Chr11 complement(131288..133462) [2175 bp, 724 aa] {ON} ...    94   1e-18
TPHA0G02990 Chr7 complement(640488..642098) [1611 bp, 536 aa] {O...    93   1e-18
SAKL0B11044g Chr2 complement(962142..962940,963019..963086,96315...    92   1e-18
ZYRO0D07502g Chr4 complement(652782..654320) [1539 bp, 512 aa] {...    93   1e-18
Suva_14.158 Chr14 complement(289281..291650) [2370 bp, 789 aa] {...    94   1e-18
CAGL0K01661g Chr11 complement(147781..149229) [1449 bp, 482 aa] ...    92   1e-18
Kwal_14.2497 s14 complement(784224..785480) [1257 bp, 418 aa] {O...    92   1e-18
AER223C Chr5 complement(1044971..1047679) [2709 bp, 902 aa] {ON}...    94   1e-18
Smik_2.13 Chr2 complement(14021..17473) [3453 bp, 1150 aa] {ON} ...    94   1e-18
Smik_2.14 Chr2 complement(14021..17473) [3453 bp, 1150 aa] {ON} ...    94   1e-18
KLLA0A02497g Chr1 (218592..219680) [1089 bp, 362 aa] {ON} highly...    91   2e-18
TPHA0A01630 Chr1 complement(328040..329347) [1308 bp, 435 aa] {O...    91   2e-18
Skud_2.4 Chr2 complement(4805..8260) [3456 bp, 1151 aa] {ON} YBL...    94   2e-18
Suva_1.86 Chr1 complement(150761..153685) [2925 bp, 974 aa] {ON}...    93   2e-18
SAKL0H01364g Chr8 complement(143450..145141) [1692 bp, 563 aa] {...    92   2e-18
YBL105C Chr2 complement(14241..17696) [3456 bp, 1151 aa] {ON}  P...    93   2e-18
Kpol_1031.67 s1031 (174170..175663) [1494 bp, 497 aa] {ON} (1741...    92   2e-18
ZYRO0F13310g Chr6 (1092612..1096322) [3711 bp, 1236 aa] {ON} som...    93   2e-18
KNAG0A05580 Chr1 (830643..831560) [918 bp, 305 aa] {ON} Anc_2.33...    89   2e-18
Suva_2.11 Chr2 complement(17473..18858) [1386 bp, 461 aa] {ON} Y...    91   2e-18
KAFR0H01570 Chr8 complement(290698..291897) [1200 bp, 399 aa] {O...    91   2e-18
TDEL0A02330 Chr1 complement(420205..421662) [1458 bp, 485 aa] {O...    92   2e-18
KAFR0K02490 Chr11 (515669..518356) [2688 bp, 895 aa] {ON} Anc_5....    93   2e-18
KNAG0K01710 Chr11 (360438..361931) [1494 bp, 497 aa] {ON} Anc_3....    92   2e-18
Ecym_3525 Chr3 (993328..995784) [2457 bp, 818 aa] {ON} similar t...    93   2e-18
Suva_10.464 Chr10 (809505..811721) [2217 bp, 738 aa] {ON} YLR362...    92   2e-18
Skud_8.163 Chr8 (290415..293645) [3231 bp, 1076 aa] {ON} YHR102W...    93   2e-18
KNAG0L00520 Chr12 (79786..80892) [1107 bp, 368 aa] {ON} Anc_7.86...    90   3e-18
Ecym_5505 Chr5 (1027605..1030616) [3012 bp, 1003 aa] {ON} simila...    93   3e-18
KAFR0E01580 Chr5 (318991..320280) [1290 bp, 429 aa] {ON} Anc_5.2...    91   3e-18
TPHA0B01520 Chr2 complement(336164..339616) [3453 bp, 1150 aa] {...    93   3e-18
TDEL0C03740 Chr3 (658468..660702) [2235 bp, 744 aa] {ON} Anc_1.1...    92   3e-18
CAGL0I06248g Chr9 (600351..602792) [2442 bp, 813 aa] {ON} simila...    92   3e-18
Ecym_5251 Chr5 (522785..525466) [2682 bp, 893 aa] {ON} similar t...    92   3e-18
KNAG0A06390 Chr1 complement(974644..976254) [1611 bp, 536 aa] {O...    92   3e-18
TBLA0A01660 Chr1 complement(391368..392828) [1461 bp, 486 aa] {O...    91   3e-18
Skud_11.67 Chr11 complement(135815..137341) [1527 bp, 508 aa] {O...    91   3e-18
NCAS0B06000 Chr2 complement(1134919..1135808,1135909..1135957) [...    89   3e-18
KNAG0C04310 Chr3 complement(842994..846503) [3510 bp, 1169 aa] {...    93   3e-18
Skud_12.447 Chr12 (790003..792210) [2208 bp, 735 aa] {ON} YLR362...    92   3e-18
NCAS0A07990 Chr1 complement(1578473..1581346) [2874 bp, 957 aa] ...    92   4e-18
KLLA0A07403g Chr1 (661261..663900) [2640 bp, 879 aa] {ON} simila...    92   4e-18
KNAG0G02780 Chr7 complement(615058..617202) [2145 bp, 714 aa] {O...    92   4e-18
TBLA0A01630 Chr1 complement(385348..386386,386496..386512) [1056...    89   4e-18
TDEL0C03050 Chr3 (545862..549299) [3438 bp, 1145 aa] {ON} Anc_7....    92   4e-18
KNAG0K01740 Chr11 (364195..366492) [2298 bp, 765 aa] {ON} Anc_3....    92   5e-18
Ecym_6301 Chr6 complement(566248..567324) [1077 bp, 358 aa] {ON}...    89   5e-18
ABL011C Chr2 complement(378257..380362) [2106 bp, 701 aa] {ON} S...    92   5e-18
ZYRO0G02816g Chr7 complement(213421..214980) [1560 bp, 519 aa] {...    91   5e-18
YDR466W Chr4 (1395121..1397817) [2697 bp, 898 aa] {ON}  PKH3Prot...    92   5e-18
Kpol_1031.10 s1031 (25064..28447) [3384 bp, 1127 aa] {ON} (25064...    92   6e-18
NCAS0A09960 Chr1 complement(1993554..1995926) [2373 bp, 790 aa] ...    91   6e-18
AEL118C Chr5 complement(399738..401789) [2052 bp, 683 aa] {ON} S...    91   6e-18
KNAG0G01240 Chr7 (277868..280597) [2730 bp, 909 aa] {ON} Anc_8.1...    92   6e-18
AEL205W Chr5 (246871..249252) [2382 bp, 793 aa] {ON} Syntenic ho...    91   6e-18
Ecym_4652 Chr4 (1272725..1276156) [3432 bp, 1143 aa] {ON} simila...    92   6e-18
SAKL0F13618g Chr6 (1085967..1089494) [3528 bp, 1175 aa] {ON} sim...    92   6e-18
KLTH0H08316g Chr8 (730027..731094) [1068 bp, 355 aa] {ON} simila...    89   6e-18
TBLA0B03990 Chr2 complement(910314..912455) [2142 bp, 713 aa] {O...    91   7e-18
TPHA0B01010 Chr2 complement(229538..231634) [2097 bp, 698 aa] {O...    91   7e-18
SAKL0C07458g Chr3 complement(687452..689395) [1944 bp, 647 aa] {...    91   7e-18
KLTH0B07106g Chr2 (571005..573260) [2256 bp, 751 aa] {ON} simila...    91   8e-18
ACR191C Chr3 complement(680398..683847) [3450 bp, 1149 aa] {ON} ...    91   9e-18
KAFR0B01510 Chr2 complement(284425..286092) [1668 bp, 555 aa] {O...    90   9e-18
KNAG0K02370 Chr11 complement(475088..477739) [2652 bp, 883 aa] {...    91   9e-18
KLTH0E11924g Chr5 (1059134..1060030) [897 bp, 298 aa] {ON} highl...    87   1e-17
KAFR0F01790 Chr6 complement(347491..349884) [2394 bp, 797 aa] {O...    91   1e-17
KLLA0C07535g Chr3 (658746..660620) [1875 bp, 624 aa] {ON} some s...    90   1e-17
NDAI0A00940 Chr1 complement(193710..195800) [2091 bp, 696 aa] {O...    91   1e-17
Suva_15.297 Chr15 (518854..520850,520945..522172) [3225 bp, 1074...    91   1e-17
KAFR0B03170 Chr2 complement(656163..658025) [1863 bp, 620 aa] {O...    90   1e-17
Ecym_6145 Chr6 complement(266766..267863) [1098 bp, 365 aa] {ON}...    88   1e-17
TDEL0E03520 Chr5 (657779..659251) [1473 bp, 490 aa] {ON} Anc_5.2...    89   1e-17
NCAS0E03010 Chr5 (599358..602810) [3453 bp, 1150 aa] {ON} Anc_7....    91   1e-17
Skud_13.465 Chr13 (826172..827929) [1758 bp, 585 aa] {ON} YMR291...    89   2e-17
YHR102W Chr8 (316572..319814) [3243 bp, 1080 aa] {ON}  KIC1Prote...    91   2e-17
KLLA0A06820g Chr1 complement(615686..618004) [2319 bp, 772 aa] {...    90   2e-17
KLLA0C03828g Chr3 (349187..351568) [2382 bp, 793 aa] {ON} simila...    90   2e-17
Kwal_27.10581 s27 complement(403249..406713) [3465 bp, 1154 aa] ...    91   2e-17
CAGL0I05390g Chr9 complement(508677..510041) [1365 bp, 454 aa] {...    89   2e-17
NDAI0E01310 Chr5 complement(260484..262094) [1611 bp, 536 aa] {O...    89   2e-17
KLTH0F06578g Chr6 complement(568519..570309) [1791 bp, 596 aa] {...    89   2e-17
NCAS0B01450 Chr2 (237824..239341) [1518 bp, 505 aa] {ON} Anc_8.652     89   2e-17
KLTH0F04730g Chr6 complement(417013..419133) [2121 bp, 706 aa] {...    90   2e-17
KAFR0G01080 Chr7 complement(243965..247417) [3453 bp, 1150 aa] {...    90   2e-17
NDAI0E03170 Chr5 complement(677441..678392,678524..678543) [972 ...    87   2e-17
Smik_8.180 Chr8 (292993..296214) [3222 bp, 1073 aa] {ON} YHR102W...    90   2e-17
Kpol_520.17 s520 complement(37953..41447) [3495 bp, 1164 aa] {ON...    90   2e-17
KAFR0A06790 Chr1 complement(1371892..1372806) [915 bp, 304 aa] {...    86   2e-17
SAKL0H07128g Chr8 complement(623681..625141) [1461 bp, 486 aa] {...    88   2e-17
Skud_4.742 Chr4 (1315170..1317881) [2712 bp, 903 aa] {ON} YDR466...    89   2e-17
KLTH0C05478g Chr3 complement(471760..475254) [3495 bp, 1164 aa] ...    90   3e-17
KLLA0D08415g Chr4 (714473..716797) [2325 bp, 774 aa] {ON} simila...    89   3e-17
Kpol_1002.111 s1002 (277615..278664) [1050 bp, 349 aa] {ON} (277...    87   3e-17
KNAG0B05880 Chr2 (1155395..1157695) [2301 bp, 766 aa] {ON} Anc_4...    89   3e-17
Kwal_33.14434 s33 complement(672031..674310) [2280 bp, 759 aa] {...    89   3e-17
NDAI0E04610 Chr5 (1042690..1046154) [3465 bp, 1154 aa] {ON} Anc_...    89   3e-17
TBLA0C02310 Chr3 complement(546887..548596) [1710 bp, 569 aa] {O...    89   3e-17
ADL283W Chr4 (205173..205197,205250..206145) [921 bp, 306 aa] {O...    86   3e-17
Ecym_8098 Chr8 (210698..212857) [2160 bp, 719 aa] {ON} similar t...    89   4e-17
YMR291W Chr13 (852630..854390) [1761 bp, 586 aa] {ON}  TDA1Prote...    88   5e-17
YDL214C Chr4 complement(74446..76545) [2100 bp, 699 aa] {ON}  PR...    88   5e-17
SAKL0C05280g Chr3 complement(502205..504490) [2286 bp, 761 aa] {...    89   5e-17
Ecym_5236 Chr5 (486270..488864) [2595 bp, 864 aa] {ON} similar t...    89   5e-17
NCAS0E01150 Chr5 complement(217594..219315) [1722 bp, 573 aa] {O...    88   5e-17
Suva_13.481 Chr13 (834531..836279) [1749 bp, 582 aa] {ON} YMR291...    88   5e-17
YPL140C Chr16 complement(287514..289034) [1521 bp, 506 aa] {ON} ...    87   5e-17
Suva_8.316 Chr8 complement(561812..563914) [2103 bp, 700 aa] {ON...    88   5e-17
Smik_15.449 Chr15 complement(772245..774437) [2193 bp, 730 aa] {...    88   6e-17
Ecym_4773 Chr4 complement(1504949..1506541) [1593 bp, 530 aa] {O...    87   6e-17
CAGL0M09361g Chr13 complement(928484..931918) [3435 bp, 1144 aa]...    89   6e-17
Smik_15.39 Chr15 (72332..74314) [1983 bp, 660 aa] {ON} YOL113W (...    88   6e-17
Suva_15.46 Chr15 (81948..83909) [1962 bp, 653 aa] {ON} YOL113W (...    88   6e-17
AER232C Chr5 complement(1066272..1067981) [1710 bp, 569 aa] {ON}...    87   6e-17
Kpol_534.14 s534 (34465..34591,34724..35616) [1020 bp, 339 aa] {...    85   7e-17
TBLA0I00910 Chr9 complement(170526..173945) [3420 bp, 1139 aa] {...    88   7e-17
Kwal_33.13831 s33 complement(413256..415358) [2103 bp, 700 aa] {...    88   7e-17
SAKL0D06666g Chr4 (551260..552522) [1263 bp, 420 aa] {ON} some s...    86   8e-17
TPHA0A05460 Chr1 (1233608..1235170) [1563 bp, 520 aa] {ON} Anc_5...    87   8e-17
KAFR0E02850 Chr5 (575512..576786) [1275 bp, 424 aa] {ON} Anc_8.4...    86   8e-17
ZYRO0B04796g Chr2 (385611..387683) [2073 bp, 690 aa] {ON} simila...    87   8e-17
NDAI0K01150 Chr11 complement(264377..266527) [2151 bp, 716 aa] {...    87   8e-17
Kwal_27.11803 s27 (952938..953678) [741 bp, 246 aa] {ON} YPL031C...    83   8e-17
TPHA0D03940 Chr4 (825250..826989) [1740 bp, 579 aa] {ON} Anc_3.4...    87   9e-17
Kwal_YGOB_27.11919 s27 (1003201..1003830,1004866..1005135) [900 ...    84   9e-17
Kwal_33.14192 s33 complement(563582..565315) [1734 bp, 577 aa] {...    87   9e-17
Smik_6.338 Chr6 (535192..536727) [1536 bp, 511 aa] {ON} YPL140C ...    87   1e-16
Smik_4.745 Chr4 (1316457..1319201) [2745 bp, 914 aa] {ON} YDR466...    87   1e-16
Smik_16.204 Chr16 complement(369272..370021) [750 bp, 249 aa] {O...    83   1e-16
KAFR0F00380 Chr6 complement(91358..92800) [1443 bp, 480 aa] {ON}...    86   1e-16
NCAS0C01580 Chr3 (291554..292873) [1320 bp, 439 aa] {ON} Anc_8.652     86   1e-16
CAGL0J03828g Chr10 (365325..366728) [1404 bp, 467 aa] {ON} simil...    86   1e-16
Suva_16.170 Chr16 complement(296877..298406) [1530 bp, 509 aa] {...    86   1e-16
NCAS0F02190 Chr6 complement(435844..437706) [1863 bp, 620 aa] {O...    87   1e-16
KLTH0G06974g Chr7 (556626..558125) [1500 bp, 499 aa] {ON} highly...    86   1e-16
Suva_11.54 Chr11 complement(116221..118401) [2181 bp, 726 aa] {O...    87   1e-16
KLLA0E14785g Chr5 complement(1323743..1324675) [933 bp, 310 aa] ...    84   2e-16
Ecym_3371 Chr3 (706573..706597,706675..707570) [921 bp, 306 aa] ...    84   2e-16
KAFR0A04070 Chr1 complement(817388..819325) [1938 bp, 645 aa] {O...    86   2e-16
Skud_15.432 Chr15 complement(761490..763601) [2112 bp, 703 aa] {...    87   2e-16
KAFR0G00460 Chr7 complement(128077..130023) [1947 bp, 648 aa] {O...    86   2e-16
Ecym_6425 Chr6 (825834..828095) [2262 bp, 753 aa] {ON} similar t...    87   2e-16
TDEL0G00630 Chr7 complement(128151..129764) [1614 bp, 537 aa] {O...    86   2e-16
Suva_16.439 Chr16 (755102..756796) [1695 bp, 564 aa] {ON} YPR111...    86   2e-16
Ecym_4647 Chr4 (1261859..1263511) [1653 bp, 550 aa] {ON} similar...    86   2e-16
Skud_11.56 Chr11 complement(117617..119776) [2160 bp, 719 aa] {O...    86   2e-16
TPHA0F03520 Chr6 (755480..757756) [2277 bp, 758 aa] {ON} Anc_1.5...    86   2e-16
YGR052W Chr7 (593596..594705) [1110 bp, 369 aa] {ON}  FMP48Putat...    84   2e-16
Skud_16.141 Chr16 complement(259166..260707) [1542 bp, 513 aa] {...    86   2e-16
Kpol_1044.26 s1044 complement(60216..62666) [2451 bp, 816 aa] {O...    86   2e-16
YOR267C Chr15 complement(822588..824867) [2280 bp, 759 aa] {ON} ...    86   2e-16
Skud_7.391 Chr7 (652479..654200) [1722 bp, 573 aa] {ON} YGR092W ...    86   2e-16
Smik_13.507 Chr13 (835298..837058) [1761 bp, 586 aa] {ON} YMR291...    86   2e-16
CAGL0M13541g Chr13 (1333846..1335714) [1869 bp, 622 aa] {ON} sim...    86   2e-16
SAKL0D12628g Chr4 (1048973..1051429) [2457 bp, 818 aa] {ON} weak...    86   2e-16
TDEL0B01590 Chr2 complement(280143..281573) [1431 bp, 476 aa] {O...    85   2e-16
KAFR0A07560 Chr1 (1525225..1527504) [2280 bp, 759 aa] {ON} Anc_2...    86   2e-16
YOL113W Chr15 (104326..106293) [1968 bp, 655 aa] {ON}  SKM1Membe...    86   2e-16
CAGL0H10318g Chr8 complement(1006299..1007222) [924 bp, 307 aa] ...    83   3e-16
CAGL0K04301g Chr11 (405248..406315) [1068 bp, 355 aa] {ON} simil...    84   3e-16
TBLA0F02350 Chr6 complement(578797..580467) [1671 bp, 556 aa] {O...    86   3e-16
CAGL0C02893g Chr3 complement(286017..287966) [1950 bp, 649 aa] {...    86   3e-16
Ecym_7361 Chr7 complement(753862..755313) [1452 bp, 483 aa] {ON}...    85   3e-16
ZYRO0F06798g Chr6 (558198..559676) [1479 bp, 492 aa] {ON} simila...    85   3e-16
TDEL0G02620 Chr7 (501589..501613,501677..502566) [915 bp, 304 aa...    83   3e-16
KLLA0B09790g Chr2 complement(855327..856214) [888 bp, 295 aa] {O...    82   3e-16
TBLA0B03590 Chr2 (834488..837022) [2535 bp, 844 aa] {ON} Anc_8.7...    86   3e-16
NCAS0A00280 Chr1 (40406..42013) [1608 bp, 535 aa] {ON} Anc_1.24        85   3e-16
TPHA0L02180 Chr12 (453556..455538) [1983 bp, 660 aa] {ON} Anc_5....    86   3e-16
TPHA0F02870 Chr6 complement(636574..638259) [1686 bp, 561 aa] {O...    85   3e-16
Suva_7.375 Chr7 (643870..645591) [1722 bp, 573 aa] {ON} YGR092W ...    85   3e-16
Smik_6.178 Chr6 (291601..293322) [1722 bp, 573 aa] {ON} YGR092W ...    85   3e-16
TDEL0F03120 Chr6 (570471..572192) [1722 bp, 573 aa] {ON} Anc_3.4...    85   3e-16
KLTH0C02662g Chr3 complement(240347..242674) [2328 bp, 775 aa] {...    86   3e-16
ACL191C Chr3 complement(26475..27572) [1098 bp, 365 aa] {ON} Syn...    84   4e-16
KNAG0J01950 Chr10 complement(352815..354317) [1503 bp, 500 aa] {...    85   4e-16
TBLA0A10420 Chr1 (2562614..2564092) [1479 bp, 492 aa] {ON} Anc_5...    85   4e-16
NDAI0C05340 Chr3 (1236394..1237296) [903 bp, 300 aa] {ON}              82   4e-16
NCAS0D00400 Chr4 complement(61545..63716) [2172 bp, 723 aa] {ON}...    86   4e-16
Kpol_530.41 s530 (94710..96326) [1617 bp, 538 aa] {ON} (94710..9...    85   4e-16
ZYRO0A02772g Chr1 complement(223226..224473) [1248 bp, 415 aa] {...    84   4e-16
Kwal_26.8703 s26 (905007..906341) [1335 bp, 444 aa] {ON} YOR231W...    84   4e-16
YGR092W Chr7 (668189..669907) [1719 bp, 572 aa] {ON}  DBF2Ser/Th...    85   4e-16
TBLA0C03140 Chr3 (759258..760763) [1506 bp, 501 aa] {ON} Anc_5.2...    84   4e-16
Kpol_1018.137 s1018 complement(366178..367914) [1737 bp, 578 aa]...    85   4e-16
Smik_16.354 Chr16 (625456..627150) [1695 bp, 564 aa] {ON} YPR111...    85   4e-16
TBLA0B00770 Chr2 complement(168444..170519) [2076 bp, 691 aa] {O...    85   5e-16
Smik_2.101 Chr2 (186008..187069) [1062 bp, 353 aa] {ON} YBL016W ...    83   5e-16
NCAS0C02510 Chr3 complement(468113..469390) [1278 bp, 425 aa] {O...    84   5e-16
KLTH0D10670g Chr4 (877472..878806) [1335 bp, 444 aa] {ON} some s...    84   5e-16
NDAI0F04520 Chr6 complement(1098426..1099895) [1470 bp, 489 aa] ...    84   5e-16
KLTH0G18194g Chr7 (1570885..1572132) [1248 bp, 415 aa] {ON} weak...    84   5e-16
SAKL0E06534g Chr5 complement(533369..534267,534334..534358) [924...    82   5e-16
Kwal_23.5576 s23 complement(1223517..1225031) [1515 bp, 504 aa] ...    84   5e-16
TPHA0B02440 Chr2 (560189..561592) [1404 bp, 467 aa] {ON} Anc_5.2...    84   6e-16
KLTH0E16104g Chr5 complement(1425822..1427042) [1221 bp, 406 aa]...    83   6e-16
CAGL0B04147g Chr2 (402798..404498) [1701 bp, 566 aa] {ON} highly...    84   6e-16
Ecym_6044 Chr6 complement(84500..85756) [1257 bp, 418 aa] {ON} s...    84   6e-16
NCAS0A14050 Chr1 complement(2763082..2764551) [1470 bp, 489 aa] ...    84   6e-16
Kwal_17.2687 s17 complement(6084..7172) [1089 bp, 362 aa] {ON} Y...    83   6e-16
NCAS0B02350 Chr2 complement(394128..395018) [891 bp, 296 aa] {ON...    82   7e-16
Kpol_529.18 s529 (52782..55118) [2337 bp, 778 aa] {ON} (52782..5...    85   7e-16
Suva_4.138 Chr4 (256421..257197) [777 bp, 258 aa] {ON} YDL108W (...    80   7e-16
Suva_4.411 Chr4 (729465..730361) [897 bp, 298 aa] {ON} YBR160W (...    82   7e-16
Skud_16.398 Chr16 (712145..713827) [1683 bp, 560 aa] {ON} YPR111...    84   7e-16
TDEL0A06610 Chr1 complement(1151052..1152824) [1773 bp, 590 aa] ...    84   8e-16
KAFR0C02840 Chr3 (559821..560873) [1053 bp, 350 aa] {ON} Anc_8.1...    82   8e-16
ZYRO0G18546g Chr7 (1530693..1533050) [2358 bp, 785 aa] {ON} simi...    84   8e-16
KLTH0G17512g Chr7 complement(1518329..1519426) [1098 bp, 365 aa]...    82   8e-16
TBLA0B09590 Chr2 (2272405..2273328) [924 bp, 307 aa] {ON} Anc_2....    81   8e-16
Smik_2.300 Chr2 (546211..547107) [897 bp, 298 aa] {ON} YBR160W (...    81   8e-16
ADR300C Chr4 complement(1222344..1225016) [2673 bp, 890 aa] {ON}...    85   8e-16
TPHA0O01620 Chr15 (321912..324359) [2448 bp, 815 aa] {ON} Anc_2....    84   8e-16
TDEL0A05980 Chr1 (1049221..1050771) [1551 bp, 516 aa] {ON} Anc_8...    84   9e-16
Smik_4.79 Chr4 (149246..150796) [1551 bp, 516 aa] {ON} YDL159W (...    84   9e-16
TPHA0G01450 Chr7 (297855..299861) [2007 bp, 668 aa] {ON}               84   9e-16
Smik_6.136 Chr6 (219577..220686) [1110 bp, 369 aa] {ON} YGR052W ...    82   9e-16
Ecym_8004 Chr8 complement(5273..7957) [2685 bp, 894 aa] {ON} sim...    84   1e-15
YNL183C Chr14 complement(293137..295509) [2373 bp, 790 aa] {ON} ...    84   1e-15
Kwal_14.1416 s14 (315842..316939) [1098 bp, 365 aa] {ON} YGR040W...    82   1e-15
TBLA0A08430 Chr1 complement(2075682..2076773) [1092 bp, 363 aa] ...    82   1e-15
NCAS0A11530 Chr1 (2281835..2283223) [1389 bp, 462 aa] {ON} Anc_3...    83   1e-15
Kwal_23.3992 s23 complement(515493..517208) [1716 bp, 571 aa] {O...    84   1e-15
Smik_14.147 Chr14 complement(272373..274742) [2370 bp, 789 aa] {...    84   1e-15
Smik_8.97 Chr8 complement(148421..149857) [1437 bp, 478 aa] {ON}...    83   1e-15
KAFR0E01810 Chr5 complement(372094..373524) [1431 bp, 476 aa] {O...    83   1e-15
SAKL0G10978g Chr7 (929164..930729) [1566 bp, 521 aa] {ON} highly...    83   1e-15
TPHA0P00640 Chr16 (132185..133963) [1779 bp, 592 aa] {ON} Anc_3....    83   1e-15
SAKL0E12958g Chr5 (1066434..1068653) [2220 bp, 739 aa] {ON} simi...    84   1e-15
NDAI0F03390 Chr6 (816047..818380) [2334 bp, 777 aa] {ON}               84   1e-15
NDAI0B03310 Chr2 complement(844616..845557) [942 bp, 313 aa] {ON...    81   1e-15
CAGL0J11308g Chr10 (1099969..1102155) [2187 bp, 728 aa] {ON} sim...    84   1e-15
YBL016W Chr2 (192451..193512) [1062 bp, 353 aa] {ON}  FUS3Mitoge...    81   2e-15
KLTH0D12166g Chr4 complement(987310..989061) [1752 bp, 583 aa] {...    83   2e-15
CAGL0H09152g Chr8 complement(895722..898055) [2334 bp, 777 aa] {...    84   2e-15
KLTH0F12012g Chr6 complement(1013169..1014881) [1713 bp, 570 aa]...    83   2e-15
ADR058C Chr4 complement(810939..811826) [888 bp, 295 aa] {ON} Sy...    80   2e-15
Kpol_513.7 s513 (14160..15050) [891 bp, 296 aa] {ON} (14160..150...    80   2e-15
YBR160W Chr2 (560078..560974) [897 bp, 298 aa] {ON}  CDC28Cataly...    80   2e-15
KLTH0F09504g Chr6 (824743..824770,824831..825729) [927 bp, 308 a...    80   2e-15
Kpol_1065.6 s1065 (12266..12916,12918..13280,13332..13340,13394....    82   2e-15
Skud_7.350 Chr7 (580913..582022) [1110 bp, 369 aa] {ON} YGR052W ...    81   2e-15
YPR111W Chr16 (747306..749000) [1695 bp, 564 aa] {ON}  DBF20Ser/...    83   2e-15
Kwal_26.8941 s26 complement(1014543..1016528) [1986 bp, 661 aa] ...    83   2e-15
Suva_15.216 Chr15 complement(376197..377624) [1428 bp, 475 aa] {...    82   2e-15
SAKL0F06094g Chr6 (457709..459442) [1734 bp, 577 aa] {ON} unipro...    83   2e-15
TBLA0C06820 Chr3 (1645811..1647508) [1698 bp, 565 aa] {ON} Anc_5...    82   2e-15
NDAI0H00610 Chr8 complement(141913..143022) [1110 bp, 369 aa] {O...    81   2e-15
YHR030C Chr8 complement(168890..170344) [1455 bp, 484 aa] {ON}  ...    82   2e-15
Smik_4.25 Chr4 complement(52454..54547) [2094 bp, 697 aa] {ON} Y...    83   2e-15
TPHA0C02880 Chr3 (623723..624778) [1056 bp, 351 aa] {ON} Anc_8.1...    81   2e-15
TBLA0B09740 Chr2 (2312062..2314815) [2754 bp, 917 aa] {ON} Anc_2...    83   2e-15
YOR231W Chr15 (772601..774127) [1527 bp, 508 aa] {ON}  MKK1Mitog...    82   2e-15
Kwal_27.11777 s27 (942591..943985) [1395 bp, 464 aa] {ON} YPL026...    82   2e-15
CAGL0G03047g Chr7 (282299..283918) [1620 bp, 539 aa] {ON} highly...    82   3e-15
Kpol_513.17 s513 (49097..50824) [1728 bp, 575 aa] {ON} (49097..5...    82   3e-15
Skud_4.39 Chr4 complement(70857..72947) [2091 bp, 696 aa] {ON} Y...    82   3e-15
Kpol_1072.1 s1072 (686..2683) [1998 bp, 665 aa] {ON} (686..2683)...    82   3e-15
YDL159W Chr4 (172481..174028) [1548 bp, 515 aa] {ON}  STE7Signal...    82   3e-15
Suva_2.105 Chr2 (186428..187489) [1062 bp, 353 aa] {ON} YBL016W ...    80   3e-15
NDAI0C03610 Chr3 (829317..831476) [2160 bp, 719 aa] {ON} Anc_5.38      82   3e-15
ZYRO0G16082g Chr7 complement(1320266..1321714) [1449 bp, 482 aa]...    82   3e-15
Ecym_5252 Chr5 (525687..526976) [1290 bp, 429 aa] {ON} similar t...    81   3e-15
ZYRO0D10252g Chr4 (860458..863109) [2652 bp, 883 aa] {ON} simila...    83   3e-15
Suva_8.282 Chr8 (511665..513185) [1521 bp, 506 aa] {ON} YOR231W ...    82   3e-15
KAFR0G00440 Chr7 (124896..127328) [2433 bp, 810 aa] {ON} Anc_1.1...    82   3e-15
KNAG0B01130 Chr2 complement(208528..210279) [1752 bp, 583 aa] {O...    82   3e-15
Skud_2.287 Chr2 (527443..528339) [897 bp, 298 aa] {ON} YBR160W (...    79   3e-15
Kwal_26.8347 s26 complement(748254..750032) [1779 bp, 592 aa] {O...    82   4e-15
Suva_4.87 Chr4 (160236..161810) [1575 bp, 524 aa] {ON} YDL159W (...    82   4e-15
Skud_8.86 Chr8 complement(149508..150953) [1446 bp, 481 aa] {ON}...    81   4e-15
CAGL0H07535g Chr8 (736241..737137) [897 bp, 298 aa] {ON} highly ...    79   4e-15
NDAI0B02900 Chr2 complement(737651..738709) [1059 bp, 352 aa] {O...    80   4e-15
Ecym_2566 Chr2 (1105239..1106126) [888 bp, 295 aa] {ON} similar ...    79   4e-15
Ecym_6196 Chr6 (364576..365652) [1077 bp, 358 aa] {ON} similar t...    80   4e-15
CAGL0K04169g Chr11 (384567..385763) [1197 bp, 398 aa] {ON} simil...    80   4e-15
KLLA0D14905g Chr4 (1256065..1257768) [1704 bp, 567 aa] {ON} simi...    81   5e-15
Skud_15.397 Chr15 (711559..713082) [1524 bp, 507 aa] {ON} YOR231...    81   5e-15
Smik_15.415 Chr15 (722292..723815) [1524 bp, 507 aa] {ON} YOR231...    81   5e-15
CAGL0K01617g Chr11 complement(143308..145632) [2325 bp, 774 aa] ...    82   5e-15
Kpol_1055.25 s1055 complement(62930..67933) [5004 bp, 1667 aa] {...    82   5e-15
Kwal_YGOB_23.3471 s23 (305207..305234,305298..306196) [927 bp, 3...    79   6e-15
TDEL0F00840 Chr6 (144884..146875) [1992 bp, 663 aa] {ON} Anc_2.9...    82   6e-15
ZYRO0C12408g Chr3 (979857..981593) [1737 bp, 578 aa] {ON} highly...    81   6e-15
Smik_4.494 Chr4 (900954..902321) [1368 bp, 455 aa] {ON} YDR247W ...    80   6e-15
CAGL0M10829g Chr13 complement(1076233..1081236) [5004 bp, 1667 a...    82   6e-15
ACR117W Chr3 (557738..559312) [1575 bp, 524 aa] {ON} Syntenic ho...    81   6e-15
KAFR0K01540 Chr11 (320997..322706) [1710 bp, 569 aa] {ON} Anc_3....    81   6e-15
KLTH0E11110g Chr5 (997486..998847) [1362 bp, 453 aa] {ON} simila...    80   6e-15
KAFR0E03030 Chr5 (606567..607457) [891 bp, 296 aa] {ON} Anc_8.51...    79   6e-15
AER222C Chr5 complement(1043479..1044750) [1272 bp, 423 aa] {ON}...    80   7e-15
ZYRO0F11418g Chr6 complement(936573..938117) [1545 bp, 514 aa] {...    80   7e-15
SAKL0G08250g Chr7 (703212..705707) [2496 bp, 831 aa] {ON} simila...    81   7e-15
SAKL0H05588g Chr8 (502752..504602) [1851 bp, 616 aa] {ON} simila...    81   8e-15
Kwal_27.11919 s27 (1003201..1003827) [627 bp, 209 aa] {OFF} YBR1...    76   8e-15
Skud_4.97 Chr4 (168099..169670) [1572 bp, 523 aa] {ON} YDL159W (...    80   9e-15
KAFR0D04500 Chr4 (887515..889989) [2475 bp, 824 aa] {ON} Anc_1.5...    81   1e-14
Ecym_4448 Chr4 complement(917136..918872) [1737 bp, 578 aa] {ON}...    80   1e-14
TDEL0D04450 Chr4 complement(811665..812924) [1260 bp, 419 aa] {O...    80   1e-14
Skud_2.90 Chr2 (176138..177199) [1062 bp, 353 aa] {ON} YBL016W (...    79   1e-14
Kwal_55.21709 s55 (948619..949641) [1023 bp, 340 aa] {ON} YOR061...    79   1e-14
NCAS0B00420 Chr2 complement(54562..56718) [2157 bp, 718 aa] {ON}...    80   1e-14
KLLA0B11902g Chr2 (1041657..1043144) [1488 bp, 495 aa] {ON} unip...    80   1e-14
ZYRO0C13156g Chr3 complement(1041022..1042068) [1047 bp, 348 aa]...    79   1e-14
TDEL0C06780 Chr3 complement(1236767..1238173) [1407 bp, 468 aa] ...    80   1e-14
Kpol_2002.24 s2002 (48405..49868) [1464 bp, 487 aa] {ON} (48405....    80   1e-14
ZYRO0A07062g Chr1 (576600..576615,576675..577561) [903 bp, 300 a...    78   1e-14
KNAG0A02350 Chr1 complement(223757..225022) [1266 bp, 421 aa] {O...    79   1e-14
SAKL0B04488g Chr2 (395136..396242) [1107 bp, 368 aa] {ON} highly...    79   1e-14
TPHA0E03850 Chr5 complement(810694..812142) [1449 bp, 482 aa] {O...    79   1e-14
Ecym_8337 Chr8 (679844..681460) [1617 bp, 538 aa] {ON} similar t...    80   1e-14
KNAG0K01250 Chr11 (246241..247467) [1227 bp, 408 aa] {ON} Anc_3....    79   2e-14
SAKL0H10758g Chr8 complement(930403..931302) [900 bp, 299 aa] {O...    77   2e-14
KAFR0G01200 Chr7 (273238..274761) [1524 bp, 507 aa] {ON} Anc_1.2...    79   2e-14
Smik_11.97 Chr11 (168854..170491) [1638 bp, 545 aa] {ON} YKL139W...    80   2e-14
ADR163W Chr4 (989728..991008) [1281 bp, 426 aa] {ON} Syntenic ho...    79   2e-14
TBLA0A08810 Chr1 (2161249..2162304) [1056 bp, 351 aa] {ON} Anc_8...    78   2e-14
Kpol_1041.9 s1041 (27806..29059) [1254 bp, 417 aa] {ON} (27806.....    79   2e-14
Suva_2.703 Chr2 complement(1238496..1239953) [1458 bp, 485 aa] {...    79   2e-14
CAGL0F03707g Chr6 complement(359839..361665) [1827 bp, 608 aa] {...    80   2e-14
TPHA0L01470 Chr12 (303604..304497) [894 bp, 297 aa] {ON} Anc_8.5...    77   2e-14
KNAG0D04040 Chr4 (730581..731897) [1317 bp, 438 aa] {ON} Anc_4.1...    79   2e-14
NCAS0A06680 Chr1 (1320265..1321704) [1440 bp, 479 aa] {ON} Anc_5...    79   2e-14
NDAI0G01280 Chr7 complement(281834..283573) [1740 bp, 579 aa] {O...    80   2e-14
KLLA0D07304g Chr4 (623352..624749) [1398 bp, 465 aa] {ON} some s...    79   2e-14
ZYRO0G20306g Chr7 complement(1675578..1677227) [1650 bp, 549 aa]...    79   2e-14
KNAG0M01450 Chr13 (254622..256061) [1440 bp, 479 aa] {ON}              79   2e-14
Skud_4.797 Chr4 complement(1405618..1407075) [1458 bp, 485 aa] {...    79   2e-14
CAGL0J00539g Chr10 (47095..48561) [1467 bp, 488 aa] {ON} highly ...    79   2e-14
KLLA0A02717g Chr1 (245082..246380) [1299 bp, 432 aa] {ON} weakly...    79   2e-14
KLLA0E17073g Chr5 complement(1515721..1518279) [2559 bp, 852 aa]...    80   2e-14
Kwal_23.5668 s23 (1263868..1268937) [5070 bp, 1689 aa] {ON} YDR2...    80   3e-14
KAFR0D02900 Chr4 (575853..577313) [1461 bp, 486 aa] {ON} Anc_7.5...    79   3e-14
ZYRO0G16632g Chr7 (1360854..1365827) [4974 bp, 1657 aa] {ON} hig...    80   3e-14
YDR283C Chr4 complement(1025070..1030049) [4980 bp, 1659 aa] {ON...    80   3e-14
TPHA0G00730 Chr7 (139442..141364) [1923 bp, 640 aa] {ON} Anc_8.7...    79   3e-14
TDEL0C02110 Chr3 (364853..366340) [1488 bp, 495 aa] {ON} Anc_7.3...    79   3e-14
Kwal_27.9773 s27 (57252..58472) [1221 bp, 406 aa] {ON} YAR018C (...    78   3e-14
Skud_14.151 Chr14 complement(284115..286490) [2376 bp, 791 aa] {...    79   3e-14
TBLA0A07460 Chr1 (1848207..1849757) [1551 bp, 516 aa] {ON} Anc_1...    79   3e-14
ADR033W Chr4 (764716..766449) [1734 bp, 577 aa] {ON} Syntenic ho...    79   4e-14
NCAS0B05560 Chr2 complement(1050313..1051371) [1059 bp, 352 aa] ...    77   4e-14
KLLA0A09713g Chr1 (851952..853625) [1674 bp, 557 aa] {ON} simila...    79   4e-14
KLTH0D08712g Chr4 complement(728072..729886) [1815 bp, 604 aa] {...    79   4e-14
TPHA0G01730 Chr7 complement(355001..356779) [1779 bp, 592 aa] {O...    79   4e-14
NCAS0G01820 Chr7 complement(323288..325690) [2403 bp, 800 aa] {O...    79   4e-14
TDEL0B01250 Chr2 complement(228145..229038) [894 bp, 297 aa] {ON...    76   4e-14
SAKL0B11308g Chr2 complement(984543..986369) [1827 bp, 608 aa] {...    79   5e-14
Suva_7.334 Chr7 (568847..569956) [1110 bp, 369 aa] {ON} YGR052W ...    77   5e-14
Kpol_1032.10 s1032 (24479..26854) [2376 bp, 791 aa] {ON} (24479....    79   5e-14
Smik_6.46 Chr6 complement(84451..89733) [5283 bp, 1760 aa] {ON} ...    79   6e-14
Smik_4.803 Chr4 complement(1408345..1409817) [1473 bp, 490 aa] {...    78   6e-14
Skud_15.39 Chr15 (69445..71412) [1968 bp, 655 aa] {ON} YOL113W (...    78   6e-14
ZYRO0C09768g Chr3 (740592..742925) [2334 bp, 777 aa] {ON} simila...    79   6e-14
NDAI0D01620 Chr4 (386654..388132) [1479 bp, 492 aa] {ON} Anc_5.274     78   6e-14
KAFR0F02190 Chr6 (428623..430095) [1473 bp, 490 aa] {ON} Anc_3.1...    77   6e-14
AFR019W Chr6 (471481..472560) [1080 bp, 359 aa] {ON} Syntenic ho...    76   6e-14
CAGL0K11275g Chr11 (1094626..1096203) [1578 bp, 525 aa] {ON} sim...    78   7e-14
YDR247W Chr4 (956013..957398) [1386 bp, 461 aa] {ON}  VHS1Cytopl...    77   7e-14
TBLA0J00990 Chr10 (224999..227335) [2337 bp, 778 aa] {ON} Anc_1....    78   7e-14
CAGL0H01639g Chr8 (158967..160532) [1566 bp, 521 aa] {ON} simila...    77   7e-14
NDAI0C04000 Chr3 (907842..912812) [4971 bp, 1656 aa] {ON} Anc_5....    79   7e-14
KNAG0A04080 Chr1 complement(551409..552635) [1227 bp, 408 aa] {O...    77   7e-14
KNAG0A03900 Chr1 complement(520500..521390) [891 bp, 296 aa] {ON...    75   7e-14
NDAI0E03210 Chr5 complement(686073..687317) [1245 bp, 414 aa] {O...    77   7e-14
AFR372W Chr6 (1109169..1111493) [2325 bp, 774 aa] {ON} Syntenic ...    78   8e-14
ACR196C Chr3 complement(692321..693913) [1593 bp, 530 aa] {ON} S...    77   8e-14
YDR523C Chr4 complement(1485566..1487038) [1473 bp, 490 aa] {ON}...    77   8e-14
Suva_2.449 Chr2 complement(789612..794603) [4992 bp, 1663 aa] {O...    79   8e-14
NDAI0E00960 Chr5 (195116..197251) [2136 bp, 711 aa] {ON} Anc_8.716     78   8e-14
KLLA0C10802g Chr3 complement(926916..931934) [5019 bp, 1672 aa] ...    78   9e-14
KAFR0C00920 Chr3 complement(185475..186674) [1200 bp, 399 aa] {O...    76   9e-14
Skud_6.38 Chr6 complement(72416..77692) [5277 bp, 1758 aa] {ON} ...    78   9e-14
YFL033C Chr6 complement(69115..74427) [5313 bp, 1770 aa] {ON}  R...    78   9e-14
KLTH0G06468g Chr7 complement(513119..518251) [5133 bp, 1710 aa] ...    78   1e-13
Suva_6.26 Chr6 complement(42811..48072) [5262 bp, 1753 aa] {ON} ...    78   1e-13
CAGL0L05632g Chr12 (612478..614511) [2034 bp, 677 aa] {ON} simil...    77   1e-13
TDEL0B04490 Chr2 (792559..793629) [1071 bp, 356 aa] {ON} Anc_8.1...    76   1e-13
Smik_4.532 Chr4 complement(956572..961554) [4983 bp, 1660 aa] {O...    78   1e-13
SAKL0H19668g Chr8 (1736301..1737674) [1374 bp, 457 aa] {ON} high...    77   1e-13
KLLA0F26983g Chr6 (2489326..2490729) [1404 bp, 467 aa] {ON} some...    77   1e-13
TDEL0A01120 Chr1 complement(189217..191466) [2250 bp, 749 aa] {O...    77   1e-13
TBLA0H03440 Chr8 (840759..841643) [885 bp, 294 aa] {ON} Anc_8.51...    75   1e-13
ZYRO0A12826g Chr1 (1014651..1015751) [1101 bp, 366 aa] {ON} high...    75   1e-13
KLTH0G18612g Chr7 (1604066..1608640) [4575 bp, 1524 aa] {ON} sim...    78   1e-13
Skud_4.546 Chr4 complement(967636..972618) [4983 bp, 1660 aa] {O...    77   2e-13
KAFR0E01490 Chr5 (298209..303167) [4959 bp, 1652 aa] {ON} Anc_5....    77   2e-13
KLLA0D12100g Chr4 complement(1031728..1033161) [1434 bp, 477 aa]...    76   2e-13
Skud_16.256 Chr16 complement(465728..467362) [1635 bp, 544 aa] {...    76   2e-13
CAGL0H01199g Chr8 (110610..115556) [4947 bp, 1648 aa] {ON} highl...    77   2e-13
KLTH0D04356g Chr4 (405904..405987,406076..407401) [1410 bp, 469 ...    76   2e-13
CAGL0M13167g Chr13 complement(1293074..1294906) [1833 bp, 610 aa...    76   2e-13
TPHA0J00630 Chr10 (139476..140600) [1125 bp, 374 aa] {ON} Anc_4....    75   2e-13
Kpol_448.13 s448 (25051..27063) [2013 bp, 670 aa] {ON} (25051..2...    76   2e-13
TBLA0D03740 Chr4 complement(926538..929057) [2520 bp, 839 aa] {O...    77   2e-13
KAFR0B00920 Chr2 (170792..172300) [1509 bp, 502 aa] {ON} Anc_7.3...    76   2e-13
YKL161C Chr11 complement(149386..150687) [1302 bp, 433 aa] {ON} ...    75   2e-13
NDAI0A04040 Chr1 complement(907696..910041) [2346 bp, 781 aa] {O...    76   2e-13
NDAI0A04760 Chr1 complement(1088637..1090103) [1467 bp, 488 aa] ...    75   3e-13
TBLA0G03450 Chr7 (913497..919415) [5919 bp, 1972 aa] {ON} Anc_8....    77   3e-13
TBLA0B01990 Chr2 complement(458264..461623) [3360 bp, 1119 aa] {...    77   3e-13
SAKL0F11110g Chr6 (868447..869832) [1386 bp, 461 aa] {ON} simila...    75   3e-13
ZYRO0F18062g Chr6 complement(1494752..1496167) [1416 bp, 471 aa]...    75   3e-13
Skud_11.88 Chr11 (169115..170659) [1545 bp, 514 aa] {ON} YKL139W...    75   3e-13
NDAI0G06150 Chr7 (1519393..1521780) [2388 bp, 795 aa] {ON} Anc_1...    76   3e-13
Kwal_23.3471 s23 (305414..306196) [783 bp, 260 aa] {OFF} YDL108W...    73   3e-13
YKL139W Chr11 (182958..184544) [1587 bp, 528 aa] {ON}  CTK1Catal...    75   3e-13
CAGL0J04972g Chr10 (475587..476606) [1020 bp, 339 aa] {ON} some ...    74   4e-13
ZYRO0F08778g Chr6 (702733..703626) [894 bp, 297 aa] {ON} highly ...    73   4e-13
Kwal_26.7552 s26 (416444..417829) [1386 bp, 461 aa] {ON} YKL139W...    75   4e-13
ZYRO0D03344g Chr4 complement(278347..280326) [1980 bp, 659 aa] {...    75   4e-13
NCAS0B02530 Chr2 complement(422882..424207) [1326 bp, 441 aa] {O...    75   4e-13
TBLA0D05640 Chr4 (1380616..1383066) [2451 bp, 816 aa] {ON} Anc_1...    76   4e-13
TPHA0H01500 Chr8 complement(336652..339639) [2988 bp, 995 aa] {O...    76   4e-13
NDAI0H03740 Chr8 (912611..915373) [2763 bp, 920 aa] {ON} Anc_2.71      76   4e-13
Kpol_1064.31 s1064 complement(52651..54350) [1700 bp, 566.666666...    75   5e-13
KNAG0C01020 Chr3 (200271..202595) [2325 bp, 774 aa] {ON} Anc_1.1...    75   5e-13
Kpol_YGOB_1064.31 s1064 complement(52620..54350) [1731 bp, 577 a...    75   5e-13
Ecym_4056 Chr4 complement(119406..120428) [1023 bp, 340 aa] {ON}...    74   5e-13
TDEL0E02510 Chr5 (486415..489156) [2742 bp, 913 aa] {ON} Anc_5.3...    75   5e-13
TDEL0D02650 Chr4 complement(505536..506636) [1101 bp, 366 aa] {O...    74   5e-13
Suva_11.86 Chr11 (169096..170685) [1590 bp, 529 aa] {ON} YKL139W...    75   5e-13
Skud_4.509 Chr4 (910551..911945) [1395 bp, 464 aa] {ON} YDR247W ...    74   6e-13
KNAG0F03410 Chr6 (640115..645094) [4980 bp, 1659 aa] {ON}              75   6e-13
Suva_16.291 Chr16 complement(504006..505433) [1428 bp, 475 aa] {...    74   6e-13
CAGL0K12562g Chr11 (1235695..1240743) [5049 bp, 1682 aa] {ON} si...    75   6e-13
Kpol_1031.32 s1031 (76827..78821) [1995 bp, 664 aa] {ON} (76827....    75   6e-13
Ecym_1508 Chr1 (1045857..1050941) [5085 bp, 1694 aa] {ON} simila...    75   7e-13
NDAI0D04050 Chr4 (952438..953538) [1101 bp, 366 aa] {ON} Anc_4.184     73   7e-13
SAKL0E04092g Chr5 complement(326532..327901,327970..327982) [138...    74   7e-13
AAL083W Chr1 (196774..201870) [5097 bp, 1698 aa] {ON} Syntenic h...    75   8e-13
CAGL0I08349g Chr9 complement(813998..816001) [2004 bp, 667 aa] {...    75   8e-13
TDEL0B06900 Chr2 complement(1220590..1222257) [1668 bp, 555 aa] ...    74   8e-13
KNAG0D03980 Chr4 (721049..722170) [1122 bp, 373 aa] {ON} Anc_4.1...    73   8e-13
CAGL0J06072g Chr10 complement(574501..576822) [2322 bp, 773 aa] ...    75   8e-13
KLTH0F17490g Chr6 (1413752..1414774) [1023 bp, 340 aa] {ON} high...    73   8e-13
Ecym_1313 Chr1 complement(633556..634455) [900 bp, 299 aa] {ON} ...    72   9e-13
TBLA0D01200 Chr4 (303528..305198) [1671 bp, 556 aa] {ON} Anc_8.7...    74   1e-12
Ecym_8164 Chr8 (342672..346076) [3405 bp, 1134 aa] {ON} similar ...    75   1e-12
Kpol_499.3 s499 complement(6075..7199) [1125 bp, 374 aa] {ON} co...    73   1e-12
KLLA0B06501g Chr2 complement(576636..579089) [2454 bp, 817 aa] {...    74   1e-12
NCAS0A12200 Chr1 (2417539..2419782) [2244 bp, 747 aa] {ON} Anc_1...    74   1e-12
KNAG0B00260 Chr2 complement(36240..38477) [2238 bp, 745 aa] {ON}...    74   1e-12
KNAG0C01040 Chr3 complement(203429..204976) [1548 bp, 515 aa] {O...    74   1e-12
KNAG0F01240 Chr6 complement(223003..225591) [2589 bp, 862 aa] {O...    74   1e-12
Smik_16.209 Chr16 complement(377965..379425) [1461 bp, 486 aa] {...    73   1e-12
KNAG0E03200 Chr5 complement(641437..646020) [4584 bp, 1527 aa] {...    74   1e-12
NCAS0F02520 Chr6 (495799..500631) [4833 bp, 1610 aa] {ON} Anc_5....    74   2e-12
TPHA0D01770 Chr4 (365255..370279) [5025 bp, 1674 aa] {ON} Anc_5....    74   2e-12
TPHA0D00360 Chr4 complement(55596..60206) [4611 bp, 1536 aa] {ON...    74   2e-12
CAGL0J04290g Chr10 complement(403542..404615) [1074 bp, 357 aa] ...    72   2e-12
YPL026C Chr16 complement(500675..502183) [1509 bp, 502 aa] {ON} ...    73   2e-12
KAFR0I01570 Chr9 (330982..332574) [1593 bp, 530 aa] {ON} Anc_2.5...    73   2e-12
TPHA0G02090 Chr7 complement(429178..430527) [1350 bp, 449 aa] {O...    73   2e-12
ACR218W Chr3 (731433..736142) [4710 bp, 1569 aa] {ON} Syntenic h...    74   2e-12
KAFR0H01460 Chr8 complement(269957..271705) [1749 bp, 582 aa] {O...    73   2e-12
YJL128C Chr10 complement(178097..180103) [2007 bp, 668 aa] {ON} ...    73   2e-12
AEL179W Chr5 (302948..303817) [870 bp, 289 aa] {ON} NOHBY510; No...    71   2e-12
TDEL0A02010 Chr1 (365325..366782) [1458 bp, 485 aa] {ON} Anc_2.4...    73   2e-12
CAGL0H01837g Chr8 complement(176352..178736) [2385 bp, 794 aa] {...    73   2e-12
NCAS0C05490 Chr3 (1114733..1115755) [1023 bp, 340 aa] {ON} Anc_5...    72   2e-12
SAKL0B04752g Chr2 (416940..418259) [1320 bp, 439 aa] {ON} weakly...    72   2e-12
Kpol_1018.148 s1018 (393064..394413) [1350 bp, 449 aa] {ON} (393...    72   2e-12
NCAS0A09750 Chr1 (1940202..1942370) [2169 bp, 722 aa] {ON}             73   3e-12
TPHA0O01080 Chr15 complement(205407..207653) [2247 bp, 748 aa] {...    73   3e-12
Skud_10.87 Chr10 complement(153140..155164) [2025 bp, 674 aa] {O...    73   3e-12
SAKL0E04950g Chr5 (401903..402994) [1092 bp, 363 aa] {ON} highly...    72   3e-12
ADR204W Chr4 (1062593..1063612) [1020 bp, 339 aa] {ON} Syntenic ...    71   3e-12
TDEL0F00530 Chr6 complement(88187..90517) [2331 bp, 776 aa] {ON}...    73   3e-12
ABL143C Chr2 complement(128215..130392) [2178 bp, 725 aa] {ON} S...    73   3e-12
Kwal_55.20189 s55 (288918..291356) [2439 bp, 812 aa] {ON} YHR082...    73   3e-12
SAKL0C07744g Chr3 (720519..721799) [1281 bp, 426 aa] {ON} simila...    72   3e-12
CAGL0M08360g Chr13 complement(833220..835520) [2301 bp, 766 aa] ...    73   3e-12
TPHA0H00750 Chr8 complement(150811..152043) [1233 bp, 410 aa] {O...    72   3e-12
CAGL0D02002g Chr4 (207419..209080) [1662 bp, 553 aa] {ON} simila...    72   4e-12
ADR293C Chr4 complement(1207021..1210425) [3405 bp, 1134 aa] {ON...    73   4e-12
KLLA0E10539g Chr5 (929989..931104) [1116 bp, 371 aa] {ON} highly...    71   4e-12
Kwal_14.1159 s14 complement(219896..224461) [4566 bp, 1521 aa] {...    73   4e-12
Kwal_55.22001 s55 (1069907..1070998) [1092 bp, 363 aa] {ON} YNL3...    71   4e-12
KAFR0G01810 Chr7 (386620..389130) [2511 bp, 836 aa] {ON} Anc_1.2...    72   4e-12
KLTH0E03652g Chr5 (330227..332671) [2445 bp, 814 aa] {ON} simila...    72   4e-12
YNL020C Chr14 complement(595623..597539) [1917 bp, 638 aa] {ON} ...    72   4e-12
Skud_15.228 Chr15 (403382..404401) [1020 bp, 339 aa] {ON} YOR061...    70   4e-12
KNAG0G01430 Chr7 complement(322758..323822) [1065 bp, 354 aa] {O...    71   5e-12
TBLA0D02070 Chr4 complement(522456..523958) [1503 bp, 500 aa] {O...    72   5e-12
YKL048C Chr11 complement(347214..349136) [1923 bp, 640 aa] {ON} ...    72   5e-12
YOR061W Chr15 (441534..442553) [1020 bp, 339 aa] {ON}  CKA2Alpha...    70   5e-12
Suva_8.111 Chr8 (204414..205433) [1020 bp, 339 aa] {ON} YOR061W ...    70   5e-12
Kpol_1037.7 s1037 (15938..17182) [1245 bp, 414 aa] {ON} (15938.....    71   5e-12
TDEL0E03300 Chr5 complement(621448..626409) [4962 bp, 1653 aa] {...    72   6e-12
TPHA0C01810 Chr3 complement(413495..414790) [1296 bp, 431 aa] {O...    71   6e-12
TBLA0B06940 Chr2 (1639189..1643520) [4332 bp, 1443 aa] {ON} Anc_...    72   6e-12
KAFR0F03900 Chr6 (763094..764203) [1110 bp, 369 aa] {ON} Anc_4.1...    70   6e-12
KAFR0C03520 Chr3 (715667..720019) [4353 bp, 1450 aa] {ON} Anc_8....    72   6e-12
Smik_10.106 Chr10 complement(175752..177776) [2025 bp, 674 aa] {...    72   7e-12
KLLA0F01408g Chr6 (135424..136302) [879 bp, 292 aa] {ON} conserv...    69   7e-12
NCAS0A04220 Chr1 (855791..857353) [1563 bp, 520 aa] {ON} Anc_2.425     71   8e-12
YJR059W Chr10 (545787..548243) [2457 bp, 818 aa] {ON}  PTK2Putat...    72   8e-12
KLTH0F18942g Chr6 (1535941..1537032) [1092 bp, 363 aa] {ON} high...    70   9e-12
NCAS0A02120 Chr1 (401097..402230) [1134 bp, 377 aa] {ON} Anc_4.184     70   9e-12
Kpol_1060.53 s1060 complement(126120..128330) [2211 bp, 736 aa] ...    71   9e-12
SAKL0G00990g Chr7 complement(89700..90824) [1125 bp, 374 aa] {ON...    70   9e-12
TPHA0H01300 Chr8 (293254..294282) [1029 bp, 342 aa] {ON} Anc_5.6...    70   1e-11
TPHA0B01150 Chr2 complement(259998..262070) [2073 bp, 690 aa] {O...    71   1e-11
NDAI0C01850 Chr3 (407978..411712) [3735 bp, 1244 aa] {ON}              72   1e-11
SAKL0G10384g Chr7 complement(883824..888848) [5025 bp, 1674 aa] ...    72   1e-11
Kpol_1035.40 s1035 (101912..102910,102960..102968,103011..106556...    72   1e-11
NCAS0G03420 Chr7 (628644..630668) [2025 bp, 674 aa] {ON} Anc_1.507     71   1e-11
SAKL0B01210g Chr2 complement(109892..114658) [4767 bp, 1588 aa] ...    71   1e-11
ZYRO0G04488g Chr7 complement(360635..362545) [1911 bp, 636 aa] {...    71   1e-11
Smik_8.156 Chr8 complement(234928..238269) [3342 bp, 1113 aa] {O...    71   1e-11
Skud_10.283 Chr10 (503324..505765) [2442 bp, 813 aa] {ON} YJR059...    71   1e-11
TBLA0C05800 Chr3 complement(1402262..1405207) [2946 bp, 981 aa] ...    71   1e-11
CAGL0F03311g Chr6 complement(327599..330736) [3138 bp, 1045 aa] ...    71   1e-11
Suva_14.327 Chr14 complement(578572..580470) [1899 bp, 632 aa] {...    70   1e-11
NDAI0D01450 Chr4 (339780..341948) [2169 bp, 722 aa] {ON} Anc_1.507     70   1e-11
Kwal_27.11830 s27 (964584..966311) [1728 bp, 575 aa] {ON} YPL042...    70   2e-11
ZYRO0A05192g Chr1 complement(416951..418198) [1248 bp, 415 aa] {...    70   2e-11
Kpol_489.20 s489 complement(59150..60178) [1029 bp, 342 aa] {ON}...    69   2e-11
Klac_YGOB_Anc_8.34 Chr6 (836287..839007,839010..841004) [4716 bp...    71   2e-11
CAGL0I03498g Chr9 (297344..298699) [1356 bp, 451 aa] {ON} simila...    70   2e-11
KLLA0E12145g Chr5 (1080245..1081612) [1368 bp, 455 aa] {ON} simi...    70   2e-11
KNAG0J02660 Chr10 (495011..497425) [2415 bp, 804 aa] {ON} Anc_1....    70   2e-11
Skud_14.309 Chr14 complement(566344..568263) [1920 bp, 639 aa] {...    70   2e-11
Suva_7.325 Chr7 (550760..551866) [1107 bp, 368 aa] {ON} YGR040W ...    69   2e-11
KNAG0H02020 Chr8 complement(357248..359026) [1779 bp, 592 aa] {O...    70   2e-11
Suva_6.208 Chr6 (369853..371880) [2028 bp, 675 aa] {ON} YJL128C ...    70   2e-11
Kpol_365.3 s365 complement(2204..4177,4180..4206,4209..4874) [26...    70   2e-11
NCAS0C03770 Chr3 complement(761101..765897) [4797 bp, 1598 aa] {...    70   2e-11
TBLA0D02730 Chr4 complement(674994..676427) [1434 bp, 477 aa] {O...    69   2e-11
YHR082C Chr8 complement(268459..271548) [3090 bp, 1029 aa] {ON} ...    70   2e-11
NDAI0G00640 Chr7 (139655..141520) [1866 bp, 621 aa] {ON} Anc_2.284     70   3e-11
KNAG0C03830 Chr3 (751393..752877) [1485 bp, 494 aa] {ON} Anc_7.3...    69   3e-11
CAGL0G02035g Chr7 (179911..180930) [1020 bp, 339 aa] {ON} highly...    68   3e-11
KNAG0B04500 Chr2 (865766..869089) [3324 bp, 1107 aa] {ON} Anc_5....    70   3e-11
Smik_6.125 Chr6 (201071..202177) [1107 bp, 368 aa] {ON} YGR040W ...    69   3e-11
Suva_12.148 Chr12 (223571..225982) [2412 bp, 804 aa] {ON} YJR059...    70   3e-11
Smik_16.420 Chr16 complement(725685..727658) [1974 bp, 657 aa] {...    69   3e-11
Suva_11.178 Chr11 complement(330253..332184) [1932 bp, 643 aa] {...    69   3e-11
KAFR0D04800 Chr4 complement(942369..944690) [2322 bp, 773 aa] {O...    70   3e-11
TDEL0C00590 Chr3 complement(94223..99031) [4809 bp, 1602 aa] {ON...    70   3e-11
TBLA0H01820 Chr8 (429920..433417) [3498 bp, 1165 aa] {ON} Anc_5....    70   4e-11
ZYRO0F03014g Chr6 complement(255189..260003) [4815 bp, 1604 aa] ...    70   4e-11
Smik_8.160 Chr8 complement(245207..248323) [3117 bp, 1038 aa] {O...    70   4e-11
NDAI0E03080 Chr5 complement(653882..655798) [1917 bp, 638 aa] {O...    69   4e-11
TDEL0B02610 Chr2 complement(470263..471282) [1020 bp, 339 aa] {O...    68   4e-11
TDEL0B01470 Chr2 complement(257397..259169) [1773 bp, 590 aa] {O...    69   4e-11
Skud_7.337 Chr7 (562750..563856) [1107 bp, 368 aa] {ON} YGR040W ...    68   4e-11
CAGL0F03245g Chr6 complement(316924..320034) [3111 bp, 1036 aa] ...    69   4e-11
Skud_13.300 Chr13 (519521..520633) [1113 bp, 370 aa] {ON} YMR139...    68   4e-11
SAKL0C12870g Chr3 (1145051..1146142) [1092 bp, 363 aa] {ON} high...    68   5e-11
Suva_3.129 Chr3 (193311..194282) [972 bp, 323 aa] {ON} YCR091W (...    67   5e-11
Kpol_1056.20 s1056 complement(44529..46724) [2196 bp, 731 aa] {O...    69   5e-11
TBLA0A01580 Chr1 complement(367370..369976) [2607 bp, 868 aa] {O...    69   5e-11
NCAS0F02410 Chr6 complement(476683..478071) [1389 bp, 462 aa] {O...    68   5e-11
NDAI0G03110 Chr7 complement(725984..731107) [5124 bp, 1707 aa] {...    69   5e-11
Smik_14.311 Chr14 complement(558013..559926) [1914 bp, 637 aa] {...    69   5e-11
KNAG0A05920 Chr1 complement(883522..884742) [1221 bp, 406 aa] {O...    68   5e-11
TBLA0A09370 Chr1 complement(2310412..2311443) [1032 bp, 343 aa] ...    67   5e-11
Skud_8.143 Chr8 complement(242422..245535) [3114 bp, 1037 aa] {O...    69   6e-11
AFR205C Chr6 complement(805580..806953) [1374 bp, 457 aa] {ON} S...    68   6e-11
Skud_16.460 Chr16 complement(807116..809077) [1962 bp, 653 aa] {...    69   6e-11
Kpol_185.2 s185 complement(1614..3704) [2091 bp, 696 aa] {ON} co...    69   6e-11
Ecym_6092 Chr6 (178965..180299) [1335 bp, 444 aa] {ON} similar t...    68   6e-11
TDEL0H01070 Chr8 complement(192834..194624) [1791 bp, 596 aa] {O...    69   6e-11
Smik_15.241 Chr15 (407598..408617) [1020 bp, 339 aa] {ON} YOR061...    67   6e-11
Skud_9.134 Chr9 complement(256610..257728) [1119 bp, 372 aa] {ON...    67   6e-11
KNAG0B04460 Chr2 (856495..859461) [2967 bp, 988 aa] {ON} Anc_5.3...    69   7e-11
Ecym_4364 Chr4 (772870..773997) [1128 bp, 375 aa] {ON} similar t...    67   7e-11
SAKL0E07722g Chr5 complement(625066..627441) [2376 bp, 791 aa] {...    69   7e-11
YPR161C Chr16 complement(864449..866422) [1974 bp, 657 aa] {ON} ...    68   7e-11
Suva_2.413 Chr2 (735541..736923) [1383 bp, 460 aa] {ON} YDR247W ...    68   8e-11
NDAI0E01690 Chr5 (335849..337051) [1203 bp, 400 aa] {ON} Anc_2.391     67   8e-11
NDAI0A01970 Chr1 (440268..442184) [1917 bp, 638 aa] {ON} Anc_7.335     68   8e-11
NCAS0B06260 Chr2 complement(1180650..1182821) [2172 bp, 723 aa] ...    68   8e-11
ZYRO0F08272g Chr6 (668685..670508) [1824 bp, 607 aa] {ON} simila...    68   8e-11
Suva_15.275 Chr15 complement(470782..473862) [3081 bp, 1026 aa] ...    68   9e-11
Suva_16.274 Chr16 complement(476249..477916) [1668 bp, 555 aa] {...    68   9e-11
YGR040W Chr7 (575398..576504) [1107 bp, 368 aa] {ON}  KSS1Mitoge...    67   9e-11
YHR079C Chr8 complement(258244..261591) [3348 bp, 1115 aa] {ON} ...    68   9e-11
ZYRO0B16038g Chr2 (1300484..1301515) [1032 bp, 343 aa] {ON} high...    67   9e-11
KLLA0B11946g Chr2 complement(1048033..1049352) [1320 bp, 439 aa]...    67   1e-10
Suva_16.491 Chr16 complement(848824..850794) [1971 bp, 656 aa] {...    68   1e-10
Ecym_6056 Chr6 complement(107449..108888) [1440 bp, 479 aa] {ON}...    67   1e-10
YPL042C Chr16 complement(473040..474707) [1668 bp, 555 aa] {ON} ...    67   1e-10
KLLA0E15313g Chr5 (1362851..1365025) [2175 bp, 724 aa] {ON} simi...    68   1e-10
Skud_16.239 Chr16 complement(438063..439727) [1665 bp, 554 aa] {...    67   1e-10
NCAS0C02390 Chr3 complement(446642..448468) [1827 bp, 608 aa] {O...    67   1e-10
Skud_11.181 Chr11 complement(326935..328845) [1911 bp, 636 aa] {...    68   1e-10
KAFR0K01310 Chr11 (270172..271191) [1020 bp, 339 aa] {ON} Anc_5....    66   1e-10
YKL198C Chr11 complement(68232..70220) [1989 bp, 662 aa] {ON}  P...    67   1e-10
YIL035C Chr9 complement(287790..288908) [1119 bp, 372 aa] {ON}  ...    66   1e-10
Kpol_1041.29 s1041 (73725..74876) [1152 bp, 383 aa] {ON} (73725....    66   1e-10
ADR253W Chr4 (1141941..1143083) [1143 bp, 380 aa] {ON} Syntenic ...    66   1e-10
NDAI0C05160 Chr3 (1199533..1201026) [1494 bp, 497 aa] {ON} Anc_8...    67   2e-10
Kpol_1031.76 s1031 (193193..194923) [1731 bp, 576 aa] {ON} (1931...    67   2e-10
CAGL0I04422g Chr9 (394159..395427) [1269 bp, 422 aa] {ON} some s...    66   2e-10
KLTH0E11396g Chr5 (1018348..1020069) [1722 bp, 573 aa] {ON} simi...    67   2e-10
Smik_13.338 Chr13 (528578..529690) [1113 bp, 370 aa] {ON} YMR139...    66   2e-10
Smik_16.193 Chr16 complement(350311..351978) [1668 bp, 555 aa] {...    67   2e-10
Smik_10.349 Chr10 (534756..537209) [2454 bp, 817 aa] {ON} YJR059...    67   2e-10
KLLA0D11814g Chr4 complement(1007240..1009021) [1782 bp, 593 aa]...    67   2e-10
KAFR0E00330 Chr5 complement(74619..76574) [1956 bp, 651 aa] {ON}...    67   2e-10
NCAS0H01780 Chr8 complement(341549..344773) [3225 bp, 1074 aa] {...    67   2e-10
ADL102C Chr4 complement(503667..504785) [1119 bp, 372 aa] {ON} S...    66   2e-10
TBLA0C03180 Chr3 complement(770462..775468) [5007 bp, 1668 aa] {...    67   2e-10
Skud_11.20 Chr11 complement(51603..53558) [1956 bp, 651 aa] {ON}...    67   2e-10
Suva_15.271 Chr15 complement(460466..463813) [3348 bp, 1115 aa] ...    67   2e-10
TPHA0L01350 Chr12 (282034..283884) [1851 bp, 616 aa] {ON}              67   2e-10
NDAI0F00560 Chr6 complement(128674..129717) [1044 bp, 347 aa] {O...    65   2e-10
Ecym_3323 Chr3 (618386..620632) [2247 bp, 748 aa] {ON} similar t...    67   2e-10
Kpol_1033.1 s1033 complement(1..828) [828 bp, 276 aa] {ON} compl...    64   2e-10
NCAS0G03810 Chr7 complement(703842..705827) [1986 bp, 661 aa] {O...    67   2e-10
TPHA0A02630 Chr1 complement(562516..565164) [2649 bp, 882 aa] {O...    67   3e-10
Suva_9.104 Chr9 (178011..180428) [2418 bp, 805 aa] {ON} YIL095W ...    67   3e-10
ZYRO0F01034g Chr6 (80328..82826) [2499 bp, 832 aa] {ON} similar ...    67   3e-10
KNAG0A06140 Chr1 (931737..933437) [1701 bp, 566 aa] {ON} Anc_2.4...    66   3e-10
KAFR0F02710 Chr6 (528336..529493) [1158 bp, 385 aa] {ON} Anc_2.3...    65   3e-10
Suva_13.319 Chr13 (525309..526421) [1113 bp, 370 aa] {ON} YMR139...    65   3e-10
Kwal_56.24584 s56 complement(1063271..1064578) [1308 bp, 435 aa]...    65   3e-10
Smik_4.157 Chr4 complement(289446..290605,290830..291250) [1581 ...    66   3e-10
TPHA0A04570 Chr1 (1038551..1040674) [2124 bp, 707 aa] {ON} Anc_1...    66   3e-10
NCAS0D01230 Chr4 complement(225213..226661) [1449 bp, 482 aa] {O...    65   4e-10
KNAG0G00280 Chr7 complement(43196..45262) [2067 bp, 688 aa] {ON}...    66   4e-10
NCAS0C03560 Chr3 complement(710551..712476) [1926 bp, 641 aa] {O...    66   4e-10
YMR139W Chr13 (546125..547237) [1113 bp, 370 aa] {ON}  RIM11Prot...    65   4e-10
Suva_1.84 Chr1 complement(148430..149737) [1308 bp, 435 aa] {ON}...    65   4e-10
NCAS0H03070 Chr8 complement(590494..592440) [1947 bp, 648 aa] {O...    66   4e-10
TPHA0A04030 Chr1 (901665..904829) [3165 bp, 1054 aa] {ON} Anc_3....    66   4e-10
ZYRO0D16170g Chr4 (1348849..1349982) [1134 bp, 377 aa] {ON} high...    65   4e-10
Smik_9.84 Chr9 (162983..165409) [2427 bp, 808 aa] {ON} YIL095W (...    66   4e-10
Ecym_2540 Chr2 (1048071..1049792) [1722 bp, 573 aa] {ON} similar...    65   4e-10
YIL095W Chr9 (183937..186369) [2433 bp, 810 aa] {ON}  PRK1Protei...    66   5e-10
TPHA0I03100 Chr9 complement(681645..683666) [2022 bp, 673 aa] {O...    65   5e-10
KNAG0L01860 Chr12 (336795..337817) [1023 bp, 340 aa] {ON} Anc_5....    64   5e-10
NCAS0I02680 Chr9 (498371..500752) [2382 bp, 793 aa] {ON}               65   6e-10
Kpol_1039.33 s1039 complement(102096..104201) [2106 bp, 701 aa] ...    65   6e-10
ZYRO0C12078g Chr3 (946320..948647) [2328 bp, 775 aa] {ON} simila...    65   6e-10
ADL217W Chr4 (321491..323743) [2253 bp, 750 aa] {ON} Syntenic ho...    65   6e-10
Smik_11.24 Chr11 complement(52600..54522) [1923 bp, 640 aa] {ON}...    65   7e-10
Suva_11.24 Chr11 complement(52742..52930,52961..54523) [1752 bp,...    65   7e-10
KAFR0H03330 Chr8 complement(635910..637019) [1110 bp, 369 aa] {O...    64   7e-10
NDAI0G06240 Chr7 (1546580..1549282) [2703 bp, 900 aa] {ON} Anc_1...    65   7e-10
AFL217C Chr6 complement(30765..32840) [2076 bp, 691 aa] {ON} Syn...    65   8e-10
NCAS0G00490 Chr7 complement(83953..84996) [1044 bp, 347 aa] {ON}...    64   8e-10
Skud_8.139 Chr8 complement(232178..235534) [3357 bp, 1118 aa] {O...    65   8e-10
NDAI0J00420 Chr10 (73312..75606) [2295 bp, 764 aa] {ON} Anc_7.515      65   8e-10
Skud_1.73 Chr1 (144821..146128) [1308 bp, 435 aa] {ON} YAR018C (...    64   8e-10
Ecym_5209 Chr5 complement(445530..448133) [2604 bp, 867 aa] {ON}...    65   9e-10
Kwal_55.20221 s55 (304482..308006) [3525 bp, 1174 aa] {ON} YHR07...    65   9e-10
Kwal_47.17868 s47 (587449..588546) [1098 bp, 365 aa] {ON} YMR139...    64   1e-09
Smik_1.78 Chr1 complement(147996..149303) [1308 bp, 435 aa] {ON}...    64   1e-09
NCAS0A04010 Chr1 complement(809163..810299) [1137 bp, 378 aa] {O...    64   1e-09
CAGL0L12650g Chr12 (1360085..1361788) [1704 bp, 567 aa] {ON} sim...    64   1e-09
KNAG0A02220 Chr1 complement(198240..199979) [1740 bp, 579 aa] {O...    64   1e-09
Smik_2.191 Chr2 complement(338792..342118) [3327 bp, 1108 aa] {O...    64   2e-09
KLTH0H01584g Chr8 (143065..144453) [1389 bp, 462 aa] {ON} simila...    64   2e-09
Kwal_47.18098 s47 (685497..686621) [1125 bp, 374 aa] {ON} YIL035...    63   2e-09
Smik_11.200 Chr11 complement(333676..335592) [1917 bp, 638 aa] {...    64   2e-09
YAR018C Chr1 complement(170396..171703) [1308 bp, 435 aa] {ON}  ...    63   2e-09
CAGL0K11990g Chr11 complement(1156224..1159199) [2976 bp, 991 aa...    64   2e-09
ZYRO0A08448g Chr1 complement(677122..678225) [1104 bp, 367 aa] {...    63   2e-09
NCAS0I03020 Chr9 (555481..557853) [2373 bp, 790 aa] {ON} Anc_1.149     64   2e-09
TBLA0H00370 Chr8 (71216..73393) [2178 bp, 725 aa] {ON} Anc_2.425...    64   2e-09
Smik_9.156 Chr9 complement(261998..263116) [1119 bp, 372 aa] {ON...    63   2e-09
KLLA0C16577g Chr3 complement(1451181..1452695) [1515 bp, 504 aa]...    63   2e-09
Ecym_3160 Chr3 complement(304537..306957) [2421 bp, 806 aa] {ON}...    64   2e-09
KAFR0A02560 Chr1 complement(532248..533351) [1104 bp, 367 aa] {O...    62   2e-09
KNAG0J00820 Chr10 complement(137927..141202) [3276 bp, 1091 aa] ...    64   2e-09
TPHA0N01450 Chr14 complement(318088..320340) [2253 bp, 750 aa] {...    64   2e-09
Kwal_27.11542 s27 complement(841389..843764) [2376 bp, 791 aa] {...    64   3e-09
KLLA0E08405g Chr5 complement(756205..758538) [2334 bp, 777 aa] {...    64   3e-09
TBLA0B06510 Chr2 (1536156..1538489) [2334 bp, 777 aa] {ON} Anc_1...    63   3e-09
TDEL0G02150 Chr7 (422718..424703) [1986 bp, 661 aa] {ON} Anc_2.2...    63   3e-09
CAGL0G02607g Chr7 complement(240244..242310) [2067 bp, 688 aa] {...    63   3e-09
SAKL0H11352g Chr8 complement(975064..976857) [1794 bp, 597 aa] {...    63   3e-09
SAKL0F07854g Chr6 (600324..601442) [1119 bp, 372 aa] {ON} highly...    62   3e-09
TPHA0B02780 Chr2 complement(633307..634449) [1143 bp, 380 aa] {O...    62   3e-09
NDAI0A02720 Chr1 complement(612346..613455) [1110 bp, 369 aa] {O...    62   3e-09
KNAG0H02860 Chr8 (531728..532843) [1116 bp, 371 aa] {ON}               62   3e-09
TPHA0G02800 Chr7 (597211..598722) [1512 bp, 503 aa] {ON} Anc_2.4...    63   3e-09
SAKL0C06248g Chr3 complement(577990..580185) [2196 bp, 731 aa] {...    63   3e-09
SAKL0G08448g Chr7 (718250..721717) [3468 bp, 1155 aa] {ON} simil...    63   3e-09
KAFR0J01370 Chr10 complement(250424..252766) [2343 bp, 780 aa] {...    63   4e-09
Kpol_2001.10 s2001 (30724..33018) [2295 bp, 764 aa] {ON} (30724....    63   4e-09
CAGL0I05896g Chr9 (560169..562505) [2337 bp, 778 aa] {ON} some s...    63   4e-09
TPHA0H01470 Chr8 complement(329451..333578) [4128 bp, 1375 aa] {...    63   4e-09
KLTH0G10318g Chr7 (872129..874501) [2373 bp, 790 aa] {ON} simila...    63   4e-09
NCAS0A15040 Chr1 complement(2962030..2964036) [2007 bp, 668 aa] ...    63   4e-09
Kpol_1067.14 s1067 (29413..31050) [1638 bp, 545 aa] {ON} (29413....    62   4e-09
KAFR0C01720 Chr3 (351078..352208) [1131 bp, 376 aa] {ON} Anc_3.4...    62   4e-09
NCAS0A13320 Chr1 (2622149..2623258) [1110 bp, 369 aa] {ON}             62   4e-09
Kpol_1052.22 s1052 (72364..75669) [3306 bp, 1101 aa] {ON} (72364...    63   4e-09
NCAS0E01560 Chr5 (294095..295345) [1251 bp, 416 aa] {ON}               62   4e-09
TDEL0H02380 Chr8 complement(399810..400931) [1122 bp, 373 aa] {O...    62   5e-09
NCAS0C04540 Chr3 complement(929920..931056) [1137 bp, 378 aa] {O...    62   5e-09
KAFR0A00840 Chr1 complement(151896..152894) [999 bp, 332 aa] {ON...    61   5e-09
KLLA0F16467g Chr6 (1519800..1520822) [1023 bp, 340 aa] {ON} high...    61   6e-09
KLLA0E07437g Chr5 complement(672690..673787) [1098 bp, 365 aa] {...    61   6e-09
Kpol_376.5 s376 (6334..7767) [1434 bp, 477 aa] {ON} (6334..7767)...    62   6e-09
TDEL0H00890 Chr8 complement(146908..149088) [2181 bp, 726 aa] {O...    62   6e-09
KLTH0F05918g Chr6 complement(525566..527254) [1689 bp, 562 aa] {...    62   7e-09
KLTH0E09658g Chr5 (869857..870957) [1101 bp, 366 aa] {ON} highly...    61   7e-09
KLLA0D13266g Chr4 complement(1137750..1141208) [3459 bp, 1152 aa...    62   7e-09
Kpol_1063.4 s1063 complement(10790..11932) [1143 bp, 380 aa] {ON...    61   8e-09
CAGL0L06820g Chr12 (769035..770135) [1101 bp, 366 aa] {ON} highl...    61   8e-09
KLLA0F08877g Chr6 (825217..826182) [966 bp, 321 aa] {ON} uniprot...    60   8e-09
CAGL0I05192g Chr9 complement(493635..494756) [1122 bp, 373 aa] {...    61   8e-09
TBLA0G00820 Chr7 complement(191559..192833) [1275 bp, 424 aa] {O...    61   8e-09
SAKL0C06666g Chr3 complement(628448..630367) [1920 bp, 639 aa] {...    62   8e-09
NDAI0B03560 Chr2 complement(892839..895109) [2271 bp, 756 aa] {O...    62   9e-09
KAFR0F01630 Chr6 complement(323802..326057) [2256 bp, 751 aa] {O...    62   9e-09
KLTH0F05522g Chr6 complement(477035..478975) [1941 bp, 646 aa] {...    61   1e-08
YBR059C Chr2 complement(356861..360187) [3327 bp, 1108 aa] {ON} ...    62   1e-08
TBLA0E02590 Chr5 complement(651679..654864) [3186 bp, 1061 aa] {...    62   1e-08
KAFR0C00430 Chr3 complement(88561..91410) [2850 bp, 949 aa] {ON}...    62   1e-08
TDEL0C04800 Chr3 (866157..867467) [1311 bp, 436 aa] {ON} Anc_3.3...    61   1e-08
KLLA0B07579g Chr2 (659591..661759) [2169 bp, 722 aa] {ON} simila...    61   2e-08
KLLA0E04247g Chr5 (382874..383995) [1122 bp, 373 aa] {ON} simila...    60   2e-08
Kpol_209.1 s209 (1823..5734) [3912 bp, 1303 aa] {ON} (1823..5734...    61   2e-08
KLLA0A05819g Chr1 (541545..543659) [2115 bp, 704 aa] {ON} simila...    61   2e-08
ACR249C Chr3 complement(797020..798951) [1932 bp, 643 aa] {ON} S...    60   2e-08
CAGL0J03432g Chr10 (330031..331899) [1869 bp, 622 aa] {ON} simil...    60   2e-08
Suva_9.165 Chr9 complement(276469..277587) [1119 bp, 372 aa] {ON...    60   2e-08
ADL043C Chr4 complement(612088..614109) [2022 bp, 673 aa] {ON} S...    60   2e-08
Kpol_1013.52 s1013 (123332..125881) [2550 bp, 849 aa] {ON} (1233...    61   2e-08
Kpol_2001.46 s2001 (127016..129376) [2361 bp, 786 aa] {ON} (1270...    60   2e-08
TBLA0A03220 Chr1 complement(765108..768590) [3483 bp, 1160 aa] {...    60   2e-08
Ecym_2042 Chr2 complement(67312..68397) [1086 bp, 361 aa] {ON} s...    59   2e-08
KLTH0E03828g Chr5 (345775..349131) [3357 bp, 1118 aa] {ON} simil...    60   3e-08
YDL079C Chr4 complement(312951..314044,314337..314748) [1506 bp,...    60   3e-08
Kwal_33.13681 s33 complement(350547..352694) [2148 bp, 715 aa] {...    60   3e-08
CAGL0H10208g Chr8 complement(996853..999936) [3084 bp, 1027 aa] ...    60   3e-08
AGL249C Chr7 complement(234347..236092) [1746 bp, 581 aa] {ON} S...    60   3e-08
KAFR0B00520 Chr2 (105553..107502) [1950 bp, 649 aa] {ON} Anc_4.1...    60   3e-08
TPHA0K02030 Chr11 (432238..434505) [2268 bp, 755 aa] {ON} Anc_4....    60   3e-08
NDAI0A05700 Chr1 (1288604..1292077) [3474 bp, 1157 aa] {ON} Anc_...    60   3e-08
ABR088C Chr2 complement(546325..547920) [1596 bp, 531 aa] {ON} S...    59   4e-08
TDEL0F02980 Chr6 (539327..541549) [2223 bp, 740 aa] {ON} Anc_1.1...    59   4e-08
KNAG0C02250 Chr3 complement(444156..446639) [2484 bp, 827 aa] {O...    59   4e-08
TPHA0B03130 Chr2 complement(719624..721372) [1749 bp, 582 aa] {O...    59   5e-08
KNAG0D02790 Chr4 (507235..508848) [1614 bp, 537 aa] {ON} Anc_5.3...    59   5e-08
Ecym_7206 Chr7 complement(423402..425576) [2175 bp, 724 aa] {ON}...    59   5e-08
TPHA0C03380 Chr3 (740939..743032) [2094 bp, 697 aa] {ON} Anc_2.2...    59   5e-08
Kwal_33.13984 s33 complement(471429..473378) [1950 bp, 649 aa] {...    59   5e-08
KLLA0F01507g Chr6 (144356..145774) [1419 bp, 472 aa] {ON} some s...    59   5e-08
NDAI0B00400 Chr2 (74403..76643) [2241 bp, 746 aa] {ON} Anc_1.149       59   5e-08
ADL315C Chr4 complement(146096..147400) [1305 bp, 434 aa] {ON} S...    59   5e-08
Ecym_2302 Chr2 (587299..588951) [1653 bp, 550 aa] {ON} similar t...    59   6e-08
ADL168C Chr4 complement(398517..399605) [1089 bp, 362 aa] {ON} S...    58   6e-08
KLTH0F03916g Chr6 complement(348177..350282) [2106 bp, 701 aa] {...    59   6e-08
KNAG0H00790 Chr8 complement(124926..126131) [1206 bp, 401 aa] {O...    58   6e-08
YJL141C Chr10 complement(147967..150390) [2424 bp, 807 aa] {ON} ...    59   6e-08
KAFR0H01040 Chr8 complement(189604..190860) [1257 bp, 418 aa] {O...    58   6e-08
Suva_14.32 Chr14 complement(52757..53884) [1128 bp, 375 aa] {ON}...    58   7e-08
TBLA0J01200 Chr10 (271800..275420) [3621 bp, 1206 aa] {ON} Anc_1...    59   7e-08
TBLA0B10030 Chr2 (2399979..2402123) [2145 bp, 714 aa] {ON} Anc_4...    59   7e-08
TDEL0G03220 Chr7 complement(600259..601350) [1092 bp, 363 aa] {O...    58   7e-08
ZYRO0C02772g Chr3 (216325..217464) [1140 bp, 379 aa] {ON} highly...    58   7e-08
Suva_16.382 Chr16 (673009..674205) [1197 bp, 398 aa] {ON} YPR054...    58   7e-08
KLTH0A03542g Chr1 (306667..307803) [1137 bp, 378 aa] {ON} highly...    58   7e-08
SAKL0F15510g Chr6 complement(1251475..1253373) [1899 bp, 632 aa]...    59   8e-08
CAGL0K00693g Chr11 complement(75466..78096) [2631 bp, 876 aa] {O...    59   8e-08
YPR054W Chr16 (666280..667446) [1167 bp, 388 aa] {ON}  SMK1Middl...    58   9e-08
Kpol_161.2 s161 complement(3125..4246) [1122 bp, 373 aa] {ON} co...    57   9e-08
CAGL0E01683g Chr5 complement(166821..167948) [1128 bp, 375 aa] {...    57   9e-08
KAFR0D04760 Chr4 complement(932849..936205) [3357 bp, 1118 aa] {...    58   1e-07
TPHA0D01540 Chr4 complement(316471..318594) [2124 bp, 707 aa] {O...    58   1e-07
Suva_6.268 Chr6 (470348..472519) [2172 bp, 723 aa] {ON} YJL187C ...    58   1e-07
TDEL0A00600 Chr1 complement(101753..102877) [1125 bp, 374 aa] {O...    57   1e-07
Smik_16.296 Chr16 (542962..544128) [1167 bp, 388 aa] {ON} YPR054...    57   1e-07
Smik_10.91 Chr10 complement(145745..148153) [2409 bp, 802 aa] {O...    58   1e-07
TBLA0A07770 Chr1 complement(1916632..1917939) [1308 bp, 435 aa] ...    57   1e-07
Ecym_3488 Chr3 complement(915087..916400) [1314 bp, 437 aa] {ON}...    57   1e-07
TBLA0D05770 Chr4 (1424960..1427671) [2712 bp, 903 aa] {ON} Anc_1...    58   1e-07
ZYRO0D10472g Chr4 (876899..880357) [3459 bp, 1152 aa] {ON} simil...    58   1e-07
Kwal_55.21900 s55 complement(1027253..1029130) [1878 bp, 625 aa]...    57   1e-07
Kwal_27.12559 s27 (1273349..1274593) [1245 bp, 414 aa] {ON} YPR0...    57   2e-07
TDEL0H00560 Chr8 (94614..96500) [1887 bp, 628 aa] {ON} Anc_7.515...    57   2e-07
TBLA0D00220 Chr4 (52218..54500) [2283 bp, 760 aa] {ON} Anc_2.96 ...    57   2e-07
NDAI0G03920 Chr7 complement(934765..935889) [1125 bp, 374 aa] {O...    57   2e-07
Skud_2.179 Chr2 complement(325193..328465) [3273 bp, 1090 aa] {O...    58   2e-07
KLLA0D07810g Chr4 complement(669095..671251) [2157 bp, 718 aa] {...    57   2e-07
Skud_9.78 Chr9 (160531..162960) [2430 bp, 809 aa] {ON} YIL095W (...    57   2e-07
AEL149C Chr5 complement(348350..350533) [2184 bp, 727 aa] {ON} S...    57   2e-07
ZYRO0G18590g Chr7 complement(1533974..1536202) [2229 bp, 742 aa]...    57   2e-07
Ecym_2650 Chr2 complement(1257641..1260325) [2685 bp, 894 aa] {O...    57   2e-07
Ecym_8129 Chr8 (269437..271626) [2190 bp, 729 aa] {ON} similar t...    57   2e-07
YJL187C Chr10 complement(76803..79262) [2460 bp, 819 aa] {ON}  S...    57   2e-07
TBLA0E02460 Chr5 (620609..621745) [1137 bp, 378 aa] {ON} Anc_7.2...    56   2e-07
KNAG0H00560 Chr8 (89502..91268) [1767 bp, 588 aa] {ON} Anc_2.597...    57   2e-07
Skud_10.30 Chr10 complement(51698..54124) [2427 bp, 808 aa] {ON}...    57   2e-07
Skud_14.172 Chr14 (323327..325564) [2238 bp, 745 aa] {ON} YNL161...    57   2e-07
KAFR0A01040 Chr1 complement(197612..200350) [2739 bp, 912 aa] {O...    57   2e-07
Smik_14.167 Chr14 (311655..312284,312591..314228) [2268 bp, 755 ...    57   2e-07
KNAG0C02600 Chr3 complement(504486..507134) [2649 bp, 882 aa] {O...    57   2e-07
SAKL0B07304g Chr2 (625541..627007) [1467 bp, 488 aa] {ON} simila...    57   2e-07
TPHA0F02150 Chr6 complement(475516..477768) [2253 bp, 750 aa] {O...    57   2e-07
ZYRO0C15862g Chr3 (1239992..1241305) [1314 bp, 437 aa] {ON} simi...    56   3e-07
Skud_10.73 Chr10 complement(123049..125436) [2388 bp, 795 aa] {O...    57   3e-07
KAFR0F02730 Chr6 (537477..539309) [1833 bp, 610 aa] {ON} Anc_4.4...    57   3e-07
YNL161W Chr14 (332597..334867) [2271 bp, 756 aa] {ON}  CBK1Serin...    57   3e-07
KLTH0B06424g Chr2 complement(518184..520328) [2145 bp, 714 aa] {...    57   3e-07
KNAG0F01440 Chr6 (261403..263685) [2283 bp, 760 aa] {ON}               57   3e-07
NCAS0G02070 Chr7 (372747..374960) [2214 bp, 737 aa] {ON} Anc_2.96      57   3e-07
Suva_4.297 Chr4 complement(523650..526973) [3324 bp, 1107 aa] {O...    57   3e-07
KNAG0A01330 Chr1 complement(34784..35977) [1194 bp, 397 aa] {ON}...    56   3e-07
TBLA0J00250 Chr10 (42058..44457) [2400 bp, 799 aa] {ON} Anc_7.51...    57   3e-07
NCAS0A06000 Chr1 (1184842..1187133) [2292 bp, 763 aa] {ON} Anc_4...    57   3e-07
TPHA0M01500 Chr13 (317999..319291) [1293 bp, 430 aa] {ON} Anc_3....    56   3e-07
Kpol_1051.42 s1051 (98030..99379,99382..100212) [2181 bp, 726 aa...    57   3e-07
TPHA0P01380 Chr16 (278259..279380) [1122 bp, 373 aa] {ON} Anc_3....    56   3e-07
Suva_4.168 Chr4 complement(302527..303654) [1128 bp, 375 aa] {ON...    56   3e-07
NDAI0F03200 Chr6 complement(770618..772924) [2307 bp, 768 aa] {O...    57   3e-07
Suva_14.178 Chr14 (328862..331195) [2334 bp, 777 aa] {ON} YNL161...    57   3e-07
Kwal_33.14554 s33 (717776..719920) [2145 bp, 714 aa] {ON} YNL161...    56   4e-07
Skud_12.48 Chr12 complement(97218..99422) [2205 bp, 734 aa] {ON}...    56   4e-07
Suva_6.221 Chr6 (399862..400920,400924..402096) [2232 bp, 743 aa...    56   4e-07
NDAI0G05790 Chr7 complement(1433294..1435252) [1959 bp, 652 aa] ...    56   4e-07
TPHA0M01120 Chr13 complement(223548..225914) [2367 bp, 788 aa] {...    56   5e-07
KLLA0F17006g Chr6 complement(1561859..1563106) [1248 bp, 415 aa]...    55   5e-07
Skud_4.176 Chr4 complement(308461..309594) [1134 bp, 377 aa] {ON...    55   5e-07
Kpol_1035.34 s1035 (79914..80978) [1065 bp, 354 aa] {ON} (79914....    55   5e-07
AGR027C Chr7 complement(763303..766188) [2886 bp, 961 aa] {ON} S...    56   5e-07
ZYRO0D01584g Chr4 (124739..126688) [1950 bp, 649 aa] {ON} some s...    56   5e-07
KLTH0F18458g Chr6 complement(1491777..1493663) [1887 bp, 628 aa]...    55   6e-07
TPHA0E02270 Chr5 (471696..472916) [1221 bp, 406 aa] {ON} Anc_5.2...    55   6e-07
KAFR0A07370 Chr1 complement(1487868..1490012) [2145 bp, 714 aa] ...    55   6e-07
KNAG0F03730 Chr6 complement(697517..699586) [2070 bp, 689 aa] {O...    55   6e-07
AFR035W Chr6 (498529..500688) [2160 bp, 719 aa] {ON} Syntenic ho...    55   7e-07
SAKL0C04576g Chr3 complement(444365..446611) [2247 bp, 748 aa] {...    55   7e-07
Kwal_33.14081 s33 complement(519343..521085) [1743 bp, 580 aa] {...    55   7e-07
Smik_10.45 Chr10 complement(74813..77278) [2466 bp, 821 aa] {ON}...    55   8e-07
Kpol_1066.19 s1066 (31013..32806) [1794 bp, 597 aa] {OFF} (31013...    55   8e-07
Kpol_YGOB_1066.19 s1066 (30983..32806) [1824 bp, 607 aa] {ON} AN...    55   8e-07
Skud_14.32 Chr14 complement(49930..51057) [1128 bp, 375 aa] {ON}...    54   9e-07
TBLA0A06670 Chr1 complement(1630701..1632023) [1323 bp, 440 aa] ...    55   9e-07
KAFR0F01940 Chr6 complement(379908..382283) [2376 bp, 791 aa] {O...    55   1e-06
NCAS0H01740 Chr8 complement(331436..335284) [3849 bp, 1282 aa] {...    55   1e-06
SAKL0E12342g Chr5 complement(1021369..1023795) [2427 bp, 808 aa]...    55   1e-06
ZYRO0G05214g Chr7 (420482..422980) [2499 bp, 832 aa] {ON} some s...    55   1e-06
Kpol_1003.35 s1003 (89266..91407) [2142 bp, 713 aa] {ON} (89266....    55   1e-06
NDAI0G03150 Chr7 complement(741321..742463) [1143 bp, 380 aa] {O...    54   1e-06
Smik_14.24 Chr14 complement(40883..42010) [1128 bp, 375 aa] {ON}...    54   1e-06
YNL307C Chr14 complement(56446..57573) [1128 bp, 375 aa] {ON}  M...    54   1e-06
ZYRO0G20570g Chr7 (1695518..1697305) [1788 bp, 595 aa] {ON} simi...    54   1e-06
Skud_16.340 Chr16 (631100..632266) [1167 bp, 388 aa] {ON} YPR054...    54   1e-06
CAGL0D01694g Chr4 complement(176981..178279) [1299 bp, 432 aa] {...    54   1e-06
Skud_13.385 Chr13 complement(672612..674966) [2355 bp, 784 aa] {...    54   2e-06
Ecym_8380 Chr8 (772519..774573) [2055 bp, 684 aa] {ON} similar t...    54   2e-06
Smik_12.44 Chr12 complement(92046..94262) [2217 bp, 738 aa] {ON}...    54   2e-06
YLL019C Chr12 complement(105686..107899) [2214 bp, 737 aa] {ON} ...    54   2e-06
KNAG0H01220 Chr8 (209884..212625) [2742 bp, 913 aa] {ON} Anc_3.2...    54   2e-06
NDAI0C01890 Chr3 (419452..423777) [4326 bp, 1441 aa] {ON} Anc_5....    54   2e-06
KAFR0F01150 Chr6 complement(218711..219811) [1101 bp, 366 aa] {O...    53   2e-06
SAKL0H24288g Chr8 (2099353..2101317) [1965 bp, 654 aa] {ON} simi...    54   2e-06
Ecym_6400 Chr6 complement(779716..781983) [2268 bp, 755 aa] {ON}...    54   2e-06
TBLA0I01930 Chr9 complement(436511..440596) [4086 bp, 1361 aa] {...    54   2e-06
NDAI0E01960 Chr5 (397897..399717) [1821 bp, 606 aa] {ON} Anc_2.425     54   2e-06
Kwal_27.10945 s27 (565717..568524) [2808 bp, 935 aa] {ON} YBR059...    54   3e-06
TBLA0B05930 Chr2 (1400163..1402316) [2154 bp, 717 aa] {ON} Anc_2...    54   3e-06
Suva_13.399 Chr13 complement(679223..681388) [2166 bp, 721 aa] {...    54   3e-06
YMR216C Chr13 complement(698811..701039) [2229 bp, 742 aa] {ON} ...    53   3e-06
NCAS0A11020 Chr1 (2193556..2194869) [1314 bp, 437 aa] {ON} Anc_3...    53   3e-06
NCAS0A10590 Chr1 complement(2108142..2111429) [3288 bp, 1095 aa]...    54   3e-06
KLTH0C07260g Chr3 (626334..629039) [2706 bp, 901 aa] {ON} simila...    53   3e-06
NDAI0H02930 Chr8 (715278..716846) [1569 bp, 522 aa] {ON} Anc_2.391     53   4e-06
KLLA0D10527g Chr4 (892955..894892) [1938 bp, 645 aa] {ON} simila...    53   4e-06
KLTH0H10582g Chr8 (914695..916440) [1746 bp, 581 aa] {ON} weakly...    53   4e-06
Smik_10.183 Chr10 complement(319743..321746) [2004 bp, 667 aa] {...    53   5e-06
KLLA0F22297g Chr6 complement(2083448..2085547) [2100 bp, 699 aa]...    53   5e-06
CAGL0F03905g Chr6 complement(377962..380088) [2127 bp, 708 aa] {...    52   7e-06
YJL057C Chr10 complement(328118..330121) [2004 bp, 667 aa] {ON} ...    52   7e-06
TDEL0D01930 Chr4 complement(373906..375753) [1848 bp, 615 aa] {O...    52   7e-06
Smik_13.424 Chr13 complement(682907..685177) [2271 bp, 756 aa] {...    52   8e-06
CAGL0D06600g Chr4 (626571..628748) [2178 bp, 725 aa] {ON} simila...    52   8e-06
TBLA0B08650 Chr2 (2065061..2066308) [1248 bp, 415 aa] {ON} Anc_3...    52   8e-06
Kwal_47.17345 s47 complement(364905..367004) [2100 bp, 699 aa] {...    52   8e-06
Skud_10.153 Chr10 (288733..290742) [2010 bp, 669 aa] {ON} YJL057...    52   9e-06
Kpol_1027.1 s1027 (1..2088) [2088 bp, 695 aa] {ON} (1..2088) [20...    52   9e-06
SAKL0C05236g Chr3 (498347..501385) [3039 bp, 1012 aa] {ON} simil...    52   9e-06
TBLA0H02950 Chr8 complement(721123..723906) [2784 bp, 927 aa] {O...    52   9e-06
ABR177C Chr2 complement(735829..738090) [2262 bp, 753 aa] {ON} S...    52   1e-05
AFL143C Chr6 complement(164241..165326) [1086 bp, 361 aa] {ON} S...    51   1e-05
KLTH0E07128g Chr5 complement(657986..660064) [2079 bp, 692 aa] {...    51   1e-05
TBLA0D05210 Chr4 (1279846..1282323) [2478 bp, 825 aa] {ON} Anc_1...    51   1e-05
KNAG0I03000 Chr9 (596789..598840) [2052 bp, 683 aa] {ON} Anc_4.4...    51   1e-05
Kpol_251.4 s251 (5802..8318) [2517 bp, 838 aa] {ON} (5802..8318)...    51   2e-05
KLLA0F18612g Chr6 (1711131..1713575) [2445 bp, 814 aa] {ON} some...    51   2e-05
ZYRO0A01848g Chr1 (152134..154248) [2115 bp, 704 aa] {ON} simila...    51   2e-05
Suva_10.55 Chr10 complement(110943..113177) [2235 bp, 744 aa] {O...    50   2e-05
TBLA0G01910 Chr7 complement(500551..502596) [2046 bp, 681 aa] {O...    50   2e-05
TDEL0D03520 Chr4 (647828..650977) [3150 bp, 1049 aa] {ON} Anc_3....    51   2e-05
NDAI0G01760 Chr7 (384420..385700) [1281 bp, 426 aa] {ON}               50   2e-05
Suva_6.133 Chr6 (221952..223955) [2004 bp, 667 aa] {ON} YJL057C ...    50   2e-05
Kpol_413.7 s413 complement(18363..20267) [1905 bp, 634 aa] {ON} ...    50   3e-05
NDAI0K01030 Chr11 (239418..241712) [2295 bp, 764 aa] {ON} Anc_8....    50   3e-05
TDEL0E02600 Chr5 (501545..504934) [3390 bp, 1129 aa] {ON} Anc_5....    50   4e-05
TPHA0H01880 Chr8 (441140..442402) [1263 bp, 420 aa] {ON} Anc_6.2...    49   4e-05
NDAI0C00570 Chr3 (108274..110547) [2274 bp, 757 aa] {ON}               50   4e-05
AEL173W Chr5 (313261..314856) [1596 bp, 531 aa] {ON} Syntenic ho...    50   4e-05
YOL128C Chr15 complement(78352..79479) [1128 bp, 375 aa] {ON}  Y...    49   4e-05
Skud_16.42 Chr16 complement(75193..76287) [1095 bp, 364 aa] {ON}...    49   4e-05
KLTH0E15004g Chr5 (1328930..1330165) [1236 bp, 411 aa] {ON} simi...    49   4e-05
Ecym_8100 Chr8 complement(214001..216547) [2547 bp, 848 aa] {ON}...    50   4e-05
TDEL0F01550 Chr6 (282677..284839) [2163 bp, 720 aa] {ON} Anc_4.4...    49   6e-05
Smik_15.25 Chr15 complement(46541..47668) [1128 bp, 375 aa] {ON}...    49   6e-05
TBLA0D01110 Chr4 (283160..285640) [2481 bp, 826 aa] {ON} Anc_8.7...    49   7e-05
TDEL0B03770 Chr2 (676581..678575) [1995 bp, 664 aa] {ON} Anc_8.7...    49   7e-05
NDAI0A00920 Chr1 (189693..192521) [2829 bp, 942 aa] {ON} Anc_1.1...    49   7e-05
TBLA0A02240 Chr1 (539297..540538) [1242 bp, 413 aa] {ON} Anc_6.2...    49   7e-05
NDAI0D02970 Chr4 (701299..704058) [2760 bp, 919 aa] {ON} Anc_4.4...    49   7e-05
SAKL0D06820g Chr4 (566145..567938) [1794 bp, 597 aa] {ON} simila...    49   8e-05
ZYRO0B00638g Chr2 (42738..44930) [2193 bp, 730 aa] {ON} similar ...    49   8e-05
NCAS0A09570 Chr1 complement(1907017..1909200) [2184 bp, 727 aa] ...    49   9e-05
TBLA0J01000 Chr10 complement(227869..231072) [3204 bp, 1067 aa] ...    49   9e-05
Kpol_1002.21 s1002 complement(62702..63895) [1194 bp, 397 aa] {O...    48   1e-04
ZYRO0E06864g Chr5 complement(516731..520078) [3348 bp, 1115 aa] ...    49   1e-04
ZYRO0A06182g Chr1 (493846..496062) [2217 bp, 738 aa] {ON} simila...    48   1e-04
CAGL0H00979g Chr8 complement(94328..95527) [1200 bp, 399 aa] {ON...    48   1e-04
SAKL0D03234g Chr4 (262365..264941) [2577 bp, 858 aa] {ON} some s...    48   1e-04
Smik_6.441 Chr6 (721619..722713) [1095 bp, 364 aa] {ON} YPL236C ...    47   1e-04
Ecym_6294 Chr6 complement(551351..552982) [1632 bp, 543 aa] {ON}...    48   1e-04
NCAS0G01210 Chr7 complement(215860..216963) [1104 bp, 367 aa] {O...    47   1e-04
SAKL0D05104g Chr4 (402641..404692) [2052 bp, 683 aa] {ON} simila...    47   2e-04
AEL120W Chr5 (396394..398715) [2322 bp, 773 aa] {ON} Syntenic ho...    47   2e-04
AFR150C Chr6 complement(707303..708352) [1050 bp, 349 aa] {ON} S...    47   2e-04
Smik_10.132 Chr10 (212933..214873) [1941 bp, 646 aa] {ON} YJL106...    47   2e-04
Suva_15.32 Chr15 complement(56314..57447) [1134 bp, 377 aa] {ON}...    47   2e-04
NCAS0B08320 Chr2 complement(1585766..1588471) [2706 bp, 901 aa] ...    47   2e-04
CAGL0J05082g Chr10 (483782..485743) [1962 bp, 653 aa] {ON} simil...    47   2e-04
Kwal_14.2554 s14 (811455..813233) [1779 bp, 592 aa] {ON} YJL057C...    47   3e-04
TPHA0I02660 Chr9 (582108..584219) [2112 bp, 703 aa] {ON} Anc_1.3...    47   3e-04
NDAI0F01340 Chr6 complement(327928..329148) [1221 bp, 406 aa] {O...    47   3e-04
KNAG0B01670 Chr2 (307587..309860) [2274 bp, 757 aa] {ON} Anc_1.2...    47   3e-04
NDAI0A05280 Chr1 complement(1191032..1192342) [1311 bp, 436 aa] ...    46   4e-04
NCAS0A09170 Chr1 (1813960..1815846) [1887 bp, 628 aa] {ON} Anc_1...    46   4e-04
KNAG0A05430 Chr1 complement(800787..803153) [2367 bp, 788 aa] {O...    46   4e-04
SAKL0H05214g Chr8 (468419..470185) [1767 bp, 588 aa] {ON} simila...    46   5e-04
Smik_11.58 Chr11 (112932..115715) [2784 bp, 927 aa] {ON} YKL171W...    46   5e-04
KNAG0E03260 Chr5 complement(654134..655246) [1113 bp, 370 aa] {O...    46   5e-04
ZYRO0G17094g Chr7 complement(1404552..1406804) [2253 bp, 750 aa]...    46   5e-04
Kwal_33.13825 s33 (409772..412477) [2706 bp, 901 aa] {ON} YKL171...    46   5e-04
YKL171W Chr11 (127475..130261) [2787 bp, 928 aa] {ON}  NNK1Prote...    46   6e-04
CAGL0K12496g Chr11 (1219220..1220302) [1083 bp, 360 aa] {ON} sim...    45   6e-04
Kpol_463.19 s463 complement(53246..55561) [2316 bp, 771 aa] {ON}...    46   6e-04
KLLA0F02838g Chr6 (264329..266596) [2268 bp, 755 aa] {ON} simila...    46   7e-04
Skud_10.107 Chr10 (189314..191254) [1941 bp, 646 aa] {ON} YJL106...    45   7e-04
KLTH0D03080g Chr4 (295808..297730) [1923 bp, 640 aa] {ON} simila...    45   7e-04
YPL236C Chr16 complement(101608..102702) [1095 bp, 364 aa] {ON} ...    45   7e-04
ZYRO0F03190g Chr6 complement(270262..271371) [1110 bp, 369 aa] {...    45   7e-04
Suva_6.29 Chr6 complement(51588..52691) [1104 bp, 367 aa] {ON} Y...    45   8e-04
TDEL0D01220 Chr4 complement(228529..230451) [1923 bp, 640 aa] {O...    45   8e-04
TBLA0D02510 Chr4 complement(626101..627234) [1134 bp, 377 aa] {O...    45   9e-04
Ecym_2153 Chr2 complement(287697..288788) [1092 bp, 363 aa] {ON}...    45   9e-04
NCAS0C03810 Chr3 complement(772530..773660) [1131 bp, 376 aa] {O...    45   0.001
KNAG0B05340 Chr2 complement(1031600..1033588) [1989 bp, 662 aa] ...    45   0.001
TPHA0D00430 Chr4 complement(73651..74730) [1080 bp, 359 aa] {ON}...    45   0.001
Kwal_26.7276 s26 (293129..295069) [1941 bp, 646 aa] {ON} YJL106W...    45   0.001
NCAS0C01030 Chr3 (192001..194043) [2043 bp, 680 aa] {ON} Anc_8.732     45   0.001
Ecym_1502 Chr1 (1030765..1031838) [1074 bp, 357 aa] {ON} similar...    45   0.001
Kpol_1064.42 s1064 complement(78573..80207) [1635 bp, 544 aa] {O...    45   0.001
Suva_16.70 Chr16 complement(110631..111725) [1095 bp, 364 aa] {O...    45   0.001
Ecym_3487 Chr3 complement(910575..914810) [4236 bp, 1411 aa] {ON...    45   0.001
CAGL0M08316g Chr13 (829069..831963) [2895 bp, 964 aa] {ON} weakl...    45   0.001
Suva_6.182 Chr6 complement(328699..330642) [1944 bp, 647 aa] {ON...    45   0.001
Suva_6.222 Chr6 (400975..402096) [1122 bp, 373 aa] {ON} YJL141C ...    44   0.001
ZYRO0D02970g Chr4 complement(231363..233669) [2307 bp, 768 aa] {...    45   0.001
KAFR0C03480 Chr3 (708186..709277) [1092 bp, 363 aa] {ON} Anc_8.4...    44   0.001
AER348C Chr5 complement(1275897..1277774) [1878 bp, 625 aa] {ON}...    45   0.001
Kwal_56.24274 s56 (932404..933444) [1041 bp, 346 aa] {ON} YPL236...    44   0.001
CAGL0H08437g Chr8 complement(825191..829423) [4233 bp, 1410 aa] ...    45   0.002
TPHA0A02760 Chr1 (594482..597502) [3021 bp, 1006 aa] {ON} Anc_1....    45   0.002
Skud_6.41 Chr6 complement(81310..82416) [1107 bp, 368 aa] {ON} Y...    44   0.002
NDAI0A07790 Chr1 (1790683..1795206) [4524 bp, 1507 aa] {ON} Anc_...    45   0.002
KNAG0D00830 Chr4 complement(130823..131986) [1164 bp, 387 aa] {O...    44   0.002
YJL106W Chr10 (221390..223327) [1938 bp, 645 aa] {ON}  IME2Serin...    44   0.002
TBLA0B09215 Chr2 complement(2180179..2181375) [1197 bp, 398 aa] ...    44   0.002
KLTH0B02178g Chr2 (171582..174551) [2970 bp, 989 aa] {ON} simila...    45   0.002
TPHA0G01380 Chr7 (279600..281579) [1980 bp, 659 aa] {ON} Anc_8.7...    44   0.002
Skud_11.54 Chr11 (113775..116570) [2796 bp, 931 aa] {ON} YKL171W...    44   0.002
TBLA0B08810 Chr2 (2094401..2095375) [975 bp, 324 aa] {ON} Anc_2....    44   0.002
KAFR0A01340 Chr1 (259300..261171) [1872 bp, 623 aa] {ON} Anc_1.2...    44   0.002
YFL029C Chr6 complement(78055..79161) [1107 bp, 368 aa] {ON}  CA...    44   0.002
KNAG0J02030 Chr10 complement(368141..370327) [2187 bp, 728 aa] {...    44   0.002
Suva_11.52 Chr11 (112355..115156) [2802 bp, 933 aa] {ON} YKL171W...    44   0.003
TPHA0I00820 Chr9 (177222..179651) [2430 bp, 809 aa] {ON} Anc_1.2...    44   0.003
NDAI0G05370 Chr7 (1313015..1315555) [2541 bp, 846 aa] {ON} Anc_1...    44   0.003
KLTH0D12518g Chr4 complement(1023214..1024992) [1779 bp, 592 aa]...    44   0.003
Kwal_26.6921 s26 (123345..123875) [531 bp, 176 aa] {OFF} YOR351C...    41   0.004
Skud_15.25 Chr15 complement(43728..44864) [1137 bp, 378 aa] {ON}...    43   0.004
Kwal_26.9032 s26 complement(1047382..1049157) [1776 bp, 591 aa] ...    43   0.005
Kpol_2001.31 s2001 complement(90402..93110) [2709 bp, 902 aa] {O...    43   0.005
Ecym_6239 Chr6 complement(445704..447791) [2088 bp, 695 aa] {ON}...    43   0.005
TPHA0A03700 Chr1 complement(808996..813273) [4278 bp, 1425 aa] {...    43   0.006
TDEL0A06750 Chr1 (1179818..1180936) [1119 bp, 372 aa] {ON} Anc_6...    42   0.006
NCAS0I01210 Chr9 complement(218242..222582) [4341 bp, 1446 aa] {...    43   0.007
CAGL0G04455g Chr7 (426386..428641) [2256 bp, 751 aa] {ON} simila...    42   0.007
Smik_6.49 Chr6 complement(93305..94408) [1104 bp, 367 aa] {ON} Y...    42   0.008
KLTH0F04686g Chr6 (413669..416209) [2541 bp, 846 aa] {ON} weakly...    42   0.009
TDEL0C00660 Chr3 complement(107849..108952) [1104 bp, 367 aa] {O...    42   0.009
KAFR0A01740 Chr1 complement(356086..358035) [1950 bp, 649 aa] {O...    42   0.009
SAKL0A03344g Chr1 complement(305149..306243) [1095 bp, 364 aa] {...    42   0.010
ZYRO0E07876g Chr5 (616134..617243) [1110 bp, 369 aa] {ON} simila...    41   0.015
Kpol_538.20 s538 (39404..42382) [2979 bp, 992 aa] {ON} (39404..4...    41   0.016
Kwal_56.23723 s56 complement(676986..677432) [447 bp, 149 aa] {O...    39   0.017
KLLA0A06776g Chr1 (612115..614517) [2403 bp, 800 aa] {ON} simila...    41   0.018
KLLA0C07216g Chr3 (626227..628278) [2052 bp, 683 aa] {ON} simila...    41   0.020
Ecym_6359 Chr6 complement(699564..702176) [2613 bp, 870 aa] {ON}...    41   0.021
Kwal_33.15381 s33 complement(1080902..1083868) [2967 bp, 988 aa]...    41   0.022
Ecym_8210 Chr8 (431406..434297) [2892 bp, 963 aa] {ON} similar t...    41   0.025
TBLA0A02040 Chr1 complement(493305..495056) [1752 bp, 583 aa] {O...    40   0.026
TBLA0A06660 Chr1 complement(1626147..1630400) [4254 bp, 1417 aa]...    41   0.027
KAFR0B03270 Chr2 complement(677477..679231) [1755 bp, 584 aa] {O...    40   0.029
KLTH0H03080g Chr8 complement(274038..275078) [1041 bp, 346 aa] {...    40   0.035
SAKL0H10340g Chr8 complement(883790..886009) [2220 bp, 739 aa] {...    40   0.037
NDAI0D02140 Chr4 complement(496708..499785) [3078 bp, 1025 aa] {...    40   0.051
AFR076W Chr6 (564252..566714) [2463 bp, 820 aa] {ON} Syntenic ho...    39   0.076
KLTH0E15026g Chr5 (1331171..1335730) [4560 bp, 1519 aa] {ON} sim...    39   0.077
TPHA0G00610 Chr7 (114519..116138) [1620 bp, 539 aa] {ON} Anc_8.7...    39   0.11 
TBLA0B06620 Chr2 complement(1556378..1559671) [3294 bp, 1097 aa]...    39   0.11 
Kwal_14.1249 s14 (252877..253911) [1035 bp, 344 aa] {ON} YFL029C...    38   0.11 
Skud_2.225 Chr2 (405095..409459) [4365 bp, 1454 aa] {ON} YBR097W...    39   0.12 
SAKL0B01474g Chr2 complement(145734..146777) [1044 bp, 347 aa] {...    38   0.12 
TDEL0C03760 Chr3 complement(661391..663895) [2505 bp, 834 aa] {O...    38   0.13 
KLTH0G18282g Chr7 complement(1576512..1577558) [1047 bp, 348 aa]...    38   0.15 
NCAS0A07080 Chr1 complement(1400590..1403607) [3018 bp, 1005 aa]...    38   0.15 
YBR097W Chr2 (436951..441315) [4365 bp, 1454 aa] {ON}  VPS15Myri...    38   0.19 
KAFR0G01670 Chr7 (363200..367459) [4260 bp, 1419 aa] {ON} Anc_3....    38   0.23 
KNAG0A07560 Chr1 (1186540..1187550) [1011 bp, 336 aa] {ON} Anc_3...    37   0.24 
CAGL0G01716g Chr7 complement(155248..156390) [1143 bp, 380 aa] {...    37   0.24 
Kpol_1065.32 s1065 complement(65735..70255) [4521 bp, 1506 aa] {...    37   0.29 
SAKL0G13882g Chr7 complement(1191656..1194604) [2949 bp, 982 aa]...    37   0.30 
KAFR0F02310 Chr6 (452380..453912) [1533 bp, 510 aa] {ON} Anc_3.1...    37   0.33 
Suva_4.344 Chr4 (606007..610371) [4365 bp, 1454 aa] {ON} YBR097W...    37   0.36 
TDEL0D04390 Chr4 complement(799835..801340) [1506 bp, 501 aa] {O...    37   0.37 
TDEL0E04680 Chr5 complement(875878..878862) [2985 bp, 994 aa] {O...    37   0.39 
Kwal_27.12562 s27 (1274883..1279139) [4257 bp, 1418 aa] {ON} YBR...    37   0.43 
SAKL0B07326g Chr2 (627224..631477) [4254 bp, 1417 aa] {ON} simil...    37   0.44 
KLLA0F22605g Chr6 complement(2109034..2111913) [2880 bp, 959 aa]...    36   0.58 
KNAG0J02520 Chr10 (472464..476795) [4332 bp, 1443 aa] {ON} Anc_3...    36   0.73 
KLTH0E15972g Chr5 complement(1414595..1416016) [1422 bp, 473 aa]...    35   0.76 
NDAI0I00630 Chr9 (138710..139813) [1104 bp, 367 aa] {ON} Anc_6.2...    35   0.87 
Smik_2.239 Chr2 (421843..426207) [4365 bp, 1454 aa] {ON} YBR097W...    35   0.92 
NDAI0A06470 Chr1 (1470263..1472083) [1821 bp, 606 aa] {ON} Anc_3...    35   0.94 
AEL330C Chr5 complement(27521..28105) [585 bp, 194 aa] {ON} Synt...    34   0.98 
AGR315C Chr7 complement(1319993..1322872) [2880 bp, 959 aa] {ON}...    35   1.2  
AER216C Chr5 complement(1032840..1034348) [1509 bp, 502 aa] {ON}...    35   1.2  
CAGL0K01815g Chr11 (162973..164487) [1515 bp, 504 aa] {ON} simil...    35   1.2  
ZYRO0A05060g Chr1 complement(405402..406886) [1485 bp, 494 aa] {...    35   1.2  
ZYRO0F09174g Chr6 complement(744109..745638) [1530 bp, 509 aa] {...    35   1.3  
ZYRO0G12232g Chr7 (964508..967591) [3084 bp, 1027 aa] {ON} simil...    35   1.3  
Kpol_1010.68 s1010 complement(168093..169595) [1503 bp, 500 aa] ...    35   1.3  
Suva_4.232 Chr4 (417104..418627) [1524 bp, 507 aa] {ON} YDL017W ...    35   1.6  
TPHA0A04330 Chr1 (974713..976218) [1506 bp, 501 aa] {ON} Anc_3.1...    35   1.6  
KNAG0E03740 Chr5 complement(738877..741528) [2652 bp, 883 aa] {O...    35   1.7  
NCAS0A01090 Chr1 (216576..218042) [1467 bp, 488 aa] {ON} Anc_6.215     34   1.8  
Kwal_27.9804 s27 (69307..70728) [1422 bp, 473 aa] {ON} YDL017W (...    34   1.8  
YDL017W Chr4 (424209..425732) [1524 bp, 507 aa] {ON}  CDC7DDK (D...    34   1.9  
KLLA0C04345g Chr3 (397899..399326) [1428 bp, 475 aa] {ON} simila...    34   1.9  
Smik_4.218 Chr4 (406174..407697) [1524 bp, 507 aa] {ON} YDL017W ...    34   2.2  
Skud_4.237 Chr4 (418979..420502) [1524 bp, 507 aa] {ON} YDL017W ...    34   2.3  
Kpol_1002.61 s1002 complement(167383..169851) [2469 bp, 822 aa] ...    34   2.4  
KNAG0K01660 Chr11 complement(345808..347331) [1524 bp, 507 aa] {...    33   3.0  
Suva_7.481 Chr7 complement(829537..832644) [3108 bp, 1035 aa] {O...    33   3.4  
TPHA0J03180 Chr10 complement(691886..694882) [2997 bp, 998 aa] {...    33   3.7  
Ecym_5258 Chr5 (536868..538376) [1509 bp, 502 aa] {ON} similar t...    33   3.7  
TBLA0F01730 Chr6 complement(431961..433004) [1044 bp, 347 aa] {O...    33   3.9  
TPHA0H02120 Chr8 complement(498282..499385) [1104 bp, 367 aa] {O...    33   4.3  
SAKL0C07876g Chr3 (732534..733970) [1437 bp, 478 aa] {ON} simila...    33   6.0  
TDEL0A07100 Chr1 complement(1240969..1241997,1242076..1242102) [...    32   6.5  
Kpol_1018.16 s1018 (46272..46298,46411..47481) [1098 bp, 365 aa]...    32   9.0  
Smik_6.306 Chr6 complement(480942..484031) [3090 bp, 1029 aa] {O...    32   9.1  
TBLA0D01500 Chr4 (374387..375796) [1410 bp, 469 aa] {ON} Anc_5.5...    32   9.6  

>CAGL0K05709g Chr11 complement(556732..560043) [3312 bp, 1103 aa] {ON}
            similar to uniprot|Q12263 Saccharomyces cerevisiae
            YDR507c GIN4
          Length = 1103

 Score = 1987 bits (5147), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 992/1103 (89%), Positives = 992/1103 (89%)

Query: 1    MSAISSNTVSVIKNNQIGPWKLGETLGSGSTGKVLLASNETTKQQAAVKVISKAVFEAMN 60
            MSAISSNTVSVIKNNQIGPWKLGETLGSGSTGKVLLASNETTKQQAAVKVISKAVFEAMN
Sbjct: 1    MSAISSNTVSVIKNNQIGPWKLGETLGSGSTGKVLLASNETTKQQAAVKVISKAVFEAMN 60

Query: 61   NSESNGDATNALPYNIEQEIIIMKLLNHPNVLRLFDVWETNSDLYLVLEYAEKGELFNML 120
            NSESNGDATNALPYNIEQEIIIMKLLNHPNVLRLFDVWETNSDLYLVLEYAEKGELFNML
Sbjct: 61   NSESNGDATNALPYNIEQEIIIMKLLNHPNVLRLFDVWETNSDLYLVLEYAEKGELFNML 120

Query: 121  VERGPLPENEAVRAFRQIIIGISYCHSLGVVHRDLKPEXXXXXXXXXXXXADFGMAALES 180
            VERGPLPENEAVRAFRQIIIGISYCHSLGVVHRDLKPE            ADFGMAALES
Sbjct: 121  VERGPLPENEAVRAFRQIIIGISYCHSLGVVHRDLKPENLLLDNKLNIKIADFGMAALES 180

Query: 181  EDKLLETSCGSPHYAAPEIISGLPYEGFSSDVWSCGVILFALLTGRLPFDEEDGNIRNLL 240
            EDKLLETSCGSPHYAAPEIISGLPYEGFSSDVWSCGVILFALLTGRLPFDEEDGNIRNLL
Sbjct: 181  EDKLLETSCGSPHYAAPEIISGLPYEGFSSDVWSCGVILFALLTGRLPFDEEDGNIRNLL 240

Query: 241  LKVQKGEFEMPDDDEITKEAQDLLARLLTVDPSKRITIREILKHPLLQKYPSIKDSRSIR 300
            LKVQKGEFEMPDDDEITKEAQDLLARLLTVDPSKRITIREILKHPLLQKYPSIKDSRSIR
Sbjct: 241  LKVQKGEFEMPDDDEITKEAQDLLARLLTVDPSKRITIREILKHPLLQKYPSIKDSRSIR 300

Query: 301  NLPREDTYLSPLADTNSKIDDAILQNLVILWHGKDAREIAAKLREPGANTEKTLYALLYR 360
            NLPREDTYLSPLADTNSKIDDAILQNLVILWHGKDAREIAAKLREPGANTEKTLYALLYR
Sbjct: 301  NLPREDTYLSPLADTNSKIDDAILQNLVILWHGKDAREIAAKLREPGANTEKTLYALLYR 360

Query: 361  FKCDTQREANRARRQSKIVQRNSTIRSTAPEXXXXXXXXXXXXXXXRASIIASSSKRPVS 420
            FKCDTQREANRARRQSKIVQRNSTIRSTAPE               RASIIASSSKRPVS
Sbjct: 361  FKCDTQREANRARRQSKIVQRNSTIRSTAPESPSKKKTYTPQKKNKRASIIASSSKRPVS 420

Query: 421  VTKTATNITVNSSITGTPKSAKRMSMNNSARKRMSALYGXXXXXXXXXXXXXXXXXXXXF 480
            VTKTATNITVNSSITGTPKSAKRMSMNNSARKRMSALYG                    F
Sbjct: 421  VTKTATNITVNSSITGTPKSAKRMSMNNSARKRMSALYGTRDSPTKTSRSRRSSIITKDF 480

Query: 481  LGNRPRDSVISMSHNKRASKSSKRISLVPNLKRQSVTTKLMATYAKLSEDDDWEYIERET 540
            LGNRPRDSVISMSHNKRASKSSKRISLVPNLKRQSVTTKLMATYAKLSEDDDWEYIERET
Sbjct: 481  LGNRPRDSVISMSHNKRASKSSKRISLVPNLKRQSVTTKLMATYAKLSEDDDWEYIERET 540

Query: 541  KRTSSDFATLIDEIFEYEKYEQIRKEKAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 600
            KRTSSDFATLIDEIFEYEKYEQIRKEKA                                
Sbjct: 541  KRTSSDFATLIDEIFEYEKYEQIRKEKAELERKVRETKEREERERKERQEKELQERLERE 600

Query: 601  XXXXXXXDIARQMDEEISNLKKELVGDQDNEDKFRSVSEPLXXXXXXXXXXXXXXXGILR 660
                   DIARQMDEEISNLKKELVGDQDNEDKFRSVSEPL               GILR
Sbjct: 601  RIEKQKEDIARQMDEEISNLKKELVGDQDNEDKFRSVSEPLESKSKKIEDIEEDIDGILR 660

Query: 661  NRKYSLQTRPVSRLDPGIGFIDKPRQSEQHVPETVNLEPELEETEQKILETIRRSKFLGS 720
            NRKYSLQTRPVSRLDPGIGFIDKPRQSEQHVPETVNLEPELEETEQKILETIRRSKFLGS
Sbjct: 661  NRKYSLQTRPVSRLDPGIGFIDKPRQSEQHVPETVNLEPELEETEQKILETIRRSKFLGS 720

Query: 721  SFDIKKELENVKRHRQTSQPIEKEMAPPALPETLPKAVEKKNVSMDPSLRKISDIKVPQF 780
            SFDIKKELENVKRHRQTSQPIEKEMAPPALPETLPKAVEKKNVSMDPSLRKISDIKVPQF
Sbjct: 721  SFDIKKELENVKRHRQTSQPIEKEMAPPALPETLPKAVEKKNVSMDPSLRKISDIKVPQF 780

Query: 781  TRKSRHFSTSNRRLSVLSMYSTKESYSNLADILKNGPGEKEMIQTAPTPKSADDSDQLFD 840
            TRKSRHFSTSNRRLSVLSMYSTKESYSNLADILKNGPGEKEMIQTAPTPKSADDSDQLFD
Sbjct: 781  TRKSRHFSTSNRRLSVLSMYSTKESYSNLADILKNGPGEKEMIQTAPTPKSADDSDQLFD 840

Query: 841  TIDEADTPASVSREERLYEVAEESENELANKKIDIADLLNSEGSNLKSVEEQEDSMKLPK 900
            TIDEADTPASVSREERLYEVAEESENELANKKIDIADLLNSEGSNLKSVEEQEDSMKLPK
Sbjct: 841  TIDEADTPASVSREERLYEVAEESENELANKKIDIADLLNSEGSNLKSVEEQEDSMKLPK 900

Query: 901  LPPLFEDGSTKETKEQSKSMIPENMQSSESQKQIEKNNSDEGGSLNPFMTKHRDVSDKGV 960
            LPPLFEDGSTKETKEQSKSMIPENMQSSESQKQIEKNNSDEGGSLNPFMTKHRDVSDKGV
Sbjct: 901  LPPLFEDGSTKETKEQSKSMIPENMQSSESQKQIEKNNSDEGGSLNPFMTKHRDVSDKGV 960

Query: 961  TKEKPTVTMKTTSEQVSADKKRNMSFLRXXXXXXXXXXDNVDVTLSTSVSSKQLFSGLVN 1020
            TKEKPTVTMKTTSEQVSADKKRNMSFLR          DNVDVTLSTSVSSKQLFSGLVN
Sbjct: 961  TKEKPTVTMKTTSEQVSADKKRNMSFLRKLSKGSSSSKDNVDVTLSTSVSSKQLFSGLVN 1020

Query: 1021 LLKGWTKYGLKGIAIDSTSQTITGKLANDNILSFRSTAFSILIFSQEKGSAVTFRKVSGS 1080
            LLKGWTKYGLKGIAIDSTSQTITGKLANDNILSFRSTAFSILIFSQEKGSAVTFRKVSGS
Sbjct: 1021 LLKGWTKYGLKGIAIDSTSQTITGKLANDNILSFRSTAFSILIFSQEKGSAVTFRKVSGS 1080

Query: 1081 GKAVRRLSDEVKKVLSKEGVLRD 1103
            GKAVRRLSDEVKKVLSKEGVLRD
Sbjct: 1081 GKAVRRLSDEVKKVLSKEGVLRD 1103

>Suva_2.687 Chr2 complement(1215095..1218481) [3387 bp, 1128 aa] {ON}
            YCL024W (REAL)
          Length = 1128

 Score = 1026 bits (2652), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 595/1159 (51%), Positives = 757/1159 (65%), Gaps = 92/1159 (7%)

Query: 3    AISSNTVSVIKNNQIGPWKLGETLGSGSTGKVLLASNETTKQQAAVKVISKAVFEAMNNS 62
            A++ N++  IK+N IGPWKLGETLG GSTGKV LA N++T Q+AAVKVISKAVF + N S
Sbjct: 2    AVNGNSIQAIKDNTIGPWKLGETLGLGSTGKVQLARNKSTGQEAAVKVISKAVFNSGNVS 61

Query: 63   ESNGDATN---ALPYNIEQEIIIMKLLNHPNVLRLFDVWETNSDLYLVLEYAEKGELFNM 119
             ++   +N   ALPY IE+EIIIMKLLNHPNVLRL+DVWETN+DLYLVLEYAEKGELFN+
Sbjct: 62   GTSIVGSNTPDALPYGIEREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNL 121

Query: 120  LVERGPLPENEAVRAFRQIIIGISYCHSLGVVHRDLKPEXXXXXXXXXXXXADFGMAALE 179
            LVERGPLPENEA+R FRQIIIG+SYCH+LG+VHRDLKPE            ADFGMAALE
Sbjct: 122  LVERGPLPENEAIRFFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALE 181

Query: 180  SEDKLLETSCGSPHYAAPEIISGLPYEGFSSDVWSCGVILFALLTGRLPFDEEDGNIRNL 239
            +E KLLETSCGSPHYAAPEI+SG+PY+GF+SDVWSCGVILFALLTGRLPFDEEDGNIR L
Sbjct: 182  TEGKLLETSCGSPHYAAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGNIRAL 241

Query: 240  LLKVQKGEFEMPDDDEITKEAQDLLARLLTVDPSKRITIREILKHPLLQKYPSIKDSRSI 299
            LLKVQKGEFE+P DDEI++EAQDL++++LTVDP +RI  R+ILKHPLLQKYPSI+DS+SI
Sbjct: 242  LLKVQKGEFELPSDDEISREAQDLISKILTVDPERRIKARDILKHPLLQKYPSIRDSKSI 301

Query: 300  RNLPREDTYLSPLADTNSKIDDAILQNLVILWHGKDAREIAAKLREPGANTEKTLYALLY 359
            R+LPREDTYL+PL+++NS ID  ILQNLVILWHG+D   I AKL+EPGAN EKTLYALLY
Sbjct: 302  RDLPREDTYLTPLSESNSSIDATILQNLVILWHGRDPDGIRAKLQEPGANAEKTLYALLY 361

Query: 360  RFKCDTQREANRARRQSKIVQRNS--TIRSTAPEXXXXXXXXXXXXXXXRASII--ASSS 415
            RFKCDTQ+E     +Q +I +R S  ++  + P+               R SII  +SS 
Sbjct: 362  RFKCDTQKE---LIKQQQIRKRQSIGSVSISPPK----RTSTTPQRRRNRESIISVSSSR 414

Query: 416  KRPVSVTKTATNITVNSSITGTPKSAKRMSMNNSARKRMSALYGXXXXXXXXXXXXXXXX 475
            K+P+S  K   +   +S++T TP S+KR+S N S++K++S +                  
Sbjct: 415  KKPISFNKFTASSASSSNLT-TPGSSKRLSKNFSSKKKLSTIVNQSSPTPSSRNKRTSIA 473

Query: 476  XXXXFLGNRPRDSVISMS-HNKRASKSSKRISLVPNLKRQSVTTKLMATYAKLSEDDDWE 534
                   N+ R S+ S +  NKRASKS++R+SL+P++KR+SVTTKLM+TYAKL+EDDDWE
Sbjct: 474  NVDK---NQKRASIFSTTKKNKRASKSTRRMSLIPSMKRESVTTKLMSTYAKLAEDDDWE 530

Query: 535  YIERETKRTSSDFATLIDEIFEYEKYEQIRKEKAXXXXXXXXXXXXXXXXXXXXXXXXXX 594
            YIE+ETKRTSS+FATLIDEIFEYEKY+QIRKEK                           
Sbjct: 531  YIEKETKRTSSNFATLIDEIFEYEKYDQIRKEKEELERKVKEAKALEELERRKRKQEEKE 590

Query: 595  XXXX---XXXXXXXXXDIARQMDEEISNLKKELVGDQDN--EDKFRSVSEPLXXXXXXXX 649
                            ++ +Q+D +IS+L+ EL+  ++   E   RS+S P+        
Sbjct: 591  RARKLLEKEELKRKQEELKKQIDIDISDLEHELINHREEKFEGNIRSISAPMENEENNIN 650

Query: 650  XXXXXXXGILRNRKYSLQTRPVSRLDPGIGFIDKPRQSEQHVPETVNLEPELEETEQKIL 709
                    ILR R +SLQTRPVSRLDPGI F   P ++E  V E    E E   TE+KIL
Sbjct: 651  HLEADIDNILRRRNFSLQTRPVSRLDPGIIF-SSPIETEDPV-EPKKAENERLTTEKKIL 708

Query: 710  ETIRRSKFLGSSFDIKKELENVKRHRQTSQPIEKEMAPPALPE--------------TLP 755
            ETIRRSKFLGSSF+I KEL    +  Q   P     AP  L E               LP
Sbjct: 709  ETIRRSKFLGSSFNIDKEL----KLSQMEYP--GMAAPQRLSEERIVSDSNGKYESLVLP 762

Query: 756  K-----AVEKKNVS-------MDPSLRKISDIKVPQFTRKSRHFSTSNRRLSVLSMYSTK 803
            K     A  K N +        +  LRKISDI+VPQFTRKSRHFS SN+RLSVLSMYSTK
Sbjct: 763  KDAKGVAHLKDNTAPTTTELLSNGELRKISDIRVPQFTRKSRHFSESNKRLSVLSMYSTK 822

Query: 804  ESYSNLADILKNGPGE--KEMIQTAPTPKSADDSDQLFDTI-DEADTPASVSREERLYEV 860
            ES++NL DILKNG  +   +  Q  PTP+SADDS+ LF+T+ +EA+   + S +ERLY+V
Sbjct: 823  ESFTNLVDILKNGNLDINPQQNQRVPTPRSADDSEFLFETVNEEAEYTGNSSNDERLYDV 882

Query: 861  AEESENELANKKIDIADLLNSEGSNLKSVEEQEDSMKLPKLPPL-FEDGSTKETKEQS-- 917
             +    +    K++ AD  N  GS   + E++  ++ LP LPPL  +D + K+ +EQ   
Sbjct: 883  GDSCIKDKNTLKLNFADRFN--GS---TNEKETKNLHLPTLPPLNGKDEAGKQGEEQEKE 937

Query: 918  --------KSMIPENMQSSESQK-QIEKNNSDEGGS-----LNPFMTKHRDVSDKGVTKE 963
                    KSMIPE+   S ++K Q E+ +   GG      LN  + K R+ ++   T+ 
Sbjct: 938  DLHEQPKVKSMIPESDSLSHAEKEQKEREDQQRGGKDLEPPLNKSVQKTREKNND--TQA 995

Query: 964  KPTVTMKTTSEQVSADKKRNMSFLRXXXXXXXXXXDNVDVTLSTSVSSKQLFSGLVNLLK 1023
            K   T    ++ VS     N SF R                L   VS+KQLF+GL  LL+
Sbjct: 996  KNQSTDPKPNKNVSG----NGSFFRKFSKSSTSE---KSTELYAKVSAKQLFNGLEKLLR 1048

Query: 1024 GWTKYGLKGIAIDSTSQTITGKLANDNILSFRSTAFSILIFSQEKGSAVTFRKVSGSGKA 1083
            GW +YGLK +  +  + T+TGKL+++N+ S RST F + I+ + K S V F+K+SGS K 
Sbjct: 1049 GWNQYGLKNVKSNPNNLTLTGKLSSENMFSLRSTLFEVSIYQKGKVSVVEFKKISGSFKT 1108

Query: 1084 VRRLSDEVKKVLSKEGVLR 1102
            V++L  EV+ VL+KEGVL+
Sbjct: 1109 VKKLVKEVENVLNKEGVLQ 1127

>Skud_4.783 Chr4 complement(1382552..1385959) [3408 bp, 1135 aa] {ON}
            YDR507C (REAL)
          Length = 1135

 Score = 1014 bits (2623), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 586/1171 (50%), Positives = 748/1171 (63%), Gaps = 111/1171 (9%)

Query: 3    AISSNTVSVIKNNQIGPWKLGETLGSGSTGKVLLASNETTKQQAAVKVISKAVFEAMNNS 62
            A++ N+V  IK+N IGPWKLGETLG GSTGKV LA N++T Q+AAVKVISKAVF A N S
Sbjct: 2    AVNGNSVPAIKDNTIGPWKLGETLGLGSTGKVQLARNKSTGQEAAVKVISKAVFNAGNMS 61

Query: 63   ESN--GDAT-NALPYNIEQEIIIMKLLNHPNVLRLFDVWETNSDLYLVLEYAEKGELFNM 119
             ++  G  T +ALPY IE+EIIIMKLLNHPNVLRL+DVWETN+DLYLVLEYAEKGELFN+
Sbjct: 62   GTSIVGSITPDALPYGIEREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNL 121

Query: 120  LVERGPLPENEAVRAFRQIIIGISYCHSLGVVHRDLKPEXXXXXXXXXXXXADFGMAALE 179
            LVERGPLPENEA+R FRQIIIG+SYCH+LG+VHRDLKPE            ADFGMAALE
Sbjct: 122  LVERGPLPENEAIRFFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALE 181

Query: 180  SEDKLLETSCGSPHYAAPEIISGLPYEGFSSDVWSCGVILFALLTGRLPFDEEDGNIRNL 239
            +E KLLETSCGSPHYAAPEI+SG+PY+GF+SDVWSCGVILFALLTGRLPFDEEDGNIR L
Sbjct: 182  TEGKLLETSCGSPHYAAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGNIRTL 241

Query: 240  LLKVQKGEFEMPDDDEITKEAQDLLARLLTVDPSKRITIREILKHPLLQKYPSIKDSRSI 299
            LLKVQKG+FE+P DDE+++EAQDL+ ++LTVDP +RI  R+ILKHPLLQKYPSI+DS+SI
Sbjct: 242  LLKVQKGQFELPSDDEVSREAQDLICKILTVDPKRRIKARDILKHPLLQKYPSIRDSKSI 301

Query: 300  RNLPREDTYLSPLADTNSKIDDAILQNLVILWHGKDAREIAAKLREPGANTEKTLYALLY 359
            R LPREDTYL+PL+++NS ID  ILQNLVILWHG+D   I  KL+EPGAN EKTLYALLY
Sbjct: 302  RGLPREDTYLTPLSESNSSIDATILQNLVILWHGRDPDGIKEKLKEPGANAEKTLYALLY 361

Query: 360  RFKCDTQREANRARRQSKIVQRNSTIRSTAPEXXXXXXXXXXXXXXXRASIIA--SSSKR 417
            RFKCDTQ+E  R ++Q K  Q  S++ +++P                R SII+  SS K+
Sbjct: 362  RFKCDTQKELIR-QQQIKKRQSISSVSTSSPN----KISTTPQRRKNRESIISVTSSRKK 416

Query: 418  PVSVTKTATNITVNSSITGTPKSAKRMSMNNSARKRMSALYGXXXXXXXXXXXXXXXXXX 477
            P+S  K   +   +S++T TP S+KR+S N S++KR+S +                    
Sbjct: 417  PISFNKFTASSASSSNLT-TPGSSKRLSKNFSSKKRLSTIVNQASPTPASRNKRTSIINV 475

Query: 478  XXFLGNRPRDSVISMS-HNKRASKSSKRISLVPNLKRQSVTTKLMATYAKLSEDDDWEYI 536
                 N+ R SV S +  NK+ S+S+K++SL+P++KR+SVTTKLM+TYAKL+ DDDWEYI
Sbjct: 476  DK---NQRRASVFSTAKRNKKTSRSTKKLSLIPSMKRESVTTKLMSTYAKLAADDDWEYI 532

Query: 537  ERETKRTSSDFATLIDEIFEYEKYEQIRKEKAX---XXXXXXXXXXXXXXXXXXXXXXXX 593
            E+ETKRTSS+FATLIDEIFEYEKYE+IRKEK                             
Sbjct: 533  EKETKRTSSNFATLIDEIFEYEKYEKIRKEKKELELKVREAKAREELERRKRKQEEKEHS 592

Query: 594  XXXXXXXXXXXXXXDIARQMDEEISNLKKELVGDQDN--EDKFRSVSEPLXXXXXXXXXX 651
                          ++ +Q++ +IS+L+ EL   ++   +   RS+S P+          
Sbjct: 593  RKVLEKEELKRKQQELKKQIEIDISDLEHELSKHKEEKPDGNIRSISAPMESEEKNINHL 652

Query: 652  XXXXXGILRNRKYSLQTRPVSRLDPGIGFIDKPRQSEQHVPETVNLEPELEETEQKILET 711
                  ILR R +SLQTRPVSRLDPGI F   P + E  V E    E E   TE+KILET
Sbjct: 653  EVDIDNILRRRNFSLQTRPVSRLDPGIMF-SSPVEKESAV-EPKRTENERLTTEKKILET 710

Query: 712  IRRSKFLGSSFDIKKELENVKRHRQTSQPIEKEMAPPALPETLPKAVEKKNVSMDPS--- 768
            IRRSKFLGSSF+I+KEL+           + K   P  +P   P+ + ++ +  DPS   
Sbjct: 711  IRRSKFLGSSFNIEKELK-----------LSKMEYPSMVP---PQRLSEERIVSDPSDDY 756

Query: 769  -------------------------------LRKISDIKVPQFTRKSRHFSTSNRRLSVL 797
                                           LRKIS+++VPQFTRKSRHFS SN+RLSVL
Sbjct: 757  GSLVLPKDARGYSQLEDHIAPTTGDLLSNGELRKISEVRVPQFTRKSRHFSESNKRLSVL 816

Query: 798  SMYSTKESYSNLADILKNG--PGEKEMIQTAPTPKSADDSDQLFDTI-DEADTPASVSRE 854
            SMYS+KES++NL DILKNG     K+  Q  PTPKSADDS+ LF+T+ +EA+   + S +
Sbjct: 817  SMYSSKESFTNLVDILKNGNIDVHKQQSQRIPTPKSADDSEFLFETVNEEAEYTGNSSND 876

Query: 855  ERLYEVAEESENELANKKIDIADLLNSEGSNLKSVEEQEDSMKLPKLPPLFEDGSTKETK 914
            ERLY+V + +  + +  K++ AD  N+  +     E++ +++ LP LPPL       + K
Sbjct: 877  ERLYDVGDSTIKDKSALKLNFADRFNASTN-----EKETENLHLPTLPPLNGGDEVNKQK 931

Query: 915  EQS--------KSMIPENMQSS----------------ESQKQIEKNNSDEGGSLNPFMT 950
            ++         KSMIP++  SS                E Q++  K   D    LN  + 
Sbjct: 932  DEDVLGIQPKVKSMIPQSDSSSHTGKEEEKEEKGEEGREDQEKDAKGAKDIEPPLNKSVQ 991

Query: 951  KHRDVSDKGVTKEKPTVTMKTTSEQVSADKKRNMSFLRXXXXXXXXXXDNVDVTLSTSVS 1010
            K R  +D G     P V       +   +   N SF R           +  V L   VS
Sbjct: 992  KTR-ANDSG-----PQVKSHPREPKKDRNISGNGSFFRKFSKSSTS---DKSVELYAKVS 1042

Query: 1011 SKQLFSGLVNLLKGWTKYGLKGIAIDSTSQTITGKLANDNILSFRSTAFSILIFSQEKGS 1070
            +KQLF+GL  LL+GWT+YGLK I     + T+TGKL+++NI S RST F I I+ + K S
Sbjct: 1043 AKQLFNGLEKLLRGWTQYGLKNIKSHPNNLTLTGKLSSENIFSLRSTLFEISIYPRGKMS 1102

Query: 1071 AVTFRKVSGSGKAVRRLSDEVKKVLSKEGVL 1101
             V F+KVSG+ KAV++L +EV+ VLSKEGVL
Sbjct: 1103 VVQFKKVSGAFKAVKKLVNEVENVLSKEGVL 1133

>YDR507C Chr4 complement(1462358..1465786) [3429 bp, 1142 aa] {ON}
            GIN4Protein kinase involved in bud growth and assembly of
            the septin ring, proposed to have kinase-dependent and
            kinase-independent activities; undergoes
            autophosphorylation; similar to Kcc4p and Hsl1p
          Length = 1142

 Score = 1013 bits (2619), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 590/1168 (50%), Positives = 739/1168 (63%), Gaps = 96/1168 (8%)

Query: 3    AISSNTVSVIKNNQIGPWKLGETLGSGSTGKVLLASNETTKQQAAVKVISKAVFEAMNNS 62
            AI+ N++  IK+N IGPWKLGETLG GSTGKV LA N +T Q+AAVKVISKAVF   N S
Sbjct: 2    AINGNSIPAIKDNTIGPWKLGETLGLGSTGKVQLARNGSTGQEAAVKVISKAVFNTGNVS 61

Query: 63   ESN--GDAT-NALPYNIEQEIIIMKLLNHPNVLRLFDVWETNSDLYLVLEYAEKGELFNM 119
             ++  G  T +ALPY IE+EIIIMKLLNHPNVLRL+DVWETN+DLYLVLEYAEKGELFN+
Sbjct: 62   GTSIVGSTTPDALPYGIEREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNL 121

Query: 120  LVERGPLPENEAVRAFRQIIIGISYCHSLGVVHRDLKPEXXXXXXXXXXXXADFGMAALE 179
            LVERGPLPE+EA+R FRQIIIG+SYCH+LG+VHRDLKPE            ADFGMAALE
Sbjct: 122  LVERGPLPEHEAIRFFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALE 181

Query: 180  SEDKLLETSCGSPHYAAPEIISGLPYEGFSSDVWSCGVILFALLTGRLPFDEEDGNIRNL 239
            +E KLLETSCGSPHYAAPEI+SG+PY+GF+SDVWSCGVILFALLTGRLPFDEEDGNIR L
Sbjct: 182  TEGKLLETSCGSPHYAAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGNIRTL 241

Query: 240  LLKVQKGEFEMPDDDEITKEAQDLLARLLTVDPSKRITIREILKHPLLQKYPSIKDSRSI 299
            LLKVQKGEFEMP DDEI++EAQDL+ ++LTVDP +RI  R+ILKHPLLQKYPSI+DS+SI
Sbjct: 242  LLKVQKGEFEMPSDDEISREAQDLIRKILTVDPERRIKTRDILKHPLLQKYPSIRDSKSI 301

Query: 300  RNLPREDTYLSPLADTNSKIDDAILQNLVILWHGKDAREIAAKLREPGANTEKTLYALLY 359
            R LPREDTYL+PL+++NS ID  ILQNLVILWHG+D   I  KLREPGAN EKTLYALLY
Sbjct: 302  RGLPREDTYLTPLSESNSSIDATILQNLVILWHGRDPEGIKEKLREPGANAEKTLYALLY 361

Query: 360  RFKCDTQREANRARRQSKIVQRNSTIRSTAPEXXXXXXXXXXXXXXXRASIIASSSKRPV 419
            RFKCDTQ+E     +Q ++ +R S    +                      + SS K+P+
Sbjct: 362  RFKCDTQKE---LIKQQQVKKRQSISSVSVSPSKKVSTTPQRRRNRESLISVTSSRKKPI 418

Query: 420  SVTKTATNITVNSSITGTPKSAKRMSMNNSARKRMSALYGXXXXXXXXXXXXXXXXXXXX 479
            S  K   +   +S++T TP S+KR+S N S++K++S +                      
Sbjct: 419  SFNKFTASSASSSNLT-TPGSSKRLSKNFSSKKKLSTIVNQSSPTPASRNKRASVINVEK 477

Query: 480  FLGNRPRDSVISMS-HNKRASKSSKRISLVPNLKRQSVTTKLMATYAKLSEDDDWEYIER 538
               N+ R S+ S +  NKR+S+S KR+SL+P++KR+SVTTKLM+TYAKL+EDDDWEYIE+
Sbjct: 478  ---NQKRASIFSTTKKNKRSSRSIKRMSLIPSMKRESVTTKLMSTYAKLAEDDDWEYIEK 534

Query: 539  ETKRTSSDFATLIDEIFEYEKYEQIRKEKAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 598
            ETKRTSS+FATLIDEIFEYEKYEQIRKEK                               
Sbjct: 535  ETKRTSSNFATLIDEIFEYEKYEQIRKEKEELERKVREAKAREELERRRRKQEEKERARK 594

Query: 599  ---XXXXXXXXXDIARQMDEEISNLKKELVGDQDN--EDKFRSVSEPLXXXXXXXXXXXX 653
                        ++ +Q++ +IS+L++EL   ++   +   RS+S P+            
Sbjct: 595  LLEKEDLKRKQEELKKQIEIDISDLEQELSKHKEEKLDGNIRSISAPMENEEKNINHLEV 654

Query: 654  XXXGILRNRKYSLQTRPVSRLDPGIGFIDKPRQSEQHVPETVNLEPELEETEQKILETIR 713
                ILR R +SLQTRPVSRLDPGI F   P +    V E    E E   TE+KILETIR
Sbjct: 655  DIDNILRRRNFSLQTRPVSRLDPGIMF-SSPTEEVSPV-EPKRTENERLTTEKKILETIR 712

Query: 714  RSKFLGSSFDIKKELENVKRHRQTSQPIEKEMAPPALPE--------------TLPKAVE 759
            RSKFLGSSF+I KEL+  K    +       +AP  L E               LPK  +
Sbjct: 713  RSKFLGSSFNIDKELKLSKMEYPSI------IAPQRLSEERVVSDSNDGYESLILPK--D 764

Query: 760  KKNVSM------------DPSLRKISDIKVPQFTRKSRHFSTSNRRLSVLSMYSTKESYS 807
               VS             D  LRKIS+I+VPQFTRKSRHFS SN+RLSVLSMYSTKES++
Sbjct: 765  GNGVSQLKDSTATTAPVSDGRLRKISEIRVPQFTRKSRHFSESNKRLSVLSMYSTKESFT 824

Query: 808  NLADILKNGPGE--KEMIQTAPTPKSADDSDQLFDTI-DEADTPASVSREERLYEVAEES 864
            NL DILKNG  +   +  Q  PTP+SADDS+ LF+T+ +EA+   + S +ERLY+V + +
Sbjct: 825  NLVDILKNGNLDVNNQQSQRIPTPRSADDSEFLFETVNEEAEYTGNSSNDERLYDVGDST 884

Query: 865  ENELANKKIDIADLLNSEGSNLKSVEEQEDSMKLPKLPPLFEDGSTKETKEQS------- 917
              + +  K++ AD  N  GSN     +Q D++ LP LPPL  D   ++   Q        
Sbjct: 885  IKDKSALKLNFADRFN--GSN---EAKQTDNLHLPILPPLNGDNELRKQNSQEGDQAHPK 939

Query: 918  -KSMIPENMQSS----------------------ESQKQIEKNNSDEGGSLNPFMTKHRD 954
             KSMIPE+  SS                      E Q++ EK   D    LN  + K R+
Sbjct: 940  IKSMIPESGSSSHTEKEEENEEKEEKKPEQHKQEEDQEKREKVVDDMEPPLNKSVQKIRE 999

Query: 955  VSDKGVTKEKPTVTMKTTSEQVSADKKRNMSFLRXXXXXXXXXXDNVDVTLSTSVSSKQL 1014
             +     K+     +K   +Q       N SF R          +     L   +S+KQL
Sbjct: 1000 KNAGSQAKDHSKDHLK-EHKQDKNTAIGNGSFFRKFSKSSDKTME-----LYAKISAKQL 1053

Query: 1015 FSGLVNLLKGWTKYGLKGIAIDSTSQTITGKLANDNILSFRSTAFSILIFSQEKGSAVTF 1074
            F+GL  LL+GWT+YGLK I     + T+TGKL++DNI S RST F + I+ + K S V F
Sbjct: 1054 FNGLEKLLRGWTQYGLKNIKSHPNNLTLTGKLSSDNIFSLRSTLFEVNIYPRGKMSVVQF 1113

Query: 1075 RKVSGSGKAVRRLSDEVKKVLSKEGVLR 1102
            +KVSGS KAV++L +EV+ VL+KEGVL+
Sbjct: 1114 KKVSGSFKAVKKLVNEVENVLNKEGVLQ 1141

>Smik_4.789 Chr4 complement(1385209..1388619) [3411 bp, 1136 aa] {ON}
            YDR507C (REAL)
          Length = 1136

 Score = 1004 bits (2595), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 583/1158 (50%), Positives = 743/1158 (64%), Gaps = 82/1158 (7%)

Query: 3    AISSNTVSVIKNNQIGPWKLGETLGSGSTGKVLLASNETTKQQAAVKVISKAVFEAMNNS 62
            A++ N+V  IK+N IGPWKLGETLG GSTGKV LA N++T Q+AAVKVISK VF   N S
Sbjct: 2    AVNGNSVPAIKDNTIGPWKLGETLGLGSTGKVQLARNKSTGQEAAVKVISKTVFNTGNVS 61

Query: 63   ESN--GDAT-NALPYNIEQEIIIMKLLNHPNVLRLFDVWETNSDLYLVLEYAEKGELFNM 119
             ++  G  T +ALPY IE+EIIIMKLLNHPNVLRL+DVWETN+DLYLVLEYAEKGELFN+
Sbjct: 62   GTSIVGSTTPDALPYGIEREIIIMKLLNHPNVLRLYDVWETNADLYLVLEYAEKGELFNL 121

Query: 120  LVERGPLPENEAVRAFRQIIIGISYCHSLGVVHRDLKPEXXXXXXXXXXXXADFGMAALE 179
            LVERGPLPENEA+R FRQIIIG+SYCH+LG+VHRDLKPE            ADFGMAALE
Sbjct: 122  LVERGPLPENEAIRFFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALE 181

Query: 180  SEDKLLETSCGSPHYAAPEIISGLPYEGFSSDVWSCGVILFALLTGRLPFDEEDGNIRNL 239
            +E KLLETSCGSPHYAAPEI+SG+PY+GF+SDVWSCGVILFALLTGRLPFDEEDGNIR L
Sbjct: 182  TEGKLLETSCGSPHYAAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGNIRTL 241

Query: 240  LLKVQKGEFEMPDDDEITKEAQDLLARLLTVDPSKRITIREILKHPLLQKYPSIKDSRSI 299
            LLKVQKGEFE+P DDEI++EAQDL++R+LTVDP +RI  R+ILKHPLLQKYPSIKDS+SI
Sbjct: 242  LLKVQKGEFELPSDDEISREAQDLISRILTVDPERRIKTRDILKHPLLQKYPSIKDSKSI 301

Query: 300  RNLPREDTYLSPLADTNSKIDDAILQNLVILWHGKDAREIAAKLREPGANTEKTLYALLY 359
            R LPREDTYL+PL+++NS ID  ILQNLVILWHG+D   I  KLRE GAN EKTLYALLY
Sbjct: 302  RGLPREDTYLTPLSESNSSIDATILQNLVILWHGRDPDGIKEKLRETGANAEKTLYALLY 361

Query: 360  RFKCDTQREANRARRQSKIVQRNSTIRSTAPEXXXXXXXXXXXXXXXRASIIASSSKRPV 419
            RFKCDTQ+E     +Q +I +R S    +                      ++SS K+P+
Sbjct: 362  RFKCDTQKE---LVKQQQIKKRQSISSLSISPSKKLSTTPQRRKNRESMISVSSSRKKPI 418

Query: 420  SVTKTATNITVNSSITGTPKSAKRMSMNNSARKRMSALYGXXXXXXXXXXXXXXXXXXXX 479
            S  K   +   +S++T TP S+KR+S N S++K++S +                      
Sbjct: 419  SFNKFTASSASSSNLT-TPGSSKRLSKNFSSKKKLSTIVNQSSPTPASRNKRASVINIEK 477

Query: 480  FLGNRPRDSVISMS-HNKRASKSSKRISLVPNLKRQSVTTKLMATYAKLSEDDDWEYIER 538
               N+ R SV S +  NKR SKS KR+SL+P++KR+SVTTKLM+TYAKL+EDDDWEYIE+
Sbjct: 478  ---NQKRASVFSTAKKNKRTSKSIKRMSLIPSMKRESVTTKLMSTYAKLAEDDDWEYIEK 534

Query: 539  ETKRTSSDFATLIDEIFEYEKYEQIRKEKAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 598
            ETKRTSS+FATLIDEIFEYEKYEQIRKEK                               
Sbjct: 535  ETKRTSSNFATLIDEIFEYEKYEQIRKEKEELERKVREAKAREELERRRRRQEEKERTRK 594

Query: 599  ---XXXXXXXXXDIARQMDEEISNLKKELVGDQDN--EDKFRSVSEPLXXXXXXXXXXXX 653
                        ++ +Q++ +IS+L++EL   ++   +   RS+S P+            
Sbjct: 595  LLEKEELKMKQEELKKQIEMDISDLEQELSRHKEEKPDGNIRSISAPMENEEKNIDHLGT 654

Query: 654  XXXGILRNRKYSLQTRPVSRLDPGIGFIDKPRQSEQHVPETVNLEPELEETEQKILETIR 713
                ILR R +SLQTRPVSRLDPGI F + P ++   V E    E E   TE+KILETIR
Sbjct: 655  DIDNILRRRNFSLQTRPVSRLDPGIVFSN-PIETVYPV-EPKRSENERLTTEKKILETIR 712

Query: 714  RSKFLGSSFDIKKELENVKRHRQTSQPIEKEMAPPALPE--------TLPKAVEKKNVSM 765
            RSKFLGSSF+I+KEL+  K    +    EK      + +         LPK  + K VS 
Sbjct: 713  RSKFLGSSFNIEKELKLSKMEYPSVLAPEKLSGERVVSDLNGKYESLILPK--DAKGVSQ 770

Query: 766  --------------DPSLRKISDIKVPQFTRKSRHFSTSNRRLSVLSMYSTKESYSNLAD 811
                          D  LRKIS+++VPQFTRKSRHFS SN+RLS+LSMYSTKES++NL D
Sbjct: 771  LKDDITSTTTEHLSDGKLRKISEVRVPQFTRKSRHFSESNKRLSLLSMYSTKESFTNLVD 830

Query: 812  ILKNGPGE--KEMIQTAPTPKSADDSDQLFDTI-DEADTPASVSREERLYEVAEESENEL 868
            ILKN   +   +  Q  PTP+SADDS+ LF+T+ +EA+   + S +ERLY+V + +  + 
Sbjct: 831  ILKNSNLDVNNQQSQRIPTPRSADDSEFLFETVNEEAEYTGNSSNDERLYDVGDSTIKDK 890

Query: 869  ANKKIDIADLLNSEGSNLKSVEEQE-DSMKLPKLPPLFEDGSTKE--------TKEQSKS 919
               K++ AD  N      +S E +E D++ LP LPPL  D   ++         + + KS
Sbjct: 891  TALKLNFADRFN------ESTEYKETDNLHLPSLPPLSGDDEMRKQNSEEDSLVQPKVKS 944

Query: 920  MIPENMQSSESQKQIEKNN---------SDEGGSLNPFMTKHRDVSDKGVTKEKPTVTMK 970
            MIP++  SS ++K  EK             E   + P + K    S + + ++ P    K
Sbjct: 945  MIPQSDSSSHTEKVEEKEGESQEVQEESEKEAKDIEPPLNK----SVQKLREKNPGPQEK 1000

Query: 971  TTSEQVSADKKR------NMSFLRXXXXXXXXXXDNVDVTLSTSVSSKQLFSGLVNLLKG 1024
                    + K+      N SF R          D + V L   VS++QLF+GL  LL+G
Sbjct: 1001 DHQRDHLKEHKQDRNTTGNSSFFR--KFSKSSASDKL-VELYAKVSARQLFNGLEKLLRG 1057

Query: 1025 WTKYGLKGIAIDSTSQTITGKLANDNILSFRSTAFSILIFSQEKGSAVTFRKVSGSGKAV 1084
            WT++GLK I     + T+TGKL+++NI S RST F I I+ + + S V F+K+SGS KAV
Sbjct: 1058 WTQFGLKNIKSHPNNLTLTGKLSSENIFSLRSTLFEINIYPKGRMSVVQFKKISGSFKAV 1117

Query: 1085 RRLSDEVKKVLSKEGVLR 1102
            ++L +EV+ VL+KEGVL+
Sbjct: 1118 KKLVNEVENVLNKEGVLQ 1135

>KAFR0D04100 Chr4 complement(809681..813034) [3354 bp, 1117 aa] {ON}
            Anc_1.52 YDR507C
          Length = 1117

 Score =  999 bits (2584), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 584/1159 (50%), Positives = 735/1159 (63%), Gaps = 108/1159 (9%)

Query: 5    SSNTVSVIKNNQIGPWKLGETLGSGSTGKVLLASNETTKQQAAVKVISKAVFEAMNNSES 64
            +SN +  IK +Q+GPWKLGETLG GSTGKV LA N+TT +QAA+KVISK+VF   NNS  
Sbjct: 3    ASNNLPSIKGDQLGPWKLGETLGLGSTGKVQLAHNKTTGKQAAIKVISKSVFN--NNSAQ 60

Query: 65   NGDAT--NALPYNIEQEIIIMKLLNHPNVLRLFDVWETNSDLYLVLEYAEKGELFNMLVE 122
            +   T  +ALPY IE+EIIIMKLLNHPNVLRL+DVWETNS+LY+VLEYAEKGELFN+LVE
Sbjct: 61   SSSLTTPDALPYGIEREIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAEKGELFNLLVE 120

Query: 123  RGPLPENEAVRAFRQIIIGISYCHSLGVVHRDLKPEXXXXXXXXXXXXADFGMAALESED 182
            +GPL E EA+R FRQIIIGISYCH+LG+VHRDLKPE            ADFGMAALE+ED
Sbjct: 121  KGPLQEQEAIRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETED 180

Query: 183  KLLETSCGSPHYAAPEIISGLPYEGFSSDVWSCGVILFALLTGRLPFDEEDGNIRNLLLK 242
            KLLETSCGSPHYAAPEI+SG+PY GF+SDVWSCGVILFALLTGRLPFDEEDGNIRNLLLK
Sbjct: 181  KLLETSCGSPHYAAPEIVSGIPYHGFASDVWSCGVILFALLTGRLPFDEEDGNIRNLLLK 240

Query: 243  VQKGEFEMPDDDEITKEAQDLLARLLTVDPSKRITIREILKHPLLQKYPSIKDSRSIRNL 302
            VQ GEFEMP DDEI+ EAQDLLA++LTVDP KRI  R+ILKHPLLQKYPSIKDS+SIRNL
Sbjct: 241  VQSGEFEMPSDDEISHEAQDLLAKILTVDPEKRIRARDILKHPLLQKYPSIKDSKSIRNL 300

Query: 303  PREDTYLSPLADTNSKIDDAILQNLVILWHGKDAREIAAKLREPGANTEKTLYALLYRFK 362
            PREDTYL+PL+D NS ID  ILQNLV+LWHG+D  EI +KL+EPGAN EKTLYALL RFK
Sbjct: 301  PREDTYLNPLSDNNSTIDKTILQNLVVLWHGRDVNEIISKLKEPGANAEKTLYALLDRFK 360

Query: 363  CDTQRE---ANRARRQSKI---VQRNSTIRSTAPEXXXXXXXXXXXXXXXRASII--ASS 414
             D+++E     + R++  I   V R+   +++ P+               R S+I  +SS
Sbjct: 361  IDSEKENFKNEQIRKRQSITSSVSRSPAKKASTPQ-----------RRKNRISMISVSSS 409

Query: 415  SKRPVSVTKTATNITVN---SSITGTPKSAKRMSMNNSARKRMSALYGXXXXXXXXXXXX 471
             K+P S  + ++ +  N   SS T T  ++K+ SMN    K++S +              
Sbjct: 410  HKKPASFNRLSSVVHNNLSASSSTTTTPASKKFSMN----KKLSMIADKSNSNNSSPTPA 465

Query: 472  XXXXXXXXFLGNRPRDSVISMSHNKRASKSSKRISLVPNLKRQSVTTKLMATYAKLSEDD 531
                       N  R S+  +S NKRAS+SSKR+S++ N+KR S+TTKL+ATYAKLSEDD
Sbjct: 466  HRNKRTSMI--NTDRQSI--LSKNKRASRSSKRLSVMANMKRGSITTKLIATYAKLSEDD 521

Query: 532  DWEYIERETKRTSSDFATLIDEIFEYEKYEQIRKEKAXXXXXXXXXXXXXXXXXXXXXXX 591
            DWEYIE+ETKRTSSDFATLIDEIFE+EKYEQIRKEK                        
Sbjct: 522  DWEYIEKETKRTSSDFATLIDEIFEHEKYEQIRKEKEELARKVRLAKEREEEERRRREEE 581

Query: 592  XXXXXXXXXXXXXXXXDIARQMDEEISNLKKELVGD-----QDNEDKFRSVSEPLXXXXX 646
                             + RQMDEEI NL+ +L GD     + NED +RSVS PL     
Sbjct: 582  ELHKLNEEKKFEAQQLQLQRQMDEEIENLRADLKGDVEPNQEKNEDNYRSVSVPL----- 636

Query: 647  XXXXXXXXXXGILRNRKYSLQTRPVSRLDPGIGFIDKPRQSEQHVPETVNLEPELEETEQ 706
                       +LR R +SLQTRP+SRLDPG+ F ++    E+ +     +  +  +TE+
Sbjct: 637  ---SKETVNDNLLRQRNFSLQTRPISRLDPGLFFSEQSPTEEKPISPDEPVPNKKLDTEK 693

Query: 707  KILETIRRSKFLGSSFDIKKELENVKRHRQTSQPIEKEMAPPALPETLPK-AVEKKNV-S 764
             ILETIRRSKFLGSSFDI +EL+  ++       ++K        + LPK AV    + S
Sbjct: 694  MILETIRRSKFLGSSFDINRELKAAEKRVMQPPTVQKLTTENKSSDELPKHAVGTAALNS 753

Query: 765  MDPSLRKISDIKVPQFTRKSRHFSTSNRRLSVLSMYSTKESYSNLADILKNGPGEKEMIQ 824
                + KISDI+VPQFTRKSRHF+TSNRRLSVLSMYST++S+SNL DILKN     E+ Q
Sbjct: 754  STAEVSKISDIRVPQFTRKSRHFTTSNRRLSVLSMYSTRQSFSNLVDILKNTEAGTELGQ 813

Query: 825  TAPTPKSADDSDQLFDTI-DEADTPASVSREERLYEVAE-ESENELANKKIDIADLLNSE 882
              PTP SA DS+ +F+T+ +EA+   + S +++LYEVA+ ++  + +  K++ AD  N +
Sbjct: 814  RTPTPHSAGDSEFIFETVNEEAEYTGNSSNDDKLYEVADLDAAEKPSGMKLNFADRFNKK 873

Query: 883  GSNLKSVEEQED-SMKLPKLPPLFEDG--------------------------------S 909
              +  S E   D   KLP LPPL  DG                                S
Sbjct: 874  EED--STEPSRDIQNKLPVLPPL--DGKAGLGIYQTSSPIEPQLLERPVKGDKFMETISS 929

Query: 910  TKETKEQS-KSMIPENM---QSSESQKQIEKNNSDEGGSLNPFMTKHRDVSDKGVTKEKP 965
              E  E+  KSMIPE +     + S  +++K   D+     P M K            KP
Sbjct: 930  DNEKPEKEIKSMIPEAVIEEPKNVSPIEVQKTRKDQEHDKRPVMEK------------KP 977

Query: 966  TVTMKTTSEQVSADKKRNMSFLRXXXXXXXXXXD---NVDVTLSTSVSSKQLFSGLVNLL 1022
             V      E    +KKR++SF R                +  L T+++++Q+F GL  LL
Sbjct: 978  EVVAPKQRES-DQEKKRSVSFFRKFSGSSISSNKSKAETEKVLVTNIAARQVFDGLRRLL 1036

Query: 1023 KGWTKYGLKGIAIDSTSQTITGKLANDNILSFRSTAFSILIFSQEKGSAVTFRKVSGSGK 1082
             GW+KYGLK +   S++ TI+GKL++DNILS RST F I + S  + S+V  RK SGS K
Sbjct: 1037 NGWSKYGLKNVRSVSSTMTISGKLSSDNILSLRSTNFEIKVTSNGESSSVLIRKKSGSSK 1096

Query: 1083 AVRRLSDEVKKVLSKEGVL 1101
            AV RL+ E++ + SKEGVL
Sbjct: 1097 AVLRLTTEIENIFSKEGVL 1115

>TDEL0C06490 Chr3 complement(1191461..1194922) [3462 bp, 1153 aa] {ON}
            Anc_1.52 YDR507C
          Length = 1153

 Score =  961 bits (2483), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 561/1169 (47%), Positives = 729/1169 (62%), Gaps = 89/1169 (7%)

Query: 1    MSAISSNTVSVIKNNQIGPWKLGETLGSGSTGKVLLASNETTKQQAAVKVISKAVFE--- 57
            M+A+S+ +V  +K N+IGPWKLGETLG GSTGKV LA +E+T QQAA+KVISKA+F    
Sbjct: 1    MAAMSNRSVPTVKGNKIGPWKLGETLGLGSTGKVQLAYDESTNQQAAIKVISKAIFNVKG 60

Query: 58   AMNNSESNGDATNALPYNIEQEIIIMKLLNHPNVLRLFDVWETNSDLYLVLEYAEKGELF 117
            ++ +S       ++LPY IE+EIIIMKLLNHPNVLRL+DVWETNS+LY+VLEYA+KGELF
Sbjct: 61   SVKDSSVAASTPDSLPYGIEREIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAQKGELF 120

Query: 118  NMLVERGPLPENEAVRAFRQIIIGISYCHSLGVVHRDLKPEXXXXXXXXXXXXADFGMAA 177
            N+LVERGPLPE EA+R FRQI+IGISYCH+LG+VHRDLKPE            ADFGMAA
Sbjct: 121  NLLVERGPLPEKEAIRFFRQIVIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAA 180

Query: 178  LESEDKLLETSCGSPHYAAPEIISGLPYEGFSSDVWSCGVILFALLTGRLPFDEEDGNIR 237
            LE+EDKLLETSCGSPHYAAPEI+SG+PY GF+SDVWSCGVILFALLTGRLPFD+EDGNIR
Sbjct: 181  LETEDKLLETSCGSPHYAAPEIVSGIPYHGFASDVWSCGVILFALLTGRLPFDDEDGNIR 240

Query: 238  NLLLKVQKGEFEMPDDDEITKEAQDLLARLLTVDPSKRITIREILKHPLLQKYPSIKDSR 297
            NLLL+VQ G +EMP DDEI+ +AQDL+AR+LTVDP +RI  R+ILKHPLLQKYPSI DS+
Sbjct: 241  NLLLQVQSGRYEMPGDDEISPDAQDLIARILTVDPEQRIKARDILKHPLLQKYPSINDSK 300

Query: 298  SIRNLPREDTYLSPLADTNS-KIDDAILQNLVILWHGKDAREIAAKLREPGANTEKTLYA 356
            SIRNLPREDTYL PL++  S +ID+ ILQNLV+LWHG++  EI  KLREPGAN EKTLYA
Sbjct: 301  SIRNLPREDTYLHPLSEGESAEIDENILQNLVVLWHGREQLEIINKLREPGANAEKTLYA 360

Query: 357  LLYRFKCDTQREA-NRARRQSKIVQRNSTIRSTAPEXXXXXXXXXXXXXXXRASII--AS 413
            LL RFK DT+ ++    + + ++ Q N   + T  +               R S+I  +S
Sbjct: 361  LLDRFKSDTENDSVKHPQSKKRVSQINPVRQPTTKKAPSKPQTNASPKRRNRTSMISVSS 420

Query: 414  SSKRPVSVTKTATNI---TVNSSITGTPKSAKRMSMNNSARKRMSALYGXXXXXXXXXXX 470
            S KRPVS  K +  +   +V SS + TP  +KR+S+N S+ KR+SA+Y            
Sbjct: 421  SHKRPVSFNKLSNVVSPGSVPSSNSNTP--SKRVSVNLSSNKRLSAVY--TNSGSPTPAS 476

Query: 471  XXXXXXXXXFLGNRPRDS----------VISMSHNKRASKSSKRISLVPNLKRQSVTTKL 520
                         R  D+            S +  KR S+++ R+S  P+ KR S+TTKL
Sbjct: 477  RHKRVSIVDLERERENDTPPVPIEMLKDYSSTAKQKRLSRNNMRLSFKPSNKRGSITTKL 536

Query: 521  MATYAKLSEDDDWEYIERETKRTSSDFATLIDEIFEYEKYEQIRKEKAXXXXXXXXXXXX 580
            ++TYAKLSEDDDWEYIE+ETKRTSSDFATL D+IFE+EK+EQIR+EK             
Sbjct: 537  ISTYAKLSEDDDWEYIEKETKRTSSDFATLCDQIFEHEKFEQIRREKEELERKVRETKER 596

Query: 581  XXXXXXXXXXXXXXXXXXXXXXXXXXXDIARQMDEEISNLKKELVG----DQDNED---- 632
                                       +I RQMDEE++NL KEL G    DQD ++    
Sbjct: 597  EERERREKEIEEKRKIQEKQDLERRQLEIQRQMDEEVANLGKELQGGMNADQDADEGDEH 656

Query: 633  ---KFRSVSEPLXXXXXX-XXXXXXXXXGILRNRKYSLQTRPVSRLDPGIGFIDKPRQSE 688
                 RSVSEPL                 +LR R +SLQTRPVSRLDPG+ F     + +
Sbjct: 657  GAVNGRSVSEPLQKKSADPMADLQANIDDLLRQRTFSLQTRPVSRLDPGV-FSSDSSEKD 715

Query: 689  QHVPETVNLEPELEETEQKILETIRRSKFLGSSFDIKKELE-----NVKRHRQTSQPIEK 743
            Q+   T + +      ++ ILETIRRSKFLGSSFDI KEL+       K+ RQ+    ++
Sbjct: 716  QY---TGSEDRAKLNNDKIILETIRRSKFLGSSFDINKELKRAADNEAKKQRQSKATSDR 772

Query: 744  -------EMAPPALPETLPKAVEKKNVSMDPSLRKISDIKVPQFTRKSRHFSTSNRRLSV 796
                   E     LP+    +   K+ +     RKISDIKVPQFTRKSR F  SN+RLSV
Sbjct: 773  IISTTNDEYETQILPKNATASAPLKDHNHQAEPRKISDIKVPQFTRKSRQFGDSNKRLSV 832

Query: 797  LSMYSTKESYSNLADILKNGPGEKEMIQTAPTPKSADDSDQLFDTIDE-ADTPASVSREE 855
            LSMYS+K+SY+NLAD+L       +  + +P  +S  + + LF+ + E  +     S + 
Sbjct: 833  LSMYSSKQSYTNLADLLNEEASNAKGNRDSPNDQSGHEPEFLFENVQEDGEVTGDSSHDG 892

Query: 856  RLYEVAEESENELANKKIDIADLLNSEGSNLKSVEEQEDSMKLPKLPPLFEDG------- 908
            RLYEV E+S       K++ AD   +     ++ E++  +++LP LPPL  DG       
Sbjct: 893  RLYEVPEDSNMTKEKLKLNFADRFKTSNGEDRTAEDK--NVRLPTLPPL--DGKEAKGLG 948

Query: 909  ----STKETKEQSKSMIPENMQSSESQK-------QIEKNNS----DEGGSLNPFMTKHR 953
                S++   E ++  +   +Q+ E+Q         I+++N+     +   LN  + KHR
Sbjct: 949  IYQSSSESLPEPAQHNVKSMIQNDENQPSETAEVLSIKEDNAQVERQQEAPLNASIPKHR 1008

Query: 954  DVSDKGVTKEKPTVTMKTTSEQVSADKKRNMSFLRXXXXXXXXXXDN-VDVTLSTSVSSK 1012
              +D     E+  +  K  SE     KKRN SF R          +   D  L  SV++K
Sbjct: 1009 --TDGAQKSER--MPSKEGSE-----KKRNTSFFRKFSKSSNEKTNGEFDAELYASVAAK 1059

Query: 1013 QLFSGLVNLLKGWTKYGLKGIAIDSTSQTITGKLANDNILSFRSTAFSILIFSQEKGSAV 1072
            QLF+GL NLL+GW KYGLKG+       T+TGKL+++NILS RST F ++++S+ KGS V
Sbjct: 1060 QLFNGLQNLLQGWKKYGLKGVKSMPDKLTLTGKLSSENILSLRSTLFEMVVWSRGKGSIV 1119

Query: 1073 TFRKVSGSGKAVRRLSDEVKKVLSKEGVL 1101
             FRK SGS K ++RL  E++KVL KE VL
Sbjct: 1120 GFRKKSGSTKTLKRLVSEIEKVLLKERVL 1148

>KNAG0F00290 Chr6 (31750..35127) [3378 bp, 1125 aa] {ON} Anc_1.52
            YDR507C
          Length = 1125

 Score =  939 bits (2426), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 566/1160 (48%), Positives = 728/1160 (62%), Gaps = 102/1160 (8%)

Query: 4    ISSNTVSVIKNNQIGPWKLGETLGSGSTGKVLLASNETTKQQAAVKVISKAVFEAMNNSE 63
            I++ T   IK +QIG WK+GETLG GSTGKV LA N+TT  QAA+KVISK +F+  N + 
Sbjct: 2    ITNKTTPTIKGDQIGSWKMGETLGLGSTGKVQLAYNKTTGNQAAIKVISKTIFQDSNVTS 61

Query: 64   SNGDAT-NALPYNIEQEIIIMKLLNHPNVLRLFDVWETNSDLYLVLEYAEKGELFNMLVE 122
               + T +ALPY IE+EI+IMKLLNH NVLRL+DVWETNS+LY+VLEYAEKGELFN+LVE
Sbjct: 62   MVDNTTPDALPYGIEREIVIMKLLNHANVLRLYDVWETNSNLYMVLEYAEKGELFNLLVE 121

Query: 123  RGPLPENEAVRAFRQIIIGISYCHSLGVVHRDLKPEXXXXXXXXXXXXADFGMAALESED 182
            RGPLPENEA+R FRQIIIGISYCH+LG+VHRDLKPE            ADFGMAALE+ED
Sbjct: 122  RGPLPENEAIRFFRQIIIGISYCHALGIVHRDLKPENLLLDTKYNIKIADFGMAALETED 181

Query: 183  KLLETSCGSPHYAAPEIISGLPYEGFSSDVWSCGVILFALLTGRLPFDEEDGNIRNLLLK 242
            KLLETSCGSPHYAAPEI+SG+PY GF+SDVWSCGVIL+ALLTGRLPFDEEDGNIRNLLLK
Sbjct: 182  KLLETSCGSPHYAAPEIVSGIPYHGFASDVWSCGVILYALLTGRLPFDEEDGNIRNLLLK 241

Query: 243  VQKGEFEMPDDDEITKEAQDLLARLLTVDPSKRITIREILKHPLLQKYPSIKDSRSIRNL 302
            VQ G+FEMP+DDEI+KEAQ+L++++L V+P++RIT R+ILKHPLLQKYPSIKDS+SIRNL
Sbjct: 242  VQAGQFEMPEDDEISKEAQNLISKILVVNPAERITARDILKHPLLQKYPSIKDSKSIRNL 301

Query: 303  PREDTYLSPLADTNSKIDDAILQNLVILWHGKDAREIAAKLREPGANTEKTLYALLYRFK 362
            PREDTYL PLA+TNS ID+ ILQNLV+LWHG+D  EI  KL+E GAN EKTLYA+L RFK
Sbjct: 302  PREDTYLHPLAETNSAIDENILQNLVVLWHGRDPAEIRVKLKEHGANAEKTLYAMLNRFK 361

Query: 363  CDTQRE-------ANR-----------ARRQSKIVQRNSTIRSTAPEXXXXXXXXXXXXX 404
             D ++E        NR           A  QS  V R+S  ++T P              
Sbjct: 362  LDVEQENLKNEHLKNRQSGGQSTSMAPATNQSTAVNRSSGNKNTTPR------------K 409

Query: 405  XXRASIIA--SSSKRPVSVTKTATNITVNSSITGTPKSAKRMSMNNSARKRMSALYGXXX 462
              RAS+I+  SS KRP+S  K  T  + +S    TP ++ R       RKR+S + G   
Sbjct: 410  KNRASVISVTSSHKRPISFQKLPTLNSTSSLAAITPSTSAR-------RKRLSKISGYPV 462

Query: 463  XXXXXXXXXXXXXXXXXFLG-NRPRDSVISMSHN-KRASKSSKRISLVPNLKRQSVTTKL 520
                                    R S I  ++  K+ +++SKR+S++PN K  ++ +KL
Sbjct: 463  SNVNGSPTPASRKKRNSMANIQAARSSTIKKTNTFKKNNRASKRVSILPNNKNGTIASKL 522

Query: 521  MATYAKLSEDDDWEYIERETKRTSSDFATLIDEIFEYEKYEQIRKEKAXXXXXXXXXXXX 580
            ++TYAKLSEDD+WEY+E+ETKRTSS+FATLIDEIFE+EKYEQIRKEK             
Sbjct: 523  ISTYAKLSEDDEWEYLEQETKRTSSNFATLIDEIFEHEKYEQIRKEKEELARKVREAKER 582

Query: 581  XXXXXXXXXXXXXXXXXXXXXXXXXXXDIARQMDEEISNLKKEL-VGDQDNEDKFRSVSE 639
                                       D  R M+EEI NLKKEL +   + + + RSVSE
Sbjct: 583  EEAERKQKELQEREKQRERERKENETNDRQRIMEEEIENLKKELDMMSHEGKTESRSVSE 642

Query: 640  PLXXXXXXXXXXXXXXXGILRNRKYSLQTRPVSRLDPGIGFIDKPRQSEQHVPETVNLEP 699
            PL                +LR R  +LQTRP SRLDPG+ F D   +S+   P     E 
Sbjct: 643  PLNKKQGGVEIEVKE---LLRQRNAALQTRPKSRLDPGL-FFDSA-ESDTRNPSLQVFEG 697

Query: 700  ELE---ETEQKILETIRRSKFLGSSFDIKKELENVK-RHRQTSQPIEKEMAPPAL--PET 753
            E++   +TE+ ILETIRRSKFLGSSFDI KEL++   R   +  P     AP  L   + 
Sbjct: 698  EVDNKLKTEKAILETIRRSKFLGSSFDISKELKSASARSDYSRAPGRVITAPSNLERSDV 757

Query: 754  LPK---AVEKKNVSMD-PSLRKISDIKVPQFTRKSRHFSTSNRRLSVLSMYSTKESYSNL 809
            LPK   A     +  D P +RKISDIKVPQFTRKSR+FS S++RLSVLSMYST++S+ NL
Sbjct: 758  LPKNAIATAPLRIHSDQPEVRKISDIKVPQFTRKSRNFSESSKRLSVLSMYSTRQSFKNL 817

Query: 810  ADIL----KNGPGEKEMIQTAPTPKSADDSDQLFDTID-EADTPASVSREERLYEVAEES 864
            +D++    +N    +   Q A TP SA  S+ LF++++ EA+   + S + +LYEV+E  
Sbjct: 818  SDMMNFESENTDAAENRGQIA-TPNSAGQSEFLFESVNEEAENTNNTSTDGKLYEVSESP 876

Query: 865  ENELANK-KIDIADLLNSEGSNLKSVEEQEDSMKLPKLPPLF-EDGSTKETKEQSKSMIP 922
            E+      +++++D  N      K+  E +   KLP LPPL  E       ++Q     P
Sbjct: 877  ESSSKKGLRVNLSDRYN------KANSEADMENKLPILPPLDPEIAGLGIYQDQ-----P 925

Query: 923  ENMQSSESQKQIEKNNSDEGGSLNPFMTKHRDVSDKGVTKE-KPTVTMKTTSEQVSADKK 981
            E + +   +K+  K+ S E G ++    +  D+  + + K  +P +T K   +++ A K+
Sbjct: 926  EEVNAKPQEKK-SKSKSAETGDISEGEPEVSDLKAENIRKAPQPPITEK---KKLDAKKQ 981

Query: 982  RN-------------MSFLRXXXXXXXXXXDNVDVT-------LSTSVSSKQLFSGLVNL 1021
            RN              +FLR           +V  T       + T+VS+ Q++ GL NL
Sbjct: 982  RNDERTKASKENTFSNNFLRKLSGQSNTTTQSVKKTKLGAEDGIHTTVSATQMYQGLYNL 1041

Query: 1022 LKGWTKYGLKGIAIDSTSQTITGKLANDNILSFRSTAFSILIFSQEKGSAVTFRKVSGSG 1081
            L+GW  YGLK I  +S + TITGKLA++NILS RST F I+I  + KGS V  +K SGS 
Sbjct: 1042 LRGWGSYGLKSIKGNSENMTITGKLASENILSLRSTIFEIIIIREGKGSKVDIKKKSGST 1101

Query: 1082 KAVRRLSDEVKKVLSKEGVL 1101
            KAV RL+ EVK VL KEGV+
Sbjct: 1102 KAVNRLAGEVKNVLVKEGVM 1121

>NCAS0B08600 Chr2 (1649375..1652728) [3354 bp, 1117 aa] {ON} Anc_5.591
            YDR466W
          Length = 1117

 Score =  937 bits (2421), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 559/1167 (47%), Positives = 703/1167 (60%), Gaps = 118/1167 (10%)

Query: 1    MSAISSN--TVSVIKNNQIGPWKLGETLGSGSTGKVLLASNETTKQQAAVKVISKAVFEA 58
            M+ ++ N   +  IK + IGPWKLGETLG GSTGKV LA NETT QQAA+K+ISK++F  
Sbjct: 1    MTTLAENKKAIPTIKGDTIGPWKLGETLGLGSTGKVQLAFNETTNQQAAIKIISKSIFNT 60

Query: 59   MNNSESNGDATN---ALPYNIEQEIIIMKLLNHPNVLRLFDVWETNSDLYLVLEYAEKGE 115
              NS       N   +LPY IE+EIIIMKLL H NVL L+DVWETNS+LY++LEYAEKGE
Sbjct: 61   KPNSNETSMVANTPDSLPYGIEREIIIMKLLRHANVLSLYDVWETNSNLYMILEYAEKGE 120

Query: 116  LFNMLVERGPLPENEAVRAFRQIIIGISYCHSLGVVHRDLKPEXXXXXXXXXXXXADFGM 175
            LFN+LVE+GPLPE EAVR FRQIIIGISYCH+LG+VHRDLKPE            ADFGM
Sbjct: 121  LFNLLVEKGPLPEKEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGM 180

Query: 176  AALESEDKLLETSCGSPHYAAPEIISGLPYEGFSSDVWSCGVILFALLTGRLPFDEEDGN 235
            AALE+EDKLLETSCGSPHYAAPEI+SG+PY GF SDVWSCGVILFALLTGRLPFDEEDGN
Sbjct: 181  AALETEDKLLETSCGSPHYAAPEIVSGIPYHGFESDVWSCGVILFALLTGRLPFDEEDGN 240

Query: 236  IRNLLLKVQKGEFEMPDDDEITKEAQDLLARLLTVDPSKRITIREILKHPLLQKYPSIKD 295
            IRNLLLKVQ G+FEMPDDDE++++AQDL++R+LTVDP+KRI  REILKHPLLQKYPSIKD
Sbjct: 241  IRNLLLKVQSGQFEMPDDDEMSRDAQDLISRILTVDPTKRIKTREILKHPLLQKYPSIKD 300

Query: 296  SRSIRNLPREDTYLSPLADTNSKIDDAILQNLVILWHGKDAREIAAKLREPGANTEKTLY 355
            S+SI+NLPREDTYL PL+D NS ID +ILQNLV+LWHG+D  +IAAKL+E GAN EKT+Y
Sbjct: 301  SKSIKNLPREDTYLFPLSDNNSVIDPSILQNLVVLWHGRDKEQIAAKLKESGANAEKTIY 360

Query: 356  ALLYRFKCDTQR---EANRARRQSKIVQRNSTIRSTAPEXXXXXXXXXXXXXXXRASIIA 412
            ALLYRFK + +    +  + +R+  I+++++   ST P                    ++
Sbjct: 361  ALLYRFKIEAENLSAKQEQVKRKQSIIKKSTANVSTPPRKKNRISTMS----------VS 410

Query: 413  SSSKRPVSVTKTAT-------NITVNS----SITGTPKSAKRMSMNNSARKRMSALY--G 459
            SS KRPVS  +  T       NI  N     S   TPKS KR+S+N S+ KR+S L   G
Sbjct: 411  SSRKRPVSFNRLPTISNGKTNNIIPNGRNGDSNNTTPKSNKRLSINLSSNKRLSNLLVQG 470

Query: 460  XXXXXXXXXXXXXXXXXXXXFLGNRPRDSV--------ISMSHNKRASKSSKRISLVPNL 511
                                 L N     +         + S + +  ++SKR++ + N 
Sbjct: 471  HSNGNSNSPTPSRSKRISLINLDNSTAPPIPVNVLKDYKNKSSSSKNKRASKRLTFLGNG 530

Query: 512  KRQSVTTKLMATYAKLSEDDDWEYIERETKRTSSDFATLIDEIFEYEKYEQIRKEKAXXX 571
            KR S+TTKL++TYAKLSEDD+WEYIE+ETKRTSSDFATLIDEIFE+EKYEQIRKEK    
Sbjct: 531  KRGSITTKLLSTYAKLSEDDNWEYIEKETKRTSSDFATLIDEIFEHEKYEQIRKEKEELA 590

Query: 572  XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDIARQMDEEISNLKKELVGDQDNE 631
                                                ++   +D+EISNLK +L  +    
Sbjct: 591  RKVREAKEGEARERREQESEKQRKQREREELERQQLELQNHIDQEISNLKADLANETKGA 650

Query: 632  DKF---RSVSEPLXXXXXXXXXXXXXXXGILRNRKYSLQTRPVSRLDPGIGFIDKPRQSE 688
            + +   RSVS PL                +   R  SLQTRP SRLDPGI +   P ++ 
Sbjct: 651  EPYENPRSVSAPL--ERENPEAIERDINDLFARRNVSLQTRPKSRLDPGILY-SAPAETV 707

Query: 689  QHVPETVNLEPELEETEQKILETIRRSKFLGSSFDIKKELENV------------KRHRQ 736
             + P   +++ E++  E+KILETIRRS+FLGSS++I KELE              KR + 
Sbjct: 708  SN-PLLSDIDQEIDR-EKKILETIRRSRFLGSSYNINKELEFAKKTALAETSKKEKRSKV 765

Query: 737  TSQPIEKEMAPPALPETLPKAVEKKNVSMDPSLRKISDIKVPQFTRKSRHFSTSNRRLSV 796
            TSQ I   +A  A    +P          +  LRKIS+IKVPQFTRKSRHFS SNRRLSV
Sbjct: 766  TSQNI---VADKAAIGVIPLN------DTEAGLRKISEIKVPQFTRKSRHFSNSNRRLSV 816

Query: 797  LSMYSTKESYSNLADILK-NGPGEKEMIQTAPTPKSADDSDQLFDTIDEADTPASVSREE 855
            LSMYSTK+SY+NL DILK  G           T K++ + +  F++++E           
Sbjct: 817  LSMYSTKQSYTNLGDILKEGGVNLASEANNTTTSKASTEPEFQFESVNEGTA-------N 869

Query: 856  RLYEVAEESENELANKKIDIADLLNSEGSNLKSVEEQEDSMKLPKLPPLFE--------- 906
            +LYE+ EE E    NK+         +G   K+V       KLP LPPL E         
Sbjct: 870  KLYELQEEPEYTDVNKE---------DGKPKKNV-------KLPTLPPLHEKTNQANGLA 913

Query: 907  --------DGSTKETKEQSKSMIPENMQSSESQKQIEKNNSDEGGS-LNPFMTKHRDVSD 957
                    D    E + +S+SMIPE   S  +   ++K    E  S     + K +    
Sbjct: 914  IYQSSSDDDKKPTEPQPKSQSMIPERQDSINNSASVKKTPVVEPESQATKKINKPKQRQP 973

Query: 958  KGVTKEKPTVTMKTTSEQVSADKKRNMSFLR---XXXXXXXXXXDNVDVTLSTSVSSKQL 1014
            K   + KP   M    E     KKRN+SF R             +  D  +  +VS+ QL
Sbjct: 974  KKEEERKPLNEMPPNVE-----KKRNVSFFRKFSKSSAVSTLTKNGFDYEVYVNVSAPQL 1028

Query: 1015 FSGLVNLLKGWTKYGLKGIAIDSTSQTITGKLANDNILSFRSTAFSILIFSQEKGSAVTF 1074
            + GL+ LL+GW+KYGLK +   S    +TGKL+NDNILS RST F +++ S+ K S V F
Sbjct: 1029 YKGLLRLLQGWSKYGLKDVKSQSNYMKLTGKLSNDNILSLRSTVFEMIVESKGKQSVVGF 1088

Query: 1075 RKVSGSGKAVRRLSDEVKKVLSKEGVL 1101
             K+SGS K VRRL  E++KVL +EGVL
Sbjct: 1089 NKISGSSKTVRRLFVEIEKVLRQEGVL 1115

>Kpol_2002.46 s2002 (95107..98478) [3372 bp, 1123 aa] {ON}
            (95107..98478) [3372 nt, 1124 aa]
          Length = 1123

 Score =  933 bits (2411), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 557/1162 (47%), Positives = 729/1162 (62%), Gaps = 106/1162 (9%)

Query: 4    ISSNTVSV-IKNNQIGPWKLGETLGSGSTGKVLLASNETTKQQAAVKVISKAVFEAMNNS 62
            ISSN  ++ +K + IGPWKLGETLG GSTGKV LA NE+T QQAA+KVISK+VF +M N+
Sbjct: 2    ISSNKGNISVKGDTIGPWKLGETLGLGSTGKVQLAYNESTNQQAAIKVISKSVFSSMGNN 61

Query: 63   ESNGDAT-NALPYNIEQEIIIMKLLNHPNVLRLFDVWETNSDLYLVLEYAEKGELFNMLV 121
             S   +T ++L Y IE+EIIIMKLLNHPNVLRL+DVWETN++LY+VLEYAEKGELFN+LV
Sbjct: 62   SSMVSSTPDSLSYGIEREIIIMKLLNHPNVLRLYDVWETNNNLYMVLEYAEKGELFNLLV 121

Query: 122  ERGPLPENEAVRAFRQIIIGISYCHSLGVVHRDLKPEXXXXXXXXXXXXADFGMAALESE 181
            E+GPLPENEA+R FRQIIIG+SYCH+LG+VHRDLKPE            ADFGMAALE+E
Sbjct: 122  EKGPLPENEAIRFFRQIIIGMSYCHALGIVHRDLKPENILLDHKLNIKIADFGMAALETE 181

Query: 182  DKLLETSCGSPHYAAPEIISGLPYEGFSSDVWSCGVILFALLTGRLPFDEEDGNIRNLLL 241
            DKLLETSCGSPHYAAPEI+SGLPY G  +DVWSCGVILFALLTGRLPFDEEDGNIRNLLL
Sbjct: 182  DKLLETSCGSPHYAAPEIVSGLPYHGLETDVWSCGVILFALLTGRLPFDEEDGNIRNLLL 241

Query: 242  KVQKGEFEMPDDDEITKEAQDLLARLLTVDPSKRITIREILKHPLLQKYPSIKDSRSIRN 301
            KVQKGEFEMP DDEI+KEAQDLL ++L VDP KRI  REILKHPLLQKYPSIKDS++IRN
Sbjct: 242  KVQKGEFEMPGDDEISKEAQDLLYKILVVDPEKRIKSREILKHPLLQKYPSIKDSKTIRN 301

Query: 302  LPREDTYLSPLADT---NSKIDDAILQNLVILWHGKDAREIAAKLREPGANTEKTLYALL 358
            LPREDTYL+PL      ++ ID  ILQNLV+LWHG++  +IA KLREPGAN EKTLYALL
Sbjct: 302  LPREDTYLNPLIGNDGGDATIDKTILQNLVVLWHGRNEDDIAKKLREPGANAEKTLYALL 361

Query: 359  YRFKCDTQREANR----ARRQSKIVQRN---STIRSTAPEXXXXXXXXXXXXXXXRASII 411
            YRFK D+++EA +     +RQS I   N     I +T P+               R S+I
Sbjct: 362  YRFKVDSEQEALKNSQIKKRQSIISNNNLKSGNINTTTPQ-----------KKKNRNSVI 410

Query: 412  --ASSSKRPVSVTKTAT------NITVNSSITGTPKSAKRMSMNNSARKRMSALYGXXXX 463
              +SS KRPVS+ + +T       I+V SS   TP S+KR+SM+ S+ K    L      
Sbjct: 411  SVSSSHKRPVSLNRLSTIQNGKDVISVPSSSNTTPGSSKRISMSLSSNKGSKILPQSNSG 470

Query: 464  XXXXXXXXXXXXXXXXFLGNRP-----------RDSVISMSHNKRASKSSKRISLVPNLK 512
                               + P            +S  S ++ KRAS+ SKR+S++PN K
Sbjct: 471  SPTPAPRNKRMSVQNLETSSNPPPIPVDMLKDYGNSTSSHANAKRASRISKRLSVLPNAK 530

Query: 513  RQSVTTKLMATYAKLSEDDDWEYIERETKRTSSDFATLIDEIFEYEKYEQIRKEKAXXXX 572
            R S+TTK+++TYAKLSEDDDWE+IE+ETKR SSDFATLIDEIFE+EKYEQIRKEK     
Sbjct: 531  RGSITTKIISTYAKLSEDDDWEFIEKETKRVSSDFATLIDEIFEHEKYEQIRKEKEELER 590

Query: 573  XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDIARQMDEEISNLKKELVGDQDNED 632
                                               +   Q+ +E+    K    D+    
Sbjct: 591  KVRENKEREERQKRQKEVELAAIAREREELQRRLEEEETQITKELQQDTKNFQEDEVVHK 650

Query: 633  KFRSVSEPLXXXXXXXXXXXXXXXGILRNRKYSLQTRPVSRLDPGIGF-IDKPRQSEQHV 691
              RS+S P+                    R +SLQTRPVS+LDPGI    +KP Q E+ V
Sbjct: 651  NVRSISSPVENGNEAKSEEDASGQ-----RSFSLQTRPVSKLDPGIKCGSNKPVQMEEIV 705

Query: 692  PETVNLEPELEET---EQKILETIRRSKFLGSSFDIKKELENVKRHRQT-----SQPIEK 743
                  E EL++T   ++ ILETIRRSKFLGSSF+I KEL+ VK+  +      SQ  ++
Sbjct: 706  ------EDELDKTIDSQKVILETIRRSKFLGSSFNIDKELKQVKKDAEVKRMRKSQKEDR 759

Query: 744  EMAPPALPET--------LPK------AVEKKNVSMDPSLRKISDIKVPQFTRKSRHFST 789
            +++   + ET        LPK      A++  +  ++P  RKISDI+VPQFTRKS+ F+ 
Sbjct: 760  DVSGRIVSETNEQYETQVLPKNATAFGALKDDSEEVEP--RKISDIQVPQFTRKSKLFTD 817

Query: 790  SNRRLSVLSMYSTKESYSNLADILKNGPGEKEMIQTAPTPKSADDSDQLFDTIDEADTPA 849
            SN+RLSVLS+YS+ +SY+NLA++LK G  +  + + +   + +++ +  F+T+       
Sbjct: 818  SNKRLSVLSIYSSTQSYTNLANVLKEGGVDIGVNEGSNNVEVSEEPEFQFETVGTEIENN 877

Query: 850  SVSREERLYEVAEESENELANKKIDIADLLNSEGSNLKSVEEQEDSMKLPKLPPLFEDG- 908
                E+ +      S+   AN K++ AD  ++ G    +V E    +KLP LPPL +D  
Sbjct: 878  KYEEEKEIENENNLSQG--ANIKLNYADRFDTAG----NVNE----VKLPTLPPLGDDKV 927

Query: 909  -------STKETKEQSKSMIPENMQSSESQKQIEKNNSDEGGSLNPFMTKHRDVSDKGVT 961
                   S+K   E ++S    +++ ++S++ +++ N +    LN  + K RD       
Sbjct: 928  SDGLGIYSSKSGSEGNESKPVPSIKENKSEETLKEKNVEPKPPLNDVVPKTRDT------ 981

Query: 962  KEKPTVTMKTTSEQVSADKKRNMSFLRXXXXXXXXXXDNV--DVTLSTSVSSKQLFSGLV 1019
              K T  ++  + + S+DK R+ SF R          D    DV L ++VS  QL++GL 
Sbjct: 982  --KKTNVVQNNNAKHSSDKPRSTSFFRKISKGLTVQNDTTGYDVKLFSNVSVTQLYNGLF 1039

Query: 1020 NLLKGWTKYGLKGIAIDSTSQTITGKLANDNILSFRSTAFSILIFSQEKGSAVTFRKVSG 1079
            NLLKGW  YGLK I  +  + +I+ +L++DNILS RST   +++FS+ K S + FRK SG
Sbjct: 1040 NLLKGWKDYGLKEIKSNKEAFSISVRLSSDNILSLRSTFVDMVVFSEGKHSVIGFRKKSG 1099

Query: 1080 SGKAVRRLSDEVKKVLSKEGVL 1101
            S K ++RL+ EV+KVL KEGVL
Sbjct: 1100 SSKTLKRLTSEVEKVLRKEGVL 1121

>ZYRO0F17402g Chr6 complement(1445685..1449254) [3570 bp, 1189 aa]
            {ON} similar to uniprot|Q12263 Saccharomyces cerevisiae
            YDR507C
          Length = 1189

 Score =  911 bits (2355), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 553/1206 (45%), Positives = 707/1206 (58%), Gaps = 124/1206 (10%)

Query: 1    MSAISSNTVSVIKNNQIGPWKLGETLGSGSTGKVLLASNETTKQQAAVKVISKAVFEAM- 59
            MS ++  +   ++ +++GPWKLGETLG GSTGKV LA NE T+Q AAVK ISKA+F A  
Sbjct: 1    MSGMNKRSAPTVRGDKVGPWKLGETLGFGSTGKVQLACNEITQQSAAVKEISKAIFSAKT 60

Query: 60   --NNSESNGDATNALPYNIEQEIIIMKLLNHPNVLRLFDVWETNSDLYLVLEYAEKGELF 117
               NS       + LPY IE+EIIIMKLLNHPNVLRL+DVWETN  LY+VLEYAEKGELF
Sbjct: 61   APGNSSIAASTPDPLPYGIEREIIIMKLLNHPNVLRLYDVWETNPSLYMVLEYAEKGELF 120

Query: 118  NMLVERGPLPENEAVRAFRQIIIGISYCHSLGVVHRDLKPEXXXXXXXXXXXXADFGMAA 177
            N+LVE GPLPENEAV  FRQIIIG+SYCH+LG+VHRDLKPE            ADFGMAA
Sbjct: 121  NLLVENGPLPENEAVCFFRQIIIGVSYCHALGIVHRDLKPENLLLDHDLNIKIADFGMAA 180

Query: 178  LESEDKLLETSCGSPHYAAPEIISGLPYEGFSSDVWSCGVILFALLTGRLPFDEEDGNIR 237
            LE+EDKLLETSCGSPHYAAPEI+SG+PY GF+SD+WSCGVI FALLTGRLPFDEEDGNIR
Sbjct: 181  LETEDKLLETSCGSPHYAAPEIVSGIPYHGFASDIWSCGVIFFALLTGRLPFDEEDGNIR 240

Query: 238  NLLLKVQKGEFEMPDDDEITKEAQDLLARLLTVDPSKRITIREILKHPLLQKYPSIKDSR 297
            NLLLKVQ G+FEMPDDDEI+ EAQDLLA++LTVDP  RI  REILKHPLLQKYP++ D++
Sbjct: 241  NLLLKVQSGKFEMPDDDEISPEAQDLLAKILTVDPECRIKPREILKHPLLQKYPNVSDNK 300

Query: 298  SIRNLPREDTYLSPLADT-NSKIDDAILQNLVILWHGKDAREIAAKLREPGANTEKTLYA 356
            SIRNLPREDTYL PL+D+ +S++D  ILQNLV+LWHG+ A EIAAKL++PGAN EKTLYA
Sbjct: 301  SIRNLPREDTYLHPLSDSGSSEVDQNILQNLVVLWHGRPAGEIAAKLKDPGANAEKTLYA 360

Query: 357  LLYRFKCDTQREANRARRQSKIVQRNSTIRSTAPEXXXXXXXXXXXXXXXRASII--ASS 414
            LL RFK DT+REA R ++    +++ S++  T                  RAS I  +SS
Sbjct: 361  LLARFKNDTEREAARQKQ----IKKRSSLNGTG---AGVNNNHVSPKKRNRASTINASSS 413

Query: 415  SKRPVSVTKTA---TNITVNSSITGTPKSAKRMSMNNSARKRMSAL--YGXXXXXXXXXX 469
             KRPVS+ K +    + + ++  + +    KRMS+N S+ KR+S +   G          
Sbjct: 414  HKRPVSLIKLSGSSNSNSNSNPSSTSTTPPKRMSVNLSSNKRLSTVKTQGNGGSPTPASR 473

Query: 470  XXXXXXXXXXFLGNRPRDSVISMS------HNKRASKSSKRISLVPNLKRQSVTTKLMAT 523
                        G  P   +  +       ++KR S++S R+S  P  KR SVTTKL++T
Sbjct: 474  SKRVSIIESDKNGGAPPVPIDMLKDYNKTPNSKRLSRASVRLSFKPTNKRGSVTTKLIST 533

Query: 524  YAKLSEDDDWEYIERETKRTSSDFATLIDEIFEYEKYEQIRKEKAXXXXXXXXXXXXXXX 583
            YAKLSE+DDWEYIE+ETKRTSSDFATLIDEIFE+EK+EQIRKEKA               
Sbjct: 534  YAKLSEEDDWEYIEKETKRTSSDFATLIDEIFEHEKFEQIRKEKAELERRVKETKEREER 593

Query: 584  XXXXXXXXXXXXXXXXXXXXXXXXDIARQMDEEISNLKKELVGDQDNEDKFRSVSEPLXX 643
                                    +      ++ ++ + ++  +    +  RSVS PL  
Sbjct: 594  ERKEREEKELNEKLENDARQKREMEAQEAQGDDGTDTESDVHSNNQAPNGVRSVSAPLER 653

Query: 644  XXXXXXXXXXXX-XGILRNRKYSLQTRPVSRLDPGIGFIDKPRQSEQHVPETVNLEPELE 702
                           I   R  SLQTRPVSRLDPG+ + +     E + PE  + E E +
Sbjct: 654  KKRDSMVNVQSDIEEIFGQRTMSLQTRPVSRLDPGLFYAE-----ESNEPEAGDTEEEKK 708

Query: 703  -ETEQKILETIRRSKFLGSSFDIKKELENVKRHRQTSQPIE----KEMAPPALPETLPKA 757
              T++ ILETIRRSKFLGSSFDI KEL+N +  ++ SQP       +   P     LP  
Sbjct: 709  LRTQKNILETIRRSKFLGSSFDIGKELQNEELKKKASQPHRDRTVSQTNEPYDTRVLPTQ 768

Query: 758  VEKKNVSMDPSLRKISDIKVPQFTRKSRHFSTSNRRLSVLSMYSTKESYSNLADILKNGP 817
                    D   RKIS+I VPQFTRKSR FS SN+RLSVLSMYSTK SY+NL+++L +  
Sbjct: 769  AVATAPLRDQEPRKISEISVPQFTRKSRFFSDSNKRLSVLSMYSTKHSYNNLSNLLNDSD 828

Query: 818  GEKEMIQTAP---TPKSADDSDQLFDTIDEA-DTPASVSR----EERLYEVAEES----- 864
                 + +A      K   + +  F+ + EA D    +SR    +ERL  V+  S     
Sbjct: 829  ASDGRLNSAAEYSDVKGKKEPEFQFEAVREASDEDNGISRLSNNDERLRNVSGTSGGSGV 888

Query: 865  -ENELANK---KIDIADLLNSE--GSNLKSVEEQEDSMKLPKLPPLFEDGS--------- 909
              + L++K   K++ AD  +++   +   +      ++KLP LPPL  DG+         
Sbjct: 889  PHDNLSSKHNMKLNFADRFSADEPTAGSSNSSSASKNVKLPTLPPL--DGTSEANGLGIY 946

Query: 910  -------------TKETKEQSKSMIPEN-------------------------------- 924
                         T ++K Q  S  PE                                 
Sbjct: 947  QSSSESFRDIVEPTPKSKLQDNSSNPEQEVEEEVAGREGSVKHSAIDTASKERSKRTDRI 1006

Query: 925  --MQSSESQKQIEKNNSDEGGSLNPFMTKHRD-------VSDKGVTKEKPTVTMKTTSEQ 975
               + S  Q+ +    + +G  LN  M K R+        + KG     P   + T S  
Sbjct: 1007 DAKKPSSFQENLASAGASKGPPLNDSMPKRRNEDPRNGSTAAKGENGRAPLKDITTNS-- 1064

Query: 976  VSADKKRNMSFLRXXXXXXXXXXDNVDVTLSTSVSSKQLFSGLVNLLKGWTKYGLKGIAI 1035
               DKKRN+SF R             D  ++T+VS+KQLF GL NLL GWT+YGLK +  
Sbjct: 1065 ---DKKRNVSFFRKFSKSNEKDTTGFDGEINTTVSAKQLFLGLQNLLHGWTQYGLKDVRS 1121

Query: 1036 DSTSQTITGKLANDNILSFRSTAFSILIFSQEKGSAVTFRKVSGSGKAVRRLSDEVKKVL 1095
                 T+TGKL ++NILS RST F ++++S+ K S V FRK SGS KA+RRL  EV+KVL
Sbjct: 1122 HPEKMTLTGKLTSENILSLRSTLFEMVVWSRGKVSVVGFRKKSGSSKAMRRLVSEVEKVL 1181

Query: 1096 SKEGVL 1101
             KEGV+
Sbjct: 1182 LKEGVI 1187

>NDAI0A00660 Chr1 (121773..124841) [3069 bp, 1022 aa] {ON} Anc_1.52
          Length = 1022

 Score =  902 bits (2332), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 539/1134 (47%), Positives = 691/1134 (60%), Gaps = 165/1134 (14%)

Query: 12   IKNNQIGPWKLGETLGSGSTGKVLLASNETTKQQAAVKVISKAVFEAMNNSESN---GDA 68
            +K + IGPWKLG+TLG GSTGKV LA NETT QQAA+K+ISK++F      ES+     +
Sbjct: 10   MKGDTIGPWKLGKTLGLGSTGKVELAYNETTSQQAAIKIISKSIFSQGTVGESSMVSNSS 69

Query: 69   TNALPYNIEQEIIIMKLLNHPNVLRLFDVWETNSDLYLVLEYAEKGELFNMLVERGPLPE 128
             +ALPY IE+EIIIMKLL HPNVL L+DVWETNS LY++LEYAEKGELFN+LVERGPLPE
Sbjct: 70   PDALPYGIEREIIIMKLLRHPNVLSLYDVWETNSKLYMILEYAEKGELFNLLVERGPLPE 129

Query: 129  NEAVRAFRQIIIGISYCHSLGVVHRDLKPEXXXXXXXXXXXXADFGMAALESEDKLLETS 188
             EA+R FRQIIIGISYCH+LG+VHRDLKPE            ADFGMAALE++DK+LETS
Sbjct: 130  KEAIRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKLNIKIADFGMAALETKDKMLETS 189

Query: 189  CGSPHYAAPEIISGLPYEGFSSDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQKGEF 248
            CGSPHYAAPEI+SG+PY GF SDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQ GE+
Sbjct: 190  CGSPHYAAPEIVSGVPYHGFQSDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQSGEY 249

Query: 249  EMPDDDEITKEAQDLLARLLTVDPSKRITIREILKHPLLQKYPSIKDSRSIRNLPREDTY 308
            EMPDDDEI+KEAQDL+ R+LTVDP +RI  R+ILKHPLLQKYPSIKDSRSI+NLPREDTY
Sbjct: 250  EMPDDDEISKEAQDLIGRILTVDPEQRIKTRDILKHPLLQKYPSIKDSRSIKNLPREDTY 309

Query: 309  LSPLADTNSKIDDAILQNLVILWHGKDAREIAAKLREPGANTEKTLYALLYRFKCDTQR- 367
            L PL++ NS IDD+ILQNLV LWHG+D  +IA KLRE GA+ EKT+YALLYRFK + ++ 
Sbjct: 310  LYPLSENNSIIDDSILQNLVALWHGRDKDDIAGKLRESGADAEKTVYALLYRFKVEAEKM 369

Query: 368  -EANRARRQSKIVQRNSTIRSTAPEXXXXXXXXXXXXXXXRASIIASSSKRPVSVTKTAT 426
               +  RR+++I    S I                         ++SS KRPVS+ K +T
Sbjct: 370  NTCSSPRRKNRI----SMIS------------------------VSSSHKRPVSMKKIST 401

Query: 427  NITVNSSITGTPKSAKRM--SMNNSARKRMSALYGXXXXXXXXXXXXXXXXXXXXFLGNR 484
                      TP S +R+  S++++ RKRMS +                         N+
Sbjct: 402  ------VQNNTPPSNRRLSISLSSTQRKRMSGILQHTNSSPTPSRTKRISVINIDDSENK 455

Query: 485  -----PRDSVISMSHNKRASK----------SSKRISLVPNLKRQSVTTKLMATYAKLSE 529
                 P + +    +N +  +          ++ R++LV N KR S+TTKL++TYAKLSE
Sbjct: 456  APPPVPMEMLEDYKNNSKNVRRTIKKKKKKKNNYRLTLVNN-KRVSITTKLLSTYAKLSE 514

Query: 530  DDDWEYIERETKRTSSDFATLIDEIFEYEKYEQIRKEKAXXXXXXXXXXXXXXXXXXXXX 589
            DD+WEYIERETKRTSSDFATLIDE+FE+EKYE+IRKEK                      
Sbjct: 515  DDNWEYIERETKRTSSDFATLIDELFEHEKYERIRKEKEELERKVRETRVREQRREEEER 574

Query: 590  XXXXXXXXXXXXXXXXXXDIARQMDEEISNLKKELVGDQDNEDKFRSVSEPLXXXXXXXX 649
                               + +++DEEIS LK+    D   +D FRSVS P+        
Sbjct: 575  AELQREQLK----------LQQKIDEEISKLKE----DALEKDNFRSVSAPIKENEDEDE 620

Query: 650  XXXXXXXGILRNRK-YSLQTRPVSRLDPGIGFIDKPRQSEQHVPETVNLEPELEETEQ-- 706
                     LRNR+ +SLQTRPVSRLDPGI +   P +   +    VN        +Q  
Sbjct: 621  NENE-----LRNRRQFSLQTRPVSRLDPGILY-SAPAEIPSYERVVVNESGNKSSAQQQR 674

Query: 707  KILETIRRSKFLGSSFDIKKELENVKRHRQTSQPIEKEMAPPALPETLPKAVEKKNVSMD 766
            KILETIRRSKFLGSSF+I++ELE  +R+               L  T  + V+   V ++
Sbjct: 675  KILETIRRSKFLGSSFNIQQELEFSQRN--------------VLVPTKEQVVDVDEVKLE 720

Query: 767  PSLRKISDIKVPQFTRKSRHFSTSNRRLSVLSMYSTKESYSNLADILKNGPGEKEMIQTA 826
              LRKIS++K+PQFTRKSRHFS SN+RLSVLSMYSTK+SY+NL  ILK+G  E E  +  
Sbjct: 721  GGLRKISEVKIPQFTRKSRHFSDSNKRLSVLSMYSTKQSYTNLGHILKDGTEESEPAKKT 780

Query: 827  PTPKSADDSDQLFDTIDEADTPASVSREERLYEVAEESENELANKKIDIADLLNSEGSNL 886
            P        + LF++           R++RLYEV+EE E +   + I             
Sbjct: 781  P--------ELLFES----------GRDDRLYEVSEEPEIQEEKEDI------------- 809

Query: 887  KSVEEQEDSMKLPKLPPLFEDGST----KETKEQSKSMI--PENMQSSESQKQIEK--NN 938
                   +++ LP+LPPL +  +T     ET+    ++    EN++  +  K++++   +
Sbjct: 810  -------ETVTLPQLPPLKQSANTNANANETEINGLAIFRPKENIELEDITKEVKEVIPS 862

Query: 939  SDEGGSLNPFMTKHRDVSDKGVTKEKPTVTMKTTSEQV----------SADKKRNMSFLR 988
             D G              DK +    P   ++   E+           + +KKRN+SF R
Sbjct: 863  QDHG-------------KDKPIAINNPKQRLEVKPERQLDEIAPNKVGTTEKKRNVSFFR 909

Query: 989  XXXXXXXXXXDNVDVTLSTSVSSKQLFSGLVNLLKGWTKYGLKGIAIDSTSQTITGKLAN 1048
                         D  +  ++ S+QL++GL  LL+GWT+YGLK +  D+T+  ITGKLAN
Sbjct: 910  KFSNNSATIK-GYDHEIYVNIGSRQLYTGLRKLLEGWTQYGLKDVRSDNTAMKITGKLAN 968

Query: 1049 DNILSFRSTAFSILIFSQ-EKGSAVTFRKVSGSGKAVRRLSDEVKKVLSKEGVL 1101
            DNILS RST F +L+  +  K S + F KV GS K VRRL  E++KVL+KEGVL
Sbjct: 969  DNILSLRSTLFELLVEPKGSKYSLIGFTKVQGSSKVVRRLFTEIEKVLNKEGVL 1022

>TPHA0E03640 Chr5 complement(769962..773375) [3414 bp, 1137 aa] {ON}
            Anc_1.52 YDR507C
          Length = 1137

 Score =  894 bits (2311), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 548/1179 (46%), Positives = 702/1179 (59%), Gaps = 136/1179 (11%)

Query: 9    VSVIKNNQIGPWKLGETLGSGSTGKVLLASNETTKQQAAVKVISKAVFEAM--------- 59
            V+V  NN IGPWKLGETLG GSTGKV LA+NE T QQAA+K+ISK+VF+ +         
Sbjct: 9    VTVTGNN-IGPWKLGETLGFGSTGKVQLATNEQTNQQAAIKIISKSVFDHLVNSNNNNNS 67

Query: 60   ---NNSESNGDATN---ALPYNIEQEIIIMKLLNHPNVLRLFDVWETNSDLYLVLEYAEK 113
                +  +NG   +   ALPY IE+EIIIMKLLNH NVLRL+DVWETN++LY+VLEYAEK
Sbjct: 68   ALAASDVNNGSVQHNQEALPYGIEREIIIMKLLNHTNVLRLYDVWETNNNLYMVLEYAEK 127

Query: 114  GELFNMLVERGPLPENEAVRAFRQIIIGISYCHSLGVVHRDLKPEXXXXXXXXXXXXADF 173
            GELFN+LVE+GPL ENEAVR FRQIIIG+SYCH+LG+VHRDLKPE            ADF
Sbjct: 128  GELFNLLVEKGPLAENEAVRFFRQIIIGMSYCHALGIVHRDLKPENILLDHKSNIKIADF 187

Query: 174  GMAALESEDKLLETSCGSPHYAAPEIISGLPYEGFSSDVWSCGVILFALLTGRLPFDEED 233
            GMAALE+EDKLLETSCGSPHYAAPEI+SGLPY G  +D+WSCGVILFALLTGRLPFDEED
Sbjct: 188  GMAALETEDKLLETSCGSPHYAAPEIVSGLPYNGLETDIWSCGVILFALLTGRLPFDEED 247

Query: 234  GNIRNLLLKVQKGEFEMPDDDEITKEAQDLLARLLTVDPSKRITIREILKHPLLQKYPSI 293
            GNIRNLLLKVQKGEFEMP  DE++ EAQDL+ ++LTV+P +RI  REILKHPLLQKYP+I
Sbjct: 248  GNIRNLLLKVQKGEFEMPGSDELSLEAQDLIGKILTVNPKQRIKTREILKHPLLQKYPNI 307

Query: 294  KDSRSIRNLPREDTYLSPLADTN---SKIDDAILQNLVILWHGKDAREIAAKLREPGANT 350
            KDS++IR+LPREDTYL+PLAD N   ++ID++ILQNL +LWHGKD  EI  KL+EPGAN 
Sbjct: 308  KDSKTIRDLPREDTYLNPLADNNGVDTEIDESILQNLTVLWHGKDKNEIIKKLKEPGANA 367

Query: 351  EKTLYALLYRFKCDTQREANRARRQSKIVQRNSTIRSTAPEXXXXXXXXXXXXXXXRASI 410
            EKTLY LL+RFK DT+RE +   + S++ +R S +++++                     
Sbjct: 368  EKTLYVLLHRFKEDTERENH---KNSQLRKRQSLMKASSSSSSNQGNVPRRRKNRNSMIS 424

Query: 411  IASSSKRPVSVTKTAT-------NITVNSSITGTPKSAKRMSMN-NSARKRMSALYGXXX 462
            + SS K+PVS  K A         I++ SS   TP S+KR+S++ +S+ KR S LY    
Sbjct: 425  VTSSHKKPVSYNKIAMVGGSSKDVISLPSSSNTTPASSKRISLSLSSSNKRNSRLYTQSN 484

Query: 463  XXXXXXXXXXXXXXXXXFLGNRPRDSVISM----------SHNKRASKSSKRISLVPNLK 512
                              +        I +          + NKR S+ SKR S + N K
Sbjct: 485  SSSPTPAPRSRRSSNQNLINKESEAPPIPVDVLKDYNKISNQNKRGSRLSKRYSFLLNNK 544

Query: 513  RQSVTTKLMATYAKLSEDDDWEYIERETKRTSSDFATLIDEIFEYEKYEQIRKEKAXXXX 572
            R SVTTK+M+TYAKL+EDDDWE+IE+ETKR SSDFATLIDEIFE+EK+E+IRKEK     
Sbjct: 545  RGSVTTKIMSTYAKLAEDDDWEFIEKETKRVSSDFATLIDEIFEHEKFEKIRKEKEELER 604

Query: 573  XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXD-----IARQMDEEISNLKKE--LV 625
                                               +     +   +DEE   LK E   V
Sbjct: 605  KVIEAKQKEERERKEAEAAAKEEARVRREKELARMNKEEEQLQNDIDEEARLLKDEFNFV 664

Query: 626  GD--QDNEDKFRSVSEPLXXXXXXXXXXXXXXXGILRNRKYSLQTRPVSRLDPGIGF--- 680
             D  Q+N    RSVSEP+                    R +SLQTRP+SRLDPG+ F   
Sbjct: 665  NDETQENPINSRSVSEPVKNGGTDEKGQ----------RNFSLQTRPISRLDPGLMFSKL 714

Query: 681  --IDKPRQSEQHVPETVNLEPELEETEQKILETIRRSKFLGSSFDIKKELENV----KRH 734
              +D     ++++  T+N        ++ ILETIRRSKFLGSSFDI KEL N     KR 
Sbjct: 715  GDVDNNSSVDENL--TMN-------NQKTILETIRRSKFLGSSFDINKELNNANEERKRL 765

Query: 735  RQTSQPIEKEMAPP--------------ALPETLPKAVEKKNVSMDPSLRKISDIKVPQF 780
            RQ     +KE+                  L +     V+ K+ S D   RKIS+++VPQF
Sbjct: 766  RQLQLQKQKELEEKERIASTSYVSNENQVLSKNAIGVVDLKDFSSDVEPRKISEVQVPQF 825

Query: 781  TRKSRHFSTSNRRLSVLSMYSTKESYSNLADILKNGPGEKEMIQTAPTPKSADDSDQLFD 840
            TRKS++FS SN+RLSVLS YS+K+SY+NL D++K  P E E +   P     +  D  +D
Sbjct: 826  TRKSKYFSESNKRLSVLSFYSSKQSYTNLVDMIKENPVEDEDVTEDP---GFNFEDSQYD 882

Query: 841  TIDEAD-TPASVSRE---ERLYEVAEESENELANKKIDIADLLNSEGSNLKSVEEQEDSM 896
             ++E +  P  VS E   E   +V EE +N ++  K++ AD  ++  SN K     ED  
Sbjct: 883  YLEEKNEAPLEVSDEVPKEVDDKVQEEEKNSVS-MKLNFADRFSNVNSNTKQESSFED-- 939

Query: 897  KLPKLPPLFEDGST----------KETKEQSKSMIPENMQSSESQKQIEKNNSDEGGSLN 946
               K P +     T          K   +  KSMIPE  + + S   +E         LN
Sbjct: 940  ---KFPNILSKSGTEGLGLYSKNEKTEPKPVKSMIPEEDKVN-SSPVVE-------APLN 988

Query: 947  PFMTKHRDVSDKGVTKEKPTVTMKTTSEQVSADKKRNMSFLRX---XXXXXXXXXDNVDV 1003
              + K R  ++   T + P+ + K ++           SFLR                +V
Sbjct: 989  KVVNKTR--AENKSTSKGPSGSQKVSNTS---------SFLRKISGKSSNSTVAKGAFEV 1037

Query: 1004 TLSTSVSSKQLFSGLVNLLKGWTKYGLKGIAIDSTSQTITGKLANDNILSFRSTAFSILI 1063
             L +SV+  QLF+GL NLLKGWT YGLK + +D   + I GKL+NDNILS RST   + +
Sbjct: 1038 NLYSSVTETQLFNGLQNLLKGWTNYGLKDVKVDKQKKMIVGKLSNDNILSLRSTIVELCV 1097

Query: 1064 FSQEKGSAVTFRKVSGSGKAVRRLSDEVKKVLSKEGVLR 1102
            F++ K S +  RK SGS K +RRL+ E++KVLSKEGVL+
Sbjct: 1098 FTESKFSVIGIRKKSGSSKTMRRLASEIEKVLSKEGVLQ 1136

>KLLA0C01650g Chr3 (128119..131457) [3339 bp, 1112 aa] {ON} similar to
            uniprot|Q12263 Saccharomyces cerevisiae YDR507C
          Length = 1112

 Score =  875 bits (2261), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 522/1144 (45%), Positives = 670/1144 (58%), Gaps = 82/1144 (7%)

Query: 4    ISSNTVSVIKNNQIGPWKLGETLGSGSTGKVLLASNETTKQQAAVKVISKAVFEAMNNSE 63
            ++ N ++ +K + IGPWKLG TLG GSTGKV++A NET  QQAAVK+ISK++F A  ++ 
Sbjct: 1    MNGNGITTLKGDTIGPWKLGSTLGVGSTGKVVMAYNETKGQQAAVKIISKSIFNAQGSTM 60

Query: 64   SNGDATNALPYNIEQEIIIMKLLNHPNVLRLFDVWETNSDLYLVLEYAEKGELFNMLVER 123
              G+  + LPY IE+EIIIMKLLNHPNVLRL+DVWET+ DLY+VLEY EKGELFN+LVER
Sbjct: 61   IGGNDPDVLPYGIEREIIIMKLLNHPNVLRLYDVWETSKDLYMVLEYVEKGELFNLLVER 120

Query: 124  GPLPENEAVRAFRQIIIGISYCHSLGVVHRDLKPEXXXXXXXXXXXXADFGMAALESEDK 183
            GPLPENEAVR FRQIIIGISYCH+LG+VHRDLKPE            ADFGMAALES+DK
Sbjct: 121  GPLPENEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNVKLADFGMAALESKDK 180

Query: 184  LLETSCGSPHYAAPEIISGLPYEGFSSDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKV 243
            LLETSCGSPHYAAPEI+SGLPY GF SDVWSCGVIL+ALLTGRLPFDEEDGNIRNLLLKV
Sbjct: 181  LLETSCGSPHYAAPEIVSGLPYHGFESDVWSCGVILYALLTGRLPFDEEDGNIRNLLLKV 240

Query: 244  QKGEFEMPDDDEITKEAQDLLARLLTVDPSKRITIREILKHPLLQKYPSIKDSRSIRNLP 303
            Q G+FEMP DDEI+ EAQDL+AR+LTVDP +RI  REILKHPLL+KYPSIKDS+SIRNLP
Sbjct: 241  QSGKFEMPGDDEISSEAQDLIARILTVDPEQRIKTREILKHPLLRKYPSIKDSKSIRNLP 300

Query: 304  REDTYLSPLA--DTNSKIDDAILQNLVILWHGKDAREIAAKLREPGANTEKTLYALLYRF 361
            REDTYL+PL+    N  +D+ ILQNLV+LWHG++  +I  KL EPGAN EKT YALL+RF
Sbjct: 301  REDTYLNPLSLEGGNQCVDETILQNLVVLWHGRNKEDIITKLMEPGANLEKTFYALLHRF 360

Query: 362  KCDTQREANRAR--RQSKIVQRNSTIRSTAPEXXXXXXXXXXXXXXXRASIIASSS--KR 417
            K D  ++  + +  ++ + V  NS +   +                 R SII +SS  KR
Sbjct: 361  KHDNYQDQLKQQELQKKQSVSSNSLMYVGSLPSPNKSDSPVTTPKKKRTSIIVASSSHKR 420

Query: 418  PVSVTKTATNITVNSSITGTPKSAKRMSMNNSARKRMSALYGXXXXXXXXXXXXXXXXXX 477
            PVS+ K ++    +SS        KR+S    + KR+S L                    
Sbjct: 421  PVSMQKLSSQ---HSSPVKNGSIGKRLSKTFPSNKRISQLVSNSSSPTPAAHKRVSRIND 477

Query: 478  XXFLGNRPRDSVISMSHNKRASKSSKRISLVPNLKRQSVTTKLMATYAKLSEDDDWEYIE 537
                   P    +   + +++ + SKR SL+PN+KR S+TTKL+ATYAKLSED +WEYIE
Sbjct: 478  S---AAPPVPKEMLRDYKRQSKRQSKRFSLLPNMKRGSITTKLIATYAKLSEDSEWEYIE 534

Query: 538  RETKRTSSDFATLIDEIFEYEKYEQIRKEKA----XXXXXXXXXXXXXXXXXXXXXXXXX 593
            +ETKRTS DFATL+D+IFE+EKYEQIRKEK                              
Sbjct: 535  KETKRTSQDFATLMDQIFEHEKYEQIRKEKEELERKVNEAREKEEAERKERERIEREEQE 594

Query: 594  XXXXXXXXXXXXXXDIARQMDEEISNLKKELVG-----DQDNEDKFRSVSEPLXXXXXXX 648
                          ++  QM++EI+ LK E        D+ N    RSVS P+       
Sbjct: 595  RLEREERKRAERQKELQDQMEDEIAKLKAEYEAVQGSSDERNTANGRSVSAPIETDRTAN 654

Query: 649  XXXXXXXXG-----ILRNRKYSLQTRPVSRLDPGIGFIDKPRQSEQHVPETVNLEPELEE 703
                          ++  R +SLQTRPVSRLDPGI        +E  +  + NLE +   
Sbjct: 655  KRDSTFGIKNDINELINTRNFSLQTRPVSRLDPGI------IAAESRL--SANLEDDQAS 706

Query: 704  TEQKILETIRRSKFLGSSFDIKKELEN-----VKRHRQTSQPIEKEMAPPALPETLPKAV 758
             E+ ILETIRRSKFLGS F++  ELE      V + RQ       E       + LPK  
Sbjct: 707  KEKTILETIRRSKFLGSQFNLNVELEKAQKDLVSKERQEQLRKYSEQTAKYEVQKLPKNA 766

Query: 759  EKKNVSMDPSL--RKISDIKVPQFTRKSRHFSTSNRRLSVLSMYSTKESYSNLADILKNG 816
            +      D  +  RK+S++KVPQFTR+S+HFS+SN+R SVLS+YSTK S++NL D LKN 
Sbjct: 767  KAVATLRDDEVEPRKLSEVKVPQFTRRSKHFSSSNKRFSVLSLYSTKTSFTNLVDHLKND 826

Query: 817  ------PGEKEMIQTAPTPKSADDSDQLFDTIDEADTPASVSREERLYEVAEESENELAN 870
                  PG+ E      + K A + + +F+T++E D         +L+EV E  E +LA+
Sbjct: 827  NYLEPLPGQPEY----SSSKVAQEPEFMFETVEELD------ENSKLFEVPETEEGKLAS 876

Query: 871  KKIDIADLLNSEGSNLKSVEEQEDSMKLPKLPPL-FEDGSTKETKEQSKSMIPENMQSSE 929
                       E ++ +     +  + LP LPPL        E       +   N Q+ +
Sbjct: 877  AA-------RKESTDARKQSTNDKDINLPSLPPLQVSHDVADENGALGLGIYQPNDQTQK 929

Query: 930  SQKQIEKNNSDEGGSLNPFMTKHRDVSDKGVTKEKPT--VTMKTTSEQ-------VSADK 980
              K +     DE  S++  ++   DVS   V K+ P   V  K  +E+          + 
Sbjct: 930  PHKTML---IDE--SIDENISSTSDVSRTEVVKKPPLNDVVRKNNNERKPLEEITPKVEN 984

Query: 981  KRNMSFLRXXXXXXXXXX--DNVDVTLSTSVSSKQLFSGLVNLLKGWTKYGLKGIAIDST 1038
            KR +SF R            ++ D  L   VS+ +++  L  LL  WT YGLK +     
Sbjct: 985  KRKISFFRKFSQGSEKKLGPESFDSQLKAGVSAPKMYKALDRLLNEWTNYGLKHVESSPN 1044

Query: 1039 SQTITGKLANDNILSFRSTAFSILIFSQE-KGSAVTFRKVSGSGKAVRRLSDEVKKVLSK 1097
               I+GKL +DNILS RST F I +   E  GS + F K SGS K   RL  E++K+L K
Sbjct: 1045 DFVISGKLTSDNILSLRSTGFKITVLPGEGNGSIIQFTKKSGSTKTFNRLVKEIEKILEK 1104

Query: 1098 EGVL 1101
            E VL
Sbjct: 1105 EKVL 1108

>AFR696C Chr6 complement(1722130..1725558) [3429 bp, 1142 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YDR507C
            (GIN4) and YCL024W (KCC4)
          Length = 1142

 Score =  866 bits (2237), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 527/1175 (44%), Positives = 683/1175 (58%), Gaps = 120/1175 (10%)

Query: 6    SNTVSVIKNNQIGPWKLGETLGSGSTGKVLLASNETTKQQAAVKVISKAVFEAMNNSESN 65
            +N V+ ++ ++IGPWKLGETLG+GSTGKVLLA N  T Q AAVKVISK+VF A  ++   
Sbjct: 5    NNNVTSLRGDRIGPWKLGETLGAGSTGKVLLAQNTETGQIAAVKVISKSVFNAQGSTFVG 64

Query: 66   GDATNALPYNIEQEIIIMKLLNHPNVLRLFDVWETNSDLYLVLEYAEKGELFNMLVERGP 125
             +  + LPY IE+EIIIMKLLNHPNVLRL+DVWET  DLY+VLEY EKGELFN+LV+RGP
Sbjct: 65   SNDPDVLPYGIEREIIIMKLLNHPNVLRLYDVWETAQDLYMVLEYVEKGELFNLLVQRGP 124

Query: 126  LPENEAVRAFRQIIIGISYCHSLGVVHRDLKPEXXXXXXXXXXXXADFGMAALESEDKLL 185
            LPENEAVR FRQIIIGISYCH+LG+VHRDLKPE            ADFGMAALES+DKLL
Sbjct: 125  LPENEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKLADFGMAALESKDKLL 184

Query: 186  ETSCGSPHYAAPEIISGLPYEGFSSDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQK 245
            ETSCGSPHYAAPEI+SGLPY GF SDVWSCGVIL+ALLTGRLPFDEEDGNIRNLLLKVQ 
Sbjct: 185  ETSCGSPHYAAPEIVSGLPYHGFESDVWSCGVILYALLTGRLPFDEEDGNIRNLLLKVQS 244

Query: 246  GEFEMPDDDEITKEAQDLLARLLTVDPSKRITIREILKHPLLQKYPSIKDSRSIRNLPRE 305
            G++E+P +DEI+ EA+DL+ ++LTV+P +RI  REILKHPLLQKYPSIKDS+SIRNLPRE
Sbjct: 245  GKYEIPGEDEISPEARDLIVQILTVEPEQRIKTREILKHPLLQKYPSIKDSKSIRNLPRE 304

Query: 306  DTYLSPLADTNSKIDDAILQNLVILWHGKDAREIAAKLREPGANTEKTLYALLYRFKCDT 365
            DTYL+PL   +  ID AILQNLV+LWHG+D  EI  KL+EPGAN EKT YALL+RFK + 
Sbjct: 305  DTYLNPLDHNDGTIDQAILQNLVVLWHGRDKNEITMKLKEPGANLEKTFYALLHRFKFEN 364

Query: 366  QREANRARRQSKIVQRNST-----IRSTAPEXXXXXXXXXXXXXXXRASIIASSSKRPVS 420
            +++  + ++ +K +   S+     I  ++                  A  ++S+ KRPVS
Sbjct: 365  EQQQLKQQQIAKRISSTSSSPQQNIVKSSSRRSINNILSTPKKKRSSAINVSSAHKRPVS 424

Query: 421  VTKTATNITVNSSITGTPKS-AKRMSMNNSARKRMSALYGXXXXXXXXXXXXXXXXXXXX 479
            + K      +N   T  P S +K+ S++N  RK  + L G                    
Sbjct: 425  IQK------LNDCGTLNPTSPSKKRSLSN--RKLSAVLAGSNSSSPSRKRMSVGQDAP-- 474

Query: 480  FLGNRPRDSVISMSHNKRASKSSKRISLVPNLKRQSVTTKLMATYAKLSEDDDWEYIERE 539
                 P  + +   +NKRAS++SKR+S +P+ KR S+TTK++ATYAKLSED+DWEYI+RE
Sbjct: 475  -----PVPTAVLRDYNKRASRASKRLSFLPS-KRGSITTKIIATYAKLSEDNDWEYIDRE 528

Query: 540  TKRTSSDFATLIDEIFEYEKYEQIRKEK-------AXXXXXXXXXXXXXXXXXXXXXXXX 592
             KRTSSDFATLID IFE+EKYEQIR+EK                                
Sbjct: 529  AKRTSSDFATLIDNIFEHEKYEQIRREKEELERKVREAKEREERERRARAEAERRKREEE 588

Query: 593  XXXXXXXXXXXXXXXDIARQMDEEISNLKKELVGDQD-------NEDKFRSVSEPLXXXX 645
                           ++ + ++E+++ LK E+   +         E   RS+SEP+    
Sbjct: 589  ERRRRREVEELIRQRELQKSLEEQVARLKAEVAATKQEKRISLAQEQHVRSISEPMERKG 648

Query: 646  XXXX------XXXXXXXGILRNRKYSLQTRPVSRLDPGIGFIDKPRQSEQHVPETVNLEP 699
                              +L+ R  SL+TRP+SRLDPGI      R SE    E   LE 
Sbjct: 649  TRPSKRDSFLALQNNINSLLKRRTLSLETRPISRLDPGI------RLSE----ENTILED 698

Query: 700  ELE------ETEQKILETIRRSKFLGSSFDIKKELENVKRHRQTSQPIEKEM---APPAL 750
            +LE        E+ ILETIRRSKFLGS +DI KEL+ V+R +     + K       P L
Sbjct: 699  DLECNEDRLRVEKNILETIRRSKFLGSQYDIDKELQRVRREKLEKVNMRKSQDRKLEPGL 758

Query: 751  PE-----------------------TLPKAVEKKNVSMD--PSLRKISDIKVPQFTRKSR 785
                                      LPK V    V  D     RK+S++K+PQFTR+S+
Sbjct: 759  HSRQEQRFVSDGTTVTSSHEDSESIILPKNVTAIGVLKDEESEPRKLSEVKIPQFTRRSK 818

Query: 786  HFSTSNRRLSVLSMYSTKESYSNLADILKNGPGEKEMIQTAPTP-KSADDSDQLFDTIDE 844
            HFS S++RLSVLSMYSTK SY+NLAD L N    K +  +APT  K   + + +F++  +
Sbjct: 819  HFSASSKRLSVLSMYSTKVSYTNLADYLNNDVQLKSLQPSAPTSIKIPQEPEFMFESAGQ 878

Query: 845  ADTPASVSREERLYE---VAEESENELANKKIDIADLLNSEGSNLKSVEEQEDSMKLPKL 901
             +   + +  +   E   V  E ++E   + +++ +L +SE  + +  EE    +KLP L
Sbjct: 879  ENRYQAAAPTDTYLERPKVGVEGDHE-PGEPVELIELDDSEDRSKQYSEEDIAKVKLPIL 937

Query: 902  PPLFE------------DGSTKETKEQS--KSMIPENMQSSESQKQIEKNNSDEGGSLNP 947
            PPL                  KE   Q   KSMIP++++      Q           L+P
Sbjct: 938  PPLDHLNKPNGLGIYQAPAPPKEPLGQPVMKSMIPDDIKIKCVPNQ-----------LSP 986

Query: 948  FMTKHRDVSDKGVTKEKPTVTMKTTSEQVSADKKRNMSFLRXXXXXXXXXXDNVDVTLST 1007
                     +K +TK   TV  +  + +                        + DV L T
Sbjct: 987  RRRATERAPEKKLTK---TVPERVIAAETFPPPNTKKKPSFFKKFSREKMHSDCDVQLDT 1043

Query: 1008 SVSSKQLFSGLVNLLKGWTKYGLKGIAIDSTSQTITGKLANDNILSFRSTAFSILIFS-Q 1066
            +V   ++F  L  LL GWT YGLK +     S TITGKL++DNILS RSTAF I+I S  
Sbjct: 1044 TVGDSKMFRALNKLLNGWTSYGLKEVRSMPASYTITGKLSSDNILSLRSTAFEIVILSVA 1103

Query: 1067 EKGSAVTFRKVSGSGKAVRRLSDEVKKVLSKEGVL 1101
            + GS+V F K SGS K   RL +E++K+L KE VL
Sbjct: 1104 DTGSSVKFTKKSGSKKTFTRLVNEIEKILEKESVL 1138

>Skud_3.39 Chr3 (66201..69254) [3054 bp, 1017 aa] {ON} YCL024W (REAL)
          Length = 1017

 Score =  751 bits (1940), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 454/1125 (40%), Positives = 638/1125 (56%), Gaps = 167/1125 (14%)

Query: 17   IGPWKLGETLGSGSTGKVLLASNETTKQQAAVKVISKAVFEAMNNSESN-GDATNALPYN 75
            IGPWKLGETLG GS GKV LA +E T  + AVK+ISK++F    N+E N G+  + LPYN
Sbjct: 18   IGPWKLGETLGVGSAGKVRLAQHEGTAHKTAVKIISKSIF----NTEGNYGNHGSVLPYN 73

Query: 76   IEQEIIIMKLLNHPNVLRLFDVWETNSDLYLVLEYAEKGELFNMLVERGPLPENEAVRAF 135
            IE+EI+IMKLL+HPNVL L+DVWETN++LYL+LEYAEKGELFN+LV+RG LPE EA++ F
Sbjct: 74   IEREIVIMKLLSHPNVLGLYDVWETNNNLYLILEYAEKGELFNLLVDRGALPEREAMKCF 133

Query: 136  RQIIIGISYCHSLGVVHRDLKPEXXXXXXXXXXXXADFGMAALESEDKLLETSCGSPHYA 195
            RQIII +SYCH+LG+VHRDLKPE            ADFGMAAL+++  LLETSCGSPHYA
Sbjct: 134  RQIIIAVSYCHALGIVHRDLKPENLLLDSDYNIKVADFGMAALQTDAALLETSCGSPHYA 193

Query: 196  APEIISGLPYEGFSSDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQKGEFEMPDDDE 255
            APEI+SGLPYEGFSSDVWSCGVILFALLTGRLPFDEE+GNIR LLLKVQ+G+FEMPDD E
Sbjct: 194  APEIVSGLPYEGFSSDVWSCGVILFALLTGRLPFDEENGNIRTLLLKVQRGQFEMPDDTE 253

Query: 256  ITKEAQDLLARLLTVDPSKRITIREILKHPLLQKYPSIKDSRSIRNLPREDTYLSPLADT 315
            I+K+AQDL++++L VDP++RI IR+IL HPLL++Y +IKDS+SI++LPREDTYL PLAD 
Sbjct: 254  ISKDAQDLISKILVVDPAQRIKIRDILSHPLLKRYQTIKDSKSIKDLPREDTYLYPLADA 313

Query: 316  NSKIDDAILQNLVILWHGKDAREIAAKLREPGANTEKTLYALLYRFKCDTQREANRARRQ 375
             + IDD+ILQNLV+LWHG+ A EI AKL+  G NTEKTLYALLYRFK ++ RE+N+ RR 
Sbjct: 314  GAAIDDSILQNLVVLWHGRHADEIKAKLKASGTNTEKTLYALLYRFKLESMRESNKRRRH 373

Query: 376  S--KIVQRNSTIRSTAPEXXXXXXXXXXXXXXXRASIIASSSKRPVSVTKTATNITVNSS 433
               K   R  +  S+  +                ++  +S  KR       ++ I   +S
Sbjct: 374  KTKKTKNRKFSTSSSLVKGRNLESTPRKRTSKTHSNNFSSGKKR-------SSFILSPNS 426

Query: 434  ITGTP---KSAKRMSMNNSARKRMSALYGXXXXXXXXXXXXXXXXXXXXFLGNRPRDSVI 490
            I  +P   +++K +S+ N+                                G  P   VI
Sbjct: 427  INSSPIPLRNSKGISLRNATS------------------------------GGSPVVPVI 456

Query: 491  SMSHNKRASK-SSKRISLVPNLKRQSVTTKLMATYAKLSEDDDWEYIERETKRTSSDFAT 549
             ++  KR SK SSKR S +PNLK  SVT++L++ Y KL ++DDWE IE++TKRTSS+FAT
Sbjct: 457  LLNSFKRNSKLSSKRSSYMPNLKSGSVTSRLLSNYNKLIDEDDWECIEKDTKRTSSNFAT 516

Query: 550  LIDEIFEYEKYEQIRKEKAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDI 609
            LIDEIFE E++E  ++EK                                          
Sbjct: 517  LIDEIFEPEEFELAKREKVELQRKVR---------------------------------- 542

Query: 610  ARQMDEEISNLKKELVGDQDNEDKFRSVSEPLXXXXXXXXXXXXXXXGILRNR-KYSLQT 668
              +M + I +  +   G ++ +     VS PL                +L NR + S  T
Sbjct: 543  GSKMSDNIGDRSEFTDGMKELKRINAKVSSPLINYEFSQQELLQDIDTLLTNRYQLSAYT 602

Query: 669  RPVSRLDPGIGFIDKPRQSEQHVPETVNLEPELEETEQKILETIRRSKFLGSSFDIKKEL 728
            RP+S+LDPG+  +     +   + E   L   + +TE KI+ETI RSKFLGS  +++   
Sbjct: 603  RPISKLDPGL--MPAAGTTPHDIKEQTAL---IRDTEVKIIETIHRSKFLGSLLNVR--- 654

Query: 729  ENVKRHRQTSQPIEKEMAPPALPETLPKAVEKKNVSMDPSLRKISDIKVPQFTRKSRHFS 788
            E + +      PIE+     ++  T P   + +       +RKISD++VP FTRKSRHF+
Sbjct: 655  EGMSKDDDELAPIEES----SIISTTPLIYDDRT-----EVRKISDVEVPHFTRKSRHFT 705

Query: 789  TSNRRLSVLSMYSTKESYSNLADILKN----GPGEKEMIQTAPTPKSA------------ 832
             ++ R SVLS+YS+++S+ +L+ I KN     P ++ +  T+ + K              
Sbjct: 706  AASNRRSVLSLYSSRDSFKDLSQISKNEYSDSPSQRSVDDTSSSKKVGHTESLASVAEHI 765

Query: 833  -DDS-----------DQLFDTIDEADTPASVSREERLYEVAEESENELANKKIDIADLLN 880
             DDS           + L+D  +  D P  V   +     +  S +      +++  L +
Sbjct: 766  DDDSYNDHNSGMNSDNVLYDVPEGVDLPQEVKNSDEQSSCSLVSSSLEPTPVVELPSLSS 825

Query: 881  SEGSN---LKSVEEQEDSMKLPKLPPLFEDGSTKETKEQSKSMIPENMQSSESQKQIEKN 937
             +G N   L   + +   + LP       D       E  K +  +++ ++     +++N
Sbjct: 826  FQGKNASGLGIYQREPSKVSLPTATIDTSDAVENRETEVKKELKHDSIATNLPDDNVKEN 885

Query: 938  NSDEGGSLNPFMTKHRDVSDKGVTKEKPTVTMKTTSEQVSADKKRNMSFLRXXXXXXXXX 997
            N+                     T E P+   K++          N+S L+         
Sbjct: 886  NN--------------------ATAEAPSRIKKSS----------NVSILKNISKGKI-- 913

Query: 998  XDNVDVTLSTSVSSKQLFSGLVNLLKGWTKYGLKGIAIDSTSQTITGKLANDNILSFRST 1057
               +++ +   + +K+LF GL  LL+GW +YGLK +  D+    I GKL ND+ILS RST
Sbjct: 914  ---LELEIHAKIPNKRLFEGLHKLLEGWKQYGLKKLGFDAAKMIIKGKLVNDSILSLRST 970

Query: 1058 AFSILIF-SQEKGSAVTFRKVSGSGKAVRRLSDEVKKVLSKEGVL 1101
             F I++  + +  S + F K +GS K + +L+ E++ +L KEGVL
Sbjct: 971  LFEIIVLPNGDDRSLIKFNKKTGSSKVLTKLATEIQIILQKEGVL 1015

>Smik_3.54 Chr3 (80309..83407) [3099 bp, 1032 aa] {ON} YCL024W (REAL)
          Length = 1032

 Score =  746 bits (1925), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 466/1126 (41%), Positives = 647/1126 (57%), Gaps = 150/1126 (13%)

Query: 15   NQIGPWKLGETLGSGSTGKVLLASNETTKQQAAVKVISKAVFEAMNNSESNGDATNALPY 74
            N IGPWKLGETLG GSTGKV LA +E T Q+ AVKVI K++F++     S+G+  + LP+
Sbjct: 16   NIIGPWKLGETLGFGSTGKVQLARHERTGQKTAVKVIPKSIFKSEG---SHGNNDSVLPF 72

Query: 75   NIEQEIIIMKLLNHPNVLRLFDVWETNSDLYLVLEYAEKGELFNMLVERGPLPENEAVRA 134
            NIE+EI+IMKLL+HPNVL L+DVWET+++LYL+LEYAEKGELFN+LV+RGPLPE EA++ 
Sbjct: 73   NIEREIVIMKLLSHPNVLSLYDVWETDNNLYLILEYAEKGELFNLLVDRGPLPEREAIKC 132

Query: 135  FRQIIIGISYCHSLGVVHRDLKPEXXXXXXXXXXXXADFGMAALESEDKLLETSCGSPHY 194
            F+QIII ISYCH+LG+VHRDLKPE            ADFGMAAL+++  +LETSCGSPHY
Sbjct: 133  FKQIIIAISYCHALGIVHRDLKPENLLLDNSYNIKIADFGMAALQTDAGMLETSCGSPHY 192

Query: 195  AAPEIISGLPYEGFSSDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQKGEFEMPDDD 254
            AAPEI+SGLPYEGF+SDVWSCGVILFALLTGRLPFDEE+GN+R+LLLKVQKG+FEMP++ 
Sbjct: 193  AAPEIVSGLPYEGFASDVWSCGVILFALLTGRLPFDEENGNVRDLLLKVQKGQFEMPNNA 252

Query: 255  EITKEAQDLLARLLTVDPSKRITIREILKHPLLQKYPSIKDSRSIRNLPREDTYLSPLAD 314
            EI+ +AQDL+ R+L VDP++RI IR+IL HPLL+KY +IKDS+SI++LPRE+TYL PLAD
Sbjct: 253  EISGDAQDLIRRILVVDPTQRIKIRDILSHPLLKKYQTIKDSKSIKDLPRENTYLYPLAD 312

Query: 315  ----TNSKIDDAILQNLVILWHGKDAREIAAKLREPGANTEKTLYALLYRFKCDTQREAN 370
                T+  IDD+ILQNLVILWHG+ A EI  KL++ G NTEKTLYALLYRFK ++ +E N
Sbjct: 313  ADNHTSVTIDDSILQNLVILWHGRPAEEIMKKLQDNGTNTEKTLYALLYRFKLESMKETN 372

Query: 371  RARRQSKIVQRNSTIRSTAPEXXXXXXXXXXXXXXXRASIIASSSKRPVSVTKTATNITV 430
            + R +SKI   N T +                            SKR  +++ ++++   
Sbjct: 373  K-RSRSKI---NKTKK----------------------------SKRVSTLSSSSSSAFN 400

Query: 431  NSSITGTP-KSAKRMSMNN--SARKRMSALYGXXXXXXX--XXXXXXXXXXXXXFLGNRP 485
            + S+   P K A R    N  S+RKR S +                          GN  
Sbjct: 401  HQSLDSAPRKHASRGHSKNFPSSRKRSSFILSSNSTDCSPIPLRSSKRISISSAVPGNTL 460

Query: 486  RDSVISMSHNKRASKSSKRISLVPNLKRQSVTTKLMATYAKLSEDDDWEYIERETKRTSS 545
            +    S+   + + +SSKR+S +PNL R S+TT L++ Y  L +DDDWEYI+++TKRTSS
Sbjct: 461  QVPDSSLKLKRNSKRSSKRLSYMPNLGRGSLTTNLLSNYTNLIDDDDWEYIDKDTKRTSS 520

Query: 546  DFATLIDEIFEYEKYEQIRKEKAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 605
            +FATLIDEIFE EK+E  ++EKA                                     
Sbjct: 521  NFATLIDEIFEPEKFELAKREKA----------------ELQKKVQEAKRQVSKNAPISD 564

Query: 606  XXDIARQMDEEISNLKKELVGDQDNEDKFRSVSEPLXXXXXXXXXXXXXXXGILRNR-KY 664
              D+  ++ + +  LKK  + ++        VS PL                +L NR + 
Sbjct: 565  EKDVGFEVSDGMRELKK--INNK--------VSSPLMNYEFSQKELLQDIDTLLTNRYQL 614

Query: 665  SLQTRPVSRLDPGIGFIDKPRQSEQHVPETVNLEPE-LEETEQKILETIRRSKFLGSSFD 723
            S  TRP+SRLDPG+  +         +P ++  +   L++TE KI+ETIR+S+FLGS  +
Sbjct: 615  SSYTRPISRLDPGLTPVTGA------IPHSIKEKTALLQDTEMKIIETIRKSEFLGSLLN 668

Query: 724  IKKELENVKRHRQTSQPIEKEMAPPALPETLPKAVEKKNVSMDPSLRKISDIKVPQFTRK 783
            ++   E + +       IE        P      VE         +RKISD++VP FTRK
Sbjct: 669  VR---EGISQDNNQLASIEVSPKISTTPLMYNDQVE---------IRKISDVEVPHFTRK 716

Query: 784  SRHFSTSNRRLSVLSMYSTKESYSNLADILKNGPGEKEMIQTAPTPKSADDS--DQLFDT 841
            S+HF+T+N R SVLS+YS KES  +L  I KN   +      +P   S D++   +L D 
Sbjct: 717  SKHFTTANNRRSVLSLYSLKESLEDLNQISKNEEPD------SPPQGSTDNASKSELVDV 770

Query: 842  IDEADTPASVSREER-------------LYEVAEESENELANKKIDIADLLNSEGSNLKS 888
            I+E     +   ++              LY+V E  +   + +  DI D  +++    KS
Sbjct: 771  IEEVTEQKNSQHDQDDSNDSNGMNNNNILYDVPECVD---SPQGYDINDAHSTQSPASKS 827

Query: 889  VEEQEDSMKLPKLPPLFEDGST------KETKEQSKSMIPENMQSS------ESQKQIEK 936
             E +   +KLP L       ++      +E+  +S   +  N+  S      E+QK+I+ 
Sbjct: 828  TEPKP-VVKLPSLSSFQRKNASGLGIYQRESSRESLPSVTINISESDKTTENEAQKEIKH 886

Query: 937  NNSDEGGSLNPFMTKHRDVSDKGVTKEKPTVTMKTTSEQVSADKKRNMSFLRXXXXXXXX 996
            + SD        ++ H   +D    K   +  ++ +S           SFL+        
Sbjct: 887  DKSDT------ILSNHDGKADS--YKGDISNIVRESSHG---------SFLKKLSKGKIL 929

Query: 997  XXDNVDVTLSTSVSSKQLFSGLVNLLKGWTKYGLKGIAIDSTSQTITGKLANDNILSFRS 1056
              D     +   +S K+L+ GL  LL+GW +YGLK + I++    I+GKL ND ILS RS
Sbjct: 930  ELD-----VRAKISEKRLYEGLHKLLEGWKQYGLKNLGINTADMIISGKLVNDGILSLRS 984

Query: 1057 TAFSILIFSQEKG-SAVTFRKVSGSGKAVRRLSDEVKKVLSKEGVL 1101
            T F I+I     G S + F K +GS K + + + E++ +L KEGVL
Sbjct: 985  TLFEIVILPNGSGRSLIKFNKKTGSTKTLTKFATEIQIILQKEGVL 1030

>Suva_3.190 Chr3 (288639..288813,288870..291766) [3072 bp, 1024 aa]
            {ON} YDR507C (REAL)
          Length = 1024

 Score =  738 bits (1904), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 467/1117 (41%), Positives = 643/1117 (57%), Gaps = 132/1117 (11%)

Query: 15   NQIGPWKLGETLGSGSTGKVLLASNETTKQQAAVKVISKAVFEAMNNSESNGDATNALPY 74
            N IGPW+LGETLGSGSTG+V LA +E T  + AVKVISK +F+     +  G    ALPY
Sbjct: 8    NTIGPWRLGETLGSGSTGRVQLAQHERTGHKTAVKVISKTIFDT---EDGGGXXXLALPY 64

Query: 75   NIEQEIIIMKLLNHPNVLRLFDVWETNSDLYLVLEYAEKGELFNMLVERGPLPENEAVRA 134
            NIE+EI++MKLL+HPNVL L+DVWETN++LYL+LEYAEKGELFN+LV+RGPLPE EAV+ 
Sbjct: 65   NIEREIVVMKLLSHPNVLSLYDVWETNNNLYLILEYAEKGELFNLLVDRGPLPEKEAVKC 124

Query: 135  FRQIIIGISYCHSLGVVHRDLKPEXXXXXXXXXXXXADFGMAALESEDKLLETSCGSPHY 194
            FRQIII ISYCH+LG+VHRDLKPE            ADFGMAAL+++ +LLETSCGSPHY
Sbjct: 125  FRQIIIAISYCHALGIVHRDLKPENLLLDNDYNIKIADFGMAALQTDARLLETSCGSPHY 184

Query: 195  AAPEIISGLPYEGFSSDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQKGEFEMPDDD 254
            AAPEI+SGLPY GF+SDVWSCGVILFALLTGRLPFDE++GN+R+LLLKVQ+G+FEMPD  
Sbjct: 185  AAPEIVSGLPYRGFASDVWSCGVILFALLTGRLPFDEDNGNVRDLLLKVQRGQFEMPDAT 244

Query: 255  EITKEAQDLLARLLTVDPSKRITIREILKHPLLQKYPSIKDSRSIRNLPREDTYLSPLAD 314
            EI+K+AQ+L++R+L VDP++R+  R+IL HPLL+KY +I+DS+SIRNLPRE+TYL PLAD
Sbjct: 245  EISKDAQNLISRILVVDPTQRMKTRDILTHPLLKKYQTIRDSKSIRNLPRENTYLYPLAD 304

Query: 315  ----TNSKIDDAILQNLVILWHGKDAREIAAKLREPGANTEKTLYALLYRFKCDTQREAN 370
                TN+ ID +ILQNLV+LWHG+ A EI A L++ G NTEKTLYALLYRFK    +EAN
Sbjct: 305  AGNHTNATIDGSILQNLVVLWHGRPADEIVANLKDNGTNTEKTLYALLYRFK----QEAN 360

Query: 371  -RARRQSKIVQRNSTIRSTAPEXXXXXXXXXXXXXXXRASIIASSSKRPVSVTKTATNIT 429
             R+R + K   + +    +                  R       S    S  K ++ I 
Sbjct: 361  KRSRHKIKKTTKKNPPYPSMSILSSSSSHNRLSGSTPRRRTPKRRSMNFSSSKKRSSFIL 420

Query: 430  VNSSITGTP---KSAKRMSMNNSARKRMSALYGXXXXXXXXXXXXXXXXXXXXFLGNRPR 486
             ++S  G+P   +++KR S  N+A                                N P 
Sbjct: 421  ASNSSNGSPMPSRNSKRSSFFNTAS------------------------------ANVPP 450

Query: 487  DSVISMSHNKRASK-SSKRISLVPNLKRQSVTTKLMATYAKLSEDDDWEYIERETKRTSS 545
              V  ++  KR SK SSKR+S VPN+KR S+T+K ++ Y  L ++DDWEYIE++TKRTSS
Sbjct: 451  VPVKLLNSYKRNSKRSSKRLSYVPNVKRGSLTSKSLSKYTNLIDEDDWEYIEKDTKRTSS 510

Query: 546  DFATLIDEIFEYEKYEQIRKEKAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 605
            +FATLIDEIFE EK+E  R+EKA                                     
Sbjct: 511  NFATLIDEIFEPEKFELARREKA-------------------------ELQRKVQEAKRG 545

Query: 606  XXDIARQMDEEISNLKKELVGDQDNEDKFR----SVSEPLXXXXXXXXXXXXXXXGILRN 661
              D+A+ +++E  N      G  D  ++ +     VS PL                +L N
Sbjct: 546  KSDVAK-LNQENGN----ETGKSDAMEELKKINNKVSSPLINYEYSQQELLQDINTLLTN 600

Query: 662  R-KYSLQTRPVSRLDPGIGFIDKPRQSEQHVPETVNLEPELEETEQKILETIRRSKFLGS 720
            R + S  TRP+S+LDPG+  +  P      + E  +L   L +TE KILETIR+SK L S
Sbjct: 601  RCQLSAYTRPISKLDPGL--MPTPETIPYDIKEKTDL---LLDTEMKILETIRKSKILDS 655

Query: 721  SFDIKKELENVKRHRQTSQPIEKEMAPPALPETLPKAVEKKNVSMDPSLRKISDIKVPQF 780
            S +++KE+      R   +    E +P A    L    + K V       KISDI+VP F
Sbjct: 656  SLNLRKEVS-----RDADRLPSVEESPIASTTPLVYNNDSKEVC------KISDIQVPHF 704

Query: 781  TRKSRHFSTSNRRLSVLSMYSTKESYSNLADILKNGPGEKEMIQTAPTPKSADDSDQLFD 840
            TRKS+ F+ +N R SVLS+YS++ S+  L+ IL +             P S ++ D   D
Sbjct: 705  TRKSKCFTPTNNRRSVLSLYSSRHSFKGLSRILNSKDPSANPYSHINGPLS-EEIDLTED 763

Query: 841  TIDEADTPASVSREERLYEVAEES------ENELANKKIDIADLLNSEGSNLKSVEEQED 894
              +  +   + +   RLY+V+E +      +++  +   +  D   S  S++ +  E   
Sbjct: 764  IANMKNIENNNNNNNRLYDVSESAILLQGNDDDDDDDDNENDDGSQSIQSSVSNNTEPTT 823

Query: 895  SMKLPKLPPLFEDGSTKETKEQSKSMIPENMQSSESQKQIEKNNSDEGGSLNPFMTKHRD 954
             +KLP L    E  ++     Q +  I  +++SS     IE         L        D
Sbjct: 824  FVKLPSLSSFQEKNASGLGIYQREPSIEPSIESS-----IE--------PLPNVTIAIED 870

Query: 955  VSDKG---VTKEKPTVTMKTTSEQVSADKK------RNMSFLRXXXXXXXXXXDNVDVTL 1005
            V + G   +  E  T ++   + + + D K       N+SFL+            +++ +
Sbjct: 871  VDEDGENEIQHENITTSLSNDNIKKNDDTKDTIREYSNVSFLKKFSKGKI-----LELEI 925

Query: 1006 STSVSSKQLFSGLVNLLKGWTKYGLKGIAIDSTSQTITGKLANDNILSFRSTAFSILIF- 1064
               + +++LF GL  LL+GW +YGLK +  D+ +  ITGKL NDNILS RST F I++  
Sbjct: 926  HAKIPAERLFEGLHKLLEGWKQYGLKNLGFDTANMIITGKLVNDNILSLRSTLFEIIVLP 985

Query: 1065 SQEKGSAVTFRKVSGSGKAVRRLSDEVKKVLSKEGVL 1101
            +++  S + F K +GS K +++L  E++ VL KEGVL
Sbjct: 986  NRDDRSLIKFNKKTGSTKTLKKLGYEIQIVLQKEGVL 1022

>KLTH0F01672g Chr6 (127277..130771) [3495 bp, 1164 aa] {ON} similar
           to uniprot|Q12263 Saccharomyces cerevisiae YDR507C
          Length = 1164

 Score =  691 bits (1782), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 340/571 (59%), Positives = 421/571 (73%), Gaps = 10/571 (1%)

Query: 2   SAISSNTVSVIKNNQIGPWKLGETLGSGSTGKVLLASNETTKQQAAVKVISKAVFEAMNN 61
           +++  +T++ +K ++IGPWKLG TLG+GSTGKV++A +E+T QQAAVK++SK++F   +N
Sbjct: 8   NSVVKSTLTTLKGDKIGPWKLGSTLGAGSTGKVVMAQHESTGQQAAVKIVSKSIFGNQSN 67

Query: 62  SES--NGDATNALPYNIEQEIIIMKLLNHPNVLRLFDVWETNSDLYLVLEYAEKGELFNM 119
           S +    +  + LPY IE+EIIIMKLLNHPNVLRL+DVWETNS LY+VLEY EKGELFN+
Sbjct: 68  SSTIVGSNDPDVLPYGIEREIIIMKLLNHPNVLRLYDVWETNSSLYMVLEYVEKGELFNL 127

Query: 120 LVERGPLPENEAVRAFRQIIIGISYCHSLGVVHRDLKPEXXXXXXXXXXXXADFGMAALE 179
           LV+RGPLPENEAVR FRQIIIGISYCH+LG+VHRDLKPE            ADFGMAALE
Sbjct: 128 LVDRGPLPENEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAALE 187

Query: 180 SEDKLLETSCGSPHYAAPEIISGLPYEGFSSDVWSCGVILFALLTGRLPFDEEDGNIRNL 239
           S+DKLLETSCGSPHYAAPEI+SGLPY GF SDVWSCG+ILFALLTGRLPFDEEDGNIRNL
Sbjct: 188 SKDKLLETSCGSPHYAAPEIVSGLPYHGFESDVWSCGIILFALLTGRLPFDEEDGNIRNL 247

Query: 240 LLKVQKGEFEMPDDDEITKEAQDLLARLLTVDPSKRITIREILKHPLLQKYPSIKDSRSI 299
           LLKVQ G+FEMPD +EI+ EAQDL+A++LTVDP+ RI  R ILKHPLLQKYPSIKDS+SI
Sbjct: 248 LLKVQSGKFEMPDTNEISGEAQDLIAKILTVDPAARIKSRGILKHPLLQKYPSIKDSKSI 307

Query: 300 RNLPREDTYLSPLADTNSKIDDAILQNLVILWHGKDAREIAAKLREPGANTEKTLYALLY 359
           RNLPREDTYL+PL   +  IDD I+ NLV+LWHG+D  EI  KL+EPGAN EKT YALL+
Sbjct: 308 RNLPREDTYLNPLDSVDGTIDDTIIGNLVVLWHGRDRNEITNKLKEPGANLEKTFYALLF 367

Query: 360 RFKCDTQREANRARRQSKIVQRNSTIRSTAPEXXXXXXXXXXXXXXXRASIIASSS--KR 417
           RFK D+Q+E  + +R+S+ +Q +                        RA +I++SS  KR
Sbjct: 368 RFKHDSQQEQLKQQRRSQAMQVSPKKTGLRKSNSRRSINSTTPKKKTRAPVISASSSHKR 427

Query: 418 PVSVTKTATNITVNSSITGTPKSAKRMSMNNSARKRMSALYGXXXXXXXXXXXXXXXXXX 477
           PVS ++ + +   N+       S KR S+N S+ KR+SAL                    
Sbjct: 428 PVSFSRLSYSNGSNTDHNTPNSSGKRSSVNLSSNKRISALINPNSSPTPASKRASLRELD 487

Query: 478 XXFLGNRPRDSV-----ISMSHNKRASKSSKRISLVPNLKRQSVTTKLMATYAKLSEDDD 532
                  P D +      +   N+++S+ SKR+S +P  KR S+TTKL+ATYAK+SED+D
Sbjct: 488 PS-APPIPVDMLKDYNKAAPKANRKSSRISKRLSFLPGNKRGSITTKLIATYAKISEDND 546

Query: 533 WEYIERETKRTSSDFATLIDEIFEYEKYEQI 563
           WEYIE+ETKRTS+DFATL DEIFE+EKYEQI
Sbjct: 547 WEYIEKETKRTSADFATLCDEIFEHEKYEQI 577

 Score =  229 bits (584), Expect = 7e-61,   Method: Compositional matrix adjust.
 Identities = 175/494 (35%), Positives = 249/494 (50%), Gaps = 69/494 (13%)

Query: 658  ILRNRKYSLQTRPVSRLDPGIGFIDKPRQSEQHVPET-VNLEPELEETEQKILETIRRSK 716
            +L  R +SL+TRP SRLDPGI  +       + VP + +       +TE+ ILETIRRSK
Sbjct: 686  LLNRRTFSLETRPKSRLDPGIYTL-------EEVPNSDIKDGGRDLKTEKTILETIRRSK 738

Query: 717  FLGSSFDIKKELENVKRHRQ------TSQPIEKEMAPPAL---------PETLPKAVEKK 761
            FLGSSFDI KEL   +R ++        +  E  +   A          P+TLPK     
Sbjct: 739  FLGSSFDINKELARERRLKEERAAALKQRKKEDRVVSNATGNYSENGYEPQTLPKNAAAT 798

Query: 762  NVSMDPSL--RKISDIKVPQFTRKSRHFSTSNRRLSVLSMYSTKESYSNLADILKNGPGE 819
             +S D     RKIS+++VPQFTR+SRHF+ SN+RLSVLSMYSTK S++NLAD L+ G  +
Sbjct: 799  KISNDAGSDPRKISEVQVPQFTRRSRHFTASNKRLSVLSMYSTKASFTNLADHLR-GKTD 857

Query: 820  KEMIQTAP--TPKSADDSDQLFDTID-EADTPASVSREERLYEVAEESENELANK---KI 873
             + I  +P  T +   +++ +F+++D E    A  S + RLYEVAE ++ + A +   ++
Sbjct: 858  LQSINGSPPSTSRMEPETEFMFESVDGEGKETADTSADSRLYEVAEGNDPKGAARSAVRL 917

Query: 874  DIADLLNSEGSNLKSVEEQEDSMKLPKLPPL----------------FEDGSTKETKEQS 917
            + AD  N   S      E  + +KLP LPPL                  D S  E   Q 
Sbjct: 918  NFADRFNKPTSPPPQSVEDPNGIKLPSLPPLDKAKSDGVNGLGLYQPASDSSETEIHHQP 977

Query: 918  KSMIPENMQSSES-------QKQIEKNNSDEG-GSLNPFMTKHRDVSDKGVTKEKPTVTM 969
            KSMIP + +  E+       QKQ+   + +     LN  M K+ +       +  P    
Sbjct: 978  KSMIPVDAEQKEAAEAKPEEQKQVPPKDVESAPAPLNKVMKKNTEAEKNQPNQPAP---- 1033

Query: 970  KTTSEQVSADKKRNMSFLR--XXXXXXXXXXDNVDVTLSTSVSSKQLFSGLVNLLKGWTK 1027
                   +A KK N SF R               D    T +   Q+F+ L  LL  W  
Sbjct: 1034 -------NAVKKNNKSFFRRFSGKSDDEKRPGEYDFKFDTVIEGTQMFNALSKLLAAWKD 1086

Query: 1028 YGLKGIAIDSTSQTITGKLANDNILSFRSTAFSILIFSQEKGSAVTFRKVSGSGKAVRRL 1087
            YGLK +    + + I GK+++DN+LS RST F I I S+ +GS V F K SGS K  ++L
Sbjct: 1087 YGLKDVVASPSQKKIKGKMSSDNMLSLRSTLFEISIVSKGEGSIVGFTKKSGSTKTFKKL 1146

Query: 1088 SDEVKKVLSKEGVL 1101
              E++K+L  +  L
Sbjct: 1147 VKEIEKILESKKAL 1160

>SAKL0C01716g Chr3 (143880..147527) [3648 bp, 1215 aa] {ON} similar
           to uniprot|Q12263 Saccharomyces cerevisiae YDR507C
          Length = 1215

 Score =  688 bits (1775), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 351/603 (58%), Positives = 430/603 (71%), Gaps = 38/603 (6%)

Query: 2   SAISSNTVSVIKNNQIGPWKLGETLGSGSTGKVLLASNETTKQQAAVKVISKAVFEAM-- 59
           ++I S+ ++ +KN++IGPWKLG  LG+GS GKVL+A +ETT QQAAVK++SK++F A+  
Sbjct: 8   NSIISSPLTTLKNDKIGPWKLGSILGAGSAGKVLMAQHETTGQQAAVKIVSKSIFGAVAQ 67

Query: 60  NNSES--NGDATNALPYNIEQEIIIMKLLNHPNVLRLFDVWETNSDLYLVLEYAEKGELF 117
           NNS +    +  + LPY IE+EIIIMKLLNH NVLRL+DVWET S+LY+VLEY EKGELF
Sbjct: 68  NNSSTIVGSNDPDLLPYGIEREIIIMKLLNHTNVLRLYDVWETKSNLYMVLEYVEKGELF 127

Query: 118 NMLVERGPLPENEAVRAFRQIIIGISYCHSLGVVHRDLKPEXXXXXXXXXXXXADFGMAA 177
           N+LVERGPLPENEAVR FRQIIIGISYCH+LG+VHRDLKPE            ADFGMAA
Sbjct: 128 NLLVERGPLPENEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAA 187

Query: 178 LESEDKLLETSCGSPHYAAPEIISGLPYEGFSSDVWSCGVILFALLTGRLPFDEEDGNIR 237
           LES+DKLLETSCGSPHYAAPEI+SGLPY GF SDVWSCGVIL+ALLTGRLPFDE++GNIR
Sbjct: 188 LESKDKLLETSCGSPHYAAPEIVSGLPYHGFESDVWSCGVILYALLTGRLPFDEDNGNIR 247

Query: 238 NLLLKVQKGEFEMPDDDEITKEAQDLLARLLTVDPSKRITIREILKHPLLQKYPSIKDSR 297
           +LLLKVQ GE+EMP +DEI+ EAQDL+A++LTVDP +RI  REILKHPLLQKYPSIKDS+
Sbjct: 248 SLLLKVQSGEYEMPGNDEISSEAQDLIAKILTVDPDRRIKTREILKHPLLQKYPSIKDSK 307

Query: 298 SIRNLPREDTYLSPLADTNSKIDDAILQNLVILWHGKDAREIAAKLREPGANTEKTLYAL 357
           SIRNLPREDTYL+PL   +  IDD ILQNLV+LWHG+D  EI AKL EPGAN EKT Y L
Sbjct: 308 SIRNLPREDTYLNPLDHGDGSIDDGILQNLVVLWHGRDRNEIVAKLNEPGANLEKTFYVL 367

Query: 358 LYRFKCDTQREANRAR---------------------RQS------KIVQRNSTIRSTAP 390
           L+RFK D  ++  + +                     RQS      K+  + S  R +  
Sbjct: 368 LFRFKHDVHQQQQQQQQQQQQQQQQQQQQQQQQQQQSRQSGYVSPKKLAMKKSASRKSIT 427

Query: 391 EXXXXXXXXXXXXXXXRASIIASSSKRPVSVTKTATNITVNSSITGTPKSA-KRMSMNNS 449
                               ++SS KRPVS  K +T    +S+  GTP S+ KRMS++ S
Sbjct: 428 STSLSGTTTPKKKNRVSMISVSSSHKRPVSFNKLSTAGKSDSAC-GTPGSSTKRMSISLS 486

Query: 450 ARKRMSALYGXXXXXXXXXXXXXXXXXXXXF-----LGNRPRDSVISMSHNKRASKSSKR 504
           + KR+SA+                            + N    ++ +    KRAS++SKR
Sbjct: 487 SSKRLSAMGPNTSPTPANKRMSVRDMDSSAPPVPMDVLNDYTSALPNRKATKRASRASKR 546

Query: 505 ISLVPNLKRQSVTTKLMATYAKLSEDDDWEYIERETKRTSSDFATLIDEIFEYEKYEQIR 564
           +S +PN+KR S+TTKL+ATYAKLSE+DDWEYIE+ETKRTS+DFATL D+IFE+EKYEQIR
Sbjct: 547 LSFLPNIKRGSITTKLIATYAKLSEEDDWEYIEKETKRTSADFATLCDQIFEHEKYEQIR 606

Query: 565 KEK 567
           KEK
Sbjct: 607 KEK 609

 Score =  261 bits (666), Expect = 4e-71,   Method: Compositional matrix adjust.
 Identities = 205/514 (39%), Positives = 268/514 (52%), Gaps = 93/514 (18%)

Query: 658  ILRNRKYSLQTRPVSRLDPGIGFIDKPRQSEQHVPETVNLEPELEETEQKILETIRRSKF 717
            +L+ R  SLQTRPVSRLDPGI  +           E   ++     TE+ ILETIRRS+F
Sbjct: 721  LLKRRTVSLQTRPVSRLDPGI--VAAENLGSVIYEEADGVDETTLRTEKTILETIRRSRF 778

Query: 718  LGSSFDIKKELENVKRH------RQTSQPIEKEMAPPAL------PETLPK---AVEKKN 762
            LGSSFDIKKELE  +R       RQ  Q I       +          LPK   AV+  N
Sbjct: 779  LGSSFDIKKELERAQRKKEEALARQHQQRILSSATAASATNDAYESRALPKNAAAVDTLN 838

Query: 763  VSMDPSLRKISDIKVPQFTRKSRHFSTSNRRLSVLSMYSTKESYSNLADILKNGPGEKEM 822
               +P  RKIS+IKVPQFTR+SRHF+ SN+RLSVLSMYSTK S++NLAD LK G   +E+
Sbjct: 839  DERNPEPRKISEIKVPQFTRRSRHFTASNKRLSVLSMYSTKSSFTNLADHLKGGADLQEV 898

Query: 823  IQTAP-TPKSADDSDQLFDTIDEAD---TPASVSREERLYEVAEESENELANKK----ID 874
              +AP T K   + + LF+++ E D   TP + + + RLYEV + SE+   + K    ++
Sbjct: 899  SGSAPSTTKITQEPEFLFESVHEEDSEETPDTTA-DSRLYEVPDGSESSKTSTKAAMRLN 957

Query: 875  IADLLNSE-GSNLKSVEEQEDSMKLPKLPPLFEDGSTK-------ETKEQSK-------- 918
             AD  N+  G N   V       KLP LPPL ++GS K       ++ E+ +        
Sbjct: 958  FADRFNTRAGDNPADV-------KLPPLPPLEKNGSKKPNGLGIYQSPERPRADPNPTSM 1010

Query: 919  -------SMIP---------------ENMQSSESQKQIEKNNSDEGGS-------LNPFM 949
                   SMIP               EN+ +S ++K   KN      +       LN  M
Sbjct: 1011 VHEPKVFSMIPDDIAGPAKSTKPAESENVPTSATKKSEPKNALHSADAPEASQPPLNGMM 1070

Query: 950  TKHRDVSDKGVTKEKPTVTMKTTSEQVSADKKRNMSFLRX-XXXXXXXXXDNVDVTLSTS 1008
             K+ D         KP   +       +A+KKRN SF R           DN D  L+TS
Sbjct: 1071 RKNND--------RKPLEDITP-----AAEKKRNRSFFRKFSRSSEEKKSDNFDAKLNTS 1117

Query: 1009 VSSKQLFSGLVNLLKGWTKYGLKGIAIDSTSQTITGKLANDNILSFRSTAFSILIF-SQE 1067
            V + Q+F+ L  LL GW  YGLK + +   ++TITGKL++DNILS RST F IL+     
Sbjct: 1118 VEAVQMFNALGKLLGGWKDYGLKEVRVQGPTKTITGKLSSDNILSLRSTMFEILVRDDSS 1177

Query: 1068 KGSAVTFRKVSGSGKAVRRLSDEVKKVLSKEGVL 1101
            KGS V F K SGS K  +RL  EV+KVL +E VL
Sbjct: 1178 KGSVVWFVKKSGSTKTFKRLVKEVEKVLERENVL 1211

>Ecym_1058 Chr1 (105835..109329) [3495 bp, 1164 aa] {ON} similar to
           Ashbya gossypii AFR696C
          Length = 1164

 Score =  670 bits (1728), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 333/574 (58%), Positives = 408/574 (71%), Gaps = 22/574 (3%)

Query: 1   MSAISSNTVSVIKNNQIGPWKLGETLGSGSTGKVLLASNETTKQQAAVKVISKAVFEAMN 60
           M    ++ V+ +K  +IGPW LGETLG GSTGKVL+A N  T Q AAVK+ISK++F A  
Sbjct: 1   MGTKDNSNVTSLKGGRIGPWMLGETLGVGSTGKVLMAQNVQTGQIAAVKIISKSIFNAQG 60

Query: 61  NSESNGDATNALPYNIEQEIIIMKLLNHPNVLRLFDVWETNSDLYLVLEYAEKGELFNML 120
           ++    +  + LPY IE+EI IMKLLNHPNVLRL+DVWET++DLY+VLEY EKGELFN+L
Sbjct: 61  STFVGSNDPDVLPYGIEREITIMKLLNHPNVLRLYDVWETSTDLYMVLEYVEKGELFNLL 120

Query: 121 VERGPLPENEAVRAFRQIIIGISYCHSLGVVHRDLKPEXXXXXXXXXXXXADFGMAALES 180
           +ERGPLPENEAVR FRQIIIGISYCH+LG+VHRDLKPE            ADFGMAALES
Sbjct: 121 IERGPLPENEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKLADFGMAALES 180

Query: 181 EDKLLETSCGSPHYAAPEIISGLPYEGFSSDVWSCGVILFALLTGRLPFDEEDGNIRNLL 240
           +DKLLETSCGSPHYAAPEI+SGLPY GF SDVWSCGVIL+ALLTGRLPFDE+DGNIR LL
Sbjct: 181 KDKLLETSCGSPHYAAPEIVSGLPYHGFESDVWSCGVILYALLTGRLPFDEDDGNIRKLL 240

Query: 241 LKVQKGEFEMPDDDEITKEAQDLLARLLTVDPSKRITIREILKHPLLQKYPSIKDSRSIR 300
           LKVQ GEFEMPD DEI+ EAQDL+A++LTVDPS RI  REILKHPLL+KYPSIKDS+SIR
Sbjct: 241 LKVQSGEFEMPDKDEISIEAQDLIAKILTVDPSGRIKTREILKHPLLKKYPSIKDSKSIR 300

Query: 301 NLPREDTYLSPLADTNSKIDDAILQNLVILWHGKDAREIAAKLREPGANTEKTLYALLYR 360
           NLPREDTYL+PL   +  +D  IL+NLV+LWHG+D  EI  KL E G N EKT YALL+R
Sbjct: 301 NLPREDTYLNPLDHNDGTVDRTILKNLVVLWHGRDENEIVMKLNEQGPNLEKTFYALLHR 360

Query: 361 FKCDTQRE-------ANRARRQSKIVQRNSTIRSTAPEXXXXXXXXXXXXXXXRASIIAS 413
           FK + +++       A R    S   QRN  I  ++                     ++S
Sbjct: 361 FKYENEQQQLKQQQIAKRISSASSSPQRN--IVKSSSRRSINQILVTPKKKRSSGINVSS 418

Query: 414 SSKRPVSVTKTATNITVNSSITGTPKSAKRMSMNNSARKRMSALYGXXXXXXXXXXXXXX 473
           + KRPVS+ K      +     G    +K+ S++N   +++SA+                
Sbjct: 419 AHKRPVSIQKWG---EIGGGNNGLISPSKKRSLSN---RKLSAILNTPSSSPSRKRMSIA 472

Query: 474 XXXXXXFLGNRPRDSVISMSHNKRASKSSKRISLVPNLKRQSVTTKLMATYAKLSEDDDW 533
                      P  + +   +NKRAS++SKR S +P++KRQS+T+K++ATYAKLSED+DW
Sbjct: 473 QDAP-------PMPTSVLRDYNKRASRNSKRFSFLPSIKRQSITSKIIATYAKLSEDNDW 525

Query: 534 EYIERETKRTSSDFATLIDEIFEYEKYEQIRKEK 567
           EYI++E KRTSSDFATLID IFE+EKYEQIR+EK
Sbjct: 526 EYIDKEAKRTSSDFATLIDNIFEHEKYEQIRREK 559

 Score =  184 bits (468), Expect = 9e-47,   Method: Compositional matrix adjust.
 Identities = 171/570 (30%), Positives = 265/570 (46%), Gaps = 115/570 (20%)

Query: 608  DIARQMDEEISNLKKEL----VGDQ-----DNEDKFRSVSEPLXXXXXXXX-----XXXX 653
            ++ R +++E++ L+ EL    V  Q      N+   RSVSEP                  
Sbjct: 630  ELQRSLEDEVAKLRAELEETRVEQQLNSMSKNQVARRSVSEPHKRHSSTSKRDSLLALQY 689

Query: 654  XXXGILRNRKYSLQTRPVSRLDPGIGFIDKPRQSEQHVPETVNLEPE--LEET----EQK 707
                +L  R  S+QTRP+SRLDPGI          Q V   ++ + E  L E     E+ 
Sbjct: 690  SINTVLNKRAVSVQTRPISRLDPGI--------MAQEVAHELDYDDEEILSERTLRREKT 741

Query: 708  ILETIRRSKFLGSSFDIKKELENVKRHRQTSQPIEKEMAPPALPETLPKAVEKKNVSMDP 767
            ILETIRRS FLGS FDI KEL+N K+ +       K++    LP+ +    +++ VS   
Sbjct: 742  ILETIRRSNFLGSQFDIHKELKNAKKEKIEKAKKRKQLNR-KLPDRISYH-DQRFVSDGT 799

Query: 768  SL----------------------------RKISDIKVPQFTRKSRHFSTSNRRLSVLSM 799
            ++                            +K+S++++P+ TR+SRH S S++R SVLSM
Sbjct: 800  TITSAHDGYDTTSLTRHTTVGVLRDDESEPKKLSEVRIPEVTRRSRHLSASSKRFSVLSM 859

Query: 800  YSTKESYSNLADILKNGPGEKEMIQTAPTPKSADDSDQLFDTIDEADTPASVSREERLYE 859
            YST  SY+NLAD +K+    K +  TA +  +         TID  +    +S  +  + 
Sbjct: 860  YSTMTSYTNLADFMKSDVQLKPLNDTASSKVTQQPEFMFESTIDNVE---RISSNDNSHI 916

Query: 860  VAEESENELA---------NKKIDIADLLNSEGSNLKSVEEQEDSMKLPKLPPL------ 904
             + E+ N             K +++ +L +++ +     EE    +KLP LPPL      
Sbjct: 917  SSMEAPNNTVIKLNYADRFYKPVEVIELDDTDNTQ-PDTEEDITKVKLPALPPLEKLNKS 975

Query: 905  ------FEDGSTKET-KEQSKSMIP------ENMQSSESQKQIEKNNSDEGGSLNPFMTK 951
                  ++  S +E  K   +S+ P      E+   +  QK    +   E G   P    
Sbjct: 976  PNGLGIYQHSSPREDFKHAVRSVTPNENKENEDPAGTTQQKAPLTSVGKELGIREPLT-- 1033

Query: 952  HRDVSDKGVTKEKPTVTMKTTSEQVSADKKRNMSFLRXXXXXXXXXXDNVDVTLSTSVSS 1011
              D++ +GV K++P+   K + E++  +                      D  L T+V++
Sbjct: 1034 --DLAQQGVPKKRPSFFRKFSKEKIKPE---------------------YDYQLDTTVNN 1070

Query: 1012 KQLFSGLVNLLKGWTKYGLKGIAIDSTSQTITGKLANDNILSFRSTAFSILIFSQEKGSA 1071
             ++F  L  LL GWT YGLK +    +   ITGKL++DNILS RSTAF +++     GS+
Sbjct: 1071 TKMFRALDKLLNGWTSYGLKQVRSSPSVSMITGKLSSDNILSLRSTAFQVVVAGSNHGSS 1130

Query: 1072 VTFRKVSGSGKAVRRLSDEVKKVLSKEGVL 1101
            V F K SGS K   RL +E++K+L KE VL
Sbjct: 1131 VRFTKKSGSKKTFARLVNEIEKILEKEKVL 1160

>TBLA0A07150 Chr1 (1776160..1780335) [4176 bp, 1391 aa] {ON}
           Anc_1.52 YDR507C
          Length = 1391

 Score =  615 bits (1587), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 303/482 (62%), Positives = 363/482 (75%), Gaps = 39/482 (8%)

Query: 12  IKNNQIGPWKLGETLGSGSTGKVLLASNETTKQQAAVKVISKAVF--EAMNNSESNGDAT 69
           +K N +GPWKLGETLG GSTGKV LA N +T QQAA+KVISKAVF  +  N S+S     
Sbjct: 12  VKGNTVGPWKLGETLGLGSTGKVQLAYNSSTGQQAAIKVISKAVFNNDNANASDSALLTP 71

Query: 70  NALPYNIEQEIIIMKLLNHPNVLRLFDVWETNSDLYLVLEYAEKGELFNMLVERGPLPEN 129
           ++LPY IE+EIIIMKLLNHPNVLRL+DVWET+S+LY+VLEYAEKGELFN+LVERGPLPEN
Sbjct: 72  DSLPYGIEREIIIMKLLNHPNVLRLYDVWETDSNLYMVLEYAEKGELFNLLVERGPLPEN 131

Query: 130 EAVRAFRQIIIGISYCHSLGVVHRDLKPEXXXXXXXXXXXXADFGMAALESEDKLLETSC 189
           EA+R FRQIIIGISYCH+LG+VHRDLKPE            ADFGMAALE+EDKLLETSC
Sbjct: 132 EAIRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEDKLLETSC 191

Query: 190 GSPHYAAPEIISGLPYEGFSSDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQKGEFE 249
           GSPHYAAPEIISGLPY G  +DVWSCG+ILFALLTGRLPFDEEDGNIRNLLLKVQ G+FE
Sbjct: 192 GSPHYAAPEIISGLPYHGLETDVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQSGQFE 251

Query: 250 MPDDDEITKEAQDLLARLLTVDPSKRITIREILKHPLLQKYPSIKDSRSIRNLPREDTYL 309
           MP +DEI++EAQDL++++LTVDP KRI  REILKHPL+QKYPSIKDS++IRNLPREDTYL
Sbjct: 252 MPGNDEISREAQDLISKILTVDPKKRIKTREILKHPLVQKYPSIKDSKTIRNLPREDTYL 311

Query: 310 SPLADTN---SKIDDAILQNLVILWHGKDAREIAAKLREPGANTEKTLYALLYRFKCDTQ 366
           +PL+D N    +ID  ILQNLV+LWHG+D++EI  KL+EPGAN EKTLYALL RFK DT+
Sbjct: 312 NPLSDDNGDVCEIDPKILQNLVVLWHGRDSKEITKKLKEPGANAEKTLYALLDRFKNDTE 371

Query: 367 REANRARRQSKIVQRNSTIRSTAPEXXXXXXXXXX----------XXXXXRASIIASSS- 415
           +E    +RQS++ +R S ++ T                            RAS+++ SS 
Sbjct: 372 KE---IKRQSQLKKRQSQVQQTHSHSNSNTSAYSHVSRGALVNTPTKRKNRASMVSVSSA 428

Query: 416 -KRPVSVTKTA----TNITVNSSITGTPK---------------SAKRMSMNNSARKRMS 455
            KRPVS  + +    +N  +N+ I GTP+               S+KRMS+N S+ KR+S
Sbjct: 429 HKRPVSFNRLSRADLSNHVINTGINGTPQRHSQIESSGTLQRNSSSKRMSINLSSNKRIS 488

Query: 456 AL 457
            L
Sbjct: 489 QL 490

 Score =  203 bits (516), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 152/411 (36%), Positives = 208/411 (50%), Gaps = 94/411 (22%)

Query: 497 RASKSSKRISLVPNLKRQSVTTKLMATYAKLSEDDDWEYIERETKRTSSDFATLIDEIFE 556
           RAS+S KR S+ PN++R S+TTKL++TYA+L+EDDDWE+IE+ETKR SS+FATLID IFE
Sbjct: 606 RASRSQKRKSVRPNMQRGSITTKLISTYAQLAEDDDWEFIEKETKRVSSNFATLIDNIFE 665

Query: 557 YEKYEQIRKEKAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDIARQMDEE 616
           +EKYEQIRKEK                                            ++++E
Sbjct: 666 HEKYEQIRKEKDELERKVRENKKREEEERLVREAIEKEKQI--------------ELEKE 711

Query: 617 ISNLKKELVGDQDN---------------EDKF-----------------RSVSEPLXXX 644
              L+KE+ GD DN                DK                  RSVS PL   
Sbjct: 712 RLQLQKEMEGDIDNAKETVQTTEGKREAHNDKIKTETDDEERDIIVDIQPRSVSAPLEKT 771

Query: 645 XXXXXXXXXXXXGILRNRKYSLQTRPVSRLDPGIGFID-------KPRQSEQHVPETVNL 697
                          + R +SL+TRPVSRLDPG+ +          P  S + +  T +L
Sbjct: 772 EKSRDSPFDYS----KQRNFSLRTRPVSRLDPGLMYSSGTGSSAYNPSHSTEDLHSTSSL 827

Query: 698 EPELEETEQKILETIRRSKFLGSSFDIKKELENVKR--------------HRQTSQPIEK 743
                +T++ ILETIRRSKFLGSSFD+KKELE V+               H +    + +
Sbjct: 828 --NRIDTQKVILETIRRSKFLGSSFDLKKELEMVEELESNRIKQQAFQDSHLEEMNDVTE 885

Query: 744 EMAPPAL----------------PETLPKAVEKKNVSM---DPSL--RKISDIKVPQFTR 782
           +++   +                 E LPK+   K  ++   D S+  R +S+IKVPQFTR
Sbjct: 886 DLSQHNVDTSNDRIVSTTNDRYETEILPKSHAGKTQTIGLNDSSVQPRTLSEIKVPQFTR 945

Query: 783 KSRHFSTSNRRLSVLSMYSTKESYSNLADILKNGPGEKEMIQTAPTPKSAD 833
           KS+ FS SN+RLSVLS+YS++ES++NL D+LK      E  + +PT KS +
Sbjct: 946 KSKFFSESNKRLSVLSLYSSRESFTNLVDMLKEDGINVEPTERSPTTKSQE 996

 Score = 98.6 bits (244), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 50/104 (48%), Positives = 69/104 (66%), Gaps = 1/104 (0%)

Query: 999  DNVDVTLSTSVSSKQLFSGLVNLLKGWTKYGLKGIAIDSTSQTITGKLANDNILSFRSTA 1058
            ++ D  L  +V++ Q+F GL  L +GW+KYGLK I     S   TGK++++NILSF+ST 
Sbjct: 1286 NDYDFQLKANVAAPQMFKGLDTLFRGWSKYGLKNIKSSPESLRFTGKVSSENILSFKSTV 1345

Query: 1059 FSILIFSQE-KGSAVTFRKVSGSGKAVRRLSDEVKKVLSKEGVL 1101
            F + I S   K   + F+K SGS K+VRRL +EV+ VL KEGVL
Sbjct: 1346 FELEIISNSVKTCLLRFKKTSGSSKSVRRLVNEVENVLRKEGVL 1389

>Kwal_33.13225 s33 (127676..130570) [2895 bp, 964 aa] {ON} YFR016C -
            Hypothetical ORF [contig 120] FULL
          Length = 964

 Score =  579 bits (1492), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 389/975 (39%), Positives = 533/975 (54%), Gaps = 100/975 (10%)

Query: 203  LPYEGFSSDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQKGEFEMPDDDEITKEAQD 262
            LPY GF SDVWSCG+ILFALLTGRLPFDEEDGNIRNLLLKVQ G+FEMPD DEI+ EAQD
Sbjct: 10   LPYHGFESDVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMPDSDEISPEAQD 69

Query: 263  LLARLLTVDPSKRITIREILKHPLLQKYPSIKDSRSIRNLPREDTYLSPLADTNSKIDDA 322
            L+A++LTVDP+ RI  REILKHPLLQKYPSIKDS+SIRNLPREDTYL+PL   N  ID++
Sbjct: 70   LIAKILTVDPAARIKSREILKHPLLQKYPSIKDSKSIRNLPREDTYLNPLDSVNGSIDES 129

Query: 323  ILQNLVILWHGKDAREIAAKLREPGANTEKTLYALLYRFKCDTQREANRARRQSK---IV 379
            I+ NLV+LWHG+D  EI A+L+EPGAN EKT YALL+RFK D+ +E  + +R+S+   I 
Sbjct: 130  IINNLVVLWHGRDRNEITAQLKEPGANLEKTFYALLFRFKHDSHQEQLKQQRRSQASHIS 189

Query: 380  QRNSTIRSTAPEXXXXXXXXXXXXXXXRASIIASSS--KRPVSVTKTATNITVNSSITGT 437
             + S +R++                  +A +I++SS  KRPVS  + + N   N++ T  
Sbjct: 190  PKRSNMRNSV---SRRSITNVTPKKKNKAPVISASSSHKRPVSFNRLSFNNGSNTAHTPP 246

Query: 438  PKSAKRMSMNNSARKRMSALYGXXXXXXXXXXXXXXXXXXXXFLGNRPRDSVISMSHN-- 495
              ++KR S+N S+ KR+SAL                           P D +   + +  
Sbjct: 247  TSASKRASVNLSSNKRISALINPNNSPTPVHKRSSMRDLDAS-APPIPMDMLKDYNKSAP 305

Query: 496  ---KRASKSSKRISLVPNLKRQSVTTKLMATYAKLSEDDDWEYIERETKRTSSDFATLID 552
               +R+++ SKR+S +P  KR S+TTKL+ATYAK+S+D+DWEYIE+ET+RTS+DFATL D
Sbjct: 306  KVSRRSTRLSKRLSFLPGNKRGSITTKLIATYAKISKDNDWEYIEKETRRTSADFATLCD 365

Query: 553  EIFEY--------EKYEQIRKEKAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 604
            EIFE+        EK E  R+ +                                     
Sbjct: 366  EIFEHEKYEQIRKEKEELERRVREAKEQEELERRQREEEERLQREMELQHQMRLEEESRR 425

Query: 605  XXXDIARQMDEEISNLKKEL--VGDQDNEDKFRSVSEPLXXXXXXXXXXXXXX-----XG 657
               +    +++EI+ LK+ +   G  D+ +  RSVS P                      
Sbjct: 426  RQRETQELIEQEIALLKQSVNPQGPSDS-NHVRSVSAPAESVLKVDKRGSTGNLDNDIMA 484

Query: 658  ILRNRKYSLQTRPVSRLDPGIGFIDKPRQSEQHVPETVNLEPELEETEQKILETIRRSKF 717
            +L  R +SL+TRP SRLDPGI        SE+    + N   +L  TE+ ILETIRRSKF
Sbjct: 485  LLNRRTFSLETRPKSRLDPGI------YTSEEEDFGSKNHGADLS-TEKTILETIRRSKF 537

Query: 718  LGSSFDIKKELENVKRHRQTSQPI-----EKEMAPPAL----------PETLPKAVEKKN 762
            LGSSFDI KEL   +R ++    +     E+ +A  A            +TLPK      
Sbjct: 538  LGSSFDINKELARERRLKEERAALAKRKDEERVASNATTANVVGNGYESQTLPKRKMGSA 597

Query: 763  VSMDPSLRKISDIKVPQFTRKSRHFSTSNRRLSVLSMYSTKESYSNLADILKNGPGEKEM 822
            +      RKIS+++VPQFTR+SRHF+ SN+RLSVLSMYSTK S++NLAD LK G  + ++
Sbjct: 598  MEASSEPRKISEVEVPQFTRRSRHFTASNKRLSVLSMYSTKTSFTNLADHLK-GKADVQL 656

Query: 823  IQTAPTPKSADDSDQ--LFDTID-EADTPASVSREERLYEVAE--ESENELANKKIDIAD 877
            IQT+P   S  D +   +F+++D E    A  S + RLYEVAE  +++N     K++ AD
Sbjct: 657  IQTSPPSASKMDQEAEFMFESVDKEGKETADTSADSRLYEVAETKDAKNAKPAVKLNFAD 716

Query: 878  LLNSEGSNLKSVEEQEDSMKLPKLPPLFED--------GSTKETKEQS--------KSMI 921
              N   S      +   ++KLP LPPL ++        G  + T E S        KSM+
Sbjct: 717  RFNRPTSPPSQDTDSSAAIKLPALPPLDKNKPNMVSGLGLYQATAEPSHEDAQPVAKSMV 776

Query: 922  PENMQS---SESQKQIEKNNSDEGGS----------LNPFMTKHRDVSDKGVTKEKPTVT 968
             ++++S   +E +  + +       S          LN  M K+ D   K ++   P V 
Sbjct: 777  IDDVESEITTEPRNTVTETEEAAKNSTVVPTAPVAPLNNVMKKNTDADRKPLSDITPAV- 835

Query: 969  MKTTSEQVSADKKRNMSFLR--XXXXXXXXXXDNVDVTLSTSVSSKQLFSGLVNLLKGWT 1026
                      +KK N SF R             + D    T +   Q+F+ L  LL  W 
Sbjct: 836  ----------EKKANKSFFRKFSSKGSDEKKSGDYDFRFKTVIEETQMFNALSKLLAAWK 885

Query: 1027 KYGLKGIAIDSTSQTITGKLANDNILSFRSTAFSILIFSQEKGSAVTFRKVSGSGKAVRR 1086
             YGLK +    + + I GKL++DNILS RST F I +  + +GS V F K SGS K  ++
Sbjct: 886  DYGLKDVIASPSLKQIRGKLSSDNILSLRSTLFIITVVGRGEGSYVEFTKKSGSNKTFKK 945

Query: 1087 LSDEVKKVLSKEGVL 1101
            L  E++K+L  +  L
Sbjct: 946  LVKEIEKILESKKAL 960

>YCL024W Chr3 (79162..82275) [3114 bp, 1037 aa] {ON}  KCC4Protein
           kinase of the bud neck involved in the septin
           checkpoint, associates with septin proteins, negatively
           regulates Swe1p by phosphorylation, shows structural
           homology to bud neck kinases Gin4p and Hsl1p
          Length = 1037

 Score =  540 bits (1390), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 251/372 (67%), Positives = 307/372 (82%), Gaps = 8/372 (2%)

Query: 1   MSAISSNTVSVIK-NNQIGPWKLGETLGSGSTGKVLLASNETTKQQAAVKVISKAVFEAM 59
           M+  ++ T S  K ++ IGPWKLGETLG GSTGKV LA +E T  + AVKVISK++F   
Sbjct: 1   MTVANTETHSAAKPSSTIGPWKLGETLGFGSTGKVQLAQHERTGHRTAVKVISKSIFNN- 59

Query: 60  NNSESNGDATNALPYNIEQEIIIMKLLNHPNVLRLFDVWETNSDLYLVLEYAEKGELFNM 119
           N + SN D+   LPYNIE+EI+IMKLL+HPNVL L+DVWETN++LYL+LEYAEKGELFN+
Sbjct: 60  NGNHSNDDS--VLPYNIEREIVIMKLLSHPNVLSLYDVWETNNNLYLILEYAEKGELFNL 117

Query: 120 LVERGPLPENEAVRAFRQIIIGISYCHSLGVVHRDLKPEXXXXXXXXXXXXADFGMAALE 179
           LV+ GPLPE EA+  FRQIIIGISYCH+LG+VHRDLKPE            ADFGMAAL+
Sbjct: 118 LVDHGPLPEREAINCFRQIIIGISYCHALGIVHRDLKPENLLLDSFYNIKIADFGMAALQ 177

Query: 180 SEDKLLETSCGSPHYAAPEIISGLPYEGFSSDVWSCGVILFALLTGRLPFDEEDGNIRNL 239
           ++  LLETSCGSPHYAAPEI+SGLPYEGF+SDVWSCGVILFALLTGRLPFDEE+GN+R+L
Sbjct: 178 TDADLLETSCGSPHYAAPEIVSGLPYEGFASDVWSCGVILFALLTGRLPFDEENGNVRDL 237

Query: 240 LLKVQKGEFEMPDDDEITKEAQDLLARLLTVDPSKRITIREILKHPLLQKYPSIKDSRSI 299
           LLKVQKG+FEMP+D EI+++AQDL+ ++L VDP +RI IR+IL HPLL+KY +IKDS+SI
Sbjct: 238 LLKVQKGQFEMPNDTEISRDAQDLIGKILVVDPRQRIKIRDILSHPLLKKYQTIKDSKSI 297

Query: 300 RNLPREDTYLSPLADTN----SKIDDAILQNLVILWHGKDAREIAAKLREPGANTEKTLY 355
           ++LPRE+TYL PLAD+N    + IDD+ILQNLV+LWHG+ A +I +KL+E G N EK LY
Sbjct: 298 KDLPRENTYLYPLADSNNHTSASIDDSILQNLVVLWHGRHADDIVSKLKENGTNKEKILY 357

Query: 356 ALLYRFKCDTQR 367
           ALLYRFK D+ R
Sbjct: 358 ALLYRFKLDSVR 369

 Score =  218 bits (556), Expect = 9e-58,   Method: Compositional matrix adjust.
 Identities = 198/634 (31%), Positives = 301/634 (47%), Gaps = 95/634 (14%)

Query: 495  NKRASK--SSKRISLVPNLKRQSVTTKLMATYAKLSEDDDWEYIERETKRTSSDFATLID 552
            +KR SK  SSKR+S +PN KR S+T+K ++ +  L +DDDWEYIE++ KRTSS+FATLID
Sbjct: 470  HKRNSKKRSSKRLSYMPNTKRSSLTSKSLSNFTNLIDDDDWEYIEKDAKRTSSNFATLID 529

Query: 553  EIFEYEKYEQIRKEKAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDIARQ 612
            EIFE EK+E  ++EKA                                           +
Sbjct: 530  EIFEPEKFELAKREKAELQRKVQEAKRQSVNAQKINED---------------------E 568

Query: 613  MDEEISNLKKELVGDQDNEDKFRSVSEPLXXXXXXXXXXXXXXXGILRNR-KYSLQTRPV 671
               E+S+  KEL    D       VS PL                +L NR + S  TRP+
Sbjct: 569  FGSEVSDGMKELKKIND------KVSSPLINYEFSQQELLQDIDTLLTNRYQLSSYTRPI 622

Query: 672  SRLDPGIGFIDKPRQSEQHVPETV--NLEPE---LEETEQKILETIRRSKFLGSSFDIKK 726
            SRLDPG+            V ET+  NL+ +   L++TE+KI+ETIRRSKFLGS  +++ 
Sbjct: 623  SRLDPGL----------TPVTETLPNNLKEKTALLQDTEKKIIETIRRSKFLGSLLNVRG 672

Query: 727  ELENVKRHRQTSQPIEKEMAPPALPETLPKAVEKKNVSMDPSLRKISDIKVPQFTRKSRH 786
             L           P + E+AP      +       N  M+P  R+ISD++VP FTRKS+H
Sbjct: 673  GL----------SPGKSELAPIEESPIVSTTPLIYNDRMEP--RRISDVEVPHFTRKSKH 720

Query: 787  FSTSNRRLSVLSMYSTKESYSNL--------ADILKNGPGEKEMIQTAP-TPKSADDSDQ 837
            F+T+N R SVLS+Y+ K+S  +L         D+   G  + E     P   +S  DS  
Sbjct: 721  FTTANNRRSVLSLYA-KDSIKDLNEFLIKEDPDLPPQGSTDNESRSEDPEIAESITDSRN 779

Query: 838  LFDTIDEADTPASVSREERLYEVAEESENELANKKIDIADLLNSEGSNLKSVEEQEDSMK 897
            +    D++    +V+ +  L +  +       +++ D+ D    +  N   + +  +   
Sbjct: 780  IQYDEDDSKDGDNVNNDNILSDFPQGVG---ISQEYDMKD----KNPNQSPISKSAEPTL 832

Query: 898  LPKLPPLFEDGSTKETKEQSKSMIPENMQSSESQKQIEKNNSDEGGSLNPFMTKHRDVSD 957
            + KLP L    S+ + K  S   + +   S  +   +  NNS  G ++        D ++
Sbjct: 833  VVKLPSL----SSFQGKNASGLGLYQREPSKVTLPSLTSNNSSVGENI-------EDGAE 881

Query: 958  KGVTKEKPTVTMKTTSEQVSADKKRNMSF---------LRXXXXXXXXXXDNVDVTLSTS 1008
            KG   EK   ++     +   DKK N +                        +++ +   
Sbjct: 882  KGTESEKIAASLSDDDLKEDNDKKDNDTVNAPTTVKKPPNSVLLKKFSKGKILELEIHAK 941

Query: 1009 VSSKQLFSGLVNLLKGWTKYGLKGIAIDSTSQTITGKLANDNILSFRSTAFSILIFSQEK 1068
            +  K+L+ GL  LL+GW +YGLK +  + T+  ITGKL ND+IL  RST F I++     
Sbjct: 942  IPEKRLYEGLHKLLEGWKQYGLKNLVFNITNMIITGKLVNDSILFLRSTLFEIMVLPNGD 1001

Query: 1069 G-SAVTFRKVSGSGKAVRRLSDEVKKVLSKEGVL 1101
            G S + F K +GS K + +L+ E++ +L KEGVL
Sbjct: 1002 GRSLIKFNKKTGSTKTLTKLATEIQIILQKEGVL 1035

>SAKL0E02860g Chr5 complement(228726..232859) [4134 bp, 1377 aa]
           {ON} similar to uniprot|Q75DQ1 Ashbya gossypii ABL034W
           ABL034Wp and weakly similar to YKL101W uniprot|P34244
           Saccharomyces cerevisiae YKL101W HSL1 Nim1p-related
           protein kinase that regulates the morphogenesis and
           septin checkpoints associates with the assembled septin
           filament required along with Hsl7p for bud neck
           recruitment phosphorylation and degradation of Swe1p
          Length = 1377

 Score =  383 bits (984), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 199/397 (50%), Positives = 265/397 (66%), Gaps = 29/397 (7%)

Query: 2   SAISSNTVSVIKNNQ--IGPWKLGETLGSGSTGKVLLASNETTKQQAAVKVISKAVFEAM 59
           SA ++NT S  + ++  +GPWKLG+TLG GS+G+V LA N  T + AA+K++ K V  + 
Sbjct: 41  SASTTNTKSSKRKSRDTVGPWKLGKTLGKGSSGRVRLAKNMETGKLAAIKIVPKKVVRST 100

Query: 60  NNSESNGDATNALPYNIEQEIIIMKLLNHPNVLRLFDVWETNSDLYLVLEYAEKGELFNM 119
           N S+ +  A   LPY IE+EIIIMKL++HPN++ L++VWE  S+L+LVLEY E GELF+ 
Sbjct: 101 NASKKSNAANGNLPYGIEREIIIMKLISHPNIMALYEVWENKSELFLVLEYVEGGELFDY 160

Query: 120 LVERGPLPENEAVRAFRQIIIGISYCHSLGVVHRDLKPEXXXX-XXXXXXXXADFGMAAL 178
           LV +G LPE EAV  FRQII G++YCH+  + HRDLKPE             ADFGMAAL
Sbjct: 161 LVSKGKLPEQEAVHYFRQIIQGVAYCHNYNICHRDLKPENLLVDKKNHQIKIADFGMAAL 220

Query: 179 ESEDKLLETSCGSPHYAAPEIISGLPYEGFSSDVWSCGVILFALLTGRLPFDEEDGNIRN 238
           E+ +KLLETSCGSPHYA+PEI+ G  Y G  SDVWSCG+ILFALLTG LPF+  D NI+ 
Sbjct: 221 ETTNKLLETSCGSPHYASPEIVMGKNYHGSPSDVWSCGIILFALLTGHLPFN--DDNIKK 278

Query: 239 LLLKVQKGEFEMPDDDEITKEAQDLLARLLTVDPSKRITIREILKHPLLQKYPSIKDSRS 298
           LLLKVQ G++ MP +  I+ EAQDL++++L VDP  RITI E+L+HPL+ KY     +RS
Sbjct: 279 LLLKVQSGKYHMPQN--ISSEAQDLISKILIVDPRGRITINEVLQHPLITKY---DKARS 333

Query: 299 IRNLPREDTYL---SP-LADTNSK--IDDAILQNLVILWHGKDAREIAAKLREPGANTEK 352
             N    D +L   +P L    SK  ID +IL NL ILWHG  +  I A+L + G   EK
Sbjct: 334 KSN---SDLHLLSRTPQLVTLQSKEDIDGSILGNLQILWHGAPSEYIVARLLQHGFTEEK 390

Query: 353 TLYALLYRFKCDTQREANRARRQSKIVQRNSTIRSTA 389
             Y+LL++++           RQ+  V+ +S + +T 
Sbjct: 391 LFYSLLWQYQ----------ERQNPSVENDSFVETTV 417

>Ecym_7392 Chr7 complement(803240..807544) [4305 bp, 1434 aa] {ON}
           similar to Ashbya gossypii ABL034W
          Length = 1434

 Score =  381 bits (978), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 191/372 (51%), Positives = 251/372 (67%), Gaps = 23/372 (6%)

Query: 1   MSAISSNTVSVIKNNQ------IGPWKLGETLGSGSTGKVLLASNETTKQQAAVKVISKA 54
           +S IS+ + +V K  +      +GPWKLG+TLG GS+G+V LA N  T + AA+K++ K 
Sbjct: 39  LSQISNASTTVRKTGKKKNRDTVGPWKLGKTLGKGSSGRVRLAKNMETGKLAAIKIVPK- 97

Query: 55  VFEAMNNSESNGDATNALPYNIEQEIIIMKLLNHPNVLRLFDVWETNSDLYLVLEYAEKG 114
                 N   N     +LPY IE+EIIIMKL++HPNV+ L++VWE   +LYLVLEY E G
Sbjct: 98  -----RNVRHNNTQLTSLPYGIEREIIIMKLISHPNVMALYEVWENKPELYLVLEYVEGG 152

Query: 115 ELFNMLVERGPLPENEAVRAFRQIIIGISYCHSLGVVHRDLKPEXXXX-XXXXXXXXADF 173
           ELF+ L+ RG LPE EAV  F+QI+ G+SYCH   + HRDLKPE             ADF
Sbjct: 153 ELFDYLISRGKLPEQEAVHYFKQIVQGVSYCHHFNICHRDLKPENLLLDKKNLSVKIADF 212

Query: 174 GMAALESEDKLLETSCGSPHYAAPEIISGLPYEGFSSDVWSCGVILFALLTGRLPFDEED 233
           GMAALE+ DKLLETSCGSPHYA+PEI+ G  Y G  SDVWSCG+ILFALLTG LPF+  D
Sbjct: 213 GMAALETTDKLLETSCGSPHYASPEIVMGQKYHGSPSDVWSCGIILFALLTGHLPFN--D 270

Query: 234 GNIRNLLLKVQKGEFEMPDDDEITKEAQDLLARLLTVDPSKRITIREILKHPLLQKYPSI 293
            N++ LLLKVQ G+++MP +  I+ EA+DL+A++L VDP+ RITI E+L+HPLL KY   
Sbjct: 271 DNVKKLLLKVQSGKYQMPQN--ISNEAKDLIAKILIVDPAMRITIDEVLEHPLLLKYQKT 328

Query: 294 KDSRSIRNLPREDTYLSP---LADTNSKIDDAILQNLVILWHGKDAREIAAKLREPGANT 350
           + S+S  NL   D+  +P   + ++  KID++IL NL ILWHG     +  KL + G   
Sbjct: 329 R-SKSSSNLHALDS--TPNIVVLESEDKIDESILSNLQILWHGAPKEYLTGKLLQQGFTE 385

Query: 351 EKTLYALLYRFK 362
           EK  Y+LL R++
Sbjct: 386 EKLFYSLLLRYQ 397

>KLTH0D05566g Chr4 (498055..501441) [3387 bp, 1128 aa] {ON} weakly
           similar to uniprot|P34244 Saccharomyces cerevisiae
           YKL101W HSL1 Nim1p-related protein kinase that regulates
           the morphogenesis and septin checkpoints associates with
           the assembled septin filament required along with Hsl7p
           for bud neck recruitment phosphorylation and degradation
           of Swe1p
          Length = 1128

 Score =  368 bits (945), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 188/350 (53%), Positives = 235/350 (67%), Gaps = 20/350 (5%)

Query: 17  IGPWKLGETLGSGSTGKVLLASNETTKQQAAVKVISKAVFEAMNNSESNGDATNALPYNI 76
           IGPWKLG+TLG GS+G+V LA N  T + AAVK++ K          +     NALPY I
Sbjct: 55  IGPWKLGKTLGKGSSGRVRLAKNMETGKLAAVKIVPK----------TKSSRPNALPYGI 104

Query: 77  EQEIIIMKLLNHPNVLRLFDVWETNSDLYLVLEYAEKGELFNMLVERGPLPENEAVRAFR 136
           E+EIIIMKL++HPNV+ L++VWE   +L+LVLEY + GELF+ LV RG L E EA+  FR
Sbjct: 105 EREIIIMKLISHPNVMGLYEVWENKLELFLVLEYVDGGELFDYLVSRGRLSEKEAIHYFR 164

Query: 137 QIIIGISYCHSLGVVHRDLKPEX-XXXXXXXXXXXADFGMAALESEDKLLETSCGSPHYA 195
           QII G +YCHS  + HRDLKPE             ADFGMAAL++ +KLLETSCGSPHYA
Sbjct: 165 QIIEGTAYCHSFNICHRDLKPENLLLDKKNKRIKIADFGMAALQTSNKLLETSCGSPHYA 224

Query: 196 APEIISGLPYEGFSSDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQKGEFEMPDDDE 255
           +PEI+ G  Y G  SDVWSCG+ILFALLTG LPF+  D NI+ LLLKVQ G+++MP    
Sbjct: 225 SPEIVMGKTYNGGPSDVWSCGIILFALLTGHLPFN--DDNIKRLLLKVQAGKYQMP--QA 280

Query: 256 ITKEAQDLLARLLTVDPSKRITIREILKHPLLQKYPSIKDSRSIRNLPREDTYLSPLADT 315
           I+ EAQDL++R+L VDP+KRITI +IL HPL+ KY   K S+S  +L    ++ SP   T
Sbjct: 281 ISLEAQDLISRILVVDPNKRITINDILSHPLITKY-DYKRSKSNSDL-HILSHTSPQICT 338

Query: 316 ---NSKIDDAILQNLVILWHGKDAREIAAKLREPGANTEKTLYALLYRFK 362
                 +D  ILQNL ILWHG     I  +L EP    EKT Y+LL  ++
Sbjct: 339 IRSERDVDPTILQNLQILWHGAPKDYIMKRLLEPELTEEKTFYSLLLAYQ 388

>ABL034W Chr2 (333432..337709) [4278 bp, 1425 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YKL101W (HSL1)
          Length = 1425

 Score =  372 bits (956), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 182/350 (52%), Positives = 236/350 (67%), Gaps = 16/350 (4%)

Query: 17  IGPWKLGETLGSGSTGKVLLASNETTKQQAAVKVISKAVFEAMNNSESNGDATNALPYNI 76
           +GPWKLG+TLG GS+G+V LA N  + + AA+K++ K       N   N     ALPY I
Sbjct: 58  VGPWKLGKTLGKGSSGRVRLAKNMQSGKLAAIKIVPK------RNVRHNQKQVTALPYGI 111

Query: 77  EQEIIIMKLLNHPNVLRLFDVWETNSDLYLVLEYAEKGELFNMLVERGPLPENEAVRAFR 136
           E+EIIIMKL+ HPN++ L++VWE  S+LYLVLEY E GELF+ L+ RG LPE EA+  F+
Sbjct: 112 EREIIIMKLITHPNIMALYEVWENKSELYLVLEYVEGGELFDYLIARGKLPEQEAIHYFK 171

Query: 137 QIIIGISYCHSLGVVHRDLKPEX-XXXXXXXXXXXADFGMAALESEDKLLETSCGSPHYA 195
           QI+ G+SYCH+  + HRDLKPE             ADFGMAALE+ ++LLETSCGSPHYA
Sbjct: 172 QIVQGVSYCHNFNICHRDLKPENLLLDKKNKTVKIADFGMAALETTNRLLETSCGSPHYA 231

Query: 196 APEIISGLPYEGFSSDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQKGEFEMPDDDE 255
           +PEI+ G  Y G  SDVWSCG+ILFALLTG LPF+  D N+R LLLKVQ G ++MP +  
Sbjct: 232 SPEIVMGQKYHGSPSDVWSCGIILFALLTGHLPFN--DDNVRKLLLKVQHGRYQMPSN-- 287

Query: 256 ITKEAQDLLARLLTVDPSKRITIREILKHPLLQKYPSIKDSRSIRNLPREDTYLSP-LAD 314
           ++KEA+DL++++L VDP KRIT+ +IL+HPLL KY +    +     P E     P + D
Sbjct: 288 VSKEAKDLISKILVVDPEKRITVDKILEHPLLVKYDN--PGKGGLACPLEKPEERPKVLD 345

Query: 315 TNS--KIDDAILQNLVILWHGKDAREIAAKLREPGANTEKTLYALLYRFK 362
            +S   ID+ IL NL ILWHG     +  KL + G   EK  YALL R++
Sbjct: 346 IHSIDDIDETILSNLQILWHGAPKEYLVDKLLQSGFTEEKLFYALLLRYQ 395

>KLLA0F13552g Chr6 complement(1252906..1256709) [3804 bp, 1267 aa]
           {ON} weakly similar to uniprot|P34244 Saccharomyces
           cerevisiae YKL101W HSL1 Nim1p-related protein kinase
           that regulates the morphogenesis and septin checkpoints
           associates with the assembled septin filament required
           along with Hsl7p for bud neck recruitment
           phosphorylation and degradation of Swe1p
          Length = 1267

 Score =  367 bits (942), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 177/355 (49%), Positives = 241/355 (67%), Gaps = 18/355 (5%)

Query: 17  IGPWKLGETLGSGSTGKVLLASNETTKQQAAVKVISKAVFEAMNNSESNGDATNALPYNI 76
           +GPWKLG+TLG GS+G+V LA N  T + +A+K++ K   ++        +    LPY I
Sbjct: 70  VGPWKLGKTLGKGSSGRVRLAKNMETGKLSAIKIVPKKFVKS--------NQIKQLPYGI 121

Query: 77  EQEIIIMKLLNHPNVLRLFDVWETNSDLYLVLEYAEKGELFNMLVERGPLPENEAVRAFR 136
           E+EIIIMKL++HPNV+ L++VWE  S+LYLVLEY E GELF+ LV +G LPE+EA+  F+
Sbjct: 122 EREIIIMKLISHPNVMGLYEVWENKSELYLVLEYVEGGELFDYLVSKGKLPESEAIHYFK 181

Query: 137 QIIIGISYCHSLGVVHRDLKPEXXXXXXXXXX-XXADFGMAALESEDKLLETSCGSPHYA 195
           QI+  ++YCH   + HRDLKPE             ADFGMAALE+ DKLLETSCGSPHYA
Sbjct: 182 QIVQAVAYCHGFNICHRDLKPENLLLDKKKRSIKIADFGMAALETSDKLLETSCGSPHYA 241

Query: 196 APEIISGLPYEGFSSDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQKGEFEMPDDDE 255
           +PEI+ G  Y G  SDVWSCG+ILFALLTG LPF+  D N++ LLLKVQ G+++MP    
Sbjct: 242 SPEIVLGRKYHGSPSDVWSCGIILFALLTGHLPFN--DDNVKKLLLKVQSGKYQMP--QW 297

Query: 256 ITKEAQDLLARLLTVDPSKRITIREILKHPLLQKYPSIKDSRS---IRNLPREDTYLSPL 312
           ++ EA+DL++R+L VDP++RITI +IL+H LL KY     S+S   +  L R    +S  
Sbjct: 298 LSVEAKDLISRILVVDPNRRITIDQILQHELLTKYDQKSRSKSNSDLNLLNRTPNIVSFS 357

Query: 313 ADTNSKIDDAILQNLVILWHGKDAREIAAKLREPGANTEKTLYALLYRFKCDTQR 367
           ++ +  ID+ IL NL ILWHG   + +  +L +PG   EK  Y+LL+ ++   Q+
Sbjct: 358 SERD--IDETILSNLQILWHGAARKHLVTRLMKPGFTEEKMFYSLLWNYQEKQQK 410

>Kwal_26.7788 s26 (511530..515333) [3804 bp, 1267 aa] {ON} YKL101W
           (HSL1) - Putative protein kinase homologous to S. pombe
           cdr1/nim1 [contig 55] FULL
          Length = 1267

 Score =  365 bits (936), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 187/371 (50%), Positives = 241/371 (64%), Gaps = 20/371 (5%)

Query: 17  IGPWKLGETLGSGSTGKVLLASNETTKQQAAVKVISKAVFEAMNNSESNGDATNALPYNI 76
           IGPWKLG+TLG GS+G+V LA N  T + AA+K++ K          +    T +LPY I
Sbjct: 55  IGPWKLGKTLGKGSSGRVRLAKNMETGKLAAIKIVPK----------TKSSRTGSLPYGI 104

Query: 77  EQEIIIMKLLNHPNVLRLFDVWETNSDLYLVLEYAEKGELFNMLVERGPLPENEAVRAFR 136
           E+EIIIMKL++HPNV+ L++VWE   +L+LVLEY + GELF+ LV RG LPE EA+  FR
Sbjct: 105 EREIIIMKLISHPNVMGLYEVWENKLELFLVLEYVDGGELFDYLVSRGRLPEKEAIHYFR 164

Query: 137 QIIIGISYCHSLGVVHRDLKPEXXXXXXXXXX-XXADFGMAALESEDKLLETSCGSPHYA 195
           QII G +YCH   + HRDLKPE             ADFGMAAL++ +KLLETSCGSPHYA
Sbjct: 165 QIIEGTAYCHGFNICHRDLKPENLLLDKKNKRIKIADFGMAALQTSNKLLETSCGSPHYA 224

Query: 196 APEIISGLPYEGFSSDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQKGEFEMPDDDE 255
           +PEI+ G  Y G  SDVWSCG+ILFALLTG LPF+  D NI+ LLLKVQ G+++MP    
Sbjct: 225 SPEIVMGKNYNGGPSDVWSCGIILFALLTGHLPFN--DDNIKRLLLKVQAGKYQMP--QS 280

Query: 256 ITKEAQDLLARLLTVDPSKRITIREILKHPLLQKYPS--IKDSRSIRNLPREDTYLSPLA 313
           ++  AQDL++R+L VDP KRI+I EIL HPLL KY +   K +  +  L      +S + 
Sbjct: 281 VSSGAQDLISRILVVDPDKRISINEILAHPLLAKYGNKRSKSNSDLHILSHSKPQISTI- 339

Query: 314 DTNSKIDDAILQNLVILWHGKDAREIAAKLREPGANTEKTLYALL--YRFKCDTQREANR 371
            + S +D  ILQNL ILWHG     I   L +P    EKT Y+LL  Y+ +   Q+E   
Sbjct: 340 KSESDVDPTILQNLQILWHGAPKESILKGLLKPELTEEKTFYSLLLAYQQRQSKQKEKPP 399

Query: 372 ARRQSKIVQRN 382
                KI+Q++
Sbjct: 400 PINAPKILQKS 410

>TDEL0A02550 Chr1 (457841..461950) [4110 bp, 1369 aa] {ON} Anc_2.479
           YKL101W
          Length = 1369

 Score =  364 bits (935), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 187/390 (47%), Positives = 246/390 (63%), Gaps = 48/390 (12%)

Query: 17  IGPWKLGETLGSGSTGKVLLASNETTKQQAAVKVISK----------------------- 53
           +GPWKLG+TLG GS+G+V LA N  T Q AA+K++ K                       
Sbjct: 76  VGPWKLGKTLGKGSSGRVRLAKNMETGQLAAIKIVPKKNNVLGKNDACSTSSASYTSNSS 135

Query: 54  ----AVFEAMNNSESNGDATNAL-PYNIEQEIIIMKLLNHPNVLRLFDVWETNSDLYLVL 108
                +    NN  + G +  A  PY IE+EI+IMKL++H NVL L++VWE  S+LYLVL
Sbjct: 136 QTSTMMNTTANNYTTAGHSNVATNPYGIEREIVIMKLISHANVLGLYEVWENKSELYLVL 195

Query: 109 EYAEKGELFNMLVERGPLPENEAVRAFRQIIIGISYCHSLGVVHRDLKPEXXXXXXXXXX 168
           EY + GELF+ LV RG L E EAV  F+QII G+SYCH+  + HRDLKPE          
Sbjct: 196 EYVDGGELFDYLVSRGRLCEREAVHYFKQIIQGVSYCHAFNICHRDLKPENLLLDKKNST 255

Query: 169 -XXADFGMAALESEDKLLETSCGSPHYAAPEIISGLPYEGFSSDVWSCGVILFALLTGRL 227
              ADFGMAALE  +KLL+TSCGSPHYA+PEI+ G  Y G  SDVWSCG+ILFALLTG L
Sbjct: 256 IKIADFGMAALEVSNKLLQTSCGSPHYASPEIVMGKQYHGGPSDVWSCGIILFALLTGHL 315

Query: 228 PFDEEDGNIRNLLLKVQKGEFEMPDDDEITKEAQDLLARLLTVDPSKRITIREILKHPLL 287
           PF+  D +I+ LLLKVQ G+++MP +  ++KEAQDL+A++LTV+P+KR+T  EIL+HPL+
Sbjct: 316 PFN--DDSIKKLLLKVQSGKYQMPQN--LSKEAQDLIAKILTVNPAKRLTTEEILRHPLI 371

Query: 288 QKYPSIKDSRSIRNLPRE-------------DTYLSPLADTNSK--IDDAILQNLVILWH 332
            KY S+  ++  + L +              + Y +   + NS+  IDD IL NL ILWH
Sbjct: 372 VKYDSMMKTKKYKALYKNMGQGKSNADLHLLNNYEATTINLNSRKDIDDTILNNLQILWH 431

Query: 333 GKDAREIAAKLREPGANTEKTLYALLYRFK 362
           G     I AKL +P  + EK  Y+LL ++K
Sbjct: 432 GASRELIVAKLLQPRMSEEKVFYSLLLKYK 461

>YKL101W Chr11 (248920..253476) [4557 bp, 1518 aa] {ON}
           HSL1Nim1p-related protein kinase that regulates the
           morphogenesis and septin checkpoints; associates with
           the assembled septin filament; required along with Hsl7p
           for bud neck recruitment, phosphorylation, and
           degradation of Swe1p
          Length = 1518

 Score =  365 bits (936), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 187/389 (48%), Positives = 251/389 (64%), Gaps = 49/389 (12%)

Query: 17  IGPWKLGETLGSGSTGKVLLASNETTKQQAAVKVI--SKAVFEAMNNS------------ 62
           +GPWKLG+TLG GS+G+V LA N  T Q AA+K++   KA     NN             
Sbjct: 78  VGPWKLGKTLGKGSSGRVRLAKNMETGQLAAIKIVPKKKAFVHCSNNGTVPNSYSSSMVT 137

Query: 63  ------------ESNGDATNALPYNIEQEIIIMKLLNHPNVLRLFDVWETNSDLYLVLEY 110
                        SN   TN  PY IE+EI+IMKL++H NV+ LF+VWE  S+LYLVLEY
Sbjct: 138 SNVSSPSIASREHSNHSQTN--PYGIEREIVIMKLISHTNVMALFEVWENKSELYLVLEY 195

Query: 111 AEKGELFNMLVERGPLPENEAVRAFRQIIIGISYCHSLGVVHRDLKPEXXXXXXXXXX-X 169
            + GELF+ LV +G LPE EA+  F+QI+ G+SYCHS  + HRDLKPE            
Sbjct: 196 VDGGELFDYLVSKGKLPEREAIHYFKQIVEGVSYCHSFNICHRDLKPENLLLDKKNRRIK 255

Query: 170 XADFGMAALESEDKLLETSCGSPHYAAPEIISGLPYEGFSSDVWSCGVILFALLTGRLPF 229
            ADFGMAALE  +KLL+TSCGSPHYA+PEI+ G PY G  SDVWSCG++LFALLTG LPF
Sbjct: 256 IADFGMAALELPNKLLKTSCGSPHYASPEIVMGRPYHGGPSDVWSCGIVLFALLTGHLPF 315

Query: 230 DEEDGNIRNLLLKVQKGEFEMPDDDEITKEAQDLLARLLTVDPSKRITIREILKHPLLQK 289
           +  D NI+ LLLKVQ G+++MP +  ++ EA+DL++++L +DP KRIT +EILKHPL++K
Sbjct: 316 N--DDNIKKLLLKVQSGKYQMPSN--LSSEARDLISKILVIDPEKRITTQEILKHPLIKK 371

Query: 290 YPSIKDSRSIRNLPRE---------DTYL----SP-LADTNSK--IDDAILQNLVILWHG 333
           Y  +  ++ +R + ++         D +L    SP +   +SK  ID++IL++L ILWHG
Sbjct: 372 YDDLPVNKVLRKMRKDNMARGKSNSDLHLLNNVSPSIVTLHSKGEIDESILRSLQILWHG 431

Query: 334 KDAREIAAKLREPGANTEKTLYALLYRFK 362
                I AKL +   + EK  Y+LL ++K
Sbjct: 432 VSRELITAKLLQKPMSEEKLFYSLLLQYK 460

>Smik_11.139 Chr11 (235511..240115) [4605 bp, 1534 aa] {ON} YKL101W
           (REAL)
          Length = 1534

 Score =  364 bits (935), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 185/389 (47%), Positives = 251/389 (64%), Gaps = 49/389 (12%)

Query: 17  IGPWKLGETLGSGSTGKVLLASNETTKQQAAVKVISKAVFEAMNNSESNGDATNAL---- 72
           +GPWKLG+TLG GS+G+V LA N  T Q AA+K++ K   +A  +  +NG   N+     
Sbjct: 78  VGPWKLGKTLGKGSSGRVRLAKNMETGQLAAIKIVPKK--KAFVHRSTNGTMPNSYSSSM 135

Query: 73  ----------------------PYNIEQEIIIMKLLNHPNVLRLFDVWETNSDLYLVLEY 110
                                 PY IE+EI+IMKL++H NV+ LF+VWE  S+LYLVLEY
Sbjct: 136 VTSNVSSPSIVSKEYSNHSQTNPYGIEREIVIMKLISHTNVMALFEVWENKSELYLVLEY 195

Query: 111 AEKGELFNMLVERGPLPENEAVRAFRQIIIGISYCHSLGVVHRDLKPEXXXXXXXXXX-X 169
            + GELF+ LV +G LPE EA+  F+QI+ G+SYCHS  + HRDLKPE            
Sbjct: 196 VDGGELFDYLVSKGKLPEREAIHYFKQIVEGVSYCHSFNICHRDLKPENLLLDKKNRRIK 255

Query: 170 XADFGMAALESEDKLLETSCGSPHYAAPEIISGLPYEGFSSDVWSCGVILFALLTGRLPF 229
            ADFGMAALE  +KLL+TSCGSPHYA+PEI+ G PY G  SDVWSCG++LFALLTG LPF
Sbjct: 256 IADFGMAALELPNKLLKTSCGSPHYASPEIVMGRPYHGGPSDVWSCGIVLFALLTGHLPF 315

Query: 230 DEEDGNIRNLLLKVQKGEFEMPDDDEITKEAQDLLARLLTVDPSKRITIREILKHPLLQK 289
           +  D NI+ LLLKVQ G+++MP +  ++ EA+DL++++L +DP+KRIT +EILKHPL++K
Sbjct: 316 N--DDNIKKLLLKVQSGKYQMPMN--LSAEARDLISKILVIDPAKRITTQEILKHPLIKK 371

Query: 290 YPSIKDSRSIRNLPRE---------DTYL----SPLADT---NSKIDDAILQNLVILWHG 333
           Y  +  ++ +R + R+         D +L    SP   T    S ID++IL++L ILWHG
Sbjct: 372 YDDLPVNKILRKMKRDNMARGKSNSDLHLLNNVSPSIVTLYSRSDIDESILRSLQILWHG 431

Query: 334 KDAREIAAKLREPGANTEKTLYALLYRFK 362
                I AKL +   + EK  Y+LL ++K
Sbjct: 432 VSRELITAKLLQKPMSEEKLFYSLLLQYK 460

>NCAS0A05770 Chr1 (1132854..1137239) [4386 bp, 1461 aa] {ON}
           Anc_2.479
          Length = 1461

 Score =  362 bits (929), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 191/381 (50%), Positives = 247/381 (64%), Gaps = 41/381 (10%)

Query: 17  IGPWKLGETLGSGSTGKVLLASNETTKQQAAVKVISK-------------AVFEAMNNSE 63
           +GPWKLG+TLG GS+G+V LA N  T Q AA+K++ K             + F A +NS 
Sbjct: 98  VGPWKLGKTLGKGSSGRVRLAKNIETGQLAAIKIVPKKHKLFMKSSHSNVSFFSAASNSN 157

Query: 64  SN------------GDATNAL-PYNIEQEIIIMKLLNHPNVLRLFDVWETNSDLYLVLEY 110
           SN            G   N   PY IE+EI+IMKL++HPNV+ L++VWE  S+LYLVLEY
Sbjct: 158 SNISTLATSPPMNNGSEKNQPNPYGIEREIVIMKLISHPNVMALYEVWENKSELYLVLEY 217

Query: 111 AEKGELFNMLVERGPLPENEAVRAFRQIIIGISYCHSLGVVHRDLKPEX-XXXXXXXXXX 169
            + GELF+ LV +G L E EAV  F+QII G+SYCHS  + HRDLKPE            
Sbjct: 218 VDGGELFDYLVSKGKLSEKEAVHYFKQIIQGVSYCHSFNICHRDLKPENLLLDKKNKSIK 277

Query: 170 XADFGMAALESEDKLLETSCGSPHYAAPEIISGLPYEGFSSDVWSCGVILFALLTGRLPF 229
            ADFGMAALE  +KLL+TSCGSPHYA+PEI+ G  Y G  SDVWSCG+ILFALLTG LPF
Sbjct: 278 IADFGMAALELPNKLLQTSCGSPHYASPEIVMGKSYHGGPSDVWSCGIILFALLTGHLPF 337

Query: 230 DEEDGNIRNLLLKVQKGEFEMPDDDEITKEAQDLLARLLTVDPSKRITIREILKHPLLQK 289
           +  D NI+ LLLKVQ G+F MP    ++ EAQDL++R+L +DPSKRIT   IL HPL+ K
Sbjct: 338 N--DDNIKKLLLKVQAGKFRMP--STLSPEAQDLISRILVIDPSKRITTDRILNHPLILK 393

Query: 290 Y-PSIKDSRSIRNLPREDTYL------SPLADTN-SKIDDAILQNLVILWHGKDAREIAA 341
           Y P+ K+  S ++    D ++       P++ T+ + ID +IL+NL ILWHG     I A
Sbjct: 394 YEPAGKNMVSGKS--NSDLHVLEHISPQPISLTSRNDIDASILKNLQILWHGTSRELIIA 451

Query: 342 KLREPGANTEKTLYALLYRFK 362
           KL +   + EK  Y+LL+++K
Sbjct: 452 KLLQTPMSEEKLFYSLLWQYK 472

>Suva_11.123 Chr11 (235064..239644) [4581 bp, 1526 aa] {ON} YKL101W
           (REAL)
          Length = 1526

 Score =  362 bits (929), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 186/389 (47%), Positives = 250/389 (64%), Gaps = 49/389 (12%)

Query: 17  IGPWKLGETLGSGSTGKVLLASNETTKQQAAVKVI--SKAVFEAMNNS------------ 62
           +GPWKLG+TLG GS+G+V LA N  T Q AA+K++   KA     NN             
Sbjct: 78  VGPWKLGKTLGKGSSGRVRLAKNMETGQLAAIKIVPKKKAFVHRSNNGTVPNSYSSSMVT 137

Query: 63  ------------ESNGDATNALPYNIEQEIIIMKLLNHPNVLRLFDVWETNSDLYLVLEY 110
                        SN   TN  PY IE+EI+IMKL++H NV+ LF+VWE  S+LYLVLEY
Sbjct: 138 SNVSSPSIVSKEHSNHSQTN--PYGIEREIVIMKLISHANVMALFEVWENKSELYLVLEY 195

Query: 111 AEKGELFNMLVERGPLPENEAVRAFRQIIIGISYCHSLGVVHRDLKPEXXXXXXXXXX-X 169
            + GELF+ LV RG LPE EA+  F+QI+ G+SYCHS  + HRDLKPE            
Sbjct: 196 VDGGELFDYLVSRGKLPEREAIHYFKQIVEGVSYCHSFNICHRDLKPENLLLDKKNKKIK 255

Query: 170 XADFGMAALESEDKLLETSCGSPHYAAPEIISGLPYEGFSSDVWSCGVILFALLTGRLPF 229
            ADFGMAALE  +KLL+TSCGSPHYA+PEI+ G PY G  SDVWSCG++LFALLTG LPF
Sbjct: 256 IADFGMAALELPNKLLKTSCGSPHYASPEIVMGRPYHGGPSDVWSCGIVLFALLTGHLPF 315

Query: 230 DEEDGNIRNLLLKVQKGEFEMPDDDEITKEAQDLLARLLTVDPSKRITIREILKHPLLQK 289
           +  D NI+ LLLKVQ G+++MP +  ++ EA++L++++L +DP KRIT +EIL+HPL++K
Sbjct: 316 N--DDNIKKLLLKVQSGKYQMPMN--LSLEARNLISKILVIDPEKRITTQEILEHPLIKK 371

Query: 290 YPSIKDSRSIRNL---------PREDTYL----SP---LADTNSKIDDAILQNLVILWHG 333
           Y ++  ++ +R +            D +L    SP     +T ++ID++IL++L ILWHG
Sbjct: 372 YDNLPVNKMLRKMKGDSMTRGKSNSDLHLLDNVSPSIVTLNTKNEIDESILRSLQILWHG 431

Query: 334 KDAREIAAKLREPGANTEKTLYALLYRFK 362
                I AKL +   + EK  Y+LL R+K
Sbjct: 432 VSRELITAKLLQKPMSEEKLFYSLLLRYK 460

>KNAG0A06540 Chr1 (1002435..1006733) [4299 bp, 1432 aa] {ON}
           Anc_2.479 YKL101W
          Length = 1432

 Score =  360 bits (923), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 187/378 (49%), Positives = 242/378 (64%), Gaps = 40/378 (10%)

Query: 17  IGPWKLGETLGSGSTGKVLLASNETTKQQAAVKVI--SKAVFEAMNNSESNGDATNAL-- 72
           +GPWKLG+TLG GS+G+V LA N    Q AA+K++  +K +    +N  SN ++T     
Sbjct: 85  VGPWKLGKTLGKGSSGRVRLAKNMENGQLAAIKIVPKNKCLKGGTDNCSSNDNSTTLTTN 144

Query: 73  --------------PYNIEQEIIIMKLLNHPNVLRLFDVWETNSDLYLVLEYAEKGELFN 118
                         PY IE+EI+IMKL++H NV+ LF+VWE  +DL+LVLEY + GELF+
Sbjct: 145 YSMENTSDKDIPLNPYGIEREIVIMKLISHRNVMGLFEVWENKNDLFLVLEYVDGGELFD 204

Query: 119 MLVERGPLPENEAVRAFRQIIIGISYCHSLGVVHRDLKPEX-XXXXXXXXXXXADFGMAA 177
            LV +G LPE EAV  F+QII G+++CHS  + HRDLKPE             ADFGMAA
Sbjct: 205 YLVSKGKLPEWEAVHYFKQIIEGVAFCHSYNICHRDLKPENLLLDKKNKIIKIADFGMAA 264

Query: 178 LESEDKLLETSCGSPHYAAPEIISGLPYEGFSSDVWSCGVILFALLTGRLPFDEEDGNIR 237
           LE  +KLLETSCGSPHYA+PEI+ G PY G  SDVWSCG+ILFALLTG LPF+  D NIR
Sbjct: 265 LELPNKLLETSCGSPHYASPEIVMGKPYHGGPSDVWSCGIILFALLTGHLPFN--DDNIR 322

Query: 238 NLLLKVQKGEFEMPDDDEITKEAQDLLARLLTVDPSKRITIREILKHPLLQKY------- 290
            LLLKVQ G F +P +  I+ EAQDL+A++L V+P +RI I +ILKHPL+ KY       
Sbjct: 323 KLLLKVQSGRFRLPRN--ISLEAQDLIAKILVVNPRQRIKISDILKHPLITKYRQFFKVK 380

Query: 291 ------PSIKDSRSIRNLPREDTYLSPLADTNSKIDDAILQNLVILWHGKDAREIAAKLR 344
                 PS  +  S   L   +  L+  AD    ID++IL+NL ILWHG     I AKL 
Sbjct: 381 FNQVPNPSATNLNSEHMLTPNNLKLASRAD----IDESILRNLQILWHGTSREIIIAKLL 436

Query: 345 EPGANTEKTLYALLYRFK 362
           +   + EK  Y+LL+++K
Sbjct: 437 QYPMSAEKIFYSLLWQYK 454

>Skud_11.126 Chr11 (235011..239567) [4557 bp, 1518 aa] {ON} YKL101W
           (REAL)
          Length = 1518

 Score =  360 bits (925), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 183/387 (47%), Positives = 250/387 (64%), Gaps = 45/387 (11%)

Query: 17  IGPWKLGETLGSGSTGKVLLASNETTKQQAAVKVI--SKAVFEAMNN------------- 61
           +GPWKLG+TLG GS+G+V LA N  T Q AA+K++   KA     NN             
Sbjct: 78  VGPWKLGKTLGKGSSGRVRLAKNIETGQLAAIKIVPKKKAFVHRSNNGTVPNSYSSSMIT 137

Query: 62  ---------SESNGDATNALPYNIEQEIIIMKLLNHPNVLRLFDVWETNSDLYLVLEYAE 112
                    S+ + + T   PY IE+EI+IMKL++H NV+ LF+VWE  S+LYLVLEY +
Sbjct: 138 SNVSSPSIASKEHSNHTQTNPYGIEREIVIMKLISHANVMALFEVWENKSELYLVLEYVD 197

Query: 113 KGELFNMLVERGPLPENEAVRAFRQIIIGISYCHSLGVVHRDLKPEXXXXXXXXXX-XXA 171
            GELF+ LV +G LPE EA+  F+QI+ G+S+CHS  + HRDLKPE             A
Sbjct: 198 GGELFDYLVSKGKLPEREAIHYFKQIVEGVSFCHSFNICHRDLKPENLLLDKKNRKIKIA 257

Query: 172 DFGMAALESEDKLLETSCGSPHYAAPEIISGLPYEGFSSDVWSCGVILFALLTGRLPFDE 231
           DFGMAALE  +KLL+TSCGSPHYA+PEI+ G PY G  SDVWSCG++LFALLTG LPF+ 
Sbjct: 258 DFGMAALELPNKLLKTSCGSPHYASPEIVMGRPYHGGPSDVWSCGIVLFALLTGHLPFN- 316

Query: 232 EDGNIRNLLLKVQKGEFEMPDDDEITKEAQDLLARLLTVDPSKRITIREILKHPLLQKYP 291
            D NI+ LLLKVQ G+++MP +  ++ EA+DL++++L ++P KRIT +EIL HPL++KY 
Sbjct: 317 -DDNIKKLLLKVQSGKYQMPMN--LSAEARDLISKILVINPEKRITTQEILNHPLIKKYD 373

Query: 292 SIKDSRSIRNLPRE---------DTYL----SPLADT---NSKIDDAILQNLVILWHGKD 335
           ++  ++ IR + R+         D +L    SP   T     +ID++IL++L ILWHG  
Sbjct: 374 NLPINKMIRKMKRDNMARGKSNSDLHLLNNVSPSVVTLHSRGEIDESILRSLQILWHGVS 433

Query: 336 AREIAAKLREPGANTEKTLYALLYRFK 362
              I AKL +   + EK  Y+LL ++K
Sbjct: 434 RELITAKLLQKPMSEEKLFYSLLLQYK 460

>TBLA0I01150 Chr9 complement(235187..240424) [5238 bp, 1745 aa] {ON}
           Anc_2.479 YKL101W
          Length = 1745

 Score =  358 bits (918), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 182/383 (47%), Positives = 234/383 (61%), Gaps = 45/383 (11%)

Query: 17  IGPWKLGETLGSGSTGKVLLASNETTKQQAAVKVISKAVFEAMNNSESNGDATNALP--- 73
           +GPWKLG+TLG GS+G+V LA N  T Q AA+K++ K         +S   + ++ P   
Sbjct: 70  VGPWKLGKTLGKGSSGRVRLAKNMKTGQLAAIKIVPKNFHSKKKRQDSPAKSLSSSPDKP 129

Query: 74  --------------YNIEQEIIIMKLLNHPNVLRLFDVWETNSDLYLVLEYAEKGELFNM 119
                         Y IE+EI+IMKL++HPNV+ L++VWE  S+LYLVLEY + GELF+ 
Sbjct: 130 YTTHSNETNPSNNSYGIEREIVIMKLISHPNVMGLYEVWENKSELYLVLEYVDGGELFDY 189

Query: 120 LVERGPLPENEAVRAFRQIIIGISYCHSLGVVHRDLKPEX-XXXXXXXXXXXADFGMAAL 178
           LV RG LPE EAV  F+QII G++YCH+  + HRDLKPE             ADFGMAAL
Sbjct: 190 LVSRGKLPEREAVHYFKQIIQGVAYCHAFNICHRDLKPENLLLDKKNKIIKIADFGMAAL 249

Query: 179 ESEDKLLETSCGSPHYAAPEIISGLPYEGFSSDVWSCGVILFALLTGRLPFDEEDGNIRN 238
           E  DKLL TSCGSPHYA+PEI+ G  Y G  +DVWSCG+ILFALLTG LPF+ +  NI+ 
Sbjct: 250 EVSDKLLSTSCGSPHYASPEIVMGKSYHGSPTDVWSCGIILFALLTGHLPFNHD--NIKK 307

Query: 239 LLLKVQKGEFEMPDDDEITKEAQDLLARLLTVDPSKRITIREILKHPLLQKYP------- 291
           LLLKVQ G + MP D  ++ +A+DL++++L VDP KR+T  EIL H L+ KY        
Sbjct: 308 LLLKVQSGVYHMPSD--LSPDAKDLISKILVVDPDKRLTTTEILNHSLITKYDRMGLTNR 365

Query: 292 ------SIKDSRS------IRNLPREDTYLSPLADTNSKIDDAILQNLVILWHGKDAREI 339
                 S+   +S      I NL   D  L    D    ID +IL NL ILWHG+    I
Sbjct: 366 NYNNNLSMARDKSNSNLNFINNLSNVDILLQNPCD----IDTSILSNLQILWHGESKHAI 421

Query: 340 AAKLREPGANTEKTLYALLYRFK 362
             KL +P  N EK  Y+LL ++K
Sbjct: 422 IDKLLQPNMNEEKLFYSLLLKYK 444

>KAFR0D03200 Chr4 (628993..633339) [4347 bp, 1448 aa] {ON} Anc_2.479
           YKL101W
          Length = 1448

 Score =  354 bits (908), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 188/378 (49%), Positives = 245/378 (64%), Gaps = 36/378 (9%)

Query: 17  IGPWKLGETLGSGSTGKVLLASNETTKQQAAVKVISKA-VFEAMN-----------NSES 64
           +GPWKLG+TLG GS+G+V LA N  T Q AA+K++ K  +F   N           N ES
Sbjct: 89  VGPWKLGKTLGKGSSGRVRLAKNMETGQLAAIKIVPKTKIFRKQNDNSFQMSSYSSNDES 148

Query: 65  -----NGDATNAL-PYNIEQEIIIMKLLNHPNVLRLFDVWETNSDLYLVLEYAEKGELFN 118
                N D  + + PY IE+EI+IMKL++HPNV+ L++VWE  S+L+LVLEY + GELF+
Sbjct: 149 PKHTNNNDTYSKINPYGIEREIVIMKLISHPNVMGLYEVWENKSELFLVLEYVDGGELFD 208

Query: 119 MLVERGPLPENEAVRAFRQIIIGISYCHSLGVVHRDLKPEXXXXXXX-XXXXXADFGMAA 177
            LV RG L E EAV  F+QII G+SYCHS  + HRDLKPE             ADFGMAA
Sbjct: 209 YLVSRGKLSEREAVHYFKQIIEGVSYCHSFNICHRDLKPENLLLDKKINTIKIADFGMAA 268

Query: 178 LESEDKLLETSCGSPHYAAPEIISGLPYEGFSSDVWSCGVILFALLTGRLPFDEEDGNIR 237
           LE  +KLL TSCGSPHYA+PEI+ G  Y G  SDVWSCG+ILFALLTG LPF+  D +I+
Sbjct: 269 LELPNKLLVTSCGSPHYASPEIVMGKSYHGSPSDVWSCGIILFALLTGHLPFN--DDSIK 326

Query: 238 NLLLKVQKGEFEMPDDDEITKEAQDLLARLLTVDPSKRITIREILKHPLLQKYPSIK-DS 296
            LLLKVQ G+F+MP +  I+ EA+DL++R+L VDP KRI I +IL HPL++KY   K DS
Sbjct: 327 KLLLKVQSGKFQMPQN--ISLEAEDLISRILVVDPEKRIQINDILIHPLIRKYEDNKTDS 384

Query: 297 RSIRNLPREDTYLSPLADTN------------SKIDDAILQNLVILWHGKDAREIAAKLR 344
            ++ +  +     S L   N            ++ID++IL+NL ILWHG     I +KL 
Sbjct: 385 NNVSSYKKSSKSNSNLHILNDMGPSIVTLKARNEIDESILKNLQILWHGTSRELIISKLL 444

Query: 345 EPGANTEKTLYALLYRFK 362
           +   + EK  Y+LL ++K
Sbjct: 445 QTPMSEEKLFYSLLLQYK 462

>ZYRO0G03366g Chr7 (261014..265864) [4851 bp, 1616 aa] {ON} similar
           to uniprot|P34244 Saccharomyces cerevisiae YKL101W HSL1
           Nim1p-related protein kinase that regulates the
           morphogenesis and septin checkpoints associates with the
           assembled septin filament required along with Hsl7p for
           bud neck recruitment phosphorylation and degradation of
           Swe1p
          Length = 1616

 Score =  355 bits (911), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 186/396 (46%), Positives = 238/396 (60%), Gaps = 54/396 (13%)

Query: 17  IGPWKLGETLGSGSTGKVLLASNETTKQQAAVKVISKAV-----------------FEAM 59
           +GPWKLG+TLG GS+G+V LA N  T Q AA+K++ K                   F A 
Sbjct: 98  VGPWKLGKTLGKGSSGRVRLAKNMETGQLAAIKIVPKKKCKNDPGSHSSSKSTESDFSAT 157

Query: 60  ---------------NNSESNGDATNALPYNIEQEIIIMKLLNHPNVLRLFDVWETNSDL 104
                           N+ +      A PY IE+EI+IMKL++H N+L L++VWE  S+L
Sbjct: 158 MNTTTNTNRATTNGGTNANAGPSEVPANPYGIEREIVIMKLISHSNILGLYEVWENKSEL 217

Query: 105 YLVLEYAEKGELFNMLVERGPLPENEAVRAFRQIIIGISYCHSLGVVHRDLKPEXXXXXX 164
           YLVLEY + GELF+ LV RG L E EAV  F+QI+ G+SYCHS  + HRDLKPE      
Sbjct: 218 YLVLEYVDGGELFDYLVSRGKLGEREAVHYFKQIVQGVSYCHSFNICHRDLKPENLLLDK 277

Query: 165 XXXX-XXADFGMAALESEDKLLETSCGSPHYAAPEIISGLPYEGFSSDVWSCGVILFALL 223
                  ADFGMAALE  +KLL+TSCGSPHYA+PEI+ G PY G  SDVWSCG+ILFALL
Sbjct: 278 KNKSIKIADFGMAALEVSNKLLQTSCGSPHYASPEIVMGRPYHGGPSDVWSCGIILFALL 337

Query: 224 TGRLPFDEEDGNIRNLLLKVQKGEFEMPDDDEITKEAQDLLARLLTVDPSKRITIREILK 283
           TG LPF+  D NI+ LLLKVQ G+F MP +  ++ EA+DL++++L V+P KRI   EIL 
Sbjct: 338 TGHLPFN--DDNIKKLLLKVQSGKFHMPQN--LSAEAKDLMSKILVVNPFKRIATEEILN 393

Query: 284 HPLLQKYP---------------SIKDSRSIRNLPREDTYLSPLADTNSK--IDDAILQN 326
           HPLL KY                ++   +S  +L   D   S + D  S+  IDD+I+ N
Sbjct: 394 HPLLTKYDKLVKPVKYRSSVNPVALSQGKSNSDLHVLDASNSNIVDLRSREDIDDSIVSN 453

Query: 327 LVILWHGKDAREIAAKLREPGANTEKTLYALLYRFK 362
           L ILWHG     I AKL +P  + EK  Y+LL  +K
Sbjct: 454 LQILWHGASRELIVAKLLQPRMSEEKLFYSLLLSYK 489

>Kpol_431.9 s431 complement(22310..26968) [4659 bp, 1552 aa] {ON}
           complement(22310..26968) [4659 nt, 1553 aa]
          Length = 1552

 Score =  353 bits (907), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 185/400 (46%), Positives = 246/400 (61%), Gaps = 60/400 (15%)

Query: 17  IGPWKLGETLGSGSTGKVLLASNETTKQQAAVKVISKA-----VFEAMNNSESNGD---- 67
           +GPWKLG+TLG GS+G+V LA N  T + AA+K++ K         + N + +NGD    
Sbjct: 91  VGPWKLGKTLGKGSSGRVRLAKNIETGKLAAIKIVPKNKKFNNQHRSKNTNSNNGDLFLS 150

Query: 68  ------ATNAL-----------------PYNIEQEIIIMKLLNHPNVLRLFDVWETNSDL 104
                  TN                   PY IE+EI+IMKLL+HPNV+ L++VWE N++L
Sbjct: 151 YSSIHNTTNTHNARNTDNTAIENSGGGNPYGIEREIVIMKLLSHPNVMALYEVWENNNEL 210

Query: 105 YLVLEYAEKGELFNMLVERGPLPENEAVRAFRQIIIGISYCHSLGVVHRDLKPEX-XXXX 163
           YLVLEY + GELF+ LV +G L E+EAV  F+QII GISYCHS  + HRDLKPE      
Sbjct: 211 YLVLEYVDGGELFDYLVSKGKLTESEAVHYFKQIINGISYCHSFNICHRDLKPENLLLDK 270

Query: 164 XXXXXXXADFGMAALESEDKLLETSCGSPHYAAPEIISGLPYEGFSSDVWSCGVILFALL 223
                  ADFGMAAL+  ++LL+TSCGSPHYA+PEI+ G  Y G  SD+WSCG+ILFALL
Sbjct: 271 KRRIIKIADFGMAALQVSNRLLQTSCGSPHYASPEIVMGKCYNGAPSDIWSCGIILFALL 330

Query: 224 TGRLPFDEEDGNIRNLLLKVQKGEFEMPDDDEITKEAQDLLARLLTVDPSKRITIREILK 283
           TG LPF+  D NI+ LL+KVQ G ++MP    I++EA++L++R+L VDPSKRI+  +IL 
Sbjct: 331 TGHLPFN--DDNIKKLLIKVQNGRYQMP--SYISQEAKNLISRILVVDPSKRISTEQILS 386

Query: 284 HPLLQKY---------------------PSIKDSRSIRNLPREDTYLSPLADTNSKIDDA 322
           HPLL KY                      S  D   + N+P+    +   A   S ID++
Sbjct: 387 HPLLTKYDKRLGKKDRKVTKNNKIMHRGKSNSDLNMLSNIPQNTEIVKLRA--RSDIDES 444

Query: 323 ILQNLVILWHGKDAREIAAKLREPGANTEKTLYALLYRFK 362
           IL+NL ILWHG     I AKL +   + EK +Y+LL+++K
Sbjct: 445 ILKNLQILWHGISRDIIIAKLLQTPMSEEKLIYSLLWKYK 484

>CAGL0K08514g Chr11 complement(854143..858612) [4470 bp, 1489 aa]
           {ON} similar to uniprot|P34244 Saccharomyces cerevisiae
           YKL101w serine/threonine-protein kinase
          Length = 1489

 Score =  350 bits (899), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 183/399 (45%), Positives = 245/399 (61%), Gaps = 41/399 (10%)

Query: 17  IGPWKLGETLGSGSTGKVLLASNETTKQQAAVKVISKAVFE------------AMNNSES 64
           +GPWKLG+TLG GS+G+V LA N      AA+K++ K  +              +++   
Sbjct: 90  VGPWKLGKTLGKGSSGRVRLAKNIENGTLAAIKIVPKRTYNRRMRDQKMKTAGGVSSGTD 149

Query: 65  NGDATN-----------AL-PYNIEQEIIIMKLLNHPNVLRLFDVWETNSDLYLVLEYAE 112
           + D++N           AL PY IE+EI+IMKL++HPNV+ L +VWE  S+LYLVLEY +
Sbjct: 150 SKDSSNREDPIKNGTDSALNPYGIEREIVIMKLISHPNVMGLLEVWENKSELYLVLEYVD 209

Query: 113 KGELFNMLVERGPLPENEAVRAFRQIIIGISYCHSLGVVHRDLKPEX-XXXXXXXXXXXA 171
            GELF+ LV +G L E EAV  F QII G+SYCHS  + HRDLKPE             A
Sbjct: 210 GGELFDYLVSKGKLSEPEAVHYFTQIIQGVSYCHSFNICHRDLKPENLLLDKKNKVIKIA 269

Query: 172 DFGMAALESEDKLLETSCGSPHYAAPEIISGLPYEGFSSDVWSCGVILFALLTGRLPFDE 231
           DFGMAALE  +KLLETSCGSPHYA+PEI+ G PY G  SDVWSCG+ILFALLTG LPF+ 
Sbjct: 270 DFGMAALELPNKLLETSCGSPHYASPEIVMGKPYHGGPSDVWSCGIILFALLTGHLPFN- 328

Query: 232 EDGNIRNLLLKVQKGEFEMPDDDEITKEAQDLLARLLTVDPSKRITIREILKHPLLQKY- 290
            D NI+ LLLKVQ G F++P    +T +A+DL+ R+L  +P KR+TI EIL HPL++KY 
Sbjct: 329 -DDNIKKLLLKVQAGRFQLP--PYLTNDAKDLITRILVTNPEKRLTINEILNHPLIKKYR 385

Query: 291 -PSIK----------DSRSIRNLPREDTYLSPLADTNSKIDDAILQNLVILWHGKDAREI 339
            P              S S  ++   +T  +   ++   ID +IL++L ILWHG   + +
Sbjct: 386 NPPAHIRKLNLLGRGKSNSDLHVLEYNTPATVCLNSEEDIDQSILKSLQILWHGTPRQRL 445

Query: 340 AAKLREPGANTEKTLYALLYRFKCDTQREANRARRQSKI 378
             +L   GA  EK  Y+LL+++K    +  +  + Q KI
Sbjct: 446 VERLLVEGATEEKLFYSLLFQYKLKHSKPISATKLQKKI 484

>NDAI0D02750 Chr4 (639802..644349) [4548 bp, 1515 aa] {ON} Anc_2.479
           YKL101W
          Length = 1515

 Score =  321 bits (823), Expect = 1e-90,   Method: Compositional matrix adjust.
 Identities = 161/298 (54%), Positives = 206/298 (69%), Gaps = 13/298 (4%)

Query: 74  YNIEQEIIIMKLLNHPNVLRLFDVWETNSDLYLVLEYAEKGELFNMLVERGPLPENEAVR 133
           Y IE+EI+IMKL++HPNV+ L++VWE  S+LYL+LEY + GELF+ LV RG LPE EA+ 
Sbjct: 197 YGIEREIVIMKLISHPNVMGLYEVWENKSELYLILEYVDGGELFDYLVSRGKLPEAEAIH 256

Query: 134 AFRQIIIGISYCHSLGVVHRDLKPEX-XXXXXXXXXXXADFGMAALESEDKLLETSCGSP 192
            F+QII G+SYCHS  + HRDLKPE             ADFGMAALE   KLL+TSCGSP
Sbjct: 257 YFKQIIQGVSYCHSFNICHRDLKPENLLIDKKKKSIKIADFGMAALELPKKLLQTSCGSP 316

Query: 193 HYAAPEIISGLPYEGFSSDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQKGEFEMPD 252
           HYA+PEI+ G  Y G  SDVWSCG+ILFALLTG LPF+  D NI+ LLLKVQ G+++MP 
Sbjct: 317 HYASPEIVMGKSYHGGPSDVWSCGIILFALLTGHLPFN--DDNIKKLLLKVQAGKYQMPK 374

Query: 253 DDEITKEAQDLLARLLTVDPSKRITIREILKHPLLQKY-PSIKDSRSIRNLPREDTYL-- 309
           +  ++ EA+DL++R+L V PSKR+T  EIL HPL+ KY  S K    ++     D +L  
Sbjct: 375 N--LSDEAKDLISRILVVSPSKRLTTVEILNHPLILKYEKSSKKKHMVKGKSNSDLHLLD 432

Query: 310 --SPLADT-NSK--IDDAILQNLVILWHGKDAREIAAKLREPGANTEKTLYALLYRFK 362
             SP   T NS+  ID++IL+NL ILWHG     I AKL +   + EK  Y+LL ++K
Sbjct: 433 SISPENITLNSRMDIDESILKNLQILWHGTSRDIIIAKLLQKPISEEKLFYSLLLQYK 490

 Score = 58.2 bits (139), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 27/49 (55%), Positives = 34/49 (69%)

Query: 17  IGPWKLGETLGSGSTGKVLLASNETTKQQAAVKVISKAVFEAMNNSESN 65
           +GPWKLG+TLG GS+G+V LA N  T Q AA+K++ K     M NS SN
Sbjct: 90  VGPWKLGKTLGKGSSGRVRLAKNVETGQLAAIKIVPKRNKFVMKNSNSN 138

>TPHA0G03200 Chr7 (683296..687900) [4605 bp, 1534 aa] {ON} Anc_2.479
           YKL101W
          Length = 1534

 Score =  302 bits (774), Expect = 3e-84,   Method: Compositional matrix adjust.
 Identities = 155/327 (47%), Positives = 214/327 (65%), Gaps = 31/327 (9%)

Query: 61  NSESNGDATNALPYNIEQEIIIMKLLNHPNVLRLFDVWETNSDLYLVLEYAEKGELFNML 120
           N   N D +N   Y IE+EI+IMKL++HPNV+ L++VWE  ++LYLVLEY + GELF+ L
Sbjct: 194 NDSRNKDNSNR--YGIEREIVIMKLVSHPNVMALYEVWENKNELYLVLEYVDGGELFDYL 251

Query: 121 VERGPLPENEAVRAFRQIIIGISYCHSLGVVHRDLKPEXXXXXXXXXX-XXADFGMAALE 179
           V +G L E EAVR F+QII G+ YCHS  + HRDLKPE             ADFGMAAL+
Sbjct: 252 VSKGKLTELEAVRYFKQIIRGVQYCHSFNICHRDLKPENLLLDKKRKLIKIADFGMAALQ 311

Query: 180 SEDKLLETSCGSPHYAAPEIISGLPYEGFSSDVWSCGVILFALLTGRLPFDEEDGNIRNL 239
             + LL+TSCGSPHYA+PEI+ G  Y G  SDVWSCG+ILFALLTG LPF+  D +I+ L
Sbjct: 312 VSNTLLKTSCGSPHYASPEIVMGKTYNGGPSDVWSCGIILFALLTGHLPFN--DDSIKKL 369

Query: 240 LLKVQKGEFEMPDDDEITKEAQDLLARLLTVDPSKRITIREILKHPLLQKYP---SIKDS 296
           L+KVQ G ++MP  + ++K+A+DL++R+L V+P  R+T  +IL+HPL+ KY    S+K  
Sbjct: 370 LIKVQNGRYQMP--NYLSKDAKDLISRILLVNPKARLTTEQILEHPLITKYDNQYSLKKE 427

Query: 297 --------RSIRNLPR--EDTYLSPLADTNSK-----------IDDAILQNLVILWHGKD 335
                   ++  NL R   +T L+ L +   K           IDD+IL+NL ILW+G  
Sbjct: 428 NKLTKQAIKNYNNLMRGKSNTDLAILQNIPDKTDIIQLRSRNDIDDSILRNLQILWNGVP 487

Query: 336 AREIAAKLREPGANTEKTLYALLYRFK 362
              + +KL +   + EK +Y+LL+++K
Sbjct: 488 RETLISKLIQDPVSEEKLIYSLLWQYK 514

>Kwal_33.13222 s33 (127342..127788) [447 bp, 148 aa] {OFF} YDR507C
           (GIN4) - putative serine/threonine kinase [contig 120]
           PARTIAL
          Length = 148

 Score =  210 bits (535), Expect = 2e-62,   Method: Composition-based stats.
 Identities = 96/120 (80%), Positives = 105/120 (87%)

Query: 83  MKLLNHPNVLRLFDVWETNSDLYLVLEYAEKGELFNMLVERGPLPENEAVRAFRQIIIGI 142
           MKLL+H NVLRL+DVWETNS+LY+VLEY EKGELFN+LVERGPLPENEAVR FRQIIIGI
Sbjct: 1   MKLLHHANVLRLYDVWETNSNLYMVLEYVEKGELFNLLVERGPLPENEAVRFFRQIIIGI 60

Query: 143 SYCHSLGVVHRDLKPEXXXXXXXXXXXXADFGMAALESEDKLLETSCGSPHYAAPEIISG 202
           SYCH+LG+VHRDLKPE            ADFGMAALES+DKLLETSCGSPHYAAPEI+SG
Sbjct: 61  SYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAALESKDKLLETSCGSPHYAAPEIVSG 120

>CAGL0M08910g Chr13 complement(887703..889541) [1839 bp, 612 aa]
           {ON}
          Length = 612

 Score =  221 bits (564), Expect = 6e-61,   Method: Compositional matrix adjust.
 Identities = 115/282 (40%), Positives = 176/282 (62%), Gaps = 16/282 (5%)

Query: 2   SAISSNTVSVIKNNQIGPWKLGETLGSGSTGKVLLASNETTKQQAAVKVISKAVFEAMNN 61
           S +S+   S+   +++G +++ +TLG GS GKV LA + TT Q+ A+K+I+K V      
Sbjct: 21  SYVSNKVSSLADGSRVGNYQIVKTLGEGSFGKVKLAYHVTTGQKVALKIINKKVL----- 75

Query: 62  SESNGDATNALPYNIEQEIIIMKLLNHPNVLRLFDVWETNSDLYLVLEYAEKGELFNMLV 121
                 A + +   IE+EI  ++LL HP++++L+DV ++  ++ +V+EYA   ELF+ +V
Sbjct: 76  ------AKSDMQGRIEREISYLRLLRHPHIIKLYDVIKSKDEIIMVIEYA-GNELFDYIV 128

Query: 122 ERGPLPENEAVRAFRQIIIGISYCHSLGVVHRDLKPEXXXXXXXXXXXXADFGMAALESE 181
           +R  + E EA R F+QII  + YCH   +VHRDLKPE            ADFG++ + ++
Sbjct: 129 QRNKMSEQEARRFFQQIISAVEYCHRHKIVHRDLKPENLLLDEHLNVKIADFGLSNIMTD 188

Query: 182 DKLLETSCGSPHYAAPEIISGLPYEGFSSDVWSCGVILFALLTGRLPFDEEDGNIRNLLL 241
              L+TSCGSP+YAAPE+ISG  Y G   DVWSCGVIL+ +L  RLPFD+E  +I  L  
Sbjct: 189 GNFLKTSCGSPNYAAPEVISGKLYAGPEVDVWSCGVILYVMLCRRLPFDDE--SIPVLFK 246

Query: 242 KVQKGEFEMPDDDEITKEAQDLLARLLTVDPSKRITIREILK 283
            +  G + +P    ++  A DL+ R+L V+P  RI+I EI++
Sbjct: 247 NISNGVYTLP--KFLSPGASDLIKRMLIVNPLNRISIHEIMQ 286

>TPHA0C00470 Chr3 (81482..83377) [1896 bp, 631 aa] {ON} Anc_5.611
           YDR477W
          Length = 631

 Score =  220 bits (560), Expect = 3e-60,   Method: Compositional matrix adjust.
 Identities = 113/273 (41%), Positives = 175/273 (64%), Gaps = 16/273 (5%)

Query: 16  QIGPWKLGETLGSGSTGKVLLASNETTKQQAAVKVISKAVFEAMNNSESNGDATNALPYN 75
           +IG +++ +TLG GS GKV LA + TT+Q+ A+K+I+K V   ++ S+  G         
Sbjct: 26  KIGNYQIVKTLGEGSFGKVKLAFHSTTRQKVALKIINKKV---LSKSDMQG--------R 74

Query: 76  IEQEIIIMKLLNHPNVLRLFDVWETNSDLYLVLEYAEKGELFNMLVERGPLPENEAVRAF 135
           IE+EI  ++LL HP++++L+DV ++  ++ +V+EYA+  ELF+ +V+R  + ENE  R F
Sbjct: 75  IEREISYLRLLRHPHIIKLYDVIKSKDEIIMVIEYADH-ELFDYIVQREKMSENEGRRFF 133

Query: 136 RQIIIGISYCHSLGVVHRDLKPEXXXXXXXXXXXXADFGMAALESEDKLLETSCGSPHYA 195
           +QII  + YCH   +VHRDLKPE             DFG++ + ++   L+TSCGSP+YA
Sbjct: 134 QQIISAVEYCHRHKIVHRDLKPENLLLDEHYNVKITDFGLSNIITDGNFLKTSCGSPNYA 193

Query: 196 APEIISGLPYEGFSSDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQKGEFEMPDDDE 255
           APE+ISG  Y G   DVWSCGVIL+ LL  RLPFD+E  +I  L   +  G + +P  + 
Sbjct: 194 APEVISGKLYAGPEVDVWSCGVILYVLLCRRLPFDDE--SIPTLFKNINNGVYTIP--NF 249

Query: 256 ITKEAQDLLARLLTVDPSKRITIREILKHPLLQ 288
           +++ A  L+ ++L V+P  RITI +I++ P  +
Sbjct: 250 LSEGAASLIKKMLIVNPMNRITIGDIIQDPWFK 282

>Suva_2.651 Chr2 (1164264..1166165) [1902 bp, 633 aa] {ON} YDR477W
           (REAL)
          Length = 633

 Score =  218 bits (556), Expect = 9e-60,   Method: Compositional matrix adjust.
 Identities = 115/282 (40%), Positives = 175/282 (62%), Gaps = 16/282 (5%)

Query: 2   SAISSNTVSVIKNNQIGPWKLGETLGSGSTGKVLLASNETTKQQAAVKVISKAVFEAMNN 61
           SA+++   S+     IG +++ +TLG GS GKV LA + TT Q+ A+K+I+K V      
Sbjct: 36  SALNNPKSSLADGAHIGNYQIVKTLGEGSFGKVKLAYHTTTGQKVALKIINKKVL----- 90

Query: 62  SESNGDATNALPYNIEQEIIIMKLLNHPNVLRLFDVWETNSDLYLVLEYAEKGELFNMLV 121
                 A + +   IE+EI  ++LL HP++++L+DV ++  ++ +V+EYA   ELF+ +V
Sbjct: 91  ------AKSDMQGRIEREISYLRLLRHPHIIKLYDVIKSKDEIIMVIEYA-GNELFDYIV 143

Query: 122 ERGPLPENEAVRAFRQIIIGISYCHSLGVVHRDLKPEXXXXXXXXXXXXADFGMAALESE 181
           +R  + E+EA R F+QII  + YCH   +VHRDLKPE            ADFG++ + ++
Sbjct: 144 QRDKMSEDEARRFFQQIISAVEYCHRHKIVHRDLKPENLLLDEHLNVKIADFGLSNIMTD 203

Query: 182 DKLLETSCGSPHYAAPEIISGLPYEGFSSDVWSCGVILFALLTGRLPFDEEDGNIRNLLL 241
              L+TSCGSP+YAAPE+ISG  Y G   DVWSCGVIL+ +L  RLPFD+E  +I  L  
Sbjct: 204 GNFLKTSCGSPNYAAPEVISGKLYAGPEVDVWSCGVILYVMLCRRLPFDDE--SIPVLFK 261

Query: 242 KVQKGEFEMPDDDEITKEAQDLLARLLTVDPSKRITIREILK 283
            +  G + +P    ++  A  L+ R+L V+P  RI+I EI++
Sbjct: 262 NISNGVYSLP--KFLSPGAASLIKRMLIVNPLNRISIHEIMQ 301

>Smik_4.754 Chr4 (1333667..1335565) [1899 bp, 632 aa] {ON} YDR477W
           (REAL)
          Length = 632

 Score =  218 bits (554), Expect = 2e-59,   Method: Compositional matrix adjust.
 Identities = 115/282 (40%), Positives = 174/282 (61%), Gaps = 16/282 (5%)

Query: 2   SAISSNTVSVIKNNQIGPWKLGETLGSGSTGKVLLASNETTKQQAAVKVISKAVFEAMNN 61
           SA+++   S+     IG +++ +TLG GS GKV LA + TT Q+ A+K+I+K V      
Sbjct: 37  SALNNPKSSLADGAHIGNYQIVKTLGEGSFGKVKLAYHTTTGQKVALKIINKKVL----- 91

Query: 62  SESNGDATNALPYNIEQEIIIMKLLNHPNVLRLFDVWETNSDLYLVLEYAEKGELFNMLV 121
                 A + +   IE+EI  ++LL HP++++L+DV ++  ++ +V+EYA   ELF+ +V
Sbjct: 92  ------AKSDMQGRIEREISYLRLLRHPHIIKLYDVIKSKDEIIMVIEYA-GNELFDYIV 144

Query: 122 ERGPLPENEAVRAFRQIIIGISYCHSLGVVHRDLKPEXXXXXXXXXXXXADFGMAALESE 181
           +R  + E EA R F+QII  + YCH   +VHRDLKPE            ADFG++ + ++
Sbjct: 145 QRDKMSEQEARRFFQQIISAVEYCHRHKIVHRDLKPENLLLDEHLNVKIADFGLSNIMTD 204

Query: 182 DKLLETSCGSPHYAAPEIISGLPYEGFSSDVWSCGVILFALLTGRLPFDEEDGNIRNLLL 241
              L+TSCGSP+YAAPE+ISG  Y G   DVWSCGVIL+ +L  RLPFD+E  +I  L  
Sbjct: 205 GNFLKTSCGSPNYAAPEVISGKLYAGPEVDVWSCGVILYVMLCRRLPFDDE--SIPVLFK 262

Query: 242 KVQKGEFEMPDDDEITKEAQDLLARLLTVDPSKRITIREILK 283
            +  G + +P    ++  A  L+ R+L V+P  RI+I EI++
Sbjct: 263 NISNGVYTLP--KFLSPGAAGLIKRMLIVNPLNRISIHEIMQ 302

>Skud_4.751 Chr4 (1332135..1334039) [1905 bp, 634 aa] {ON} YDR477W
           (REAL)
          Length = 634

 Score =  217 bits (553), Expect = 3e-59,   Method: Compositional matrix adjust.
 Identities = 115/282 (40%), Positives = 174/282 (61%), Gaps = 16/282 (5%)

Query: 2   SAISSNTVSVIKNNQIGPWKLGETLGSGSTGKVLLASNETTKQQAAVKVISKAVFEAMNN 61
           SA+++   S+     IG +++ +TLG GS GKV LA + TT Q+ A+K+I+K V      
Sbjct: 38  SALNNPKSSLADGAHIGNYQIVKTLGEGSFGKVKLAYHTTTGQKVALKIINKKVL----- 92

Query: 62  SESNGDATNALPYNIEQEIIIMKLLNHPNVLRLFDVWETNSDLYLVLEYAEKGELFNMLV 121
                 A + +   IE+EI  ++LL HP++++L+DV ++  ++ +V+EYA   ELF+ +V
Sbjct: 93  ------AKSDMQGRIEREISYLRLLRHPHIIKLYDVIKSKDEIIMVIEYA-GNELFDYIV 145

Query: 122 ERGPLPENEAVRAFRQIIIGISYCHSLGVVHRDLKPEXXXXXXXXXXXXADFGMAALESE 181
           +R  + E EA R F+QII  + YCH   +VHRDLKPE            ADFG++ + ++
Sbjct: 146 QRDKMSEQEARRFFQQIISAVEYCHRHKIVHRDLKPENLLLDEHLNVKIADFGLSNIMTD 205

Query: 182 DKLLETSCGSPHYAAPEIISGLPYEGFSSDVWSCGVILFALLTGRLPFDEEDGNIRNLLL 241
              L+TSCGSP+YAAPE+ISG  Y G   DVWSCGVIL+ +L  RLPFD+E  +I  L  
Sbjct: 206 GNFLKTSCGSPNYAAPEVISGKLYAGPEVDVWSCGVILYVMLCRRLPFDDE--SIPVLFK 263

Query: 242 KVQKGEFEMPDDDEITKEAQDLLARLLTVDPSKRITIREILK 283
            +  G + +P    ++  A  L+ R+L V+P  RI+I EI++
Sbjct: 264 NISNGVYTLP--KFLSPGAAGLIKRMLIVNPLNRISIHEIMQ 303

>Kpol_1018.65 s1018 (189779..191584) [1806 bp, 601 aa] {ON}
           (189779..191584) [1806 nt, 602 aa]
          Length = 601

 Score =  216 bits (550), Expect = 4e-59,   Method: Compositional matrix adjust.
 Identities = 111/268 (41%), Positives = 170/268 (63%), Gaps = 16/268 (5%)

Query: 16  QIGPWKLGETLGSGSTGKVLLASNETTKQQAAVKVISKAVFEAMNNSESNGDATNALPYN 75
           +IG +++ +TLG GS GKV LA + TT Q+ A+K+I+K +            A + +   
Sbjct: 38  RIGNYQIIKTLGEGSFGKVKLAYHVTTNQRVALKIINKKIL-----------AKSDMQGR 86

Query: 76  IEQEIIIMKLLNHPNVLRLFDVWETNSDLYLVLEYAEKGELFNMLVERGPLPENEAVRAF 135
           IE+EI  ++LL HP++++L+DV ++  D+ +V+EYA+  ELF+ +V+R  + ENEA + F
Sbjct: 87  IEREISYLRLLRHPHIIKLYDVIKSKEDIIMVIEYADH-ELFDYIVQRDKMSENEARKFF 145

Query: 136 RQIIIGISYCHSLGVVHRDLKPEXXXXXXXXXXXXADFGMAALESEDKLLETSCGSPHYA 195
           +QII  + YCH   +VHRDLKPE            ADFG++ + ++   L+TSCGSP+YA
Sbjct: 146 QQIISAVEYCHRHKIVHRDLKPENLLLDEELNVKIADFGLSNIMTDGNFLKTSCGSPNYA 205

Query: 196 APEIISGLPYEGFSSDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQKGEFEMPDDDE 255
           APE+ISG  Y G   DVWSCGVIL+ +L  RLPFD  D +I  L   +  G + +P    
Sbjct: 206 APEVISGKLYAGPEVDVWSCGVILYVMLCRRLPFD--DDSIPVLFKNISNGIYTLP--KF 261

Query: 256 ITKEAQDLLARLLTVDPSKRITIREILK 283
           ++  A +L+ R+L V+P  RI++ EI++
Sbjct: 262 LSPGAANLIKRMLIVNPLNRISMNEIME 289

>YDR477W Chr4 (1412373..1414274) [1902 bp, 633 aa] {ON}
           SNF1AMP-activated serine/threonine protein kinase found
           in a complex containing Snf4p and members of the
           Sip1p/Sip2p/Gal83p family; required for transcription of
           glucose-repressed genes, thermotolerance, sporulation,
           and peroxisome biogenesis
          Length = 633

 Score =  216 bits (551), Expect = 4e-59,   Method: Compositional matrix adjust.
 Identities = 112/268 (41%), Positives = 167/268 (62%), Gaps = 16/268 (5%)

Query: 16  QIGPWKLGETLGSGSTGKVLLASNETTKQQAAVKVISKAVFEAMNNSESNGDATNALPYN 75
            IG +++ +TLG GS GKV LA + TT Q+ A+K+I+K V            A + +   
Sbjct: 51  HIGNYQIVKTLGEGSFGKVKLAYHTTTGQKVALKIINKKVL-----------AKSDMQGR 99

Query: 76  IEQEIIIMKLLNHPNVLRLFDVWETNSDLYLVLEYAEKGELFNMLVERGPLPENEAVRAF 135
           IE+EI  ++LL HP++++L+DV ++  ++ +V+EYA   ELF+ +V+R  + E EA R F
Sbjct: 100 IEREISYLRLLRHPHIIKLYDVIKSKDEIIMVIEYA-GNELFDYIVQRDKMSEQEARRFF 158

Query: 136 RQIIIGISYCHSLGVVHRDLKPEXXXXXXXXXXXXADFGMAALESEDKLLETSCGSPHYA 195
           +QII  + YCH   +VHRDLKPE            ADFG++ + ++   L+TSCGSP+YA
Sbjct: 159 QQIISAVEYCHRHKIVHRDLKPENLLLDEHLNVKIADFGLSNIMTDGNFLKTSCGSPNYA 218

Query: 196 APEIISGLPYEGFSSDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQKGEFEMPDDDE 255
           APE+ISG  Y G   DVWSCGVIL+ +L  RLPFD+E  +I  L   +  G + +P    
Sbjct: 219 APEVISGKLYAGPEVDVWSCGVILYVMLCRRLPFDDE--SIPVLFKNISNGVYTLP--KF 274

Query: 256 ITKEAQDLLARLLTVDPSKRITIREILK 283
           ++  A  L+ R+L V+P  RI+I EI++
Sbjct: 275 LSPGAAGLIKRMLIVNPLNRISIHEIMQ 302

>NCAS0A08080 Chr1 complement(1594221..1596092) [1872 bp, 623 aa]
           {ON} Anc_5.611
          Length = 623

 Score =  216 bits (549), Expect = 7e-59,   Method: Compositional matrix adjust.
 Identities = 112/274 (40%), Positives = 173/274 (63%), Gaps = 16/274 (5%)

Query: 10  SVIKNNQIGPWKLGETLGSGSTGKVLLASNETTKQQAAVKVISKAVFEAMNNSESNGDAT 69
           S+   + IG +++ +TLG GS GKV LA + TT Q+ A+K+I+K V            A 
Sbjct: 36  SLSDGSHIGNYQIVKTLGEGSFGKVKLAYHMTTGQKVALKIINKKVL-----------AK 84

Query: 70  NALPYNIEQEIIIMKLLNHPNVLRLFDVWETNSDLYLVLEYAEKGELFNMLVERGPLPEN 129
           + +   IE+EI  ++LL HP++++L+DV ++  ++ +V+EYA   ELF+ +V+R  + E+
Sbjct: 85  SDMQGRIEREISYLRLLRHPHIIKLYDVIKSKDEIIMVMEYA-GNELFDYIVQRDKMSED 143

Query: 130 EAVRAFRQIIIGISYCHSLGVVHRDLKPEXXXXXXXXXXXXADFGMAALESEDKLLETSC 189
           EA R F+QII  + YCH   +VHRDLKPE            ADFG++ + ++   L+TSC
Sbjct: 144 EARRFFQQIISAVEYCHRHKIVHRDLKPENLLLDEHLNVKIADFGLSNIMTDGNFLKTSC 203

Query: 190 GSPHYAAPEIISGLPYEGFSSDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQKGEFE 249
           GSP+YAAPE+ISG  Y G   DVWSCGVIL+ +L  RLPFD+E  +I  L   +  G + 
Sbjct: 204 GSPNYAAPEVISGKLYAGPEVDVWSCGVILYVMLCRRLPFDDE--SIPVLFKNINNGVYT 261

Query: 250 MPDDDEITKEAQDLLARLLTVDPSKRITIREILK 283
           +P    +++ A  L+ ++L V+P  RI+I+EI++
Sbjct: 262 IP--KFLSQGASTLIKKMLIVNPLNRISIQEIMQ 293

>Kwal_47.18233 s47 complement(743846..745642) [1797 bp, 598 aa] {ON}
           YDR477W (SNF1) - protein serine/threonine kinase [contig
           197] FULL
          Length = 598

 Score =  214 bits (545), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 113/271 (41%), Positives = 170/271 (62%), Gaps = 16/271 (5%)

Query: 13  KNNQIGPWKLGETLGSGSTGKVLLASNETTKQQAAVKVISKAVFEAMNNSESNGDATNAL 72
           ++ +IG +++ +TLG GS GKV LA + TT Q+ A+K+I+K V            A + +
Sbjct: 24  QDQRIGKYQIIKTLGEGSFGKVKLAYHVTTGQKVALKIINKKVL-----------AKSDM 72

Query: 73  PYNIEQEIIIMKLLNHPNVLRLFDVWETNSDLYLVLEYAEKGELFNMLVERGPLPENEAV 132
              IE+EI  ++LL HP++++L+DV ++  ++ +V+EYA   ELF+ +V+R  + ENEA 
Sbjct: 73  QGRIEREISYLRLLRHPHIIKLYDVVKSKDEIVMVIEYA-GNELFDYIVQRDKMSENEAR 131

Query: 133 RAFRQIIIGISYCHSLGVVHRDLKPEXXXXXXXXXXXXADFGMAALESEDKLLETSCGSP 192
           R F+QII  + YCH   +VHRDLKPE            ADFG++ + ++   L TSCGSP
Sbjct: 132 RFFQQIISAVEYCHRHKIVHRDLKPENLLLDEHLNVKIADFGLSNIMTDGNFLRTSCGSP 191

Query: 193 HYAAPEIISGLPYEGFSSDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQKGEFEMPD 252
           +YAAPE+ISG  Y G   DVWS GVIL+ +L  RLPFD+E  +I  L   +  G + +P 
Sbjct: 192 NYAAPEVISGKLYAGPEVDVWSSGVILYVMLCRRLPFDDE--SIPVLFKNISNGIYTLP- 248

Query: 253 DDEITKEAQDLLARLLTVDPSKRITIREILK 283
              ++  A +L+ R+L V+P  RITI EI++
Sbjct: 249 -KFLSPGAANLIKRMLIVNPLNRITIHEIMQ 278

>KLLA0A03806g Chr1 complement(338807..340615) [1809 bp, 602 aa] {ON}
           highly similar to uniprot|P06782 Saccharomyces
           cerevisiae YDR477W SNF1 Protein serine/threonine kinase
           required for release from glucose repression invertase
           expression sporulation and for expression of catabolite-
           repressed genes when glucose is limiting regulates
           Adr1p- dependent transcription primarily at the level of
           chromatin binding
          Length = 602

 Score =  214 bits (544), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 110/271 (40%), Positives = 170/271 (62%), Gaps = 16/271 (5%)

Query: 13  KNNQIGPWKLGETLGSGSTGKVLLASNETTKQQAAVKVISKAVFEAMNNSESNGDATNAL 72
           +   IG +++ +TLG GS GKV LA + +T Q+ A+K+I+K V            A + +
Sbjct: 28  QGQHIGKYQIIKTLGEGSFGKVKLAYHISTGQKVALKIINKKVL-----------AKSDM 76

Query: 73  PYNIEQEIIIMKLLNHPNVLRLFDVWETNSDLYLVLEYAEKGELFNMLVERGPLPENEAV 132
              IE+EI  ++LL HP++++L+DV ++  ++ +V+EYA   ELF+ +V+R  +PE EA 
Sbjct: 77  QGRIEREISYLRLLRHPHIIKLYDVIKSKDEIIMVIEYA-GNELFDYIVQRDKMPEQEAR 135

Query: 133 RAFRQIIIGISYCHSLGVVHRDLKPEXXXXXXXXXXXXADFGMAALESEDKLLETSCGSP 192
           R F+QII  + YCH   +VHRDLKPE            ADFG++ + ++   L+TSCGSP
Sbjct: 136 RFFQQIISAVDYCHRHKIVHRDLKPENLLLDEHLNVKIADFGLSNIMTDGNFLKTSCGSP 195

Query: 193 HYAAPEIISGLPYEGFSSDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQKGEFEMPD 252
           +YAAPE+ISG  Y G   DVWS GVIL+ +L  RLPFD+E  +I  L   +  G + +P 
Sbjct: 196 NYAAPEVISGKLYAGPEVDVWSSGVILYVMLCRRLPFDDE--SIPVLFKNISNGVYTIP- 252

Query: 253 DDEITKEAQDLLARLLTVDPSKRITIREILK 283
            + +++ A  L+ ++L V+P  RIT+ EI++
Sbjct: 253 -NFLSQGAASLIKKMLIVNPVNRITVHEIMQ 282

>Kpol_495.14 s495 (33810..35684) [1875 bp, 624 aa] {ON}
           (33810..35684) [1875 nt, 625 aa]
          Length = 624

 Score =  214 bits (545), Expect = 3e-58,   Method: Compositional matrix adjust.
 Identities = 110/269 (40%), Positives = 172/269 (63%), Gaps = 16/269 (5%)

Query: 15  NQIGPWKLGETLGSGSTGKVLLASNETTKQQAAVKVISKAVFEAMNNSESNGDATNALPY 74
           ++IG +++ +TLG GS GKV LA + TT Q+ A+K+I++ V   ++ S+  G        
Sbjct: 37  SRIGNYQIVKTLGEGSFGKVKLAFHVTTGQKVALKIINRKV---LSKSDMQG-------- 85

Query: 75  NIEQEIIIMKLLNHPNVLRLFDVWETNSDLYLVLEYAEKGELFNMLVERGPLPENEAVRA 134
            IE+EI  ++LL HP+++RL+DV ++  ++ +++EYA   ELF+ +V+R  + ENEA + 
Sbjct: 86  RIEREIAYLRLLRHPHIIRLYDVIKSKDEIIMIIEYAHH-ELFDYIVQRDKMSENEARKF 144

Query: 135 FRQIIIGISYCHSLGVVHRDLKPEXXXXXXXXXXXXADFGMAALESEDKLLETSCGSPHY 194
           F+QII  + YCH   +VHRDLKPE             DFG++ + ++   L+TSCGSP+Y
Sbjct: 145 FQQIISAVDYCHRHMIVHRDLKPENLLLDEHYNVKITDFGLSNIMTDGNFLKTSCGSPNY 204

Query: 195 AAPEIISGLPYEGFSSDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQKGEFEMPDDD 254
           AAPE+ISG  Y G   DVWSCGVIL+ +L  RLPFD+E  +I  L   +  G + +P  +
Sbjct: 205 AAPEVISGKLYAGPEVDVWSCGVILYVMLCRRLPFDDE--SIPILFKNISNGIYTLP--N 260

Query: 255 EITKEAQDLLARLLTVDPSKRITIREILK 283
            ++  A  L+ ++L V+P  RI+I EI++
Sbjct: 261 FLSDGAASLIKKMLIVNPINRISISEIMQ 289

>KAFR0C05860 Chr3 (1160586..1162520) [1935 bp, 644 aa] {ON}
           Anc_5.611 YDR477W
          Length = 644

 Score =  214 bits (546), Expect = 3e-58,   Method: Compositional matrix adjust.
 Identities = 110/268 (41%), Positives = 169/268 (63%), Gaps = 16/268 (5%)

Query: 16  QIGPWKLGETLGSGSTGKVLLASNETTKQQAAVKVISKAVFEAMNNSESNGDATNALPYN 75
           +IG +++ +TLG GS GKV LA + TT Q+ A+K+I+K +            A + +   
Sbjct: 45  KIGNYQIVKTLGEGSFGKVKLAYHITTGQKVALKIINKKIL-----------AKSDMQGR 93

Query: 76  IEQEIIIMKLLNHPNVLRLFDVWETNSDLYLVLEYAEKGELFNMLVERGPLPENEAVRAF 135
           IE+EI  ++LL HP++++L+DV ++  ++ +V+E+A   ELF+ +++R  + ENEA R F
Sbjct: 94  IEREISYLRLLRHPHIIKLYDVIKSKDEIIIVIEFA-SNELFDYIIQRDKMSENEARRFF 152

Query: 136 RQIIIGISYCHSLGVVHRDLKPEXXXXXXXXXXXXADFGMAALESEDKLLETSCGSPHYA 195
           +QII  + YCH   +VHRDLKPE            ADFG++ + ++   L+TSCGSP+YA
Sbjct: 153 QQIISAVEYCHRHKIVHRDLKPENLLLDEDLNVKIADFGLSNIMTDGNFLKTSCGSPNYA 212

Query: 196 APEIISGLPYEGFSSDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQKGEFEMPDDDE 255
           APE+ISG  Y G   DVWSCGVIL+ +L  RLPFD+E  +I  L   +  G + +P    
Sbjct: 213 APEVISGKLYAGPEVDVWSCGVILYVMLCRRLPFDDE--SIPVLFKNISNGVYILP--KF 268

Query: 256 ITKEAQDLLARLLTVDPSKRITIREILK 283
           ++  A  L+ R+L V+P  RI+I EI++
Sbjct: 269 LSPGASSLIKRMLIVNPLNRISIHEIMQ 296

>AEL230W Chr5 (198401..200227) [1827 bp, 608 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR477W (SNF1)
          Length = 608

 Score =  213 bits (542), Expect = 4e-58,   Method: Compositional matrix adjust.
 Identities = 113/274 (41%), Positives = 172/274 (62%), Gaps = 16/274 (5%)

Query: 10  SVIKNNQIGPWKLGETLGSGSTGKVLLASNETTKQQAAVKVISKAVFEAMNNSESNGDAT 69
           S+    +IG +++ +TLG GS GKV LA + +T Q+ A+K+I+K V            A 
Sbjct: 29  SIPIGQRIGKYQVIKTLGEGSFGKVKLAHHVSTGQKVALKIINKKVL-----------AK 77

Query: 70  NALPYNIEQEIIIMKLLNHPNVLRLFDVWETNSDLYLVLEYAEKGELFNMLVERGPLPEN 129
           + +   IE+EI  ++LL HP++++L+DV ++  ++ +V+EYA   ELF+ +V+R  + EN
Sbjct: 78  SDMQGRIEREISYLRLLRHPHIIKLYDVIKSKDEIIMVIEYA-GNELFDYIVQRDKMSEN 136

Query: 130 EAVRAFRQIIIGISYCHSLGVVHRDLKPEXXXXXXXXXXXXADFGMAALESEDKLLETSC 189
           EA R F+QII  + YCH   +VHRDLKPE            ADFG++ + ++   L+TSC
Sbjct: 137 EARRFFQQIISAVEYCHRHKIVHRDLKPENLLLDEHLNVKIADFGLSNIMTDGNFLKTSC 196

Query: 190 GSPHYAAPEIISGLPYEGFSSDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQKGEFE 249
           GSP+YAAPE+ISG  Y G   DVWS GVIL+ +L  RLPFD+E  +I  L   +  G + 
Sbjct: 197 GSPNYAAPEVISGKLYAGPEVDVWSSGVILYVMLCRRLPFDDE--SIPVLFKNISNGVYS 254

Query: 250 MPDDDEITKEAQDLLARLLTVDPSKRITIREILK 283
           +P    +++ A +L+ R+L V+P  RITI EI++
Sbjct: 255 IP--KFLSQGAANLIKRMLIVNPLNRITIHEIME 286

>NDAI0H00940 Chr8 complement(209645..211702) [2058 bp, 685 aa] {ON}
           Anc_5.611
          Length = 685

 Score =  215 bits (547), Expect = 4e-58,   Method: Compositional matrix adjust.
 Identities = 116/287 (40%), Positives = 175/287 (60%), Gaps = 17/287 (5%)

Query: 16  QIGPWKLGETLGSGSTGKVLLASNETTKQQAAVKVISKAVFEAMNNSESNGDATNALPYN 75
            IG +++ +TLG GS GKV LA + TT Q+ A+K+I+K V            A + +   
Sbjct: 57  HIGNYQIVKTLGEGSFGKVKLAYHMTTGQKVALKIINKKVL-----------AKSDMQGR 105

Query: 76  IEQEIIIMKLLNHPNVLRLFDVWETNSDLYLVLEYAEKGELFNMLVERGPLPENEAVRAF 135
           IE+EI  ++LL HP++++L+DV ++  ++ +V+EYA   ELF+ +V+R  + ENEA R F
Sbjct: 106 IEREISYLRLLRHPHIIKLYDVIKSKDEIIMVMEYA-GNELFDYIVQRDKMSENEARRFF 164

Query: 136 RQIIIGISYCHSLGVVHRDLKPEXXXXXXXXXXXXADFGMAALESEDKLLETSCGSPHYA 195
           +QII  + YCH   +VHRDLKPE            ADFG++ + ++   L+TSCGSP+YA
Sbjct: 165 QQIISAVEYCHRHKIVHRDLKPENLLLDEHLNVKIADFGLSNIMTDGNFLKTSCGSPNYA 224

Query: 196 APEIISGLPYEGFSSDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQKGEFEMPDDDE 255
           APE+ISG  Y G   DVWS GVIL+ +L  RLPFD+E  +I  L   +  G + +P    
Sbjct: 225 APEVISGKLYAGPEVDVWSSGVILYVMLCRRLPFDDE--SIPVLFKNINNGVYTIP--KF 280

Query: 256 ITKEAQDLLARLLTVDPSKRITIREILKHPLLQ-KYPSIKDSRSIRN 301
           +++ A  L+ R+L V+P  RI+I EI++    +   P    S+ +RN
Sbjct: 281 LSQGASSLIKRMLIVNPLNRISISEIMQDEWFKVDLPEYLLSQDLRN 327

>TBLA0E03360 Chr5 complement(838512..840476) [1965 bp, 654 aa] {ON}
           Anc_5.611 YDR477W
          Length = 654

 Score =  213 bits (543), Expect = 7e-58,   Method: Compositional matrix adjust.
 Identities = 110/268 (41%), Positives = 170/268 (63%), Gaps = 16/268 (5%)

Query: 16  QIGPWKLGETLGSGSTGKVLLASNETTKQQAAVKVISKAVFEAMNNSESNGDATNALPYN 75
           +IG +++ +TLG GS GKV LA + TT Q+ A+K+I++ V            A + +   
Sbjct: 40  KIGNYQIIKTLGEGSFGKVKLAYHATTGQKVALKIINRKVL-----------AKSDMQGR 88

Query: 76  IEQEIIIMKLLNHPNVLRLFDVWETNSDLYLVLEYAEKGELFNMLVERGPLPENEAVRAF 135
           IE+EI  ++LL HP++++L+DV ++  ++ +V+EYA+  ELF+ +V+R  + E EA R F
Sbjct: 89  IEREISYLRLLRHPHIIKLYDVIKSKDEIIMVIEYAD-NELFDYIVQRDKMSEQEARRFF 147

Query: 136 RQIIIGISYCHSLGVVHRDLKPEXXXXXXXXXXXXADFGMAALESEDKLLETSCGSPHYA 195
           +QII  + YCH   +VHRDLKPE            ADFG++ + ++   L+TSCGSP+YA
Sbjct: 148 QQIISAVDYCHRHKIVHRDLKPENLLLDEHLNVKIADFGLSNIMTDGNFLKTSCGSPNYA 207

Query: 196 APEIISGLPYEGFSSDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQKGEFEMPDDDE 255
           APE+ISG  Y G   DVWSCGVIL+ +L  RLPFD+E  +I  L   +  G + +P    
Sbjct: 208 APEVISGKLYAGPEVDVWSCGVILYVMLCRRLPFDDE--SIPVLFKNINNGIYTLP--RF 263

Query: 256 ITKEAQDLLARLLTVDPSKRITIREILK 283
           +++ A  L+ ++L V+P  RI+I EI++
Sbjct: 264 LSEGASSLIKKMLIVNPLNRISIHEIMQ 291

>SAKL0G06952g Chr7 (570584..572383) [1800 bp, 599 aa] {ON} similar
           to uniprot|P06782 Saccharomyces cerevisiae YDR477W SNF1
           Protein serine/threonine kinase required for release
           from glucose repression invertase expression sporulation
           and for expression of catabolite-repressed genes when
           glucose is limiting regulates Adr1p-dependent
           transcription primarily at the level of chromatin
           binding
          Length = 599

 Score =  212 bits (539), Expect = 9e-58,   Method: Compositional matrix adjust.
 Identities = 112/268 (41%), Positives = 169/268 (63%), Gaps = 16/268 (5%)

Query: 16  QIGPWKLGETLGSGSTGKVLLASNETTKQQAAVKVISKAVFEAMNNSESNGDATNALPYN 75
           +IG +++ +TLG GS GKV LA + TT Q+ A+K+I+K V            A + +   
Sbjct: 28  RIGKYQIIKTLGEGSFGKVKLAYHITTGQKVALKIINKKVL-----------AKSDMQGR 76

Query: 76  IEQEIIIMKLLNHPNVLRLFDVWETNSDLYLVLEYAEKGELFNMLVERGPLPENEAVRAF 135
           IE+EI  ++LL HP++++L+DV ++  ++ +V+EYA   ELF+ +V+R  + E+EA R F
Sbjct: 77  IEREISYLRLLRHPHIIKLYDVIKSKDEIVMVIEYA-GNELFDYIVQRDKMNEDEARRFF 135

Query: 136 RQIIIGISYCHSLGVVHRDLKPEXXXXXXXXXXXXADFGMAALESEDKLLETSCGSPHYA 195
           +QII  + YCH   +VHRDLKPE            ADFG++ + ++   L+TSCGSP+YA
Sbjct: 136 QQIISAVEYCHRHKIVHRDLKPENLLLDEHLNVKIADFGLSNIMTDGNFLKTSCGSPNYA 195

Query: 196 APEIISGLPYEGFSSDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQKGEFEMPDDDE 255
           APE+ISG  Y G   DVWS GVIL+ +L  RLPFD+E  +I  L   +  G + +P    
Sbjct: 196 APEVISGKLYAGPEVDVWSSGVILYVMLCRRLPFDDE--SIPVLFKNISNGVYTLP--KF 251

Query: 256 ITKEAQDLLARLLTVDPSKRITIREILK 283
           ++  A +L+ R+L V+P  RITI EI++
Sbjct: 252 LSPGASNLIKRMLIVNPLNRITIHEIMQ 279

>TPHA0D02840 Chr4 (591733..593637) [1905 bp, 634 aa] {ON} 
          Length = 634

 Score =  213 bits (541), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 109/267 (40%), Positives = 168/267 (62%), Gaps = 16/267 (5%)

Query: 16  QIGPWKLGETLGSGSTGKVLLASNETTKQQAAVKVISKAVFEAMNNSESNGDATNALPYN 75
           +IG +++ +TLG GS GKV LA + TT Q+ A+K+I+K V            A + +   
Sbjct: 64  RIGNYQIIKTLGEGSFGKVKLAYHVTTNQKVALKIINKKVL-----------AKSDMQGR 112

Query: 76  IEQEIIIMKLLNHPNVLRLFDVWETNSDLYLVLEYAEKGELFNMLVERGPLPENEAVRAF 135
           +E+EI  ++LL HP++++L+DV ++  ++ +V+EYA   ELF  +V+R  + ENEA + F
Sbjct: 113 VEREISFLRLLRHPHIIKLYDVIKSKDEIIMVIEYA-NNELFEYIVQRDKMTENEARKFF 171

Query: 136 RQIIIGISYCHSLGVVHRDLKPEXXXXXXXXXXXXADFGMAALESEDKLLETSCGSPHYA 195
           +QII  + YCH   +VHRDLKPE            ADFG++ + ++   L+TSCGSP+YA
Sbjct: 172 QQIISAVEYCHRHKIVHRDLKPENLLLDENLNVKIADFGLSNIMTDGNFLKTSCGSPNYA 231

Query: 196 APEIISGLPYEGFSSDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQKGEFEMPDDDE 255
           APE+ISG  Y G   DVWSCGVIL+ +L  RLPFD  D +I  L   +  G + +P    
Sbjct: 232 APEVISGKLYAGPEVDVWSCGVILYVMLCRRLPFD--DDSIPALFKNISNGIYTLP--KF 287

Query: 256 ITKEAQDLLARLLTVDPSKRITIREIL 282
           +++ A +L+ ++L V+P  RI++ EI+
Sbjct: 288 LSEGAANLIKKMLIVNPLNRISMTEII 314

>KLTH0G05698g Chr7 (453530..455323) [1794 bp, 597 aa] {ON} similar
           to uniprot|P06782 Saccharomyces cerevisiae YDR477W SNF1
           Protein serine/threonine kinase required for release
           from glucose repression invertase expression sporulation
           and for expression of catabolite- repressed genes when
           glucose is limiting regulates Adr1p- dependent
           transcription primarily at the level of chromatin
           binding
          Length = 597

 Score =  211 bits (538), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 113/271 (41%), Positives = 171/271 (63%), Gaps = 16/271 (5%)

Query: 13  KNNQIGPWKLGETLGSGSTGKVLLASNETTKQQAAVKVISKAVFEAMNNSESNGDATNAL 72
           ++ +IG +++ +TLG GS GKV LA + TT Q+ A+K+I+K V   +  S+  G      
Sbjct: 23  QDQRIGKYQIIKTLGEGSFGKVKLAYHVTTGQKVALKIINKKV---LAKSDMQG------ 73

Query: 73  PYNIEQEIIIMKLLNHPNVLRLFDVWETNSDLYLVLEYAEKGELFNMLVERGPLPENEAV 132
              IE+EI  ++LL HP++++L+DV ++  ++ +V+EYA   ELF+ +V+R  + E EA 
Sbjct: 74  --RIEREISYLRLLRHPHIIKLYDVIKSKDEIVMVIEYA-GNELFDYIVQRDKMSEREAR 130

Query: 133 RAFRQIIIGISYCHSLGVVHRDLKPEXXXXXXXXXXXXADFGMAALESEDKLLETSCGSP 192
           R F+QII  + YCH   +VHRDLKPE            ADFG++ + ++   L+TSCGSP
Sbjct: 131 RFFQQIISAVEYCHRHKIVHRDLKPENLLLDEHLNVKIADFGLSNIMTDGNFLKTSCGSP 190

Query: 193 HYAAPEIISGLPYEGFSSDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQKGEFEMPD 252
           +YAAPE+ISG  Y G   DVWS GVIL+ +L  RLPFD+E  +I  L   +  G + +P 
Sbjct: 191 NYAAPEVISGKLYAGPEVDVWSSGVILYVMLCRRLPFDDE--SIPILFKNISNGIYTLP- 247

Query: 253 DDEITKEAQDLLARLLTVDPSKRITIREILK 283
              ++  A +L+ R+L V+P  RITI EI++
Sbjct: 248 -KFLSPGAANLIKRMLIVNPLNRITIHEIME 277

>KNAG0B03230 Chr2 complement(625072..626997) [1926 bp, 641 aa] {ON}
           Anc_5.611 YDR477W
          Length = 641

 Score =  212 bits (539), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 111/273 (40%), Positives = 169/273 (61%), Gaps = 16/273 (5%)

Query: 16  QIGPWKLGETLGSGSTGKVLLASNETTKQQAAVKVISKAVFEAMNNSESNGDATNALPYN 75
           +IG +++ +TLG GS GKV LA + TT Q+ A+K+I+K V            A + +   
Sbjct: 41  RIGNYQIVKTLGEGSFGKVKLAYHITTNQKVALKIINKKVL-----------AKSDMQGR 89

Query: 76  IEQEIIIMKLLNHPNVLRLFDVWETNSDLYLVLEYAEKGELFNMLVERGPLPENEAVRAF 135
           IE+EI  ++LL HP++++L+DV ++  ++ +V+E+A   ELF+ +++R  + E EA R F
Sbjct: 90  IEREISYLRLLRHPHIIKLYDVIKSKDEIIIVIEFA-SNELFDYIIQRDKMSEQEARRFF 148

Query: 136 RQIIIGISYCHSLGVVHRDLKPEXXXXXXXXXXXXADFGMAALESEDKLLETSCGSPHYA 195
           +QII  + YCH   +VHRDLKPE            ADFG++ + ++   L+TSCGSP+YA
Sbjct: 149 QQIISAVEYCHRHKIVHRDLKPENLLLDEDLNVKIADFGLSNIMTDGNFLKTSCGSPNYA 208

Query: 196 APEIISGLPYEGFSSDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQKGEFEMPDDDE 255
           APE+ISG  Y G   DVWSCGVIL+ +L  RLPFD+E  +I  L   +  G + +P    
Sbjct: 209 APEVISGKLYAGPEVDVWSCGVILYVMLCRRLPFDDE--SIPVLFKNISNGVYILP--KF 264

Query: 256 ITKEAQDLLARLLTVDPSKRITIREILKHPLLQ 288
           ++  A +L+ ++L V+P  RI+I EI K    Q
Sbjct: 265 LSLGAANLIKKMLIVNPLNRISISEIFKDEWFQ 297

>Ecym_5588 Chr5 complement(1205102..1206943) [1842 bp, 613 aa] {ON}
           similar to Ashbya gossypii AEL230W
          Length = 613

 Score =  211 bits (536), Expect = 3e-57,   Method: Compositional matrix adjust.
 Identities = 111/268 (41%), Positives = 169/268 (63%), Gaps = 16/268 (5%)

Query: 16  QIGPWKLGETLGSGSTGKVLLASNETTKQQAAVKVISKAVFEAMNNSESNGDATNALPYN 75
           +IG +++ +TLG GS GKV LA + +T Q+ A+K+I+K V            A + +   
Sbjct: 39  RIGKYQVIKTLGEGSFGKVKLAYHVSTSQKVALKIINKKVL-----------AKSDMQGR 87

Query: 76  IEQEIIIMKLLNHPNVLRLFDVWETNSDLYLVLEYAEKGELFNMLVERGPLPENEAVRAF 135
           IE+EI  ++LL HP++++L+DV ++  ++ +V+EYA   ELF+ +V+R  + ENEA R F
Sbjct: 88  IEREISYLRLLRHPHIIKLYDVIKSKDEIIMVIEYA-GNELFDYIVQRDKMSENEARRFF 146

Query: 136 RQIIIGISYCHSLGVVHRDLKPEXXXXXXXXXXXXADFGMAALESEDKLLETSCGSPHYA 195
           +QII  + YCH   +VHRDLKPE            ADFG++ + ++   L+TSCGSP+YA
Sbjct: 147 QQIISAVEYCHRHKIVHRDLKPENLLLDEHLNVKIADFGLSNIMTDGNFLKTSCGSPNYA 206

Query: 196 APEIISGLPYEGFSSDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQKGEFEMPDDDE 255
           APE+ISG  Y G   DVWS GVIL+ +L  RLPFD+E  +I  L   +  G + +P    
Sbjct: 207 APEVISGKLYAGPEVDVWSSGVILYVMLCRRLPFDDE--SIPVLFKNISNGVYSIP--KF 262

Query: 256 ITKEAQDLLARLLTVDPSKRITIREILK 283
           ++  A +L+ ++L V+P  RITI EI++
Sbjct: 263 LSPGAANLIKKMLIVNPLNRITIHEIME 290

>TDEL0A04780 Chr1 (842715..844580) [1866 bp, 621 aa] {ON} Anc_5.611
           YDR477W
          Length = 621

 Score =  210 bits (535), Expect = 4e-57,   Method: Compositional matrix adjust.
 Identities = 111/268 (41%), Positives = 167/268 (62%), Gaps = 16/268 (5%)

Query: 16  QIGPWKLGETLGSGSTGKVLLASNETTKQQAAVKVISKAVFEAMNNSESNGDATNALPYN 75
           +IG +++ +TLG GS GKV LA + TT Q+ A+K+I+K V            A + +   
Sbjct: 38  RIGNYQIVKTLGEGSFGKVKLAYHVTTGQKVALKIINKKVL-----------AKSDMQGR 86

Query: 76  IEQEIIIMKLLNHPNVLRLFDVWETNSDLYLVLEYAEKGELFNMLVERGPLPENEAVRAF 135
           IE+EI  ++LL HP++++L+DV ++  ++ +V+EYA   ELF+ +V+R  + E EA R F
Sbjct: 87  IEREISYLRLLRHPHIIKLYDVIKSKDEIIMVIEYA-GNELFDYIVQRDKMSEKEARRFF 145

Query: 136 RQIIIGISYCHSLGVVHRDLKPEXXXXXXXXXXXXADFGMAALESEDKLLETSCGSPHYA 195
           +QII  + YCH   +VHRDLKPE            ADFG++ + ++   L+TSCGSP+YA
Sbjct: 146 QQIISAVEYCHRHKIVHRDLKPENLLLDEHLNVKIADFGLSNIMTDGNFLKTSCGSPNYA 205

Query: 196 APEIISGLPYEGFSSDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQKGEFEMPDDDE 255
           APE+ISG  Y G   DVWS GVIL+ +L  RLPFD+E  +I  L   +  G + +P    
Sbjct: 206 APEVISGKLYAGPEVDVWSSGVILYVMLCRRLPFDDE--SIPVLFKNISNGVYTLP--KF 261

Query: 256 ITKEAQDLLARLLTVDPSKRITIREILK 283
           ++  A  L+ R+L V+P  RI+I EI++
Sbjct: 262 LSPGAAGLIKRMLIVNPLNRISIHEIMQ 289

>ZYRO0A05544g Chr1 (450809..452704) [1896 bp, 631 aa] {ON} highly
           similar to uniprot|P06782 Saccharomyces cerevisiae
           YDR477W SNF1 Protein serine/threonine kinase required
           for release from glucose repression invertase expression
           sporulation and for expression of catabolite- repressed
           genes when glucose is limiting regulates Adr1p-
           dependent transcription primarily at the level of
           chromatin binding
          Length = 631

 Score =  208 bits (530), Expect = 3e-56,   Method: Compositional matrix adjust.
 Identities = 111/268 (41%), Positives = 167/268 (62%), Gaps = 16/268 (5%)

Query: 16  QIGPWKLGETLGSGSTGKVLLASNETTKQQAAVKVISKAVFEAMNNSESNGDATNALPYN 75
            IG +++ +TLG GS GKV LA + TT Q+ A+K+I+K V            A + +   
Sbjct: 47  HIGNYQIVKTLGEGSFGKVKLAYHITTGQKVALKIINKKVL-----------AKSDMQGR 95

Query: 76  IEQEIIIMKLLNHPNVLRLFDVWETNSDLYLVLEYAEKGELFNMLVERGPLPENEAVRAF 135
           IE+EI  ++LL HP++++L+DV ++  ++ +V+EYA   ELF+ +V+R  + E EA R F
Sbjct: 96  IEREISYLRLLRHPHIIKLYDVIKSKDEIIMVIEYA-GNELFDYIVQRDKMSEEEARRFF 154

Query: 136 RQIIIGISYCHSLGVVHRDLKPEXXXXXXXXXXXXADFGMAALESEDKLLETSCGSPHYA 195
           +QII  + YCH   +VHRDLKPE            ADFG++ + ++   L+TSCGSP+YA
Sbjct: 155 QQIISAVEYCHRHKIVHRDLKPENLLLDEHLNVKIADFGLSNIMTDGNFLKTSCGSPNYA 214

Query: 196 APEIISGLPYEGFSSDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQKGEFEMPDDDE 255
           APE+ISG  Y G   DVWS GVIL+ +L  RLPFD+E  +I  L   +  G + +P    
Sbjct: 215 APEVISGKLYAGPEVDVWSSGVILYVMLCRRLPFDDE--SIPVLFKNISNGVYTLP--KF 270

Query: 256 ITKEAQDLLARLLTVDPSKRITIREILK 283
           +++ A  L+ R+L V+P  RI+I EI++
Sbjct: 271 LSEGAAGLIKRMLIVNPLNRISILEIMQ 298

>KNAG0J01590 Chr10 (292565..294982) [2418 bp, 805 aa] {ON} Anc_8.654
           YPL141C
          Length = 805

 Score =  194 bits (493), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 112/316 (35%), Positives = 168/316 (53%), Gaps = 22/316 (6%)

Query: 13  KNNQIGPWKLGETLGSGSTGKVLLASNETTKQQAAVKVISKAVFEAMNNSESNGDATNAL 72
           K    GP+ +G TLG G  GKV +        +    V  +   + +     + D +  +
Sbjct: 35  KCPSFGPYLIGSTLGQGGFGKVKMGWTTPMGNKGIYDVPKQVAIKLIKRDSISNDKSKEV 94

Query: 73  PYNIEQEIIIMKLLNHPNVLRLFDVWETNSDLYLVLEYAEKGELFNMLVERGPLPENEAV 132
              I +EI  +K L+HPN+++L +V + +  + +VLEYA  GE +  + +R  L E+ A 
Sbjct: 95  --KIYREINALKQLHHPNIVKLEEVLQNSKYIGIVLEYASGGEFYKYIQKRRVLKEHVAC 152

Query: 133 RAFRQIIIGISYCHSLGVVHRDLKPEXXXXXXXXXXXXADFGMA-ALESEDKLLETSCGS 191
           R F Q+I G+ Y HS G+VHRDLK E             DFG      S+++L+ TSCGS
Sbjct: 153 RLFAQLISGVHYIHSKGLVHRDLKLENLLLDKHENLIITDFGFVNEYFSQNELMTTSCGS 212

Query: 192 PHYAAPE-IISGLPYEGFSSDVWSCGVILFALLTGRLPFDEEDGN-----IRNLLLKVQK 245
           P YAAPE +IS  PY+G  +D+WSCG+ILFA+L G LP+D++  N     I  L   +  
Sbjct: 213 PCYAAPELVISTQPYQGRRADLWSCGIILFAMLAGYLPWDDDKDNPDGEDIAKLYYYITH 272

Query: 246 GEFEMPDDDEITKEAQDLLARLLTVDPSKRITIREILKHPLLQKYPS-----------IK 294
              + P  + IT   +DLL R+L  DP +R+T+REI  H  L+K+             I 
Sbjct: 273 TALKFP--EYITPIPRDLLRRILVADPRRRVTLREIQGHQWLKKHAQFLSIQPEEWDRIS 330

Query: 295 DSRSIRNLPREDTYLS 310
            S++I  LP+ + + S
Sbjct: 331 QSKNITRLPKHNKHYS 346

>Kwal_26.8709 s26 (907885..910374) [2490 bp, 829 aa] {ON} YPL141C -
           Hypothetical ORF [contig 67] FULL
          Length = 829

 Score =  194 bits (493), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 114/297 (38%), Positives = 164/297 (55%), Gaps = 37/297 (12%)

Query: 13  KNNQIGPWKLGETLGSGSTGKVLLASNETTK------QQAAVKVISKAVFEAMNNSESNG 66
           K+   GP+ +G TLG G  GKV L  ++T+       +Q A+K+I +             
Sbjct: 33  KHVTFGPYIVGSTLGEGEFGKVKLGWSKTSNSSMDVPKQVAIKLIRR------------- 79

Query: 67  DATNALPYNIEQEIII------MKLLNHPNVLRLFDVWETNSDLYLVLEYAEKGELFNML 120
              + +P N E+EI I      +K LNHPN++RL +V + +  + +VLEYA  GE +  +
Sbjct: 80  ---DTIPKNSEKEIKIYREINALKHLNHPNIVRLEEVLQNSKYIGIVLEYASGGEFYKYI 136

Query: 121 VERGPLPENEAVRAFRQIIIGISYCHSLGVVHRDLKPEXXXXXXXXXXXXADFGMA-ALE 179
            ++  L E  A R F Q+I G+ Y HS G+VHRDLK E             DFG      
Sbjct: 137 QKKRRLKEGPACRLFAQLISGVYYMHSKGLVHRDLKLENLLLDKNENLLITDFGFVNEFL 196

Query: 180 SEDKLLETSCGSPHYAAPE-IISGLPYEGFSSDVWSCGVILFALLTGRLPFDEE----DG 234
            E++L++TSCGSP YAAPE +++  PYE   +DVWSCGVIL+A+L G LP+D++    DG
Sbjct: 197 PENELMKTSCGSPCYAAPELVVTARPYEARKADVWSCGVILYAMLAGYLPWDDDPENPDG 256

Query: 235 -NIRNLLLKVQKGEFEMPDDDEITKEAQDLLARLLTVDPSKRITIREILKHPLLQKY 290
            +I  L   + +   + P  D I    +DLL  +L  DP +RITI + LKH  LQ +
Sbjct: 257 DDIGKLYRYITRTPLKFP--DYIAPVPRDLLREILIPDPKRRITISKTLKHQWLQPH 311

>ZYRO0F06842g Chr6 (561269..563800) [2532 bp, 843 aa] {ON} similar
           to Saccharomyces cerevisiae YPL141C and to YOR233W
           uniprot|Q01919 Saccharomyces cerevisiae YOR233W KIN4
           Nonessential protein kinase with unknown cellular role
          Length = 843

 Score =  192 bits (488), Expect = 8e-50,   Method: Compositional matrix adjust.
 Identities = 113/293 (38%), Positives = 165/293 (56%), Gaps = 37/293 (12%)

Query: 17  IGPWKLGETLGSGSTGKVLL------ASNETTKQQAAVKVISKAVFEAMNNSESNGDATN 70
            GP+ +G TLG G  GKV L      +S+    +Q A+K+I +                +
Sbjct: 36  FGPYIVGSTLGEGEFGKVKLGWSKAASSSLEVPKQVAIKLIRR----------------D 79

Query: 71  ALPYNIEQEIII------MKLLNHPNVLRLFDVWETNSDLYLVLEYAEKGELFNMLVERG 124
           ++P N E+E+ I      +K L+HPN+++L +V + +  + +VLEYA  GE +  +  + 
Sbjct: 80  SIPKNSEKEVKIYREINALKHLSHPNIVKLEEVLQNSKYIGIVLEYASGGEFYKYIQRKR 139

Query: 125 PLPENEAVRAFRQIIIGISYCHSLGVVHRDLKPEXXXXXXXXXXXXADFGMA-ALESEDK 183
            L E  A R F Q++ G++Y HS G+VHRDLK E             DFG      S ++
Sbjct: 140 RLKEAIACRLFAQLVSGVNYMHSKGLVHRDLKLENLLLDKHENLVITDFGFVNEFVSHNE 199

Query: 184 LLETSCGSPHYAAPE-IISGLPYEGFSSDVWSCGVILFALLTGRLPFDEE----DGN-IR 237
           L++TSCGSP YAAPE ++S  PYE   SDVWSCGVIL+A+L G LP+D++    DGN I 
Sbjct: 200 LMKTSCGSPCYAAPELVVSTKPYEARKSDVWSCGVILYAMLAGYLPWDDDPKNPDGNDIV 259

Query: 238 NLLLKVQKGEFEMPDDDEITKEAQDLLARLLTVDPSKRITIREILKHPLLQKY 290
            L   + +   + P  + IT  ++DLL R+L  DP KRIT+R I KH  L+ +
Sbjct: 260 RLYYYITRTPLKFP--EYITPLSRDLLRRILVSDPKKRITLRSIHKHEWLKPH 310

>KLTH0D10714g Chr4 (880389..883007) [2619 bp, 872 aa] {ON} similar
           to uniprot|Q03002 Saccharomyces cerevisiae YPL141C
           Hypothetical ORF
          Length = 872

 Score =  192 bits (488), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 111/291 (38%), Positives = 162/291 (55%), Gaps = 25/291 (8%)

Query: 13  KNNQIGPWKLGETLGSGSTGKVLLASNETTK------QQAAVKVISKAVFEAMNNSESNG 66
           K+   GP+ +G TLG G  GKV +  ++T+       +Q A+K+I +       NSE   
Sbjct: 33  KHVTFGPYIVGSTLGEGEFGKVKMGWSKTSSSSMDVPKQVAIKLIRRDTIP--KNSEKE- 89

Query: 67  DATNALPYNIEQEIIIMKLLNHPNVLRLFDVWETNSDLYLVLEYAEKGELFNMLVERGPL 126
                    I +EI  +K LNHPN++RL +V + +  + +VLEYA  GE +  + ++  L
Sbjct: 90  -------VKIYREINALKHLNHPNIVRLEEVLQNSKYIGIVLEYASGGEFYKYIQKKRRL 142

Query: 127 PENEAVRAFRQIIIGISYCHSLGVVHRDLKPEXXXXXXXXXXXXADFGMA-ALESEDKLL 185
            E+ A R F Q+I G+ Y HS G+VHRDLK E             DFG       E++L+
Sbjct: 143 KESAACRLFAQLISGVYYMHSKGLVHRDLKLENLLLDKNENLLITDFGFVNEFLPENELM 202

Query: 186 ETSCGSPHYAAPE-IISGLPYEGFSSDVWSCGVILFALLTGRLPFDEE----DG-NIRNL 239
           +TSCGSP YAAPE +++  PYE   +D+WSCGVI++A+L G LP+D++    DG +I  L
Sbjct: 203 KTSCGSPCYAAPELVVTARPYEARKADIWSCGVIMYAMLAGYLPWDDDPENPDGDDIGKL 262

Query: 240 LLKVQKGEFEMPDDDEITKEAQDLLARLLTVDPSKRITIREILKHPLLQKY 290
              + +   + P  D I    +DLL  +L  DP KRITI + L H  LQ +
Sbjct: 263 YRYITRTPLKFP--DYIAPVPRDLLRAILVADPKKRITIAQTLHHQWLQPH 311

>Kpol_1072.29 s1072 complement(61987..64668) [2682 bp, 893 aa] {ON}
           complement(61987..64668) [2682 nt, 894 aa]
          Length = 893

 Score =  191 bits (486), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 112/300 (37%), Positives = 166/300 (55%), Gaps = 27/300 (9%)

Query: 6   SNTVSVIKNNQI--GPWKLGETLGSGSTGKVLLA------SNETTKQQAAVKVISKAVFE 57
           S+ +S +K  QI  GP+ +G TLG G  GKV L       SN+   +Q A+K+I +   +
Sbjct: 28  SDRLSKLKRKQITFGPYYIGSTLGEGEFGKVKLGWTRNPTSNQEVSKQVAIKLIRRD--K 85

Query: 58  AMNNSESNGDATNALPYNIEQEIIIMKLLNHPNVLRLFDVWETNSDLYLVLEYAEKGELF 117
            + NSE            I +EI  +K L HPN+++L +V + +  + +VLEYA  GE +
Sbjct: 86  IVKNSEKE--------IKIFREINALKHLTHPNIVKLEEVLQNSKYIGIVLEYASGGEFY 137

Query: 118 NMLVERGPLPENEAVRAFRQIIIGISYCHSLGVVHRDLKPEXXXXXXXXXXXXADFGMA- 176
             +  +  L E    R F Q++ G++Y HS G+VHRDLK E             DFG   
Sbjct: 138 RYIQRKRRLKETAGCRLFTQLVSGVNYMHSKGLVHRDLKLENLLLDKHENLVITDFGFVN 197

Query: 177 ALESEDKLLETSCGSPHYAAPE-IISGLPYEGFSSDVWSCGVILFALLTGRLPFDEEDGN 235
               ++ L++TSCGSP YAAPE +IS  PYE   +D+WSCG+IL+A+L G LP+D++  N
Sbjct: 198 EFLKDNDLMKTSCGSPCYAAPELVISTKPYEARKADIWSCGIILYAMLAGYLPWDDDPQN 257

Query: 236 -----IRNLLLKVQKGEFEMPDDDEITKEAQDLLARLLTVDPSKRITIREILKHPLLQKY 290
                I  L   + +   + P  + I+   +DLL RLL  DP KR+ IR+I +H  L+ +
Sbjct: 258 PEGDDIARLYYFITRTSLKFP--EYISPIPRDLLRRLLVSDPRKRLNIRQIQQHEWLRPH 315

>TPHA0G01710 Chr7 complement(350452..352869) [2418 bp, 805 aa] {ON}
           Anc_8.654 YPL141C
          Length = 805

 Score =  190 bits (483), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 108/283 (38%), Positives = 158/283 (55%), Gaps = 24/283 (8%)

Query: 17  IGPWKLGETLGSGSTGKVLLASNETTKQ-----QAAVKVISKAVFEAMNNSESNGDATNA 71
            GP+ +G TLG G  GKV L   +TT +     Q A+K+I +     +N SE        
Sbjct: 37  FGPYYVGSTLGEGEFGKVKLGWTKTTSKLEMPKQVAIKLIRRDAI--LNYSEKETK---- 90

Query: 72  LPYNIEQEIIIMKLLNHPNVLRLFDVWETNSDLYLVLEYAEKGELFNMLVERGPLPENEA 131
               I +EI  +K L HPN+++L +V + +  + +VLE+A  GE +  + ++  L E  A
Sbjct: 91  ----IYREINALKHLTHPNIVKLEEVLQNSKYIGIVLEFASGGEFYKYIQKKRRLKETPA 146

Query: 132 VRAFRQIIIGISYCHSLGVVHRDLKPEXXXXXXXXXXXXADFGMA-ALESEDKLLETSCG 190
            R F Q++ G+ Y HS G+VHRDLK E             DFG        ++L++TSCG
Sbjct: 147 CRLFAQLVSGVHYMHSKGLVHRDLKLENLLLDKHENLIITDFGFVNEFSQRNELMKTSCG 206

Query: 191 SPHYAAPE-IISGLPYEGFSSDVWSCGVILFALLTGRLPFDEE----DG-NIRNLLLKVQ 244
           SP YAAPE +++  PYE   +DVWSCG+IL+A+L G LP+D++    DG +I  L L + 
Sbjct: 207 SPCYAAPELVVTTEPYEARKADVWSCGIILYAMLAGYLPWDDDPQNPDGDDIAKLYLYIT 266

Query: 245 KGEFEMPDDDEITKEAQDLLARLLTVDPSKRITIREILKHPLL 287
           K   + P  + I    +DLL ++L  DP+KR+ IR I KH  L
Sbjct: 267 KTALKFP--EYINPIQRDLLRKILVSDPTKRLNIRNIEKHEWL 307

>NDAI0E02320 Chr5 (480203..483001) [2799 bp, 932 aa] {ON} 
          Length = 932

 Score =  191 bits (485), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 108/291 (37%), Positives = 159/291 (54%), Gaps = 29/291 (9%)

Query: 17  IGPWKLGETLGSGSTGKVLLA----------SNETTKQQAAVKVISKAVFEAMNNSESNG 66
            GP+ +G T+G G  GKV L           +N    +Q A+K+I +             
Sbjct: 66  FGPYIIGSTIGQGEFGKVKLGWSKNPPSSPPNNLGISKQVAIKLIKRDAISK-------- 117

Query: 67  DATNALPYNIEQEIIIMKLLNHPNVLRLFDVWETNSDLYLVLEYAEKGELFNMLVERGPL 126
           D++  L   I +EI  +K L+HPN+++L +V + +  + +VLEYA  GE +  +  +  L
Sbjct: 118 DSSKEL--KIYREINALKHLSHPNIVKLEEVLQNSRYIGIVLEYASGGEFYRYIQRKKRL 175

Query: 127 PENEAVRAFRQIIIGISYCHSLGVVHRDLKPEXXXXXXXXXXXXADFGMA-ALESEDKLL 185
            E  A R F Q+I G+ Y HS G+VHRDLK E             DFG      S ++L+
Sbjct: 176 KETAACRLFAQLINGVHYIHSKGLVHRDLKLENLLLDKHENLVITDFGFVNEFYSHNELM 235

Query: 186 ETSCGSPHYAAPE-IISGLPYEGFSSDVWSCGVILFALLTGRLPFDEEDGN-----IRNL 239
           +TSCGSP YAAPE +IS  PYE   +D+WSCG+IL+A+L G LP+D++ GN     I  L
Sbjct: 236 KTSCGSPCYAAPELVISTKPYEARKADIWSCGIILYAMLAGYLPWDDDSGNPDGDDISRL 295

Query: 240 LLKVQKGEFEMPDDDEITKEAQDLLARLLTVDPSKRITIREILKHPLLQKY 290
              + K   + P  D I    +DLL ++L  DP +RIT+++I KH  L+ +
Sbjct: 296 YYYITKTPLKFP--DYINPIPRDLLRKILVSDPRRRITMKQIEKHEWLKPH 344

>NCAS0C01590 Chr3 (293327..295921) [2595 bp, 864 aa] {ON} Anc_8.654
          Length = 864

 Score =  189 bits (481), Expect = 7e-49,   Method: Compositional matrix adjust.
 Identities = 107/287 (37%), Positives = 157/287 (54%), Gaps = 13/287 (4%)

Query: 13  KNNQIGPWKLGETLGSGSTGKVLLA--SNETTKQQAAVKVISKAVFEAMNNSESNGDATN 70
           K+   GP+ +G TLG G  GKV L    N      + + V  +   + +     + D++ 
Sbjct: 41  KHVTFGPYIIGSTLGEGEFGKVKLGWPKNSLPSSSSGIDVPKQVAIKLIRRDTISKDSSK 100

Query: 71  ALPYNIEQEIIIMKLLNHPNVLRLFDVWETNSDLYLVLEYAEKGELFNMLVERGPLPENE 130
            +   I +EI  +K L HPN+++L +V + +  + +VLEYA  GE +  +  +  L E  
Sbjct: 101 EI--KIYREINALKHLTHPNIVKLEEVLQNSKYIGIVLEYASGGEFYKYIQRKKRLKEGP 158

Query: 131 AVRAFRQIIIGISYCHSLGVVHRDLKPEXXXXXXXXXXXXADFGMAA-LESEDKLLETSC 189
           A R F Q+I G+ Y HS G+VHRDLK E             DFG  +   S  +L++TSC
Sbjct: 159 ACRLFAQLINGVHYIHSKGLVHRDLKLENLLLDKHENLIITDFGFVSEFYSHGELMKTSC 218

Query: 190 GSPHYAAPE-IISGLPYEGFSSDVWSCGVILFALLTGRLPFDEEDGN-----IRNLLLKV 243
           GSP YAAPE ++S  PYE   +D+WSCGVIL+A+L G LP+D++ GN     I  L   +
Sbjct: 219 GSPCYAAPELVVSTKPYEAKKADIWSCGVILYAMLAGYLPWDDDAGNPDGDDISRLYHYI 278

Query: 244 QKGEFEMPDDDEITKEAQDLLARLLTVDPSKRITIREILKHPLLQKY 290
            +   + P  D I    +DLL R+L  DP +RITI+ I KH  L+ +
Sbjct: 279 TQTPLKFP--DYINPIPRDLLRRILISDPRRRITIKYIEKHEWLKPH 323

>TDEL0A06000 Chr1 (1053427..1055799) [2373 bp, 790 aa] {ON}
           Anc_8.654 YPL141C
          Length = 790

 Score =  187 bits (476), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 108/284 (38%), Positives = 159/284 (55%), Gaps = 24/284 (8%)

Query: 13  KNNQIGPWKLGETLGSGSTGKVLLASNETTK-----QQAAVKVISKAVFEAMNNSESNGD 67
           K+   GP+ LG TLG G  G+V L  ++ T      +Q A+K+I +      ++ E    
Sbjct: 37  KHVTFGPYILGSTLGEGEFGRVKLGWSKNTSPNEVSKQVAIKLIRRDTIPKNSDKE---- 92

Query: 68  ATNALPYNIEQEIIIMKLLNHPNVLRLFDVWETNSDLYLVLEYAEKGELFNMLVERGPLP 127
                   I +EI  +K L+HPN+++L +V + +  + +VLEYA  GE +  + ++  L 
Sbjct: 93  ------IKIYREINALKHLSHPNIVKLEEVLQNSKYIGIVLEYASGGEFYKYIQKKRRLK 146

Query: 128 ENEAVRAFRQIIIGISYCHSLGVVHRDLKPEXXXXXXXXXXXXADFGMA-ALESEDKLLE 186
           E  A R F Q+I G+ Y HS G+VHRDLK E             DFG      +  +L++
Sbjct: 147 EAVACRLFAQLISGVQYMHSKGLVHRDLKLENLLLDKHENLVITDFGFVNEFFAHSELMK 206

Query: 187 TSCGSPHYAAPE-IISGLPYEGFSSDVWSCGVILFALLTGRLPFDEE----DGN-IRNLL 240
           TSCGSP YAAPE ++S  PYE   +D+WSCGVIL+A+L G LP+D++    DGN I  L 
Sbjct: 207 TSCGSPCYAAPELVVSSKPYEARKADIWSCGVILYAMLAGYLPWDDDTKNPDGNDIGKLY 266

Query: 241 LKVQKGEFEMPDDDEITKEAQDLLARLLTVDPSKRITIREILKH 284
             + +   + P  + IT   +DLL R+L  DP +RI++R I KH
Sbjct: 267 QYITRTPLKFP--EYITPLPRDLLRRILYPDPKRRISMRSIQKH 308

>SAKL0H07084g Chr8 complement(619288..622047) [2760 bp, 919 aa] {ON}
           weakly similar to uniprot|Q03002 Saccharomyces
           cerevisiae YPL141C Hypothetical ORF
          Length = 919

 Score =  188 bits (478), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 104/286 (36%), Positives = 159/286 (55%), Gaps = 24/286 (8%)

Query: 17  IGPWKLGETLGSGSTGKVLLASNETT-----KQQAAVKVISKAVFEAMNNSESNGDATNA 71
            GP+ +G TLG G  GKV L  ++TT      +Q A+K+I +      ++ E        
Sbjct: 41  FGPYIVGSTLGEGEFGKVKLGWSKTTGSNEVPKQVAIKLIRRDTVPKNSDKE-------- 92

Query: 72  LPYNIEQEIIIMKLLNHPNVLRLFDVWETNSDLYLVLEYAEKGELFNMLVERGPLPENEA 131
               I +EI  +K L HPN++RL +V + +  + +VLEYA  GE +  + ++  L E+ A
Sbjct: 93  --VKIYREINALKHLTHPNIVRLEEVLQNSKYIGIVLEYASGGEFYRYIQKKRRLKEHAA 150

Query: 132 VRAFRQIIIGISYCHSLGVVHRDLKPEXXXXXXXXXXXXADFGMA-ALESEDKLLETSCG 190
            R F Q+I G+ Y HS G+VHRDLK E             DFG       +++L++TSCG
Sbjct: 151 CRLFAQLISGVHYMHSKGLVHRDLKLENLLLDKNENLLITDFGFVNEFNHKNELMKTSCG 210

Query: 191 SPHYAAPE-IISGLPYEGFSSDVWSCGVILFALLTGRLPFDEEDGN-----IRNLLLKVQ 244
           SP YAAPE +++  PYE   +D+WSCGVI++A+L G LP+D++  N     I  L   + 
Sbjct: 211 SPCYAAPELVVTTKPYEARKADIWSCGVIMYAMLAGYLPWDDDSENPEGDDIAKLYHYIT 270

Query: 245 KGEFEMPDDDEITKEAQDLLARLLTVDPSKRITIREILKHPLLQKY 290
           K   + P  + I    +DLL R+L  +P KR+ +R++ +H  LQ +
Sbjct: 271 KTPLKFP--EYINPVPRDLLRRILVSNPKKRLNLRQVEQHQWLQPH 314

>NDAI0J01250 Chr10 complement(291314..294844) [3531 bp, 1176 aa]
           {ON} 
          Length = 1176

 Score =  189 bits (481), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 106/310 (34%), Positives = 172/310 (55%), Gaps = 28/310 (9%)

Query: 17  IGPWKLGETLGSGSTGKVLLASNETTKQQAAVKVISKA--VFEAMNNSESNGDATNALPY 74
           +G W   ET+G+GS GKV LA N  T++  A+K++++A  +F     S+     TN +  
Sbjct: 94  LGEWDFIETVGAGSMGKVKLARNRQTREVCAIKIVNRATKIF-LTKESKLMSHPTNHIIM 152

Query: 75  N----------IEQEII----------IMKLLNHPNVLRLFDVWETNSDLYLVLEYAEKG 114
           N          +E+EI           + ++L HP++ RLF+++  ++  Y++ EY   G
Sbjct: 153 NEKDILDRQKRLEKEISRDRRTIREASLGQILYHPHICRLFEMYTLSNHFYMLFEYVSGG 212

Query: 115 ELFNMLVERGPLPENEAVRAFRQIIIGISYCHSLGVVHRDLKPEXXXXXXXXXXXXADFG 174
           +L + +++ G L E+ A    RQI+  + Y H+  +VHRDLK E             DFG
Sbjct: 213 QLLDYIIQHGSLKESHARNFARQILSALKYLHANNIVHRDLKIENIMISSNGNIKIIDFG 272

Query: 175 MAALESEDKLLETSCGSPHYAAPEIISGLPYEGFSSDVWSCGVILFALLTGRLPFDEEDG 234
           ++ L  + K L+T CGS ++AAPE++   PY G   DVWS GV+L+ L+ G++PFD+E+ 
Sbjct: 273 LSNLYDKSKKLKTYCGSLYFAAPELLRANPYIGPEIDVWSFGVVLYVLVCGKVPFDDENS 332

Query: 235 NIRNLLLKVQKGEFEMPDDDEITKEAQDLLARLLTVDPSKRITIREILKHPLLQK-YPSI 293
           N+  L  K+++G    P    I  E   LL+ +L VDP KR T+ +++KH  + K Y SI
Sbjct: 333 NV--LHEKIKQGRVFYPQFLSI--EVISLLSTMLVVDPFKRATLDQVMKHHWMVKDYDSI 388

Query: 294 KDSRSIRNLP 303
            D+   + +P
Sbjct: 389 PDAHLPKRVP 398

>YPL141C Chr16 complement(283464..286061) [2598 bp, 865 aa] {ON}
           FRK1Protein kinase of unknown cellular role; similar to
           Kin4p; green fluorescent protein (GFP)-fusion protein
           localizes to the cytoplasm; interacts with rRNA
           transcription and ribosome biogenesis factors and the
           long chain fatty acyl-CoA synthetase Faa3
          Length = 865

 Score =  186 bits (473), Expect = 8e-48,   Method: Compositional matrix adjust.
 Identities = 115/298 (38%), Positives = 162/298 (54%), Gaps = 29/298 (9%)

Query: 13  KNNQIGPWKLGETLGSGSTGKVLL--------ASNETT--KQQAAVKVISKAVFEAMNNS 62
           K+   GP+ LG TLG G  GKV L        +SN T    +Q A+K+I +       +S
Sbjct: 34  KHVTFGPYILGSTLGEGEFGKVKLGWPKNFSNSSNSTFDFPKQVAIKLIKR-------DS 86

Query: 63  ESNGDATNALPYNIEQEIIIMKLLNHPNVLRLFDVWETNSDLYLVLEYAEKGELFNMLVE 122
            SN          I +EI  +K L+HPN+++L +V + +  + +VLEYA  GE +  + +
Sbjct: 87  ISNDYRKEV---KIYREINALKHLSHPNIVKLEEVLQNSRYIGIVLEYACGGEFYKYIQK 143

Query: 123 RGPLPENEAVRAFRQIIIGISYCHSLGVVHRDLKPEXXXXXXXXXXXXADFGMA-ALESE 181
           +  L E  A R F Q+I G+ Y HS G+VHRDLK E             DFG      S 
Sbjct: 144 KRRLKEMNACRLFSQLISGVHYIHSKGLVHRDLKLENLLLDKNENLVITDFGFVNEFCSR 203

Query: 182 DKLLETSCGSPHYAAPE-IISGLPYEGFSSDVWSCGVILFALLTGRLPFDEEDGN----- 235
           ++L++TSCGSP YAAPE +IS  PYE   +D+WSCGVIL+A+L G LP+D++  N     
Sbjct: 204 NELMKTSCGSPCYAAPELVISAEPYEARKADIWSCGVILYAILAGYLPWDDDPNNPEGSD 263

Query: 236 IRNLLLKVQKGEFEMPDDDEITKEAQDLLARLLTVDPSKRITIREILKHPLLQKYPSI 293
           I  L   +     + P  D I    +DLL R+L  DP KRI +++I KH  L+ + S 
Sbjct: 264 IGRLYNYINSTPLKFP--DYILPIPRDLLRRMLVSDPKKRINLKQIKKHEWLKPHSSF 319

>CAGL0M02519g Chr13 complement(290723..292993) [2271 bp, 756 aa]
           {ON} highly similar to uniprot|Q03002 Saccharomyces
           cerevisiae YPL141c or uniprot|Q01919 Saccharomyces
           cerevisiae YOR233w KIN4
          Length = 756

 Score =  184 bits (468), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 107/297 (36%), Positives = 158/297 (53%), Gaps = 23/297 (7%)

Query: 13  KNNQIGPWKLGETLGSGSTGKVLLASNETTKQQA------------AVKVISKAVFEAMN 60
           K+   GP+ +G TLG G  GKV LA +++  QQ               KV  +   + + 
Sbjct: 41  KHVTFGPYVIGATLGEGEFGKVKLAWSKSAYQQCDNTEGNAGNKPMTFKVPKQVAIKLIK 100

Query: 61  NSESNGDATNALPYNIEQEIIIMKLLNHPNVLRLFDVWETNSDLYLVLEYAEKGELFNML 120
                 D +      I +EI  +K L+HPN+++L +V + +  + +VLEYA  GE +  +
Sbjct: 101 RDFITKDPSKET--KIYREINALKHLSHPNIVKLEEVLQNSKYIGIVLEYAAGGEFYKFI 158

Query: 121 VERGPLPENEAVRAFRQIIIGISYCHSLGVVHRDLKPEXXXXXXXXXXXXADFGMA-ALE 179
             +  L EN A R F Q+I  + Y HS G+VHRDLK E             DFG      
Sbjct: 159 QRKRRLKENHACRLFSQLISAVHYIHSKGLVHRDLKLENLLLDNEENLIITDFGFVNEFL 218

Query: 180 SEDKLLETSCGSPHYAAPE-IISGLPYEGFSSDVWSCGVILFALLTGRLPFDEE----DG 234
            ++ +++TSCGSP YAAPE ++S  PY+   +D WSCG+ILFA+L G LP+D++    DG
Sbjct: 219 RQNGMMKTSCGSPCYAAPELVVSNRPYDARKADTWSCGIILFAMLAGYLPWDDDPKNPDG 278

Query: 235 N-IRNLLLKVQKGEFEMPDDDEITKEAQDLLARLLTVDPSKRITIREILKHPLLQKY 290
           + I  L   +     + P  + I    +DLL ++L +DP KRI IR I KHP L+ +
Sbjct: 279 HDISRLYNYILNTPLKFP--EYINPVPRDLLRKILVIDPKKRINIRSIEKHPWLESH 333

>NDAI0B02070 Chr2 (514024..517800) [3777 bp, 1258 aa] {ON} 
          Length = 1258

 Score =  187 bits (475), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 109/363 (30%), Positives = 187/363 (51%), Gaps = 40/363 (11%)

Query: 2   SAISSNTVSVIKNNQIGPWKLGETLGSGSTGKVLLASNETTKQQAAVKVISKAVFEAMNN 61
           + I SN         +G W   ET+G+GS GKV LA +  T++  A+K++++A    ++ 
Sbjct: 146 APIISNETKQFHRRSLGDWDFLETVGAGSMGKVKLAKHHQTQEICAIKIVNRATKAFLHK 205

Query: 62  SESNGDATNALPYNIEQEII---------------------IMKLLNHPNVLRLFDVWET 100
            +S     N      EQEI                      + ++L HP++ RLF++   
Sbjct: 206 EQSMPPPKN------EQEIAERQKRLEKEISRDKRTVREASLGQILYHPHICRLFEMCTM 259

Query: 101 NSDLYLVLEYAEKGELFNMLVERGPLPENEAVRAFRQIIIGISYCHSLGVVHRDLKPEXX 160
           ++  Y++ EY   G+L + +++ G L E+ A +  R I   + Y H   +VHRDLK E  
Sbjct: 260 SNHFYMLFEYVSGGQLLDYIIQHGSLREHHARKFARGIASALQYLHLNNIVHRDLKIENI 319

Query: 161 XXXXXXXXXXADFGMAALESEDKLLETSCGSPHYAAPEIISGLPYEGFSSDVWSCGVILF 220
                      DFG++ +    K L T CGS ++AAPE++   PY G   DVWS G++L+
Sbjct: 320 MISNSGEIKIIDFGLSNVFDNRKQLHTFCGSLYFAAPELLKAHPYTGPEVDVWSFGIVLY 379

Query: 221 ALLTGRLPFDEEDGNIRNLLLKVQKGEFEMPDDDEITKEAQDLLARLLTVDPSKRITIRE 280
            L+ G++PFD+E+ ++  L  K+++G+ E P  + ++ E   LL++++ VDP+KR ++R+
Sbjct: 380 VLVCGKVPFDDENSSV--LHEKIRQGKVEYP--NHLSIEVISLLSKMIVVDPAKRASLRQ 435

Query: 281 ILKHPLLQKYPSIKDSRSIRNLPREDTYLSPLADTNSKIDDAILQNLVILWHGKDAREIA 340
           +++HP + +     D   +  LPR    L+P A     ID+ +L+ +  L    D  E  
Sbjct: 436 VVEHPWMTRG---YDFPPLSYLPRR-IPLTPEA-----IDNNVLREMFRLEFIDDVEECQ 486

Query: 341 AKL 343
             L
Sbjct: 487 NSL 489

>Smik_6.339 Chr6 (538177..540774) [2598 bp, 865 aa] {ON} YPL141C
           (REAL)
          Length = 865

 Score =  185 bits (470), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 113/295 (38%), Positives = 159/295 (53%), Gaps = 29/295 (9%)

Query: 13  KNNQIGPWKLGETLGSGSTGKVLL--------ASNETTK--QQAAVKVISKAVFEAMNNS 62
           K+   GP+ LG TLG G  GKV L        +SN T +  +Q AVK+I +         
Sbjct: 34  KHVTFGPYILGSTLGEGEFGKVKLGWPKSFPSSSNATLEFPKQVAVKLIKRDTISNDYKK 93

Query: 63  ESNGDATNALPYNIEQEIIIMKLLNHPNVLRLFDVWETNSDLYLVLEYAEKGELFNMLVE 122
           E            I +EI  +K L+HPN+++L +V + +  + +VLEYA  GE +  + +
Sbjct: 94  E----------VKIYREINALKHLSHPNIVKLEEVLQNSRYIGIVLEYACGGEFYRYIQK 143

Query: 123 RGPLPENEAVRAFRQIIIGISYCHSLGVVHRDLKPEXXXXXXXXXXXXADFGMA-ALESE 181
           R  L E  A R F Q+I G+ Y HS G+VHRDLK E             DFG      S 
Sbjct: 144 RRRLKEINACRLFSQLISGVHYIHSKGLVHRDLKLENLLLDKNENLVITDFGFVNEFCSR 203

Query: 182 DKLLETSCGSPHYAAPE-IISGLPYEGFSSDVWSCGVILFALLTGRLPFDEEDGN----- 235
           ++L++TSCGSP YAAPE +IS  PYE   +D+WSCGVIL+A+L G LP+D++  N     
Sbjct: 204 NELMKTSCGSPCYAAPELVISAEPYEARKADIWSCGVILYAMLAGYLPWDDDPNNPEGSD 263

Query: 236 IRNLLLKVQKGEFEMPDDDEITKEAQDLLARLLTVDPSKRITIREILKHPLLQKY 290
           I  L   +     + P  D I    +DLL R+L  DP +RI +++I KH  L+ +
Sbjct: 264 IGRLYNYISLTPLKFP--DYILPIPRDLLRRILVSDPKRRINLKQIKKHEWLKPH 316

>Skud_16.140 Chr16 complement(255090..257687) [2598 bp, 865 aa] {ON}
           YPL141C (REAL)
          Length = 865

 Score =  185 bits (469), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 111/295 (37%), Positives = 157/295 (53%), Gaps = 29/295 (9%)

Query: 13  KNNQIGPWKLGETLGSGSTGKVLLA-------SNETT---KQQAAVKVISKAVFEAMNNS 62
           K+   GP+ LG TLG G  GKV L        S+ TT    +Q AVK+I +         
Sbjct: 34  KHVTFGPYILGSTLGEGEFGKVKLGWPKNFSNSSATTFEFPKQVAVKLIKRDTISNNYKK 93

Query: 63  ESNGDATNALPYNIEQEIIIMKLLNHPNVLRLFDVWETNSDLYLVLEYAEKGELFNMLVE 122
           E            I +EI  +K L+HPN+++L +V + +  + +VLEYA  GE +  + +
Sbjct: 94  E----------VKIYREINALKHLSHPNIVKLEEVLQNSRYIGIVLEYACGGEFYKYIQK 143

Query: 123 RGPLPENEAVRAFRQIIIGISYCHSLGVVHRDLKPEXXXXXXXXXXXXADFGMA-ALESE 181
           +  L E  A R F Q++ G+ Y HS G+VHRDLK E             DFG      S 
Sbjct: 144 KRRLKETNACRLFSQLVSGVYYIHSKGLVHRDLKLENLLLDKNENLVITDFGFVNEFCSR 203

Query: 182 DKLLETSCGSPHYAAPE-IISGLPYEGFSSDVWSCGVILFALLTGRLPFDEEDGN----- 235
           ++L++TSCGSP YAAPE +IS  PYE   +D+WSCGVIL+A+L G LP+D++  N     
Sbjct: 204 NELMKTSCGSPCYAAPELVISAEPYEARKADIWSCGVILYAMLAGYLPWDDDSNNPEGSD 263

Query: 236 IRNLLLKVQKGEFEMPDDDEITKEAQDLLARLLTVDPSKRITIREILKHPLLQKY 290
           I  L   +     + P  D I    +DLL R+L  DP KR+ +++I KH  L  +
Sbjct: 264 IGRLYNYINSTPLKFP--DYILPIPRDLLRRILVPDPKKRMNLKQIKKHEWLNSH 316

>Suva_16.169 Chr16 complement(292738..295314) [2577 bp, 858 aa] {ON}
           YPL141C (REAL)
          Length = 858

 Score =  185 bits (469), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 111/298 (37%), Positives = 158/298 (53%), Gaps = 29/298 (9%)

Query: 13  KNNQIGPWKLGETLGSGSTGKVLLA-----SNETTK-----QQAAVKVISKAVFEAMNNS 62
           K+   GP+ LG TLG G  GKV L       N +T      +Q AVK+I +         
Sbjct: 34  KHVTFGPYILGSTLGEGEFGKVKLGWPKNFPNSSTSAFDFPKQVAVKLIKRDTISNDYKK 93

Query: 63  ESNGDATNALPYNIEQEIIIMKLLNHPNVLRLFDVWETNSDLYLVLEYAEKGELFNMLVE 122
           E            I +EI  +K L+HPN+++L +V + +  + +VLEYA  GE +  + +
Sbjct: 94  E----------VKIYREINALKHLSHPNIVKLEEVLQNSRYIGIVLEYACGGEFYKYIQK 143

Query: 123 RGPLPENEAVRAFRQIIIGISYCHSLGVVHRDLKPEXXXXXXXXXXXXADFGMA-ALESE 181
           +  L E  A R F Q+I G+ Y HS G+VHRDLK E             DFG      S 
Sbjct: 144 KRRLKETNACRLFSQLISGVHYIHSKGLVHRDLKLENLLLDKNENLVITDFGFVNEFCSR 203

Query: 182 DKLLETSCGSPHYAAPE-IISGLPYEGFSSDVWSCGVILFALLTGRLPFDEEDGN----- 235
           ++L++TSCGSP YAAPE ++S  PYE   +D+WSCGVIL+A+L G LP+D++  N     
Sbjct: 204 NELMKTSCGSPCYAAPELVVSTKPYEARKADIWSCGVILYAMLAGYLPWDDDPNNPEGSD 263

Query: 236 IRNLLLKVQKGEFEMPDDDEITKEAQDLLARLLTVDPSKRITIREILKHPLLQKYPSI 293
           I  L   +     + P  D I    +DLL R+L  DP +RI +++I KH  L+ + S 
Sbjct: 264 IGRLYNYICSTPLKFP--DYILPIPRDLLRRILVSDPKRRINLKQIEKHGWLKSHSSF 319

>CAGL0M02299g Chr13 (273725..276406) [2682 bp, 893 aa] {ON} similar
           to uniprot|Q12152 Saccharomyces cerevisiae YPL150w
          Length = 893

 Score =  183 bits (464), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 102/280 (36%), Positives = 150/280 (53%), Gaps = 25/280 (8%)

Query: 16  QIGPWKLGETLGSGSTGKVLLASNETTKQQAAVKVISKAVFEAMNNSESNGDATNALPYN 75
           ++G +K+ + +G GS GKV LA++  TKQ+  +K                GD ++    N
Sbjct: 38  EVGNYKIQKQIGEGSFGKVYLATHRPTKQKVVLKT---------------GDKSDP---N 79

Query: 76  IEQEIIIMKLLNHPNVLRLFDVWETNSDLYLVLEYAEKGELFNMLVERGPLPENEAVRAF 135
           + +E+   +  ++P + +L++V  T + +++ LEY    EL++ L+ +  LP  E    F
Sbjct: 80  VVREVFYHRQFDYPYITKLYEVIVTETKVWMALEYCPGKELYDHLLSKSRLPTLECAELF 139

Query: 136 RQIIIGISYCHSLGVVHRDLKPEXXXXXXXXXXXXADFGMAALESEDKLLETSCGSPHYA 195
            QI   + Y H+L  VHRDLK E             DFG         +LET CG+  Y 
Sbjct: 140 AQITGAVHYAHTLNCVHRDLKLENVLLDKNGNAKLTDFGFTRESMTKAVLETVCGTTVYM 199

Query: 196 APEIISGLPYEGFSSDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQKGEFEMPDDDE 255
           APE+I   PY+GF  D+WS GVIL+ LL G LPFDE+D      LL  QK   + P  DE
Sbjct: 200 APEMIQHKPYDGFKVDIWSLGVILYTLLCGCLPFDEDDD-----LLTKQKIINDTPVIDE 254

Query: 256 -IT-KEAQDLLARLLTVDPSKRITIREILKHPLLQKYPSI 293
            IT  EAQ+L+ +LL+ DP++R     IL HP LQ Y ++
Sbjct: 255 RITIPEAQNLIEQLLSKDPTERPNTSAILLHPFLQPYGTL 294

>NCAS0B05090 Chr2 (946126..949758) [3633 bp, 1210 aa] {ON} 
          Length = 1210

 Score =  184 bits (467), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 93/299 (31%), Positives = 167/299 (55%), Gaps = 34/299 (11%)

Query: 17  IGPWKLGETLGSGSTGKVLLASNETTKQQAAVKVISKAVFEAMNNSESNGDATNALPYNI 76
           +G W   ET+G+GS GKV LA +  TK+  A+K++++A+   ++  +S        P   
Sbjct: 159 LGDWDFLETVGAGSMGKVKLARHHQTKEICAIKIVNRAMKAFLHKEQS------MPPPRT 212

Query: 77  EQEII---------------------IMKLLNHPNVLRLFDVWETNSDLYLVLEYAEKGE 115
           EQE++                     + ++L HP++ RLF++   ++  Y++ EY   G+
Sbjct: 213 EQEVLERQKKLEKEISRDKRTIREASLGQVLYHPHICRLFEMCTMSNHFYMLFEYVSGGQ 272

Query: 116 LFNMLVERGPLPENEAVRAFRQIIIGISYCHSLGVVHRDLKPEXXXXXXXXXXXXADFGM 175
           L + +++ G L E+ A +  R I   + Y H+  +VHRDLK E             DFG+
Sbjct: 273 LLDYIIQHGSLREHHARKFARGIASALEYIHANNIVHRDLKIENIMISTSGEIKIIDFGL 332

Query: 176 AALESEDKLLETSCGSPHYAAPEIISGLPYEGFSSDVWSCGVILFALLTGRLPFDEEDGN 235
           + +    K L T CGS ++AAPE++   PY G   DVWS GV+L+ L+ G++PFD+E+ +
Sbjct: 333 SNVFDRKKQLHTFCGSLYFAAPELLKAHPYTGPEVDVWSFGVVLYVLVCGKVPFDDENSS 392

Query: 236 IRNLLLKVQKGEFEMPDDDEITKEAQDLLARLLTVDPSKRITIREILKHPLLQK---YP 291
           +  L  K+++G+ + P  + ++ E   LL+++L VDP +R +++++++HP + +   YP
Sbjct: 393 V--LHEKIKQGKVDYP--NHLSIEVISLLSKMLVVDPLRRASLKQVVEHPWMTRGYDYP 447

>NDAI0E01290 Chr5 complement(255593..257782) [2190 bp, 729 aa] {ON}
           Anc_8.654
          Length = 729

 Score =  181 bits (459), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 106/293 (36%), Positives = 159/293 (54%), Gaps = 27/293 (9%)

Query: 16  QIGPWKLGETLGSGSTGKVLL--------ASNETTKQQAAVKVISKAVFEAMNNSESNGD 67
           + G + LG TLG G  GKV L        AS ++  +Q A+K+I +   +  ++ E    
Sbjct: 42  RFGNYILGATLGEGEFGKVKLGWSTASPTASLDSNSKQIAIKLIRRDYVKKGSDKE---- 97

Query: 68  ATNALPYNIEQEIIIMKLLNHPNVLRLFDVWETNSDLYLVLEYAEKGELFNMLVERGPLP 127
                   I +EI  +KLL HPN++RL +V + +  + +VLE+A  GE +  L  +  L 
Sbjct: 98  ------IKIYREINALKLLTHPNIVRLEEVLQNSKYIGIVLEFASGGEFYKYLQRKRRLK 151

Query: 128 ENEAVRAFRQIIIGISYCHSLGVVHRDLKPEXXXXXXXXXXXXADFGMA-ALESEDKLLE 186
           E  A + F Q+I G++Y HS G+VHRDLK E             DFG        ++L++
Sbjct: 152 EPHACQLFAQLISGVTYMHSKGLVHRDLKLENLLLDKNENLIITDFGFVNEFFGSNELMK 211

Query: 187 TSCGSPHYAAPE-IISGLPYEGFSSDVWSCGVILFALLTGRLPFDEEDGN-----IRNLL 240
            SCGSP YAAPE ++S  PY     D+WSCG+IL+A+L G LP+D++  N     I  L 
Sbjct: 212 RSCGSPCYAAPELVLSTEPYRARKVDIWSCGIILYAMLAGYLPWDDDSQNPNGDDIGKLY 271

Query: 241 LKVQKGEFEMPDDDEITKEAQDLLARLLTVDPSKRITIREILKHPLLQKYPSI 293
             + K   + P    I+  A+DL+ ++LT +PS+RI+I  I KH  L+ + S 
Sbjct: 272 QYITKTALKFP--AYISPLARDLIRKILTANPSRRISISYICKHDWLKPHASF 322

>TBLA0C04600 Chr3 (1112043..1115990) [3948 bp, 1315 aa] {ON}
           Anc_8.279 YLR096W
          Length = 1315

 Score =  184 bits (467), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 94/289 (32%), Positives = 159/289 (55%), Gaps = 31/289 (10%)

Query: 17  IGPWKLGETLGSGSTGKVLLASNETTKQQAAVKVISKAVFEAMNNSESNGDATNALPYNI 76
           +G W   ET+G+GS GKV LA +  T +  A+KV+++A    ++  ++        P   
Sbjct: 180 LGDWDFLETVGAGSMGKVKLAKHHYTNEICAIKVVNRATKGFLHKEQT------LPPPQT 233

Query: 77  EQEII---------------------IMKLLNHPNVLRLFDVWETNSDLYLVLEYAEKGE 115
           EQEI+                     + ++L HP++ RLF++   ++  Y++ EY   G+
Sbjct: 234 EQEILERQKNLEKEISRDKRTIREASLGQILYHPHICRLFEMCTMSNHFYMLFEYVSGGQ 293

Query: 116 LFNMLVERGPLPENEAVRAFRQIIIGISYCHSLGVVHRDLKPEXXXXXXXXXXXXADFGM 175
           L + +++ G L E+ A +  R I   + Y HS  +VHRDLK E             DFG+
Sbjct: 294 LLDYIIQHGSLREHHARKFARGIASALQYLHSNNIVHRDLKIENIMISTSGEIKIIDFGL 353

Query: 176 AALESEDKLLETSCGSPHYAAPEIISGLPYEGFSSDVWSCGVILFALLTGRLPFDEEDGN 235
           + L    + L T CGS ++AAPE++   PY G   DVWS GV+L+ L+ G++PFD+E+ +
Sbjct: 354 SNLYDTTRQLHTFCGSLYFAAPELLKAHPYTGPEVDVWSFGVVLYVLVCGKVPFDDENSS 413

Query: 236 IRNLLLKVQKGEFEMPDDDEITKEAQDLLARLLTVDPSKRITIREILKH 284
           +  L  K+++G+ + P    ++ E   LL+++L VDP KR T+R++++H
Sbjct: 414 V--LHEKIKQGKVDYP--QHLSIEVISLLSKMLVVDPKKRATLRQVVEH 458

>TPHA0D01140 Chr4 (238656..240524) [1869 bp, 622 aa] {ON} Anc_8.654
           YPL141C
          Length = 622

 Score =  179 bits (453), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 102/297 (34%), Positives = 157/297 (52%), Gaps = 37/297 (12%)

Query: 13  KNNQIGPWKLGETLGSGSTGKVLLA------------------SNETTKQQAAVKVISKA 54
           K  + G + LG+TLG G  GKV L                   +     +Q A+K+I + 
Sbjct: 52  KQPRFGLYTLGQTLGEGEFGKVKLGYINNDNIDTLNSSGSKLGNYSHMPKQVAIKLIRRD 111

Query: 55  VFEAMNNSESNGDATNALPYNIEQEIIIMKLLNHPNVLRLFDVWETNSDLYLVLEYAEKG 114
              A   SE            + +EI  +K+L HPN+++L +V + +  + +VLEYA  G
Sbjct: 112 TLSASKESE----------IKLYREINALKMLTHPNIVKLEEVLQNSKYIGIVLEYASGG 161

Query: 115 ELFNMLVERGPLPENEAVRAFRQIIIGISYCHSLGVVHRDLKPEXXXXXXXXXXXXADFG 174
           E +  +  +  L E++A   F Q+I G+SY HS G+VHRDLK E             DFG
Sbjct: 162 EFYKYIKFKKRLKESKACTIFAQLISGVSYIHSKGLVHRDLKLENLLLDKAGNLLITDFG 221

Query: 175 MA-ALESEDKLLETSCGSPHYAAPEIISGL-PYEGFSSDVWSCGVILFALLTGRLPFDEE 232
               +   +KL+ T CGSP YAAPE+++ + PY    +D+WSCGVIL+A+L G LP+D++
Sbjct: 222 FVNEVTKTNKLMHTPCGSPCYAAPELVTSVEPYNARKADIWSCGVILYAMLAGYLPWDDD 281

Query: 233 DGNIRN-----LLLKVQKGEFEMPDDDEITKEAQDLLARLLTVDPSKRITIREILKH 284
             NI       L   ++    + P  + I    +DLL R+L +DP+KR++++ IL+H
Sbjct: 282 PKNINGTDIVKLYKYIENQPLKFP--EYINMVPRDLLRRMLEIDPAKRMSMKHILQH 336

>CAGL0M11396g Chr13 (1122109..1125687) [3579 bp, 1192 aa] {ON}
           similar to uniprot|P13186 Saccharomyces cerevisiae
           YLR096w KIN2 ser/thr protein kinase
          Length = 1192

 Score =  183 bits (465), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 90/288 (31%), Positives = 163/288 (56%), Gaps = 19/288 (6%)

Query: 17  IGPWKLGETLGSGSTGKVLLASNETTKQQAAVKVISKAVFEAMNNSESNGDATNALPY-- 74
           +G W   ET+G+GS GKV LA +  T +  A+K++++A    ++  +++    N      
Sbjct: 105 LGDWDFLETVGAGSMGKVKLAKHRRTGEVCAIKIVNRATKAFLHKEQNSPPPVNNQEIME 164

Query: 75  ---NIEQEII----------IMKLLNHPNVLRLFDVWETNSDLYLVLEYAEKGELFNMLV 121
               +E+EI           + ++  HP++ RLF++   ++  Y++ EY   G+L + ++
Sbjct: 165 RQKKLEKEISRDKRAIREASLGQIFYHPHICRLFEMCTMSNHFYMLFEYVAGGQLLDYII 224

Query: 122 ERGPLPENEAVRAFRQIIIGISYCHSLGVVHRDLKPEXXXXXXXXXXXXADFGMAALESE 181
           + G L E+ A +  R +   + Y H+  +VHRDLK E             DFG++ +   
Sbjct: 225 QHGSLREHHARKFARGVASALQYLHANNIVHRDLKIENIMISNSGEIKIIDFGLSNVYDT 284

Query: 182 DKLLETSCGSPHYAAPEIISGLPYEGFSSDVWSCGVILFALLTGRLPFDEEDGNIRNLLL 241
            K L T CGS ++AAPE++   PY G   DVWS GV+L+ L+ G++PFD+E+ ++  L  
Sbjct: 285 RKQLHTFCGSLYFAAPELLKAHPYTGPEVDVWSFGVVLYVLVCGKVPFDDENSSV--LHE 342

Query: 242 KVQKGEFEMPDDDEITKEAQDLLARLLTVDPSKRITIREILKHPLLQK 289
           K+++G+ E P    ++ E   LL+++L VDPS+R +++++++HP + K
Sbjct: 343 KIKRGKVEYP--QHLSIEVMSLLSKMLVVDPSRRASLKQVVEHPWMTK 388

>Smik_4.367 Chr4 (655941..659141) [3201 bp, 1066 aa] {ON} YDR122W
           (REAL)
          Length = 1066

 Score =  182 bits (462), Expect = 4e-46,   Method: Compositional matrix adjust.
 Identities = 95/283 (33%), Positives = 160/283 (56%), Gaps = 19/283 (6%)

Query: 17  IGPWKLGETLGSGSTGKVLLASNETTKQQAAVKVISKA--VF---EAMNNSESNGDATNA 71
           +G W+  ET+G+GS GKV LA +  T +  AVK++++A   F   E M     N      
Sbjct: 115 LGDWEFVETVGAGSMGKVKLAKHRYTNEVCAVKIVNRATKAFLHKEQMLPPPKNEQDVLE 174

Query: 72  LPYNIEQEII----------IMKLLNHPNVLRLFDVWETNSDLYLVLEYAEKGELFNMLV 121
               +E+EI           + ++L HP++ RLF++   ++  Y++ EY   G+L + ++
Sbjct: 175 RQKKLEKEISRDKRTIREASLGQVLYHPHICRLFEMCTLSNHFYMLFEYVSGGQLLDYII 234

Query: 122 ERGPLPENEAVRAFRQIIIGISYCHSLGVVHRDLKPEXXXXXXXXXXXXADFGMAALESE 181
           + G + E++A +  R I   + Y H+  +VHRDLK E             DFG++ L   
Sbjct: 235 QHGSIREHQARKFARGIASALMYLHANNIVHRDLKIENIMISDSSEIKIIDFGLSNLYDS 294

Query: 182 DKLLETSCGSPHYAAPEIISGLPYEGFSSDVWSCGVILFALLTGRLPFDEEDGNIRNLLL 241
            K L T CGS ++AAPE++   PY G   DVWS GV+LF L+ G++PFD+E+ ++  L  
Sbjct: 295 RKQLHTFCGSLYFAAPELLKAHPYTGPEVDVWSFGVVLFVLVCGKVPFDDENSSV--LHE 352

Query: 242 KVQKGEFEMPDDDEITKEAQDLLARLLTVDPSKRITIREILKH 284
           K+++G+ E P    ++ E   LL+++L VDP +R T++++++H
Sbjct: 353 KIKQGKVEYP--QHLSIEVISLLSKMLVVDPKRRATLKQVVEH 393

>KAFR0H02540 Chr8 complement(483399..485852) [2454 bp, 817 aa] {ON}
           Anc_8.654 YPL141C
          Length = 817

 Score =  180 bits (457), Expect = 5e-46,   Method: Compositional matrix adjust.
 Identities = 115/335 (34%), Positives = 169/335 (50%), Gaps = 61/335 (18%)

Query: 17  IGPWKLGETLGSGSTGKVLLASNETTKQQAAVKVISKAVFEAMNNSES-NG---DATNAL 72
            GP+ +G T+G G  GKV L               SK++    ++S S NG    AT AL
Sbjct: 58  FGPYIIGSTIGQGEFGKVKLG-------------WSKSISNKQSHSPSANGLGLYATPAL 104

Query: 73  PYNIEQEIII------------------------MKLLNHPNVLRLFDVWETNSDLYLVL 108
           P  + +++ I                        +K L HPN+++L +V + +  + +VL
Sbjct: 105 PIEVPKQVAIKLIRRDTISKDPRREIKIYREINALKQLTHPNIVKLDEVLQNSKYIGIVL 164

Query: 109 EYAEKGELFNMLVERGPLPENEAVRAFRQIIIGISYCHSLGVVHRDLKPEXXXXXXXXXX 168
           EYA  GE +  +  +  L E  A + F Q+I G++Y HS G++HRDLK E          
Sbjct: 165 EYASGGEFYKYIQRKKRLKETIACKLFAQLISGVNYIHSKGLIHRDLKLENILLDKNENL 224

Query: 169 XXADFGMA-ALESEDKLLETSCGSPHYAAPE-IISGLPYEGFSSDVWSCGVILFALLTGR 226
              DFG      + ++L++TSCGSP YAAPE +IS  PYE    D+WSCG+ILFA+L G 
Sbjct: 225 IITDFGFVNEFVTSNELMKTSCGSPCYAAPELVISSQPYEARKVDIWSCGIILFAMLAGY 284

Query: 227 LPFDEE-----DGNIRNLLLKVQKGEFEMPDDDEITKEAQDLLARLLTVDPSKRITIREI 281
           LP+D++       NI  L   +     + P  + IT   +DLL R+L  DP KR+ +R I
Sbjct: 285 LPWDDDPENPSGENIAKLYFYITTTPLKFP--EYITAIPRDLLRRILIADPKKRVDLRYI 342

Query: 282 LKH-------PLL----QKYPSIKDSRSIRNLPRE 305
           LKH       P L    +++ +I  S+SI  LP+ 
Sbjct: 343 LKHQWLKPHTPFLSISPEEWDNISRSQSILRLPKH 377

>Skud_12.164 Chr12 (315700..319182) [3483 bp, 1160 aa] {ON} YLR096W
           (REAL)
          Length = 1160

 Score =  182 bits (461), Expect = 7e-46,   Method: Compositional matrix adjust.
 Identities = 93/288 (32%), Positives = 159/288 (55%), Gaps = 19/288 (6%)

Query: 17  IGPWKLGETLGSGSTGKVLLASNETTKQQAAVKVI---SKAVFEAMNNSESNGDATNALP 73
           +G W+  ET+G+GS GKV L  +  TK+   +K++   SKA     +   S  +    L 
Sbjct: 103 LGDWEFLETVGAGSMGKVKLVKHRQTKEVCVIKIVNRASKAYLHKQHTLPSPKNENEILE 162

Query: 74  YN--IEQEII----------IMKLLNHPNVLRLFDVWETNSDLYLVLEYAEKGELFNMLV 121
               +E+EI           + ++L HP++ RLF++   ++  Y++ EY   G+L + ++
Sbjct: 163 RQKRLEKEIARDKRTVREASLGQILYHPHICRLFEMCTMSNHFYMLFEYVSGGQLLDYII 222

Query: 122 ERGPLPENEAVRAFRQIIIGISYCHSLGVVHRDLKPEXXXXXXXXXXXXADFGMAALESE 181
           + G L E+ A +  R I   + Y H+  +VHRDLK E             DFG++ +   
Sbjct: 223 QHGSLKEHHARKFARGIASALQYLHANNIVHRDLKIENIMISSSGEIKIIDFGLSNIFDY 282

Query: 182 DKLLETSCGSPHYAAPEIISGLPYEGFSSDVWSCGVILFALLTGRLPFDEEDGNIRNLLL 241
            K L T CGS ++AAPE++   PY G   D+WS G++L+ L+ G++PFD+E+ +I  L  
Sbjct: 283 RKQLHTFCGSLYFAAPELLKAQPYTGPEVDIWSFGIVLYVLVCGKVPFDDENSSI--LHE 340

Query: 242 KVQKGEFEMPDDDEITKEAQDLLARLLTVDPSKRITIREILKHPLLQK 289
           K++KG+ + P    ++ EA  LL R++ +DP KR T++ ++ HP + +
Sbjct: 341 KIKKGKVDYP--SHLSIEAISLLTRMIVIDPLKRATLKNVVDHPWMNR 386

>CAGL0J03872g Chr10 (368472..370457) [1986 bp, 661 aa] {ON} similar
           to uniprot|Q01919 Saccharomyces cerevisiae YOR233w KIN4
           ser/thr protein kinase or and similar to uniprot|Q03002
           Saccharomyces cerevisiae YPL141c
          Length = 661

 Score =  178 bits (451), Expect = 7e-46,   Method: Compositional matrix adjust.
 Identities = 106/295 (35%), Positives = 157/295 (53%), Gaps = 29/295 (9%)

Query: 13  KNNQIGPWKLGETLGSGSTGKVLLASNET----------TKQQAAVKVISKAVFEAMNNS 62
           K+   GP+ +G TLG G  GKV L    T            +Q A+K+I +     + NS
Sbjct: 37  KHVTFGPYIVGSTLGEGEFGKVKLGWTRTPSTGPEQRPAVSKQVAIKLIRRDTI--VKNS 94

Query: 63  ESNGDATNALPYNIEQEIIIMKLLNHPNVLRLFDVWETNSDLYLVLEYAEKGELFNMLVE 122
           E            I +EI  +K L HPNV+RL +V + +  + +VLEYA  GE +  +  
Sbjct: 95  EKE--------IKIYREINALKHLTHPNVVRLEEVLQNSKYIGIVLEYASGGEFYKYIQR 146

Query: 123 RGPLPENEAVRAFRQIIIGISYCHSLGVVHRDLKPEXXXXXXXXXXXXADFGMA-ALESE 181
           +  L E+ A R F Q+I G++Y HS  +VHRDLK E             DFG       +
Sbjct: 147 KRRLKESTACRLFAQLISGVTYMHSKNLVHRDLKLENLLLDKNENLVITDFGFVNEFLPD 206

Query: 182 DKLLETSCGSPHYAAPE-IISGLPYEGFSSDVWSCGVILFALLTGRLPFDEEDGN----- 235
           ++ ++TSCGSP YAAPE +IS  PY    +DVWSCG+IL+A+L G LP+D++  N     
Sbjct: 207 NEYMKTSCGSPCYAAPELVISTRPYVARKADVWSCGIILYAMLAGYLPWDDDSTNPEGDD 266

Query: 236 IRNLLLKVQKGEFEMPDDDEITKEAQDLLARLLTVDPSKRITIREILKHPLLQKY 290
           I  L   + +   + P  + IT   +DLL ++L  DP+KR+ ++ I +H  L+ +
Sbjct: 267 IGKLYQYITRTPLKFP--EYITPIPRDLLRKILVPDPNKRVNMQYIHRHEWLKPH 319

>AGR058W Chr7 (823626..826841) [3216 bp, 1071 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YLR096W (KIN2) and
           YDR122W (KIN1)
          Length = 1071

 Score =  181 bits (460), Expect = 8e-46,   Method: Compositional matrix adjust.
 Identities = 92/294 (31%), Positives = 159/294 (54%), Gaps = 29/294 (9%)

Query: 17  IGPWKLGETLGSGSTGKVLLASNETTKQQAAVKVISKAVFEAMNNSESNGDATNALPYNI 76
           +G W   ET+G+GS GKV LA +  T +  A+K++++A    M+  +  G      P   
Sbjct: 51  LGDWDFLETVGAGSMGKVKLAKHRYTNELCAIKIVNRATKSFMHKQQLQGLP----PPAT 106

Query: 77  EQEII---------------------IMKLLNHPNVLRLFDVWETNSDLYLVLEYAEKGE 115
           E+E++                     + ++L HP++ RLF++   ++  Y++ EY   G+
Sbjct: 107 EEELLERRKKLEKEVSRDKRTIREASLGQILYHPHICRLFEMCTMSNHFYMLFEYVSGGQ 166

Query: 116 LFNMLVERGPLPENEAVRAFRQIIIGISYCHSLGVVHRDLKPEXXXXXXXXXXXXADFGM 175
           L + +++ G L E  A +  R I   + Y H   +VHRDLK E             DFG+
Sbjct: 167 LLDYIIQHGSLRERHARKFARGIASALQYLHLNNIVHRDLKIENIMISSSGEIRIIDFGL 226

Query: 176 AALESEDKLLETSCGSPHYAAPEIISGLPYEGFSSDVWSCGVILFALLTGRLPFDEEDGN 235
           + +    K L T CGS ++AAPE++   PY G   D+WS GV+L+ L+ G++PFD+E+ +
Sbjct: 227 SNMYDPKKQLHTFCGSLYFAAPELLKAHPYTGPEVDIWSFGVVLYVLVCGKVPFDDENAS 286

Query: 236 IRNLLLKVQKGEFEMPDDDEITKEAQDLLARLLTVDPSKRITIREILKHPLLQK 289
           +  L  K+++G+ E P    ++ +   LL+++L VDP KR T+++++ H  +QK
Sbjct: 287 V--LHEKIKQGKVEYP--QHLSIDVISLLSKMLVVDPYKRATLKQVVHHQWMQK 336

>Smik_12.155 Chr12 (312480..315968) [3489 bp, 1162 aa] {ON} YLR096W
           (REAL)
          Length = 1162

 Score =  181 bits (459), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 93/288 (32%), Positives = 160/288 (55%), Gaps = 19/288 (6%)

Query: 17  IGPWKLGETLGSGSTGKVLLASNETTKQQAAVKVI---SKAVFEAMNNSESNGDATNALP 73
           +G W+  ET+G+GS GKV L  +  TK+   +K++   SKA     ++  S  +    L 
Sbjct: 104 LGDWEFLETVGAGSMGKVKLVKHRQTKEVCVIKIVNRASKAYLHKQHSLPSPKNENEVLE 163

Query: 74  YN--IEQEII----------IMKLLNHPNVLRLFDVWETNSDLYLVLEYAEKGELFNMLV 121
               +E+EI           + ++L HP++ RLF++   ++  Y++ EY   G+L + ++
Sbjct: 164 RQKRLEKEIARDKRTIREASLGQILYHPHICRLFEMCTMSNHFYMLFEYVSGGQLLDYII 223

Query: 122 ERGPLPENEAVRAFRQIIIGISYCHSLGVVHRDLKPEXXXXXXXXXXXXADFGMAALESE 181
           + G L E+ A +  R I   + Y HS  +VHRDLK E             DFG++ +   
Sbjct: 224 QHGSLKEHHARKFARGIASALQYLHSNNIVHRDLKIENIMISSSGEIKIIDFGLSNIFDY 283

Query: 182 DKLLETSCGSPHYAAPEIISGLPYEGFSSDVWSCGVILFALLTGRLPFDEEDGNIRNLLL 241
            K L T CGS ++AAPE++   PY G   D+WS G++L+ L+ G++PFD+E+ +I  L  
Sbjct: 284 RKQLHTFCGSLYFAAPELLKAQPYTGPEVDIWSFGIVLYVLVCGKVPFDDENSSI--LHE 341

Query: 242 KVQKGEFEMPDDDEITKEAQDLLARLLTVDPSKRITIREILKHPLLQK 289
           K++KG+ + P    ++ EA  LL +++ VDP +R T++ ++ HP + +
Sbjct: 342 KIKKGKVDYP--SHLSIEAISLLTKMIVVDPLRRATLKTVVDHPWMNR 387

>TPHA0J00820 Chr10 (193408..197064) [3657 bp, 1218 aa] {ON}
           Anc_8.279 YLR096W
          Length = 1218

 Score =  181 bits (459), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 94/295 (31%), Positives = 159/295 (53%), Gaps = 33/295 (11%)

Query: 17  IGPWKLGETLGSGSTGKVLLASNETTKQQAAVKVISKAVFEAMNNSESNGDATNALP--- 73
           +G W   ET+G+GS GKV LA +  T +  A+K++++A    +    S       LP   
Sbjct: 151 LGDWDFLETVGAGSMGKVKLARHHKTNEVCAIKIVNRATKSFLQKEAS-------LPPPK 203

Query: 74  ---------YNIEQEII----------IMKLLNHPNVLRLFDVWETNSDLYLVLEYAEKG 114
                     N+E+EI           + ++L HP++ RLF++   ++  Y++ EY   G
Sbjct: 204 SEEEALERQKNLEKEISRDKRTIREASLGQILYHPHICRLFEICTMSNHFYMLFEYVSGG 263

Query: 115 ELFNMLVERGPLPENEAVRAFRQIIIGISYCHSLGVVHRDLKPEXXXXXXXXXXXXADFG 174
           +L + +++ G L E+ A +  R I   + Y H   +VHRDLK E             DFG
Sbjct: 264 QLLDYIIQHGSLREHHARKFTRGIASALQYLHGNNIVHRDLKIENIMISTSGDIKIIDFG 323

Query: 175 MAALESEDKLLETSCGSPHYAAPEIISGLPYEGFSSDVWSCGVILFALLTGRLPFDEEDG 234
           ++ L    K L T CGS ++AAPE++   PY G   D+WS GV+L+ L  G++PFD+E+ 
Sbjct: 324 LSNLYDSKKQLNTFCGSLYFAAPELLKANPYVGPEVDIWSFGVVLYVLACGKVPFDDENS 383

Query: 235 NIRNLLLKVQKGEFEMPDDDEITKEAQDLLARLLTVDPSKRITIREILKHPLLQK 289
           ++  L  K+++G+ + P    ++ E   LL+++L VDP KR ++++I+ HP + +
Sbjct: 384 SV--LHEKIKQGKVDYP--QHLSIEVISLLSKMLVVDPKKRASLQQIVNHPWMTR 434

>Suva_2.283 Chr2 (489490..492759) [3270 bp, 1089 aa] {ON} YDR122W
           (REAL)
          Length = 1089

 Score =  181 bits (458), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 95/283 (33%), Positives = 160/283 (56%), Gaps = 19/283 (6%)

Query: 17  IGPWKLGETLGSGSTGKVLLASNETTKQQAAVKVISKA--VF---EAMNNSESNGDATNA 71
           +G W+  ET+G+GS GKV LA +  T +  AVK++++A   F   E M     N      
Sbjct: 128 LGDWEFVETVGAGSMGKVKLAKHHYTNEVCAVKIVNRATKAFLHKEQMLPPPKNEQDVLE 187

Query: 72  LPYNIEQEII----------IMKLLNHPNVLRLFDVWETNSDLYLVLEYAEKGELFNMLV 121
               +E+EI           + ++L HP++ RLF++   ++  Y++ EY   G+L + ++
Sbjct: 188 RQKKLEKEISRDKRTIREASLGQILYHPHICRLFEMCTLSNHFYMLFEYVSGGQLLDYII 247

Query: 122 ERGPLPENEAVRAFRQIIIGISYCHSLGVVHRDLKPEXXXXXXXXXXXXADFGMAALESE 181
           + G + E++A +  R I   + Y H+  +VHRDLK E             DFG++ L   
Sbjct: 248 QHGSIREHQARKFARGIASALMYLHANNIVHRDLKIENIMISDSSEIKIIDFGLSNLYDS 307

Query: 182 DKLLETSCGSPHYAAPEIISGLPYEGFSSDVWSCGVILFALLTGRLPFDEEDGNIRNLLL 241
            K L T CGS ++AAPE++   PY G   DVWS GV+LF L+ G++PFD+E+ ++  L  
Sbjct: 308 RKQLHTFCGSLYFAAPELLKANPYTGPEVDVWSFGVVLFVLVCGKVPFDDENSSV--LHE 365

Query: 242 KVQKGEFEMPDDDEITKEAQDLLARLLTVDPSKRITIREILKH 284
           K+++G+ E P    ++ E   LL+++L VDP +R T++++++H
Sbjct: 366 KIKQGKVEYP--QHLSIEVISLLSKMLVVDPKRRATLKQVVEH 406

>KNAG0G02110 Chr7 (477260..480838) [3579 bp, 1192 aa] {ON} Anc_8.279
           YLR096W
          Length = 1192

 Score =  181 bits (458), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 96/309 (31%), Positives = 167/309 (54%), Gaps = 32/309 (10%)

Query: 17  IGPWKLGETLGSGSTGKVLLASNETTKQQAAVKVISKAVFEAMNNSESNGDATNALPYNI 76
           +G W   ET+G+GS GKV LA +  T +  A+K++++A    ++  +      N  P   
Sbjct: 106 LGDWDFLETVGAGSMGKVKLAKHHHTNEICAIKIVNRATKAFLHKEQ------NLPPPKS 159

Query: 77  EQEII---------------------IMKLLNHPNVLRLFDVWETNSDLYLVLEYAEKGE 115
           EQEI+                     + ++L HP++ RLF++   ++  Y++ EY   G+
Sbjct: 160 EQEILQRQKRLEKEISRDKRTIREASLGQILYHPHICRLFEMCTMSNHFYMLFEYVSGGQ 219

Query: 116 LFNMLVERGPLPENEAVRAFRQIIIGISYCHSLGVVHRDLKPEXXXXXXXXXXXXADFGM 175
           L + +++ G L E+ A +  R I   + Y H+  +VHRDLK E             DFG+
Sbjct: 220 LLDYIIQHGSLREHHARKFARGIGSALQYLHANNIVHRDLKIENIMISTSGEIKIIDFGL 279

Query: 176 AALESEDKLLETSCGSPHYAAPEIISGLPYEGFSSDVWSCGVILFALLTGRLPFDEEDGN 235
           + +    K L T CGS ++AAPE++   PY G   DVWS GV+L+ L+ G++PFD+E  +
Sbjct: 280 SNVYDPRKQLHTFCGSLYFAAPELLKARPYLGPEVDVWSFGVVLYVLVCGKVPFDDEVSS 339

Query: 236 IRNLLLKVQKGEFEMPDDDEITKEAQDLLARLLTVDPSKRITIREILKHPLLQK-YPSIK 294
           +  L  K+++G  E P  + ++ E   LL+++L VDP +R +++++++HP + + Y  I 
Sbjct: 340 V--LHEKIKQGNVEYP--NHLSIEVLSLLSKMLVVDPERRASLKQVIEHPWMNRGYDYIT 395

Query: 295 DSRSIRNLP 303
            S   + +P
Sbjct: 396 PSYLPKRIP 404

>KLTH0G13288g Chr7 complement(1139058..1142486) [3429 bp, 1142 aa]
           {ON} similar to uniprot|P13186 Saccharomyces cerevisiae
           YLR096W KIN2 Serine/threonine protein kinase involved in
           regulation of exocytosis localizes to the cytoplasmic
           face of the plasma membrane closely related to Kin1p and
           to YDR122W uniprot|P13185 Saccharomyces cerevisiae
           YDR122W KIN1 Serine/threonine protein kinase involved in
           regulation of exocytosis; localizes to the cytoplasmic
           face of the plasma membrane; closely related to Kin2p
          Length = 1142

 Score =  181 bits (458), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 109/364 (29%), Positives = 189/364 (51%), Gaps = 46/364 (12%)

Query: 17  IGPWKLGETLGSGSTGKVLLASNETTKQQAAVKVISKAVFEAMNNSESNGDATNALPYNI 76
           +G W   ET+G+GS GKV LA +  T +  A+K++++A  +A+ + ES        P   
Sbjct: 181 LGDWDFLETVGAGSMGKVKLAKHRLTHEVCAIKIVNRAT-KALIHKESQQP-----PPRT 234

Query: 77  EQEII---------------------IMKLLNHPNVLRLFDVWETNSDLYLVLEYAEKGE 115
           ++E++                     + ++L HP++ RLF++   ++  Y++ EY   G+
Sbjct: 235 QEEVLERERKLEKEISRDKRTIRESSLGQILYHPHICRLFEMCTMSNHFYMLFEYVSGGQ 294

Query: 116 LFNMLVERGPLPENEAVRAFRQIIIGISYCHSLGVVHRDLKPEXXXXXXXXXXXXADFGM 175
           L + +++ G L E  A +  R I   + Y H   +VHRDLK E             DFG+
Sbjct: 295 LLDYIIQHGSLRERSARKFARGIASALQYLHLNNIVHRDLKIENIMISTSGEIKIIDFGL 354

Query: 176 AALESEDKLLETSCGSPHYAAPEIISGLPYEGFSSDVWSCGVILFALLTGRLPFDEEDGN 235
           + + +  K L T CGS ++AAPE++   PY G   DVWS GV+L+ L+ G++PFD+E+ +
Sbjct: 355 SNMFNPKKQLHTFCGSLYFAAPELLKACPYTGPEVDVWSFGVVLYVLVCGKVPFDDENSS 414

Query: 236 IRNLLLKVQKGEFEMPDDDEITKEAQDLLARLLTVDPSKRITIREILKHPLLQK---YPS 292
           +  L  K+++G+ E P    ++ E   LL+++L VDPSKR T+++++ H  +Q+   +P+
Sbjct: 415 V--LHEKIKQGKVEYP--QHLSIEVISLLSKMLVVDPSKRATLKQVVNHQWMQRGYDFPA 470

Query: 293 IKDSRSIRNLPREDTYLSPLADTNSKIDDAILQNLVILWHGKDAREIAAKLREPGANTEK 352
                     P    +  PL  T   +D  ++Q +  L    +  E AA L +   +T+ 
Sbjct: 471 ----------PSYIPHRVPL--TADALDPTVIQEMYRLEFVDNTSEAAAWLTKIVTSTDY 518

Query: 353 TLYA 356
            L A
Sbjct: 519 QLLA 522

>TDEL0F04060 Chr6 (749896..753276) [3381 bp, 1126 aa] {ON} Anc_8.279
           YLR096W
          Length = 1126

 Score =  180 bits (457), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 92/289 (31%), Positives = 161/289 (55%), Gaps = 31/289 (10%)

Query: 17  IGPWKLGETLGSGSTGKVLLASNETTKQQAAVKVISKAVFEAMNNSESNGDATNALPYNI 76
           +G W   ET+G+GS GKV LA +  TK+  A+K++++A    ++  +S        P   
Sbjct: 75  LGEWDFLETVGAGSMGKVKLAKHRYTKEVCAIKIVNRATNAFLHKEQS------LPPPKK 128

Query: 77  EQEII---------------------IMKLLNHPNVLRLFDVWETNSDLYLVLEYAEKGE 115
           E+EI+                     + ++L HP++ RLF++   ++  Y++ EY   G+
Sbjct: 129 EEEILERQKKLEKEISRDKRTIREASLGQILYHPHICRLFEMCTMSNHFYMLFEYVSGGQ 188

Query: 116 LFNMLVERGPLPENEAVRAFRQIIIGISYCHSLGVVHRDLKPEXXXXXXXXXXXXADFGM 175
           L + +++ G L E+ A +  R I   + Y H+  +VHRDLK E             DFG+
Sbjct: 189 LLDYIIQHGSLREHHARKFTRGIASALQYLHANNIVHRDLKIENIMISTSGEIKIIDFGL 248

Query: 176 AALESEDKLLETSCGSPHYAAPEIISGLPYEGFSSDVWSCGVILFALLTGRLPFDEEDGN 235
           + L  + K L T CGS ++AAPE++   PY G   DVWS GV+L+ L+ G++PFD+E+ +
Sbjct: 249 SNLFDKSKQLHTFCGSLYFAAPELLKASPYTGPEVDVWSFGVVLYVLVCGKVPFDDENSS 308

Query: 236 IRNLLLKVQKGEFEMPDDDEITKEAQDLLARLLTVDPSKRITIREILKH 284
           +  L  K+++G+ E P    ++ E   LL+++L VDP +R +++++++H
Sbjct: 309 V--LHEKIKQGKVEYP--QHLSIEVISLLSKMLVVDPHRRASLKQVVEH 353

>SAKL0H16632g Chr8 complement(1461613..1464801) [3189 bp, 1062 aa]
           {ON} similar to uniprot|P13186 Saccharomyces cerevisiae
           YLR096W KIN2 Serine/threonine protein kinase involved in
           regulation of exocytosis localizes to the cytoplasmic
           face of the plasma membrane closely related to Kin1p and
           to YDR122W uniprot|P13185 Saccharomyces cerevisiae
           YDR122W KIN1 Serine/threonine protein kinase involved in
           regulation of exocytosis; localizes to the cytoplasmic
           face of the plasma membrane; closely related to Kin2p
          Length = 1062

 Score =  180 bits (457), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 93/294 (31%), Positives = 158/294 (53%), Gaps = 31/294 (10%)

Query: 17  IGPWKLGETLGSGSTGKVLLASNETTKQQAAVKVISKAVFEAMNNSESNGDATNALPYNI 76
           +G W   ET+G+GS GKV LA +  T +  A+K++++A    ++  +         P   
Sbjct: 76  LGDWDFLETVGAGSMGKVKLARHRYTSEICAIKIVNRAAKSFVHKQQ------QMTPPKS 129

Query: 77  EQEII---------------------IMKLLNHPNVLRLFDVWETNSDLYLVLEYAEKGE 115
           EQE +                     + ++L HP++ RLF++   ++  Y++ EY   G+
Sbjct: 130 EQEALERKRKLEKEISRDKRTIREASLGQILYHPHICRLFEMCTMSNHFYMLFEYVSGGQ 189

Query: 116 LFNMLVERGPLPENEAVRAFRQIIIGISYCHSLGVVHRDLKPEXXXXXXXXXXXXADFGM 175
           L + +++ G L E  A +  R I   + Y H   +VHRDLK E             DFG+
Sbjct: 190 LLDYIIQHGSLRERHARKFARGIASALQYLHMNNIVHRDLKIENIMISTSGEIKIIDFGL 249

Query: 176 AALESEDKLLETSCGSPHYAAPEIISGLPYEGFSSDVWSCGVILFALLTGRLPFDEEDGN 235
           + +    K L T CGS ++AAPE++   PY G   DVWS GV+L+ L+ G++PFD+E+ +
Sbjct: 250 SNMYDPKKQLHTFCGSLYFAAPELLKAHPYIGPEVDVWSFGVVLYVLVCGKVPFDDENAS 309

Query: 236 IRNLLLKVQKGEFEMPDDDEITKEAQDLLARLLTVDPSKRITIREILKHPLLQK 289
           +  L  K+++G+ E P    ++ E   LL+++L VDPSKR T+++++ H  +Q+
Sbjct: 310 V--LHEKIKQGKVEYP--QHLSIEVISLLSKMLVVDPSKRATLKQVVSHQWMQR 359

>Kpol_1066.46 s1066 (82874..86551) [3678 bp, 1225 aa] {ON}
           (82874..86551) [3678 nt, 1226 aa]
          Length = 1225

 Score =  181 bits (458), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 92/283 (32%), Positives = 158/283 (55%), Gaps = 19/283 (6%)

Query: 17  IGPWKLGETLGSGSTGKVLLASNETTKQQAAVKVISKAVFEAMNNSES-----NGDATNA 71
           +G W   ET+G+GS GKV LA +  T +  A+K++++A    ++  +S     N      
Sbjct: 142 LGDWNFLETVGAGSMGKVKLAKHHRTNEICAIKIVNRATKAFLHKEQSLPAPANDQEIME 201

Query: 72  LPYNIEQEII----------IMKLLNHPNVLRLFDVWETNSDLYLVLEYAEKGELFNMLV 121
              N+E+EI           + ++L HP++ RLF++   ++  Y++ EY   G+L + ++
Sbjct: 202 RQKNLEKEISRDKRTIREASLGQILYHPHICRLFEMCTMSNHFYMLFEYVSGGQLLDYII 261

Query: 122 ERGPLPENEAVRAFRQIIIGISYCHSLGVVHRDLKPEXXXXXXXXXXXXADFGMAALESE 181
           + G L E+ A R  R I   + Y H+  +VHRDLK E             DFG++ L   
Sbjct: 262 QHGSLREHHARRFARGIASALQYLHANNIVHRDLKIENIMISTSGEIKLIDFGLSNLYDN 321

Query: 182 DKLLETSCGSPHYAAPEIISGLPYEGFSSDVWSCGVILFALLTGRLPFDEEDGNIRNLLL 241
            K L T CGS ++AAPE++   PY G   DVWS GV+L+ L+ G++PFD+E+ ++  L  
Sbjct: 322 RKQLHTFCGSLYFAAPELLKANPYTGPEVDVWSFGVVLYVLVCGKVPFDDENSSV--LHE 379

Query: 242 KVQKGEFEMPDDDEITKEAQDLLARLLTVDPSKRITIREILKH 284
           K+++G+ E      ++ E   LL+++L VDP +R ++++++ H
Sbjct: 380 KIKQGKVEY--SQHLSIEVISLLSKMLVVDPKRRASLKQVVDH 420

>Kpol_1012.6 s1012 (11581..13467) [1887 bp, 628 aa] {ON}
           (11581..13467) [1887 nt, 629 aa]
          Length = 628

 Score =  176 bits (446), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 103/293 (35%), Positives = 156/293 (53%), Gaps = 27/293 (9%)

Query: 13  KNNQIGPWKLGETLGSGSTGKVLLASNE--------TTKQQAAVKVISKAVFEAMNNSES 64
           K    GP+ LG T+G G  GKV    +         T  +Q A+K+I +       + E 
Sbjct: 48  KQPTFGPYYLGSTIGEGEFGKVKSGWSRKPQNDNGLTIGKQVAIKLIRRDTLAEKKDQE- 106

Query: 65  NGDATNALPYNIEQEIIIMKLLNHPNVLRLFDVWETNSDLYLVLEYAEKGELFNMLVERG 124
                      + +EI  +KLL+HPN+++L DV + +  + +VLEYA  GE +  L  + 
Sbjct: 107 ---------LKVYREINALKLLSHPNIVKLEDVLQNSKYIGIVLEYASGGEFYKYLQRKK 157

Query: 125 PLPENEAVRAFRQIIIGISYCHSLGVVHRDLKPEXXXXXXXXXXXXADFGMA-ALESEDK 183
            L E  A   F Q+I G++Y HS G+VHRDLK E             DFG    + + +K
Sbjct: 158 RLKEPLACSTFAQLISGVAYIHSKGLVHRDLKLENLLLDKHSNLVITDFGFVNEISTNNK 217

Query: 184 LLETSCGSPHYAAPE-IISGLPYEGFSSDVWSCGVILFALLTGRLPFDEE----DG-NIR 237
           L++T CGSP YAAPE ++S  PY+   +D+WS GVIL+A+L G LP+D++    DG NI 
Sbjct: 218 LMKTPCGSPCYAAPELVLSTKPYDARKADIWSAGVILYAMLAGYLPWDDDPENPDGSNIM 277

Query: 238 NLLLKVQKGEFEMPDDDEITKEAQDLLARLLTVDPSKRITIREILKHPLLQKY 290
            L   + K   + P  D I   A+DL+ ++L + P  R+ I ++ +H  L+ +
Sbjct: 278 RLYEYITKNNLKFP--DYIEPLARDLIRKILVIQPKSRLNIVQVQQHEWLKPH 328

>YLR096W Chr12 (332590..336033) [3444 bp, 1147 aa] {ON}
           KIN2Serine/threonine protein kinase involved in
           regulation of exocytosis; localizes to the cytoplasmic
           face of the plasma membrane; closely related to Kin1p
          Length = 1147

 Score =  180 bits (456), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 92/288 (31%), Positives = 161/288 (55%), Gaps = 19/288 (6%)

Query: 17  IGPWKLGETLGSGSTGKVLLASNETTKQQAAVKVI---SKAVFEAMNNSESNGDATNALP 73
           +G W+  ET+G+GS GKV L  +  TK+   +K++   SKA     ++  S  + +  L 
Sbjct: 96  LGDWEFLETVGAGSMGKVKLVKHRQTKEICVIKIVNRASKAYLHKQHSLPSPKNESEILE 155

Query: 74  YN--IEQEII----------IMKLLNHPNVLRLFDVWETNSDLYLVLEYAEKGELFNMLV 121
               +E+EI           + ++L HP++ RLF++   ++  Y++ EY   G+L + ++
Sbjct: 156 RQKRLEKEIARDKRTVREASLGQILYHPHICRLFEMCTMSNHFYMLFEYVSGGQLLDYII 215

Query: 122 ERGPLPENEAVRAFRQIIIGISYCHSLGVVHRDLKPEXXXXXXXXXXXXADFGMAALESE 181
           + G L E+ A +  R I   + Y H+  +VHRDLK E             DFG++ +   
Sbjct: 216 QHGSLKEHHARKFARGIASALQYLHANNIVHRDLKIENIMISSSGEIKIIDFGLSNIFDY 275

Query: 182 DKLLETSCGSPHYAAPEIISGLPYEGFSSDVWSCGVILFALLTGRLPFDEEDGNIRNLLL 241
            K L T CGS ++AAPE++   PY G   D+WS G++L+ L+ G++PFD+E+ +I  L  
Sbjct: 276 RKQLHTFCGSLYFAAPELLKAQPYTGPEVDIWSFGIVLYVLVCGKVPFDDENSSI--LHE 333

Query: 242 KVQKGEFEMPDDDEITKEAQDLLARLLTVDPSKRITIREILKHPLLQK 289
           K++KG+ + P    ++ E   LL R++ VDP +R T++ +++HP + +
Sbjct: 334 KIKKGKVDYP--SHLSIEVISLLTRMIVVDPLRRATLKNVVEHPWMNR 379

>YDR122W Chr4 (694700..697894) [3195 bp, 1064 aa] {ON}
           KIN1Serine/threonine protein kinase involved in
           regulation of exocytosis; localizes to the cytoplasmic
           face of the plasma membrane; closely related to Kin2p
          Length = 1064

 Score =  179 bits (454), Expect = 4e-45,   Method: Compositional matrix adjust.
 Identities = 94/283 (33%), Positives = 160/283 (56%), Gaps = 19/283 (6%)

Query: 17  IGPWKLGETLGSGSTGKVLLASNETTKQQAAVKVISKA--VF---EAMNNSESNGDATNA 71
           +G W+  ET+G+GS GKV LA +  T +  AVK++++A   F   E M     N      
Sbjct: 117 LGDWEFVETVGAGSMGKVKLAKHRYTNEVCAVKIVNRATKAFLHKEQMLPPPKNEQDVLE 176

Query: 72  LPYNIEQEII----------IMKLLNHPNVLRLFDVWETNSDLYLVLEYAEKGELFNMLV 121
               +E+EI           + ++L HP++ RLF++   ++  Y++ EY   G+L + ++
Sbjct: 177 RQKKLEKEISRDKRTIREASLGQILYHPHICRLFEMCTLSNHFYMLFEYVSGGQLLDYII 236

Query: 122 ERGPLPENEAVRAFRQIIIGISYCHSLGVVHRDLKPEXXXXXXXXXXXXADFGMAALESE 181
           + G + E++A +  R I   + Y H+  +VHRDLK E             DFG++ +   
Sbjct: 237 QHGSIREHQARKFARGIASALIYLHANNIVHRDLKIENIMISDSSEIKIIDFGLSNIYDS 296

Query: 182 DKLLETSCGSPHYAAPEIISGLPYEGFSSDVWSCGVILFALLTGRLPFDEEDGNIRNLLL 241
            K L T CGS ++AAPE++   PY G   DVWS GV+LF L+ G++PFD+E+ ++  L  
Sbjct: 297 RKQLHTFCGSLYFAAPELLKANPYTGPEVDVWSFGVVLFVLVCGKVPFDDENSSV--LHE 354

Query: 242 KVQKGEFEMPDDDEITKEAQDLLARLLTVDPSKRITIREILKH 284
           K+++G+ E P    ++ E   LL+++L VDP +R T++++++H
Sbjct: 355 KIKQGKVEYP--QHLSIEVISLLSKMLVVDPKRRATLKQVVEH 395

>Smik_15.417 Chr15 (725513..727933) [2421 bp, 806 aa] {ON} YOR233W
           (REAL)
          Length = 806

 Score =  177 bits (449), Expect = 5e-45,   Method: Compositional matrix adjust.
 Identities = 104/290 (35%), Positives = 158/290 (54%), Gaps = 24/290 (8%)

Query: 13  KNNQIGPWKLGETLGSGSTGKVLL----ASNET-TKQQAAVKVISKAVFEAMNNSESNGD 67
           K+   GP+ +G TLG G  GKV L    AS+ T   +Q A+K+I +   +   + E    
Sbjct: 39  KHATFGPYIIGSTLGEGEFGKVKLGWTKASSPTEVPKQVAIKLIRRDTIKKDADKE---- 94

Query: 68  ATNALPYNIEQEIIIMKLLNHPNVLRLFDVWETNSDLYLVLEYAEKGELFNMLVERGPLP 127
                   I +EI  +K L HPN++ L +V + +  + +VLE+   GE +  +  +  L 
Sbjct: 95  ------VKIYREINALKHLTHPNIIYLEEVLQNSKYIGIVLEFVSGGEFYKYIQRKRRLK 148

Query: 128 ENEAVRAFRQIIIGISYCHSLGVVHRDLKPEXXXXXXXXXXXXADFGMA-ALESEDKLLE 186
           E+ A R F Q+I G++Y H  G+VHRDLK E             DFG       +++L+ 
Sbjct: 149 ESSACRLFAQLISGVNYMHYKGLVHRDLKLENLLLDKHENLVITDFGFVNEFFKDNELMN 208

Query: 187 TSCGSPHYAAPE-IISGLPYEGFSSDVWSCGVILFALLTGRLPFDEEDGN-----IRNLL 240
           TSCGSP YAAPE ++S  PYE   +DVWSCGVIL+A+L G LP+D++  N     I  L 
Sbjct: 209 TSCGSPCYAAPELVVSTKPYEARKADVWSCGVILYAMLAGYLPWDDDHENPTGDDIARLY 268

Query: 241 LKVQKGEFEMPDDDEITKEAQDLLARLLTVDPSKRITIREILKHPLLQKY 290
             + +   + P  + IT   +DLL R+L  +P +R+++R I +H  L+ +
Sbjct: 269 QYITQTPLKFP--EYITPVPRDLLRRILVPNPRRRVSLRSIERHEWLKPH 316

>NCAS0B03740 Chr2 complement(668231..671380) [3150 bp, 1049 aa] {ON}
           Anc_8.279
          Length = 1049

 Score =  179 bits (453), Expect = 5e-45,   Method: Compositional matrix adjust.
 Identities = 94/289 (32%), Positives = 157/289 (54%), Gaps = 26/289 (8%)

Query: 17  IGPWKLGETLGSGSTGKVLLASNETTKQQAAVKVISKAVFEAMNNSESNGDATNALPYNI 76
           +G W   ET+G+GS GKV LA N  T +  A+K++++A    ++   +       +P + 
Sbjct: 68  LGDWDFVETVGAGSMGKVKLAKNRRTNEVCAIKIVNRATKIFLSKEYAAKHNGYTIPLS- 126

Query: 77  EQEII---------------------IMKLLNHPNVLRLFDVWETNSDLYLVLEYAEKGE 115
           E+E+I                     + ++L HP++ RL+++   ++  Y++ EY   G+
Sbjct: 127 EKEVIERQKNLEKEASRDKRTVREASLGQILYHPHICRLYEMHTLSNHFYMLFEYVSGGQ 186

Query: 116 LFNMLVERGPLPENEAVRAFRQIIIGISYCHSLGVVHRDLKPEXXXXXXXXXXXXADFGM 175
           L + +++ G L E+ A    RQI   + Y HS  +VHRDLK E             DFG+
Sbjct: 187 LLDYIIQHGSLKESRARTFTRQICSALKYLHSHNIVHRDLKIENIMISKDGNIKLIDFGL 246

Query: 176 AALESEDKLLETSCGSPHYAAPEIISGLPYEGFSSDVWSCGVILFALLTGRLPFDEEDGN 235
           + L  +   L+T CGS ++AAPE++   PY G   DVWS GV+L+ L+ G++PFD+E+ N
Sbjct: 247 SNLYDKCNKLKTYCGSLYFAAPELLKATPYIGPEIDVWSFGVVLYVLVCGKVPFDDENSN 306

Query: 236 IRNLLLKVQKGEFEMPDDDEITKEAQDLLARLLTVDPSKRITIREILKH 284
           +  L  K+++G+   P    I  E   LL+++L VDP KR T+ +++ H
Sbjct: 307 V--LHEKIKQGKVFYPQFLSI--EVISLLSKMLVVDPFKRATLDQVMNH 351

>Skud_4.383 Chr4 (666354..669551) [3198 bp, 1065 aa] {ON} YDR122W
           (REAL)
          Length = 1065

 Score =  179 bits (453), Expect = 5e-45,   Method: Compositional matrix adjust.
 Identities = 95/283 (33%), Positives = 160/283 (56%), Gaps = 19/283 (6%)

Query: 17  IGPWKLGETLGSGSTGKVLLASNETTKQQAAVKVISKA--VF---EAMNNSESNGDATNA 71
           +G W+  ET+G+GS GKV LA +  T +  AVK++++A   F   E M     N      
Sbjct: 115 LGDWEFIETVGAGSMGKVKLARHRRTNEVCAVKIVNRATKAFLHKEQMLPPPKNEQDVLE 174

Query: 72  LPYNIEQEII----------IMKLLNHPNVLRLFDVWETNSDLYLVLEYAEKGELFNMLV 121
               +E+EI           + ++L HP++ RLF++   ++  Y++ EY   G+L + ++
Sbjct: 175 RQKKLEKEISRDKRTIREASLGQILYHPHICRLFEMCTLSNHFYMLFEYVSGGQLLDYII 234

Query: 122 ERGPLPENEAVRAFRQIIIGISYCHSLGVVHRDLKPEXXXXXXXXXXXXADFGMAALESE 181
           + G + E++A +  R I   + Y H+  +VHRDLK E             DFG++ L   
Sbjct: 235 QHGSIREHQAKKFARGIASALMYLHANNIVHRDLKIENIMISDSSEIKIIDFGLSNLYDS 294

Query: 182 DKLLETSCGSPHYAAPEIISGLPYEGFSSDVWSCGVILFALLTGRLPFDEEDGNIRNLLL 241
            K L T CGS ++AAPE++   PY G   DVWS GV+LF L+ G++PFD+E+ ++  L  
Sbjct: 295 RKQLYTFCGSLYFAAPELLKANPYTGPEVDVWSFGVVLFVLVCGKVPFDDENSSV--LHE 352

Query: 242 KVQKGEFEMPDDDEITKEAQDLLARLLTVDPSKRITIREILKH 284
           K+++G+ E P    ++ E   LL+++L VDP +R T++++++H
Sbjct: 353 KIKQGKVEYP--QHLSIEVISLLSKMLVVDPKRRATLKQVVEH 393

>Ecym_4291 Chr4 complement(620549..623986) [3438 bp, 1145 aa] {ON}
           similar to Ashbya gossypii AGR058W
          Length = 1145

 Score =  179 bits (453), Expect = 5e-45,   Method: Compositional matrix adjust.
 Identities = 93/290 (32%), Positives = 160/290 (55%), Gaps = 21/290 (7%)

Query: 17  IGPWKLGETLGSGSTGKVLLASNETTKQQAAVKVISKAVFEAMNNSE-------SNGDAT 69
           +G W   ET+G+GS GKV LA +  T +  A+K++++A    ++  +       SN +  
Sbjct: 112 LGDWDFLETVGAGSMGKVKLAKHRYTNELCAIKIVNRATKSFIHKQQQQQLPPPSNEEEL 171

Query: 70  NALPYNIEQEII----------IMKLLNHPNVLRLFDVWETNSDLYLVLEYAEKGELFNM 119
                 +E+EI           + ++L HP++ RLF++   ++  Y++ EY   G+L + 
Sbjct: 172 MERRKKLEKEISRDKRTIREASLGQILYHPHICRLFEMCTMSNHFYMLFEYVSGGQLLDY 231

Query: 120 LVERGPLPENEAVRAFRQIIIGISYCHSLGVVHRDLKPEXXXXXXXXXXXXADFGMAALE 179
           +++ G L E  A +  R I   + Y H   +VHRDLK E             DFG++ L 
Sbjct: 232 IIQHGSLRERHARKFARGIASALQYLHMNNIVHRDLKIENIMISSSGEIRIIDFGLSNLY 291

Query: 180 SEDKLLETSCGSPHYAAPEIISGLPYEGFSSDVWSCGVILFALLTGRLPFDEEDGNIRNL 239
              K L T CGS ++AAPE++   PY G   D+WS GV+L+ L+ G++PFD+E+ ++  L
Sbjct: 292 DPKKQLHTFCGSLYFAAPELLKAHPYTGPEVDIWSFGVVLYVLVCGKVPFDDENASV--L 349

Query: 240 LLKVQKGEFEMPDDDEITKEAQDLLARLLTVDPSKRITIREILKHPLLQK 289
             K+++G+ E P    ++ +   LL+++L VDP KR T+++++ H  +QK
Sbjct: 350 HEKIKQGKVEYP--QHLSIDVISLLSKMLVVDPLKRATLKQVVNHQWMQK 397

>NCAS0B01470 Chr2 (241003..243186) [2184 bp, 727 aa] {ON} Anc_8.654
          Length = 727

 Score =  176 bits (446), Expect = 6e-45,   Method: Compositional matrix adjust.
 Identities = 107/304 (35%), Positives = 161/304 (52%), Gaps = 31/304 (10%)

Query: 3   AISSNTVSVIKNNQIGPWKLGETLGSGSTGKVLLASNETTK---------QQAAVKVISK 53
            IS N  S +K    GP+ +G TLG G  GKV +  + T+          +Q A+K+I +
Sbjct: 24  TISRNKKSHMK---FGPYIVGATLGEGEFGKVKMGWSTTSSSSGKITEDSKQVAIKLIRR 80

Query: 54  AVFEAMNNSESNGDATNALPYNIEQEIIIMKLLNHPNVLRLFDVWETNSDLYLVLEYAEK 113
              +  +  E            I +EI  +K L HPN++RL +V + +  + +VLEYA  
Sbjct: 81  DFIKKGSEKE----------MKIFREINSLKHLTHPNIVRLEEVLQNSKYIGIVLEYASG 130

Query: 114 GELFNMLVERGPLPENEAVRAFRQIIIGISYCHSLGVVHRDLKPEXXXXXXXXXXXXADF 173
           GE +  +  +  L E  A R F Q+I G+SY HS G+VHRDLK E             DF
Sbjct: 131 GEFYKYVQRKRRLKEATACRLFAQLISGVSYMHSKGIVHRDLKLENLLLDKHENLIITDF 190

Query: 174 GMA-ALESEDKLLETSCGSPHYAAPE-IISGLPYEGFSSDVWSCGVILFALLTGRLPFDE 231
           G      ++++L++TSCGSP YAAPE +I+  PY+   +D+WSCG+IL+ +L G LP+D+
Sbjct: 191 GFVNEFYADNELMKTSCGSPCYAAPELVITTEPYKARKADIWSCGIILYGMLAGYLPWDD 250

Query: 232 EDGN-----IRNLLLKVQKGEFEMPDDDEITKEAQDLLARLLTVDPSKRITIREILKHPL 286
           +  N     I  L   + K   + P  + IT   +DLL  +L  +P +R++ R I KH  
Sbjct: 251 DKQNPNGEDIVRLYHYITKTPLKFP--EYITPLPRDLLRHILVSNPVRRMSSRHIKKHEW 308

Query: 287 LQKY 290
           L  +
Sbjct: 309 LSPH 312

>Suva_10.180 Chr10 (337364..340843) [3480 bp, 1159 aa] {ON} YLR096W
           (REAL)
          Length = 1159

 Score =  179 bits (453), Expect = 6e-45,   Method: Compositional matrix adjust.
 Identities = 91/288 (31%), Positives = 159/288 (55%), Gaps = 19/288 (6%)

Query: 17  IGPWKLGETLGSGSTGKVLLASNETTKQQAAVKVISKAVFEAMNNSES-----NGDATNA 71
           +G W+  ET+G+GS GKV L  +  TK+   +K++++A    ++   S     N +    
Sbjct: 104 LGDWEFLETVGAGSMGKVKLVKHCQTKEVCVIKIVNRASKAFLHKQHSLPPPKNENELLE 163

Query: 72  LPYNIEQEII----------IMKLLNHPNVLRLFDVWETNSDLYLVLEYAEKGELFNMLV 121
               +E+EI           + ++L HP++ RLF++   ++  Y++ EY   G+L + ++
Sbjct: 164 RQKRLEKEIARDKRTVREASLGQILYHPHICRLFEMCTMSNHFYMLFEYVSGGQLLDYII 223

Query: 122 ERGPLPENEAVRAFRQIIIGISYCHSLGVVHRDLKPEXXXXXXXXXXXXADFGMAALESE 181
           + G L E+ A +  R I   + Y H+  +VHRDLK E             DFG++ +   
Sbjct: 224 QHGSLKEHHARKFARGIASALQYLHANNIVHRDLKIENIMISNSGEIKIIDFGLSNIFDS 283

Query: 182 DKLLETSCGSPHYAAPEIISGLPYEGFSSDVWSCGVILFALLTGRLPFDEEDGNIRNLLL 241
            K L T CGS ++AAPE++   PY G   D+WS G++L+ L+ G++PFD+E+ +I  L  
Sbjct: 284 KKKLHTFCGSLYFAAPELLKAQPYTGPEVDIWSFGIVLYVLVCGKVPFDDENSSI--LHE 341

Query: 242 KVQKGEFEMPDDDEITKEAQDLLARLLTVDPSKRITIREILKHPLLQK 289
           K++KG+ + P    ++ +A  LL R++ VDP KR T++ +  HP + +
Sbjct: 342 KIKKGKVDYP--SHLSIDAVSLLTRMIVVDPLKRATLKNVTDHPWMNR 387

>TBLA0B03970 Chr2 complement(904167..907793) [3627 bp, 1208 aa] {ON}
           Anc_8.654 YPL141C
          Length = 1208

 Score =  178 bits (451), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 108/284 (38%), Positives = 156/284 (54%), Gaps = 25/284 (8%)

Query: 17  IGPWKLGETLGSGSTGKVLL-----ASNET-TKQQAAVKVISKAVFEAMNNSESNGDATN 70
            GP+ +G TLG G  GKV L     + N+T   +Q A+K+I +      +  E       
Sbjct: 69  FGPYIVGSTLGEGEFGKVKLGWVKASPNDTQVPKQVAIKLIRRDAIVKGSEKE------- 121

Query: 71  ALPYNIEQEIIIMKLLNHPNVLRLFDVWETNSDLYLVLEYAEKGELFNMLVERGPLPENE 130
                I +EI  +K L HPN++RL +V + +  + +VLEYA  GE +  + ++  L E+ 
Sbjct: 122 ---IKIYREINALKHLTHPNIVRLEEVLQNSKYIGIVLEYASGGEFYKYIQKKRRLKESV 178

Query: 131 AVRAFRQIIIGISYCHSLGVVHRDLKPEXXXXXXXXXXXXADFGMAALESE-DKLLETSC 189
           A   F Q++ G+ Y H  G+VHRDLK E             DFG     S+  +L++TSC
Sbjct: 179 ASNLFSQLVSGVYYMHCKGLVHRDLKLENLLLDKYGNLIITDFGFVNEFSKFSELMKTSC 238

Query: 190 GSPHYAAPE-IISGLPYEGFSSDVWSCGVILFALLTGRLPFDEE----DGN-IRNLLLKV 243
           GSP YAAPE +IS  PYE   +D+WSCG+ILFA+L G LP+D++    DGN I  L   +
Sbjct: 239 GSPCYAAPELVISTRPYEARKADIWSCGIILFAMLAGYLPWDDDPKNPDGNDIAKLYKYI 298

Query: 244 QKGEFEMPDDDEITKEAQDLLARLLTVDPSKRITIREILKHPLL 287
                + P  + I+  A+DLL  +L   P KR T+++ILKH  L
Sbjct: 299 TTTPLKFP--EYISPMARDLLRNILIPYPQKRATLKQILKHQWL 340

>Skud_15.399 Chr15 (714789..717212) [2424 bp, 807 aa] {ON} YOR233W
           (REAL)
          Length = 807

 Score =  176 bits (446), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 106/291 (36%), Positives = 156/291 (53%), Gaps = 26/291 (8%)

Query: 13  KNNQIGPWKLGETLGSGSTGKVLL------ASNETTKQQAAVKVISKAVFEAMNNSESNG 66
           K+   GP+ +G TLG G  GKV L      + NE  KQ  A+K+I +   +   + E   
Sbjct: 39  KHATFGPYIVGSTLGEGEFGKVKLGWTKAFSPNEVPKQ-VAIKLIRRDSIKKDADKE--- 94

Query: 67  DATNALPYNIEQEIIIMKLLNHPNVLRLFDVWETNSDLYLVLEYAEKGELFNMLVERGPL 126
                    I +EI  +K L HPN++ L +V + +  + +VLE+   GE +  +  +  L
Sbjct: 95  -------VKIYREINALKHLTHPNIIYLEEVLQNSKYIGIVLEFVSGGEFYKYIQRKRRL 147

Query: 127 PENEAVRAFRQIIIGISYCHSLGVVHRDLKPEXXXXXXXXXXXXADFGMAALESED-KLL 185
            E+ A R F Q+I G+ Y HS G+VHRDLK E             DFG      ED +L+
Sbjct: 148 KESSACRLFAQLISGVDYMHSKGLVHRDLKLENLLLDKHENLVITDFGFVNEFFEDNELM 207

Query: 186 ETSCGSPHYAAPE-IISGLPYEGFSSDVWSCGVILFALLTGRLPFDEEDGN-----IRNL 239
            TSCGSP YAAPE ++S   YE   +DVWSCGVIL+A+L G LP+D++  N     I  L
Sbjct: 208 RTSCGSPCYAAPELVVSTKAYEARKADVWSCGVILYAMLAGYLPWDDDHENPTGDDIARL 267

Query: 240 LLKVQKGEFEMPDDDEITKEAQDLLARLLTVDPSKRITIREILKHPLLQKY 290
              + +   + P  + IT   +DLL R+L  +P +R+++R I +H  L+ +
Sbjct: 268 YQYITQTPLKFP--EYITPVPRDLLRRILVPNPRRRVSVRAIQRHEWLKPH 316

>Ecym_8339 Chr8 (684113..686875) [2763 bp, 920 aa] {ON} similar to
           Ashbya gossypii ACR119W
          Length = 920

 Score =  177 bits (448), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 102/284 (35%), Positives = 151/284 (53%), Gaps = 22/284 (7%)

Query: 17  IGPWKLGETLGSGSTGKVLLA-SN---ETTKQQAAVKVISKAVFEAMNNSESNGDATNAL 72
            GP+ +G TLG G  GKV L  SN   E   +  A+K++ +      +  E         
Sbjct: 62  FGPYIVGPTLGEGEFGKVKLGWSNSKPEEGSKNVAIKLVRRDTIPKHSEKE--------- 112

Query: 73  PYNIEQEIIIMKLLNHPNVLRLFDVWETNSDLYLVLEYAEKGELFNMLVERGPLPENEAV 132
              I +EI  +K LNHPN++RL +V + +  + +VL+YA  GE +  + ++  L E  A 
Sbjct: 113 -VKIYREINALKHLNHPNIVRLEEVLQNSKYIGIVLQYASGGEFYKYIQKKRRLKEPPAC 171

Query: 133 RAFRQIIIGISYCHSLGVVHRDLKPEXXXXXXXXXXXXADFGMAALESEDKLLETSCGSP 192
           R F Q+I G+ Y H  G+ HRDLK E             DFG      ++ L++TSCGSP
Sbjct: 172 RLFAQLISGVYYMHHKGLAHRDLKLENLLLDEHENLMITDFGFVNEFHKNDLMKTSCGSP 231

Query: 193 HYAAPE-IISGLPYEGFSSDVWSCGVILFALLTGRLPFDEEDGN-----IRNLLLKVQKG 246
            YAAPE +++  PYE   +DVWSCGVIL+A+L G LP+D++  N     I  L   + K 
Sbjct: 232 CYAAPELVVTARPYEARKADVWSCGVILYAMLAGYLPWDDDPENPEGDDIAKLYHYITKS 291

Query: 247 EFEMPDDDEITKEAQDLLARLLTVDPSKRITIREILKHPLLQKY 290
             + P  + I    +DLL R+L  +P  R+++ EI  H  L+ +
Sbjct: 292 ALKFP--EYIKPLPRDLLRRILVSNPDTRLSVMEIKNHEWLRPH 333

>KLLA0F19536g Chr6 (1808263..1811577) [3315 bp, 1104 aa] {ON}
           similar to uniprot|P13186 Saccharomyces cerevisiae
           YLR096W KIN2 Serine/threonine protein kinase involved in
           regulation of exocytosis localizes to the cytoplasmic
           face of the plasma membrane closely related to Kin1p and
           to YDR122W uniprot|P13185 Saccharomyces cerevisiae
           YDR122W KIN1 Serine/threonine protein kinase involved in
           regulation of exocytosis; localizes to the cytoplasmic
           face of the plasma membrane; closely related to Kin2p
          Length = 1104

 Score =  177 bits (449), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 93/295 (31%), Positives = 158/295 (53%), Gaps = 33/295 (11%)

Query: 17  IGPWKLGETLGSGSTGKVLLASNETTKQQAAVKVISKAVFEAMNNSESNGDATNALPY-N 75
           +G W   ET+G+GS GKV LA +  T +  A+K++++A    M+         N LP   
Sbjct: 95  LGDWDFLETVGAGSMGKVKLAKHRLTNEVCAIKIVNRAAKSYMHKQ-------NQLPPPK 147

Query: 76  IEQEII---------------------IMKLLNHPNVLRLFDVWETNSDLYLVLEYAEKG 114
            E+E++                     + ++L HP++ RLF++   ++  Y++ EY   G
Sbjct: 148 TEEELMERKKKLEKELSRDRRTIREASLGQILYHPHICRLFEMCTMSNHFYMLFEYVSGG 207

Query: 115 ELFNMLVERGPLPENEAVRAFRQIIIGISYCHSLGVVHRDLKPEXXXXXXXXXXXXADFG 174
           +L + +++ G L E  A +  R I   + Y H   +VHRDLK E             DFG
Sbjct: 208 QLLDYIIQHGSLRERHARKFVRGIASALQYLHLNNIVHRDLKIENIMISTSGEIKIIDFG 267

Query: 175 MAALESEDKLLETSCGSPHYAAPEIISGLPYEGFSSDVWSCGVILFALLTGRLPFDEEDG 234
           ++ L    K L T CGS ++AAPE++   PY G   D+WS GV+++ L+ G++PFD+E+ 
Sbjct: 268 LSNLYDNKKQLHTFCGSLYFAAPELLKANPYIGPEVDIWSFGVVIYVLVCGKVPFDDENA 327

Query: 235 NIRNLLLKVQKGEFEMPDDDEITKEAQDLLARLLTVDPSKRITIREILKHPLLQK 289
           ++  L  K++KG+ E P    ++ E   LL+++L VDP KR +++++  H  +Q+
Sbjct: 328 SV--LHEKIKKGKVEYP--QHLSIECISLLSKMLVVDPLKRASLKQVCNHQWMQR 378

>KAFR0A03730 Chr1 (761946..764312) [2367 bp, 788 aa] {ON} Anc_8.654
           YPL141C
          Length = 788

 Score =  175 bits (444), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 104/293 (35%), Positives = 158/293 (53%), Gaps = 24/293 (8%)

Query: 13  KNNQIGPWKLGETLGSGSTGKVLLA---SNETT--KQQAAVKVISKAVFEAMNNSESNGD 67
           K+   GP+ +G TLG G  GKV L     NE+T   +Q A+K+I +         E    
Sbjct: 27  KHVTFGPYIVGSTLGKGEFGKVKLGWSRKNESTDISKQVAIKLIRRDSILQDREKE---- 82

Query: 68  ATNALPYNIEQEIIIMKLLNHPNVLRLFDVWETNSDLYLVLEYAEKGELFNMLVERGPLP 127
                   I +EI  +K L HPN++RL +V + +  + +VLEYA  GE +  + ++  L 
Sbjct: 83  ------IKIYREINALKHLTHPNIVRLEEVLQNSKYIGIVLEYASGGEFYKYIQKKRRLK 136

Query: 128 ENEAVRAFRQIIIGISYCHSLGVVHRDLKPEXXXXXXXXXXXXADFGMA-ALESEDKLLE 186
           E  A + F Q++ G+ Y HS G+VHRDLK E             DFG        ++L++
Sbjct: 137 EPIACKLFAQLVSGVYYMHSKGLVHRDLKLENLLLDKNENLIITDFGFVNEFLQNNELMK 196

Query: 187 TSCGSPHYAAPE-IISGLPYEGFSSDVWSCGVILFALLTGRLPFDEEDGNIRN-----LL 240
           TSCGSP YAAPE +++  PY+   +DVWSCG+ILFA+L G LP+D++  N R      L 
Sbjct: 197 TSCGSPCYAAPELVVTSNPYKARKADVWSCGIILFAMLAGYLPWDDDPDNPRGDDIAKLY 256

Query: 241 LKVQKGEFEMPDDDEITKEAQDLLARLLTVDPSKRITIREILKHPLLQKYPSI 293
             +     + P    I+   +DLL ++L  +P++R+++REI  H  L+ + S 
Sbjct: 257 NYITTSPLKFP--SYISAIPRDLLRKILVANPNQRLSLREIETHQWLKPHSSF 307

>Suva_8.284 Chr8 (514891..517317) [2427 bp, 808 aa] {ON} YOR233W
           (REAL)
          Length = 808

 Score =  175 bits (444), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 105/291 (36%), Positives = 157/291 (53%), Gaps = 26/291 (8%)

Query: 13  KNNQIGPWKLGETLGSGSTGKVLL------ASNETTKQQAAVKVISKAVFEAMNNSESNG 66
           K+   GP+ +G TLG G  GKV L      + NE  KQ  A+K+I +   +   + E   
Sbjct: 39  KHATFGPYIVGSTLGEGEFGKVKLGWSKASSPNEVPKQ-VAIKLIRRDTIKKDADKE--- 94

Query: 67  DATNALPYNIEQEIIIMKLLNHPNVLRLFDVWETNSDLYLVLEYAEKGELFNMLVERGPL 126
                    I +EI  +K L HPN++ L +V + +  + +VLE+   GE +  +  +  L
Sbjct: 95  -------VKIYREINALKHLTHPNIIYLEEVLQNSKYIGIVLEFVSGGEFYKYIQRKRRL 147

Query: 127 PENEAVRAFRQIIIGISYCHSLGVVHRDLKPEXXXXXXXXXXXXADFGMAALESED-KLL 185
            E+ A R F Q+I G++Y H+ G+VHRDLK E             DFG      ED +L+
Sbjct: 148 KESSACRLFAQLISGVNYMHTKGLVHRDLKLENLLMDKHENLVITDFGFVNEFFEDNELM 207

Query: 186 ETSCGSPHYAAPE-IISGLPYEGFSSDVWSCGVILFALLTGRLPFDEEDGN-----IRNL 239
            TSCGSP YAAPE ++S   YE   +DVWSCGVIL+A+L G LP+D++  N     I  L
Sbjct: 208 RTSCGSPCYAAPELVVSTKAYEARKADVWSCGVILYAMLAGYLPWDDDHENPTGDDIARL 267

Query: 240 LLKVQKGEFEMPDDDEITKEAQDLLARLLTVDPSKRITIREILKHPLLQKY 290
              + +   + P  + IT   +DLL R+L  +P +R+++R I +H  L+ +
Sbjct: 268 YQYITQTPLKFP--EYITPIPRDLLRRILVPNPRRRVSLRAIQRHEWLKPH 316

>KAFR0B02800 Chr2 (571295..574582) [3288 bp, 1095 aa] {ON} Anc_8.279
           YLR096W
          Length = 1095

 Score =  177 bits (448), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 90/286 (31%), Positives = 160/286 (55%), Gaps = 19/286 (6%)

Query: 17  IGPWKLGETLGSGSTGKVLLASNETTKQQAAVKVISKAVFEAMNNSESNGDATNALPY-- 74
           +G W   ET+G+GS GKV LA +  T +  A+K++++A    ++  +S     N      
Sbjct: 98  LGDWDFLETVGAGSMGKVKLARHHQTNEICAIKIVNRATKAYLHKEQSLAPPKNENEMLE 157

Query: 75  ---NIEQEII----------IMKLLNHPNVLRLFDVWETNSDLYLVLEYAEKGELFNMLV 121
               +E+EI           + ++L HP++ RLF++   ++  Y++ EY   G+L + ++
Sbjct: 158 RQKKLEKEISRDKRTIREASLGQVLYHPHICRLFEMCTMSNHFYMLFEYVSGGQLLDYII 217

Query: 122 ERGPLPENEAVRAFRQIIIGISYCHSLGVVHRDLKPEXXXXXXXXXXXXADFGMAALESE 181
           + G L E+ A +  R +   + Y H+  +VHRDLK E             DFG++ +   
Sbjct: 218 QHGSLREHHARKFARGVASALQYLHANNIVHRDLKIENIMISTSGEIKIIDFGLSNVFDT 277

Query: 182 DKLLETSCGSPHYAAPEIISGLPYEGFSSDVWSCGVILFALLTGRLPFDEEDGNIRNLLL 241
            K L T CGS ++AAPE++   PY G   D+WS GV+L+ L+ G++PFD+E+ ++  L  
Sbjct: 278 RKQLHTFCGSLYFAAPELLKANPYIGPEVDIWSFGVVLYVLVCGKVPFDDENSSV--LHE 335

Query: 242 KVQKGEFEMPDDDEITKEAQDLLARLLTVDPSKRITIREILKHPLL 287
           K+++G+ E P  + ++ E   LL+++L VDP KR  + ++++HP +
Sbjct: 336 KIKQGKVEYP--NHLSIEVISLLSKMLVVDPLKRANLTKVIEHPWM 379

>YOR233W Chr15 (775846..778248) [2403 bp, 800 aa] {ON}
           KIN4Serine/threonine protein kinase that inhibits the
           mitotic exit network (MEN) when the spindle position
           checkpoint is activated; localized asymmetrically to
           mother cell cortex, spindle pole body and bud neck
          Length = 800

 Score =  174 bits (441), Expect = 5e-44,   Method: Compositional matrix adjust.
 Identities = 107/291 (36%), Positives = 158/291 (54%), Gaps = 26/291 (8%)

Query: 13  KNNQIGPWKLGETLGSGSTGKVLL------ASNETTKQQAAVKVISKAVFEAMNNSESNG 66
           K+   GP+ +G TLG G  GKV L      +SNE  KQ  A+K+I +   +         
Sbjct: 39  KHATFGPYIIGSTLGEGEFGKVKLGWTKASSSNEVPKQ-VAIKLIRRDTIKK-------- 89

Query: 67  DATNALPYNIEQEIIIMKLLNHPNVLRLFDVWETNSDLYLVLEYAEKGELFNMLVERGPL 126
           DA   +   I +EI  +K L HPN++ L +V + +  + +VLE+   GE +  +  +  L
Sbjct: 90  DADKEI--KIYREINALKHLTHPNIIYLEEVLQNSKYIGIVLEFVSGGEFYKYIQRKRRL 147

Query: 127 PENEAVRAFRQIIIGISYCHSLGVVHRDLKPEXXXXXXXXXXXXADFGMAALESED-KLL 185
            E+ A R F Q+I G++Y H  G+VHRDLK E             DFG      ED +L+
Sbjct: 148 KESSACRLFAQLISGVNYMHYKGLVHRDLKLENLLLDKHENLVITDFGFVNEFFEDNELM 207

Query: 186 ETSCGSPHYAAPE-IISGLPYEGFSSDVWSCGVILFALLTGRLPFDEEDGN-----IRNL 239
           +TSCGSP YAAPE ++S   YE   +DVWSCGVIL+A+L G LP+D++  N     I  L
Sbjct: 208 KTSCGSPCYAAPELVVSTKAYEARKADVWSCGVILYAMLAGYLPWDDDHENPTGDDIARL 267

Query: 240 LLKVQKGEFEMPDDDEITKEAQDLLARLLTVDPSKRITIREILKHPLLQKY 290
              + +   + P  + IT   +DLL R+L  +P +RI ++ I +H  L+ +
Sbjct: 268 YKYITQTPLKFP--EYITPIPRDLLRRILVPNPRRRINLQTIKRHVWLKPH 316

>ZYRO0F07194g Chr6 complement(581438..584254) [2817 bp, 938 aa] {ON}
           similar to uniprot|Q12152 Saccharomyces cerevisiae
           YPL150W Hypothetical ORF
          Length = 938

 Score =  175 bits (443), Expect = 6e-44,   Method: Compositional matrix adjust.
 Identities = 103/330 (31%), Positives = 170/330 (51%), Gaps = 26/330 (7%)

Query: 16  QIGPWKLGETLGSGSTGKVLLASNETTKQQAAVKVISKAVFEAMNNSESNGDATNALPYN 75
           ++G +K+ + +G GS GKV LAS++ T ++  +K   K+                    N
Sbjct: 33  EVGNYKILKQIGEGSFGKVYLASHKPTHRKVVLKTSDKS------------------DPN 74

Query: 76  IEQEIIIMKLLNHPNVLRLFDVWETNSDLYLVLEYAEKGELFNMLVERGPLPENEAVRAF 135
           + +E+   +  + P + +L++V  T + +++ LEY    EL+  L+    +P +E  + F
Sbjct: 75  LVREVFYHRQFDFPYITKLYEVIVTETKVWMALEYCPGRELYEHLLMLHRIPLDECAKLF 134

Query: 136 RQIIIGISYCHSLGVVHRDLKPEXXXXXXXXXXXXADFGMAALESEDKLLETSCGSPHYA 195
            QI+  + Y HSL  VHRDLK E             DFG          LET CG+  Y 
Sbjct: 135 AQIVSAVHYAHSLNCVHRDLKLENILLDKNGNAKLTDFGFTRECVSKSSLETICGTTVYM 194

Query: 196 APEIISGLPYEGFSSDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQKGEFEMPDDDE 255
           APE+I    Y+GF  D+WS GVIL+ ++ G +PFDE+D       +     +F   +D+ 
Sbjct: 195 APELIQRQAYDGFKIDIWSLGVILYTMINGTMPFDEDDETKTKWKI---VNDFPNFNDNF 251

Query: 256 ITKEAQDLLARLLTVDPSKRITIREILKHPLLQKYPSIKDSRSIRNLPREDTYLSPLADT 315
           ++ EA+DL+ RLL   PS+R T+ +IL HP LQ Y  I  SR+ + + R+   ++     
Sbjct: 252 VSHEAKDLIKRLLAKCPSERPTMEQILSHPFLQPYGQIMLSRTEKIIKRQRLGMTQF--- 308

Query: 316 NSKIDDAILQNLVILWHGKDAREIAAKLRE 345
            S+++  +L+ L     G DA+ I A +++
Sbjct: 309 RSRLERKLLKRLK--QSGFDAQSIKASIQK 336

>NCAS0C01670 Chr3 complement(306682..309372) [2691 bp, 896 aa] {ON}
           Anc_8.668
          Length = 896

 Score =  174 bits (441), Expect = 8e-44,   Method: Compositional matrix adjust.
 Identities = 92/277 (33%), Positives = 148/277 (53%), Gaps = 21/277 (7%)

Query: 16  QIGPWKLGETLGSGSTGKVLLASNETTKQQAAVKVISKAVFEAMNNSESNGDATNALPYN 75
           ++G +K+ + +G GS GKV LA +  T  +  +K           +S+ N         N
Sbjct: 34  EVGNYKILDQIGEGSFGKVYLAQHRPTHTKVVLK-----------SSDKNDP-------N 75

Query: 76  IEQEIIIMKLLNHPNVLRLFDVWETNSDLYLVLEYAEKGELFNMLVERGPLPENEAVRAF 135
           I +E+   +  ++P + +L++V  T + +++ LEY    EL++ ++    +P +E V+ F
Sbjct: 76  IVREVFYHRQFDYPYITKLYEVIITETKVWMALEYCPGKELYDRVLSMHRVPTDECVQLF 135

Query: 136 RQIIIGISYCHSLGVVHRDLKPEXXXXXXXXXXXXADFGMAALESEDKLLETSCGSPHYA 195
            QI+ G+ Y HSL  VHRDLK E             DFG          LET CG+  Y 
Sbjct: 136 AQIVGGVHYAHSLNCVHRDLKLENILLDKSGDAKLTDFGFTRECMTKTTLETICGTTVYM 195

Query: 196 APEIISGLPYEGFSSDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQKGEFEMPDDDE 255
           APE+I    Y+GF  D+WS GVIL+ ++ G +PFDE+D       +  Q  +    +++ 
Sbjct: 196 APELIERKSYDGFKIDIWSLGVILYTMINGSMPFDEDDETKTEWKIVHQTPQL---NENI 252

Query: 256 ITKEAQDLLARLLTVDPSKRITIREILKHPLLQKYPS 292
           +T +A+DL+ RLL  +P+ R T+ +ILKHP LQ + S
Sbjct: 253 VTADAKDLILRLLAKNPNDRPTVEQILKHPFLQPFGS 289

>KNAG0A03040 Chr1 complement(372150..374084) [1935 bp, 644 aa] {ON}
           Anc_8.654 YPL141C
          Length = 644

 Score =  171 bits (433), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 105/304 (34%), Positives = 155/304 (50%), Gaps = 30/304 (9%)

Query: 2   SAISSNTVSVIKNNQIGPWKLGETLGSGSTGKVLLA-----------SNETTKQQAAVKV 50
           S+ S  T S  +N   GP+ +G TLG G  GKV +             ++ T +Q A+K+
Sbjct: 32  SSNSIGTRSRKRNVTFGPYIVGSTLGEGEFGKVKMGWTRPVTDGNVGPSQRTPRQVAIKL 91

Query: 51  ISKAVFEAMNNSESNGDATNALPYNIEQEIIIMKLLNHPNVLRLFDVWETNSDLYLVLEY 110
           I +      ++ E+           I +EI  +K L HPN++ L ++ + +  + +VLEY
Sbjct: 92  IRRDTIVRNSDKETK----------IYREINALKHLTHPNIIVLEEILQNSKYIGIVLEY 141

Query: 111 AEKGELFNMLVERGPLPENEAVRAFRQIIIGISYCHSLGVVHRDLKPEXXXXXXXXXXXX 170
           A  GE +  +  +  L E  A R F Q++ G+ Y HS G+VHRDLK E            
Sbjct: 142 ASGGEFYKYIQRKRRLKEVNASRLFSQLVSGVHYMHSKGLVHRDLKLENLLLDKNENLMI 201

Query: 171 ADFGMA-ALESEDKLLETSCGSPHYAAPE-IISGLPYEGFSSDVWSCGVILFALLTGRLP 228
            DFG      +E+ L++TSCGSP YAAPE ++S   Y G   D+WSCGVIL+A+L G LP
Sbjct: 202 TDFGFVNEFSNENVLMKTSCGSPCYAAPELVVSREAYVGVKVDIWSCGVILYAMLAGYLP 261

Query: 229 FDEEDGN-----IRNLLLKVQKGEFEMPDDDEITKEAQDLLARLLTVDPSKRITIREILK 283
           +D++  N     I  L   +     + P  D +    +DLL R+L  DP +R T+  I  
Sbjct: 262 WDDDPSNPNGDDISKLYSYITATPLKFP--DYVNPLPRDLLRRILVADPRRRYTLGHIEN 319

Query: 284 HPLL 287
           H  L
Sbjct: 320 HEWL 323

>SAKL0H06754g Chr8 (594995..597649) [2655 bp, 884 aa] {ON} similar
           to uniprot|Q12152 Saccharomyces cerevisiae YPL150W
           Hypothetical ORF
          Length = 884

 Score =  173 bits (438), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 92/276 (33%), Positives = 149/276 (53%), Gaps = 21/276 (7%)

Query: 17  IGPWKLGETLGSGSTGKVLLASNETTKQQAAVKVISKAVFEAMNNSESNGDATNALPYNI 76
           IG +K+ + +G GS GKV LA++  T Q+  +K                G+  +    N+
Sbjct: 34  IGNYKIVKLIGEGSFGKVYLANHRLTHQKVVLKT---------------GNKNDP---NV 75

Query: 77  EQEIIIMKLLNHPNVLRLFDVWETNSDLYLVLEYAEKGELFNMLVERGPLPENEAVRAFR 136
            +E+   +  + P++ +L++V  T S +++ LEY    EL+  L+ +  +   E+ + F 
Sbjct: 76  VREVFYHRQFDFPHITKLYEVIVTESKVWMALEYCPGKELYEYLLMQHRISLEESGKLFA 135

Query: 137 QIIIGISYCHSLGVVHRDLKPEXXXXXXXXXXXXADFGMAALESEDKLLETSCGSPHYAA 196
           QI+  + Y HSL  VHRDLK E             DFG     +   +LET CG+  Y A
Sbjct: 136 QIVSAVYYAHSLQCVHRDLKLENILLDKKGRAKITDFGFTRECATKTMLETVCGTTVYMA 195

Query: 197 PEIISGLPYEGFSSDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQKGEFEMPDDDEI 256
           PE+I    Y+GF  D+WS GVIL+ ++ G +PFDEED       +  ++  +   +DD +
Sbjct: 196 PELIERKSYDGFKIDIWSLGVILYTMIHGTMPFDEEDETKTKWKIINEEPFY---NDDVV 252

Query: 257 TKEAQDLLARLLTVDPSKRITIREILKHPLLQKYPS 292
           +K+A+DL+++LL  DPS+R  + ++L HP LQ Y S
Sbjct: 253 SKDAKDLISQLLCKDPSQRPQLSQVLAHPFLQPYGS 288

>CAGL0B01925g Chr2 (176316..179150) [2835 bp, 944 aa] {ON} similar
           to uniprot|P13185 Saccharomyces cerevisiae YDR122w KIN1
           or uniprot|P13186 Saccharomyces cerevisiae YLR096w KIN2
          Length = 944

 Score =  173 bits (438), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 94/294 (31%), Positives = 158/294 (53%), Gaps = 19/294 (6%)

Query: 11  VIKNNQIGPWKLGETLGSGSTGKVLLASNETTKQQAAVKVISKAVFEAMNNSES---NGD 67
           V     +  W   ET+G+GS GKV LA N+ + +  A+K++ +A    M+ ++      D
Sbjct: 58  VFHRKSLSGWDFMETVGAGSMGKVKLAKNKNSNEVCAIKIVHRATKAYMHKAQQLPPPAD 117

Query: 68  ATNA------LPYNIEQ------EIIIMKLLNHPNVLRLFDVWETNSDLYLVLEYAEKGE 115
              A      L   I +      E  + ++L HPNV +L+++   ++  Y+  E+   G+
Sbjct: 118 ENEAKERQKRLNKEISRDKRTVREASLGQILFHPNVCKLYEMQTLSNHYYMFFEFISGGQ 177

Query: 116 LFNMLVERGPLPENEAVRAFRQIIIGISYCHSLGVVHRDLKPEXXXXXXXXXXXXADFGM 175
           L + +++ G L EN A +  R I+  + Y H+  +VHRDLK E             DFG+
Sbjct: 178 LLDYIIQHGSLKENHARKVSRGILSALQYLHANNIVHRDLKIENIMLSKTGEIKLIDFGL 237

Query: 176 AALESEDKLLETSCGSPHYAAPEIISGLPYEGFSSDVWSCGVILFALLTGRLPFDEEDGN 235
           + +    K L+T CGS ++AAPE++   PY G   DVWS GV+L+ L+ G++PFD+E  N
Sbjct: 238 SNMYDPRKSLQTFCGSLYFAAPELLKAHPYLGPEVDVWSFGVVLYVLVCGKVPFDDE--N 295

Query: 236 IRNLLLKVQKGEFEMPDDDEITKEAQDLLARLLTVDPSKRITIREILKHPLLQK 289
              L  K++KG+   P    ++ +   LL+++L VDP KR T+++++ H  + K
Sbjct: 296 SSALHEKIKKGKVTYP--QFLSIDVISLLSKILVVDPQKRATLQQVVNHQWMLK 347

>NDAI0E02390 Chr5 complement(496256..498907) [2652 bp, 883 aa] {ON}
           Anc_8.668
          Length = 883

 Score =  172 bits (437), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 106/342 (30%), Positives = 171/342 (50%), Gaps = 52/342 (15%)

Query: 16  QIGPWKLGETLGSGSTGKVLLASNETTKQQAAVKVISKAVFEAMNNSESNGDATNALPYN 75
           ++G +K+ + +G GS GKV LAS+  T          K V +  N S+ N          
Sbjct: 34  EVGNYKILDQIGEGSFGKVYLASHRLTH--------CKVVLKTSNKSDPN---------- 75

Query: 76  IEQEIIIMKLLNHPNVLRLFDVWETNSDLYLVLEYAEKGELFNMLVERGPLPENEAVRAF 135
           I +E+   +  ++P + +L++V  T S +++  EY    +L++ ++    +P +  +  F
Sbjct: 76  IVREVFYHRQFDYPYITQLYEVIVTESKVWMAQEYCPGKDLYDHVLSLQRVPSSACIELF 135

Query: 136 RQIIIGISYCHSLGVVHRDLKPEXXXXXXXXXXXXADFGMAALESEDKLLETSCGSPHYA 195
            QI+  + Y HSL  VHRDLK E             DFG          LET CG+  Y 
Sbjct: 136 TQIVGAVYYAHSLNCVHRDLKLENILLDKNGNAKLTDFGFTRECMTKTSLETICGTTVYM 195

Query: 196 APEIISGLPYEGFSSDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQKGEF----EMP 251
           APE+I    Y+GF  D+WS GVIL+ +L G +PFDE+D           K E+    EMP
Sbjct: 196 APELIKRESYDGFKIDIWSLGVILYTMLNGSMPFDEDDET---------KTEWKIMNEMP 246

Query: 252 --DDDEITKEAQDLLARLLTVDPSKRITIREILKHPLLQKYPSIKDSRSIRNLPREDTYL 309
             +D  ++++A+DLL +LL+ DP++R +++EIL HP LQ Y S+   ++ R L ++    
Sbjct: 247 VFNDTILSEDAKDLLIKLLSKDPNERPSMQEILHHPFLQPYGSLLLEKTDRLLRKQ---- 302

Query: 310 SPLADTNSKIDDAILQNLVILWHGKDAREIAAKLREPGANTE 351
                          +N  I +H K  R++   L+  G +T+
Sbjct: 303 ---------------RNGTIHFHSKLERKLLKNLKRTGFDTQ 329

>ACR119W Chr3 (560761..563556) [2796 bp, 931 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPL141C and YOR233W
           (KIN4)
          Length = 931

 Score =  172 bits (436), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 103/290 (35%), Positives = 152/290 (52%), Gaps = 34/290 (11%)

Query: 17  IGPWKLGETLGSGSTGKVLL----ASNETTKQQAAVKVISKAVFEAMNNSESNGDATNAL 72
            GP+ +G TLG G  GKV L    A  +   +  A+K+I +                + +
Sbjct: 42  FGPYIIGPTLGEGEFGKVKLGWSKARLDGDSRNVAIKLIRR----------------DTV 85

Query: 73  PYNIEQEIII------MKLLNHPNVLRLFDVWETNSDLYLVLEYAEKGELFNMLVERGPL 126
           P N E+EI I      +KLL+HPN++RL +V + +  + +VL+YA  GE +  + ++  L
Sbjct: 86  PKNSEKEIKIYRELNALKLLSHPNIVRLEEVLQNSKYIGIVLQYASGGEFYKYIQKKRRL 145

Query: 127 PENEAVRAFRQIIIGISYCHSLGVVHRDLKPEXXXXXXXXXXXXADFGMAALESEDKLLE 186
            E  A R F Q+I G+ Y H  G+ HRDLK E             DFG      ++ L+ 
Sbjct: 146 KEPPACRLFAQLISGVHYIHYKGLAHRDLKLENLLLDEHENLIITDFGFVNEFHKNDLMR 205

Query: 187 TSCGSPHYAAPE-IISGLPYEGFSSDVWSCGVILFALLTGRLPFDEEDGN-----IRNLL 240
           TSCGSP YAAPE ++S  PY    +DVWSCGVIL+A+L G LP+D++  N     I  L 
Sbjct: 206 TSCGSPCYAAPELVVSSKPYSAQKADVWSCGVILYAMLAGYLPWDDDPENPEGEDIAKLY 265

Query: 241 LKVQKGEFEMPDDDEITKEAQDLLARLLTVDPSKRITIREILKHPLLQKY 290
             +     + P  + I    +DLL R+L  +P  R+T+ +I +H  LQ +
Sbjct: 266 QYITHTSLKFP--EYIKPIPRDLLKRILVSNPEVRLTVADIEQHAWLQPH 313

>TBLA0C01750 Chr3 (412762..415707) [2946 bp, 981 aa] {ON} Anc_8.654
           YPL141C
          Length = 981

 Score =  172 bits (435), Expect = 5e-43,   Method: Compositional matrix adjust.
 Identities = 107/290 (36%), Positives = 154/290 (53%), Gaps = 29/290 (10%)

Query: 17  IGPWKLGETLGSGSTGKVLL--------ASNETTKQQAAVKVISKA-VFEAMNNSESNGD 67
            GP+ L  TLG G  GKV L        ASNE  KQ  A+K+I ++ +    +N E    
Sbjct: 81  FGPYILSSTLGEGEFGKVKLGWSKASTQASNEIPKQ-VAIKLIKRSSILPKGSNKE---- 135

Query: 68  ATNALPYNIEQEIIIMKLLNHPNVLRLFDVWETNSDLYLVLEYAEKGELFNMLVERGPLP 127
                   + +EI  +K L HPN+++L DV + +  + +VLEYA  GE +  +  +  L 
Sbjct: 136 ------IKVYREINALKQLCHPNIVKLDDVLQNSKYIGIVLEYASGGEFYKYIQRKKRLK 189

Query: 128 ENEAVRAFRQIIIGISYCHSLGVVHRDLKPEXXXXXXXXXXXXADFGMA-ALESEDKLLE 186
           E  A + F Q+I G+ Y HS G+VHRDLK E             DFG        ++L+ 
Sbjct: 190 EINASKLFSQLISGVHYMHSKGLVHRDLKLENLLLDKHENLIITDFGFVNEFFQTNELML 249

Query: 187 TSCGSPHYAAPE-IISGLPYEGFSSDVWSCGVILFALLTGRLPFDEE----DGN-IRNLL 240
           T CGSP YAAPE +IS  PYE   +D+WSCG+IL+A+L G LP+D++    DGN I  L 
Sbjct: 250 TPCGSPCYAAPELVISKHPYEARKADLWSCGIILYAMLAGYLPWDDDIKNPDGNDIARLY 309

Query: 241 LKVQKGEFEMPDDDEITKEAQDLLARLLTVDPSKRITIREILKHPLLQKY 290
             +     + P  + I    +DLL ++L  +  KRI +R I+ H  L+ +
Sbjct: 310 YYITTTPLKFP--EYIQPLPRDLLRKILVPNYKKRINMRRIINHEWLKPH 357

>ZYRO0D06776g Chr4 complement(583027..586641) [3615 bp, 1204 aa]
           {ON} similar to uniprot|P13186 Saccharomyces cerevisiae
           YLR096W KIN2 Serine/threonine protein kinase involved in
           regulation of exocytosis localizes to the cytoplasmic
           face of the plasma membrane closely related to Kin1p and
           to YDR122W uniprot|P13185 Saccharomyces cerevisiae
           YDR122W KIN1 Serine/threonine protein kinase involved in
           regulation of exocytosis; localizes to the cytoplasmic
           face of the plasma membrane; closely related to Kin2p
          Length = 1204

 Score =  171 bits (434), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 90/283 (31%), Positives = 158/283 (55%), Gaps = 19/283 (6%)

Query: 17  IGPWKLGETLGSGSTGKVLLASNETTKQQAAVKVISKAVFEAMNNSESNGDATN---ALP 73
           +G W   ET+G+GS GKV +A +  T +  A+K+I++A    ++  +      N   AL 
Sbjct: 137 LGDWDFLETVGAGSMGKVKIAKHHYTNEICAIKIINRATKAFLHKEQQLPPPQNEQEALE 196

Query: 74  YN--IEQEII----------IMKLLNHPNVLRLFDVWETNSDLYLVLEYAEKGELFNMLV 121
               +E+EI           + + L HP++ RLF++   ++  Y++ EY   G+L + ++
Sbjct: 197 RQKKLEKEISRDKRTIREASLGQALYHPHICRLFEMCTMSNHFYMLFEYVSGGQLLDYII 256

Query: 122 ERGPLPENEAVRAFRQIIIGISYCHSLGVVHRDLKPEXXXXXXXXXXXXADFGMAALESE 181
           + G L E+ A +  R I   + Y H+  +VHRDLK E             DFG++ +   
Sbjct: 257 QHGSLREHHARKFARGIASALQYLHANNIVHRDLKIENIMISTSGEIKIIDFGLSNMFDP 316

Query: 182 DKLLETSCGSPHYAAPEIISGLPYEGFSSDVWSCGVILFALLTGRLPFDEEDGNIRNLLL 241
              L T CGS ++AAPE++   PY G   DVWS GV+L+ L+ G++PFD+E+ ++  L  
Sbjct: 317 RTQLHTFCGSLYFAAPELLKASPYVGPEVDVWSFGVVLYVLVCGKVPFDDENSSV--LHE 374

Query: 242 KVQKGEFEMPDDDEITKEAQDLLARLLTVDPSKRITIREILKH 284
           K+++G+ + P    ++ E   LL+++L VDP KR +++++++H
Sbjct: 375 KIKQGKVDYP--QHLSIEVISLLSKMLVVDPRKRASLKQVVEH 415

>KLLA0D07348g Chr4 (626999..629728) [2730 bp, 909 aa] {ON} similar
           to uniprot|Q03002 Saccharomyces cerevisiae YPL141C
           Hypothetical ORF
          Length = 909

 Score =  170 bits (430), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 105/290 (36%), Positives = 150/290 (51%), Gaps = 34/290 (11%)

Query: 17  IGPWKLGETLGSGSTGKVLLA---SNETTKQQAAVKVISKAVFEAMNNSESNGDATNALP 73
            GP+ +G TLG G  GKV L    SN    +  A+K+I +                + +P
Sbjct: 53  FGPYIIGPTLGEGEFGKVKLGWSKSNSDESKNVAIKLIRR----------------DTIP 96

Query: 74  YNIEQEIII------MKLLNHPNVLRLFDVWETNSDLYLVLEYAEKGELFNMLVERGPLP 127
            N E+E+ I      +K L HPN++ L +V + +  + +VL YA  GE +  + ++  L 
Sbjct: 97  KNSEKEVKIYREINALKHLAHPNIVTLEEVLQNSKYIGIVLHYASGGEFYKYIQKKRRLK 156

Query: 128 ENEAVRAFRQIIIGISYCHSLGVVHRDLKPEXXXXXXXXXXXXADFGMA-ALESEDKLLE 186
           E  A R F Q+I G+ Y H  G+ HRDLK E             DFG      S + L++
Sbjct: 157 EPAACRLFAQLISGVHYMHHKGLAHRDLKLENLLLDEHENLIITDFGFVNEFSSRNDLMK 216

Query: 187 TSCGSPHYAAPE-IISGLPYEGFSSDVWSCGVILFALLTGRL-----PFDEEDGNIRNLL 240
           TSCGSP YAAPE +++   YE   +DVWSCGVIL+A+L G L     P + +  +I  L 
Sbjct: 217 TSCGSPCYAAPELVVTTKAYEARKADVWSCGVILYAMLAGYLPWDDDPDNPDGDDIAKLY 276

Query: 241 LKVQKGEFEMPDDDEITKEAQDLLARLLTVDPSKRITIREILKHPLLQKY 290
             + K   + P  + I    +D+L R+L  DPSKRIT+  ILKH  LQ +
Sbjct: 277 NYITKTSLKFP--EYINPIPRDILRRILVSDPSKRITVELILKHQWLQPH 324

>Kpol_1072.19 s1072 (44906..47596) [2691 bp, 896 aa] {ON}
           (44906..47596) [2691 nt, 897 aa]
          Length = 896

 Score =  167 bits (424), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 88/276 (31%), Positives = 148/276 (53%), Gaps = 21/276 (7%)

Query: 15  NQIGPWKLGETLGSGSTGKVLLASNETTKQQAAVKVISKAVFEAMNNSESNGDATNALPY 74
           N++G +K+ + +G GS GKV LA ++ T ++  +K               + D T+    
Sbjct: 34  NEVGNYKILKQIGEGSFGKVYLALHKPTHKKVVLK---------------SSDKTDP--- 75

Query: 75  NIEQEIIIMKLLNHPNVLRLFDVWETNSDLYLVLEYAEKGELFNMLVERGPLPENEAVRA 134
           N+ +EI   +  + P + +L++V  T + +++V+EY    EL++ L+ +  +  +E+ R 
Sbjct: 76  NVVREIFYHRQFDFPYITKLYEVIITETKVWMVIEYCPNKELYDYLLSKKRISLDESARI 135

Query: 135 FRQIIIGISYCHSLGVVHRDLKPEXXXXXXXXXXXXADFGMAALESEDKLLETSCGSPHY 194
           F QI+  + Y HSL  VHRDLK E             DFG     S++  LET CG+  Y
Sbjct: 136 FAQIVGAVYYAHSLSCVHRDLKLENILLDKDNNAKLTDFGFTRDFSKNTQLETICGTTVY 195

Query: 195 AAPEIISGLPYEGFSSDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQKGEFEMPDDD 254
            APE++    Y+G+  D+W+ G++L+ ++ G +PFDE+D     L +     ++   D+ 
Sbjct: 196 MAPELLRREKYDGYKIDIWALGILLYTIINGTMPFDEDDPKKTELKIISASPDY---DNK 252

Query: 255 EITKEAQDLLARLLTVDPSKRITIREILKHPLLQKY 290
               ++ DL+ RLL+ DPS R TI +IL HP L  Y
Sbjct: 253 YFNDDSIDLVNRLLSKDPSMRPTIEQILMHPFLASY 288

>Ecym_2405 Chr2 (788655..791222) [2568 bp, 855 aa] {ON} similar to
           Ashbya gossypii ACR133C
          Length = 855

 Score =  167 bits (423), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 93/280 (33%), Positives = 149/280 (53%), Gaps = 25/280 (8%)

Query: 16  QIGPWKLGETLGSGSTGKVLLASNETTKQQAAVKVISKAVFEAMNNSESNGDATNALPYN 75
           ++G +K+ + +G GS GKV LA+++ T Q+  +K                G+  +    N
Sbjct: 33  EVGNYKILKQVGEGSFGKVYLANHKLTHQKVVLKT---------------GEKKDP---N 74

Query: 76  IEQEIIIMKLLNHPNVLRLFDVWETNSDLYLVLEYAEKGELFNMLVERGPLPENEAVRAF 135
           + +E+   +  + P + +L++V  T S +++ LEY    EL++ L+++  +P +E  + F
Sbjct: 75  VVREVFYHRQFDFPFITKLYEVIVTESKVWMALEYCPGNELYDYLLQKQRIPLDETSKLF 134

Query: 136 RQIIIGISYCHSLGVVHRDLKPEXXXXXXXXXXXXADFGMAALESEDKLLETSCGSPHYA 195
            QI+  + Y HSL  VHRDLK E             DFG     +    LET CG+  Y 
Sbjct: 135 AQIVGAVFYAHSLQCVHRDLKLENILLDKQGYAMLTDFGFTRECATKTQLETICGTTVYM 194

Query: 196 APEIISGLPYEGFSSDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQKGEFEMPD--D 253
           APE+I    Y+G+  D WS G+IL+ +L G +PFDEED  +    LK+     EMP   D
Sbjct: 195 APELIKRESYDGYKVDTWSLGIILYTMLHGFMPFDEEDPTLTG--LKIMN---EMPPIVD 249

Query: 254 DEITKEAQDLLARLLTVDPSKRITIREILKHPLLQKYPSI 293
                 A+DL+ +LL   PS+R ++ ++L+HP LQ Y +I
Sbjct: 250 AYTNVHAKDLILKLLRKTPSERPSLNKVLEHPFLQPYGTI 289

>ACR133C Chr3 complement(581468..584023) [2556 bp, 851 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPL150W
          Length = 851

 Score =  166 bits (419), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 90/280 (32%), Positives = 149/280 (53%), Gaps = 25/280 (8%)

Query: 16  QIGPWKLGETLGSGSTGKVLLASNETTKQQAAVKVISKAVFEAMNNSESNGDATNALPYN 75
           ++G +++ + +G GS GKV LA+++ T Q+  +K  +K+                    N
Sbjct: 33  EVGNYRIVKQVGEGSFGKVYLATHKLTHQKVVLKTGAKS------------------DPN 74

Query: 76  IEQEIIIMKLLNHPNVLRLFDVWETNSDLYLVLEYAEKGELFNMLVERGPLPENEAVRAF 135
           + +E+   +   +P + +L++V  T + +++ LEY    EL++ L+ +  +P +E  R F
Sbjct: 75  VVREVFYHRQFEYPFITKLYEVIVTETRVWMALEYCPGNELYDYLLLKQRIPLDETRRLF 134

Query: 136 RQIIIGISYCHSLGVVHRDLKPEXXXXXXXXXXXXADFGMAALESEDKLLETSCGSPHYA 195
            QI+  + Y HSL  VHRDLK E             DFG     +    LET CG+  Y 
Sbjct: 135 AQIVSAVFYAHSLQCVHRDLKLENILLDKNGYAMLTDFGFTRECATKTQLETVCGTTVYM 194

Query: 196 APEIISGLPYEGFSSDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQKGEFEMPD--D 253
           APE+I    Y+G+  D WS G+IL+ +L G +PFDE+D  +R  L    K   E P   D
Sbjct: 195 APELIKREAYDGYKVDTWSLGIILYTMLHGYMPFDEDD-TVRTGL----KIMHEEPAVLD 249

Query: 254 DEITKEAQDLLARLLTVDPSKRITIREILKHPLLQKYPSI 293
           +  + +A+DL+ RLL  + ++R  + E+L+HP LQ Y ++
Sbjct: 250 EYTSPQAKDLIVRLLDKNAAQRPNLNEVLQHPFLQPYGAL 289

>KLTH0D11044g Chr4 complement(901388..903937) [2550 bp, 849 aa] {ON}
           similar to uniprot|Q12152 Saccharomyces cerevisiae
           YPL150W
          Length = 849

 Score =  165 bits (418), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 89/271 (32%), Positives = 145/271 (53%), Gaps = 21/271 (7%)

Query: 17  IGPWKLGETLGSGSTGKVLLASNETTKQQAAVKVISKAVFEAMNNSESNGDATNALPYNI 76
           +G +++ + +G GS GKV LAS+  T Q+  +K+ SK      N+             N+
Sbjct: 34  VGNYRILKIVGEGSFGKVYLASHRLTHQKVVLKMGSK------NDP------------NV 75

Query: 77  EQEIIIMKLLNHPNVLRLFDVWETNSDLYLVLEYAEKGELFNMLVERGPLPENEAVRAFR 136
            +E+   +  ++  + +L++V  T + +++ LEY    EL+  L+ +  +P +E    F 
Sbjct: 76  VREVFYHRQFDYVYITKLYEVIVTENSVWMALEYCPGKELYEYLLIKKRIPLDECSHLFS 135

Query: 137 QIIIGISYCHSLGVVHRDLKPEXXXXXXXXXXXXADFGMAALESEDKLLETSCGSPHYAA 196
           QI+  + Y HS+  VHRDLK E             DFG     +   +LET CG+  Y A
Sbjct: 136 QIVGAVFYAHSMKCVHRDLKLENILLDKKGQAKLTDFGFTRECATKGILETVCGTTVYMA 195

Query: 197 PEIISGLPYEGFSSDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQKGEFEMPDDDEI 256
           PE+I   PYEG+  D WS G+IL+ ++ G +PFDEED +I+     V    F   DD+ I
Sbjct: 196 PELIERKPYEGYKIDTWSLGIILYTMIHGAMPFDEED-DIKTKYRIVNNEPFY--DDNFI 252

Query: 257 TKEAQDLLARLLTVDPSKRITIREILKHPLL 287
               +DL+ +LL  DPS+R ++ ++L+HP +
Sbjct: 253 DANGKDLIMQLLQKDPSQRPSLTQVLQHPFM 283

>TBLA0B03860 Chr2 (887855..890821) [2967 bp, 988 aa] {ON} Anc_8.668
           YPL150W
          Length = 988

 Score =  165 bits (417), Expect = 9e-41,   Method: Compositional matrix adjust.
 Identities = 95/280 (33%), Positives = 144/280 (51%), Gaps = 25/280 (8%)

Query: 16  QIGPWKLGETLGSGSTGKVLLASNETTKQQAAVKVISKAVFEAMNNSESNGDATNALPYN 75
           ++G +++   +G GS GKV LA +  T ++  +K            S +  D       N
Sbjct: 33  EVGNYRILRQIGEGSFGKVYLAHHLPTHRKVVLK------------SSAKSDP------N 74

Query: 76  IEQEIIIMKLLNHPNVLRLFDVWETNSDLYLVLEYAEKGELFNMLVERGPLPENEAVRAF 135
           + +E+   +    P + +L+++  T + +++ LEY    EL+  L+    +P +E  R F
Sbjct: 75  VVREVFYHRQFEFPYITKLYEIIVTETKVWMALEYCPGKELYEHLLRLHRIPVDECSRLF 134

Query: 136 RQIIIGISYCHSLGVVHRDLKPEXXXXXXXXXXXXADFGMAALESEDKLLETSCGSPHYA 195
            QI   + Y HSL  VHRDLK E             DFG     +   +LET CG+  Y 
Sbjct: 135 AQISGAMYYAHSLNCVHRDLKLENILLDKVGNAKLTDFGFTRECASKNILETICGTTVYM 194

Query: 196 APEIISGLPYEGFSSDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQKGEFEMPDDDE 255
           APE+I    Y+GF  DVWS GVIL+ LL G +PFDEE    +N   K+     EMP  D 
Sbjct: 195 APELIKRERYDGFKIDVWSLGVILYTLLNGFMPFDEEQQ--KNTEWKIVN---EMPSFDS 249

Query: 256 --ITKEAQDLLARLLTVDPSKRITIREILKHPLLQKYPSI 293
             +  +A DLL++LL  DP  R +++E+L+HP LQ Y ++
Sbjct: 250 TLLGPDAVDLLSKLLAKDPIDRPSMKEVLEHPYLQPYGNV 289

>Kwal_26.8751 s26 complement(928853..931399) [2547 bp, 848 aa] {ON}
           YPL150W - Hypothetical ORF [contig 67] FULL
          Length = 848

 Score =  164 bits (414), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 88/275 (32%), Positives = 146/275 (53%), Gaps = 21/275 (7%)

Query: 16  QIGPWKLGETLGSGSTGKVLLASNETTKQQAAVKVISKAVFEAMNNSESNGDATNALPYN 75
           ++G +K+ + +G GS GKV LAS+  T Q+  +K+ SK      N+             N
Sbjct: 33  EVGNYKILKIVGEGSFGKVYLASHCLTHQKVVLKMGSK------NDP------------N 74

Query: 76  IEQEIIIMKLLNHPNVLRLFDVWETNSDLYLVLEYAEKGELFNMLVERGPLPENEAVRAF 135
           + +E+   +  ++ ++ +L++V  T + +++ LEY    EL+  L+ +  +P  E    F
Sbjct: 75  VVREVFYHRQFDYSHITKLYEVIVTENYVWMALEYCPGKELYEYLLAKKHIPLEECSELF 134

Query: 136 RQIIIGISYCHSLGVVHRDLKPEXXXXXXXXXXXXADFGMAALESEDKLLETSCGSPHYA 195
            QI+  + Y HS+  VHRDLK E             DFG     +   +LET CG+  Y 
Sbjct: 135 SQIVGAVYYAHSMKCVHRDLKLENILLDKKGHAKLTDFGFTRECATKGILETICGTTVYM 194

Query: 196 APEIISGLPYEGFSSDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQKGEFEMPDDDE 255
           APE+I   PYEG+  D WS G+IL+ ++ G +PFDE D  ++     V        D+D 
Sbjct: 195 APELIERKPYEGYKIDTWSLGIILYTMIHGTMPFDEVD-EVKTKYKIVHYN--PTYDNDY 251

Query: 256 ITKEAQDLLARLLTVDPSKRITIREILKHPLLQKY 290
           I    ++L+++LL  DP++R ++ ++L+HP LQ Y
Sbjct: 252 IDSNGKELISQLLEKDPNQRPSLTQVLQHPFLQPY 286

>KLLA0F11319g Chr6 (1042436..1044967) [2532 bp, 843 aa] {ON} similar
           to uniprot|Q12152 Saccharomyces cerevisiae YPL150W
           Hypothetical ORF
          Length = 843

 Score =  162 bits (410), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 89/275 (32%), Positives = 145/275 (52%), Gaps = 21/275 (7%)

Query: 16  QIGPWKLGETLGSGSTGKVLLASNETTKQQAAVKVISKAVFEAMNNSESNGDATNALPYN 75
           +IG +K+ + +G GS GKV LA++  T Q+  +K                    N    N
Sbjct: 33  EIGNYKISKFIGEGSFGKVYLATHRLTHQKVVLKT------------------GNKRDPN 74

Query: 76  IEQEIIIMKLLNHPNVLRLFDVWETNSDLYLVLEYAEKGELFNMLVERGPLPENEAVRAF 135
           + +E+   +  + P + +L++V  T S +++VLEY    EL+  L++   L   E+ + F
Sbjct: 75  VVREVFYHRQFDFPYITKLYEVIVTESRVWMVLEYCSGHELYEHLLKEQRLSLEESKKLF 134

Query: 136 RQIIIGISYCHSLGVVHRDLKPEXXXXXXXXXXXXADFGMAALESEDKLLETSCGSPHYA 195
            QI   + Y H L  VHRDLK E             DFG     +    LET CG+  Y 
Sbjct: 135 SQIASAVYYAHELKCVHRDLKLENVLLDGNGHAKLTDFGFTREMATRSQLETICGTTVYM 194

Query: 196 APEIISGLPYEGFSSDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQKGEFEMPDDDE 255
           APE+I    Y+GF  D+WS G+IL+ ++ G +PFDE+D +I+   LK+   E +  + + 
Sbjct: 195 APELIERKCYDGFKVDIWSLGIILYTMINGYMPFDEDD-DIKT-KLKIVNDELDF-NQEW 251

Query: 256 ITKEAQDLLARLLTVDPSKRITIREILKHPLLQKY 290
           I+ +A DL+  +L  +P++RI++ ++L HP LQ +
Sbjct: 252 ISDDAIDLIQGMLRKNPNERISLAQVLSHPFLQPW 286

>KNAG0J01670 Chr10 complement(304021..307050) [3030 bp, 1009 aa]
           {ON} 
          Length = 1009

 Score =  162 bits (411), Expect = 5e-40,   Method: Compositional matrix adjust.
 Identities = 90/274 (32%), Positives = 142/274 (51%), Gaps = 21/274 (7%)

Query: 17  IGPWKLGETLGSGSTGKVLLASNETTKQQAAVKVISKAVFEAMNNSESNGDATNALPYNI 76
           +G +K+ E +G GS GKV LA +  T ++  +K            S    D       NI
Sbjct: 43  VGNYKILEQIGEGSFGKVYLAMHRPTHRKVVIK------------SSVKNDP------NI 84

Query: 77  EQEIIIMKLLNHPNVLRLFDVWETNSDLYLVLEYAEKGELFNMLVERGPLPENEAVRAFR 136
            +E+   +   +  + +L+++  T S +++ LEY    EL++ +++   +P  E ++ F 
Sbjct: 85  VREVFYHRQFEYHYITKLYEIIVTESKVWMALEYCPGRELYDHVLQMKRIPAEECIQLFS 144

Query: 137 QIIIGISYCHSLGVVHRDLKPEXXXXXXXXXXXXADFGMAALESEDKLLETSCGSPHYAA 196
           QI+  + Y HSL  VHRDLK E             DFG      E   LET CG+  Y A
Sbjct: 145 QIVGAVYYAHSLNCVHRDLKLENILLDKDGNAKLTDFGFTRECMEKVNLETICGTTVYMA 204

Query: 197 PEIISGLPYEGFSSDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQKGEFEMPDDDEI 256
           PE+    PY+GF  D+WS GVIL+ +L+G +PFDE+D       +  ++ E+   +   +
Sbjct: 205 PELTERKPYDGFKIDIWSLGVILYTMLSGSMPFDEDDEAKTKWKIINEEPEY---NSKFM 261

Query: 257 TKEAQDLLARLLTVDPSKRITIREILKHPLLQKY 290
           T E +DL+ +LL  D + R ++REIL+H  LQ Y
Sbjct: 262 TAEGEDLVRKLLQKDSNLRPSVREILQHEFLQPY 295

>TDEL0A06140 Chr1 complement(1074016..1076601) [2586 bp, 861 aa]
           {ON} Anc_8.668 YPL150W
          Length = 861

 Score =  162 bits (409), Expect = 6e-40,   Method: Compositional matrix adjust.
 Identities = 105/359 (29%), Positives = 177/359 (49%), Gaps = 59/359 (16%)

Query: 15  NQIGPWKLGETLGSGSTGKVLLASNETTKQQAAVKVISKAVFEAMNNSESNGDATNALPY 74
           +++G +K+ + +G GS GKV LAS++ T ++  +K   K      N+             
Sbjct: 32  SEVGNYKIMKQIGEGSFGKVYLASHKPTHRKVVLKTSDK------NDP------------ 73

Query: 75  NIEQEIIIMKLLNHPNVLRLFDVWETNSDLYLVLEYAEKGELFNMLVERGPLPENEAVRA 134
           N+ +E+   +  ++  + RL++V  T + +++ LEY    EL+  L+    +  +E  R 
Sbjct: 74  NVVREVFYHRQFDYLYITRLYEVIVTETKVWMALEYCPGKELYEHLLALKRISLDECSRL 133

Query: 135 FRQIIIGISYCHSLGVVHRDLKPEXXXXXXXXXXXXADFGMAALESEDKLLETSCGSPHY 194
           F QI+  I Y HSL  VHRDLK E             DFG          L+T CG+  Y
Sbjct: 134 FAQIVGAIYYAHSLNCVHRDLKLENILLDKKGNAKLTDFGFTRECVSKSQLDTICGTTVY 193

Query: 195 AAPEIISGLPYEGFSSDVWSCGVILFALLTGRLPFDEED-----GNIRNLLLKVQKGEFE 249
            APE+     Y+GF  D+W+ GVIL+ ++ G +PFDE+D       I N          E
Sbjct: 194 MAPELTERKSYDGFKIDIWALGVILYTMINGSMPFDEDDEAKTKWKIVN----------E 243

Query: 250 MP--DDDEITKEAQDLLARLLTVDPSKRITIREILKHPLLQKY--PSIKDSRSIRNLPRE 305
           MP  ++D ++ +A+DL+ +LL  DP++R +I +IL HP LQ Y  P ++ ++ I    R 
Sbjct: 244 MPEINEDLVSPDAKDLIEQLLAKDPNERPSIEKILTHPFLQPYGIPLMEKTQKILRKQRR 303

Query: 306 DTYLSPLADTNSKIDDAILQNLVILWHGKDAREIAAKLREPGANTEKTLYALLYRFKCD 364
            +                     + +H K  R++  +L++ G +T+ ++ A + + KCD
Sbjct: 304 GS---------------------VHFHSKLERKLLKRLKQMGFDTQ-SMKASVQKKKCD 340

>TPHA0G01630 Chr7 (336511..339126) [2616 bp, 871 aa] {ON} Anc_8.668
           YPL150W
          Length = 871

 Score =  161 bits (408), Expect = 8e-40,   Method: Compositional matrix adjust.
 Identities = 93/281 (33%), Positives = 142/281 (50%), Gaps = 33/281 (11%)

Query: 16  QIGPWKLGETLGSGSTGKVLLASNETTKQQAAVKVISKAVFEAMNNSESNGDATNALPYN 75
           ++G +K+ + +G GS GKV LA +  T ++  +K  SK                     N
Sbjct: 33  EVGNYKILKQVGEGSFGKVYLAIHRPTHRKVVLKSSSKT------------------DPN 74

Query: 76  IEQEIIIMKLLNHPNVLRLFDVWETNSDLYLVLEYAEKGELFNMLVERGPLPENEAVRAF 135
           + +E+   +  +HP + +L+++  T + +++ LEY    EL++ L+    +P +E  R F
Sbjct: 75  VVREVFYHRQFDHPYITKLYEIIITETKVWMSLEYCPGKELYDYLLVMRRIPLDECSRLF 134

Query: 136 RQIIIGISYCHSLGVVHRDLKPEXXXXXXXXXXXXADFGMAALESEDKLLETSCGSPHYA 195
            QI+  + Y HSL  VHRDLK E            ADFG     +    LET CG+  Y 
Sbjct: 135 AQIVGAVYYAHSLNCVHRDLKLENILLDMQGNAKLADFGFTRECATKNQLETICGTTVYM 194

Query: 196 APEIISGLPYEGFSSDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQKGEF----EMP 251
           APE++    Y+GF  D+WS GVIL+ L+ G +PFDEED           + E+    E P
Sbjct: 195 APELLRRDTYDGFKIDIWSLGVILYTLINGSMPFDEEDE---------TRTEWKIINEEP 245

Query: 252 DDDE--ITKEAQDLLARLLTVDPSKRITIREILKHPLLQKY 290
           D +E      + +L+  LL  DP KR ++ EILKH  L+ Y
Sbjct: 246 DYNEKIFNANSIELIKSLLIKDPKKRPSMTEILKHKFLEPY 286

>KNAG0H03140 Chr8 complement(589553..592363) [2811 bp, 936 aa] {ON}
           Anc_8.279 YLR096W
          Length = 936

 Score =  160 bits (406), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 92/284 (32%), Positives = 150/284 (52%), Gaps = 21/284 (7%)

Query: 17  IGPWKLGETLGSGSTGKVLLASNETTKQQAAVKVISKAVFEAMNNSESNGDATNALPYNI 76
           +G W    T+G+GS GKV LA +       AVK++++A    +   +S   A  +     
Sbjct: 115 LGDWDFQTTVGAGSMGKVKLARHRYDDTVCAVKIVNRATKTFLYRQQS-APAPQSKADIK 173

Query: 77  EQEIIIMK----------------LLNHPNVLRLFDVWETNSDLYLVLEYAEKGELFNML 120
           E+E ++ K                +L+H N+ +L+ +   ++  Y++ EY   G+L + +
Sbjct: 174 ERERLLAKEIARDTRTVREASLGQVLSHQNICQLYQMCTMSNHFYMMFEYVSGGQLLDYI 233

Query: 121 VERGPLPENEAVRAFRQIIIGISYCHSLGVVHRDLKPEXXXXXXXXXXXXADFGMAALES 180
           ++ G L E  A    R I  G++Y H+  VVHRDLK E             DFG++ L  
Sbjct: 234 IQHGSLREPLARSFARAIASGLAYLHANNVVHRDLKIENIMLTAAGEIKIIDFGLSNLFD 293

Query: 181 EDKLLETSCGSPHYAAPEIISGLPYEGFSSDVWSCGVILFALLTGRLPFDEEDGNIRNLL 240
               L T CGS ++AAPE++   PY G   D+WS GVIL+ L+ G++PFD+E+ N   L 
Sbjct: 294 PRAKLTTYCGSLYFAAPELLRAKPYIGPEIDIWSFGVILYVLVVGKVPFDDENSNA--LH 351

Query: 241 LKVQKGEFEMPDDDEITKEAQDLLARLLTVDPSKRITIREILKH 284
            K+++G+   P    ++ E   LL ++LTV+P +R T++EI+ H
Sbjct: 352 EKIKRGKVSYP--ATLSIECISLLTKMLTVNPKRRATLKEIVTH 393

>KNAG0D01090 Chr4 complement(183319..184437) [1119 bp, 372 aa] {ON} 
          Length = 372

 Score =  152 bits (384), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 86/276 (31%), Positives = 140/276 (50%), Gaps = 26/276 (9%)

Query: 22  LGETLGSGSTGKVLLASNETTKQQAAVKVISKAVFEAMNNSESNGDATNALPYNIEQEII 81
           +G  LG G  GKV    ++ +    A+KV+ K               T+ L Y +E++ I
Sbjct: 115 IGLKLGKGKFGKVFCVRHKESGFICALKVMQK---------------TDILQYKLERQFI 159

Query: 82  ----IMKLLNHPNVLRLFDVWETNSDLYLVLEYAEKGELFNMLVERGPLPENEAVRAFRQ 137
               I   LNHPN+ +L+  +     +YL++EY   GEL+  L   GP     A     Q
Sbjct: 160 REVEIQSSLNHPNIAKLYGYFHDEKRVYLIMEYMLYGELYKTLEIHGPFENAVATNYVYQ 219

Query: 138 IIIGISYCHSLGVVHRDLKPEXXXXXXXXXXXXADFGMAALESEDKLLETSCGSPHYAAP 197
           I   I Y H   ++HRD+KPE             DFG + +  +     T CG+  Y +P
Sbjct: 220 IASAILYLHQRHIIHRDIKPENILIGPHNQLKLTDFGWSIINPKGLRRRTFCGTIDYLSP 279

Query: 198 EIISGLPYEGFSSDVWSCGVILFALLTGRLPFDEEDGNIRNLLL-KVQKGEFEMPDDDEI 256
           EI+    Y+  + D+W+ G++ + LL G  PF+E   N ++L   ++++G+   P   ++
Sbjct: 280 EIVDYKEYD-HNVDIWALGIVAYELLVGSPPFEE---NTKDLTYERIRRGDIVFP--KQV 333

Query: 257 TKEAQDLLARLLTVDPSKRITIREILKHPLLQKYPS 292
           T EA+D + R+L ++P KR+T++EI+ HP + KY S
Sbjct: 334 TPEARDFIERILVLEPKKRMTLKEIMSHPWILKYKS 369

>KNAG0I01480 Chr9 (287733..289055) [1323 bp, 440 aa] {ON} Anc_1.374
           YFR014C
          Length = 440

 Score =  154 bits (388), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 99/277 (35%), Positives = 148/277 (53%), Gaps = 23/277 (8%)

Query: 20  WKLGETLGSGSTGKVLLASNETTKQQAAVKVISKAVFEAMNNSESNGDATNALPYNIEQE 79
           ++ G+T+G+G+ G V  A+  +T ++ AVK+I K   E         D    + Y+   E
Sbjct: 41  YEFGKTMGAGTFGVVRKATKISTGEEVAVKIILKKALEG-------NDIQLQMLYD---E 90

Query: 80  IIIMKLLNHPNVLRLFDVW-ETNSDLYLVLEYAEKGELFNMLVERGPLPENEAVRAFRQI 138
           + I++ L HPN++  F  W E+   +Y+V + A  GELF+ +++RG   E +AV    QI
Sbjct: 91  LAILQQLKHPNIVE-FKAWFESKDKIYIVTQLATGGELFDTILKRGKFTELDAVDIVVQI 149

Query: 139 IIGISYCHSLGVVHRDLKPEXXXXX---XXXXXXXADFGMAA-LESEDKLLETSCGSPHY 194
           +  + Y HS  VVHRDLKPE               ADFG+A  LE E  L+  + GS  Y
Sbjct: 150 LKAVEYIHSQNVVHRDLKPENILYVDESEKSQIVIADFGIAKRLEGEGDLIFKAAGSLGY 209

Query: 195 AAPEII--SGLPYEGFSSDVWSCGVILFALLTGRLPFDEE--DGNIRNLLLKVQKGEFEM 250
            APE++  SG    G   D+WS G+I + LL G  PF  E  DG +  ++   +   F  
Sbjct: 210 VAPEVLLNSG---HGKPCDIWSVGIIAYTLLCGYSPFVAEDVDGFLDEIVENEEPIAFHS 266

Query: 251 PDDDEITKEAQDLLARLLTVDPSKRITIREILKHPLL 287
           P  DEI+ EA+  + R +T+DP +R T  E+LK P +
Sbjct: 267 PYWDEISNEAKQFILRAVTIDPFQRPTATELLKDPWI 303

>Skud_16.132 Chr16 (239797..242571) [2775 bp, 924 aa] {ON} YPL150W
           (REAL)
          Length = 924

 Score =  160 bits (404), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 104/352 (29%), Positives = 172/352 (48%), Gaps = 47/352 (13%)

Query: 16  QIGPWKLGETLGSGSTGKVLLASNETTKQQAAVKVISKAVFEAMNNSESNGDATNALPYN 75
           ++G +K+ + +G GS GKV LA +  T ++  +K            S+ N         N
Sbjct: 37  EVGNYKILKQIGEGSFGKVYLALHRPTHRKVCLKT-----------SDKNDP-------N 78

Query: 76  IEQEIIIMKLLNHPNVLRLFDVWETNSDLYLVLEYAEKGELFNMLVERGPLPENEAVRAF 135
           I +E+   +  + P + +L++V  T S +++ LEY    EL++ L+    +   E    F
Sbjct: 79  IVREVFYHRQFDFPYITKLYEVIVTESKVWMALEYCPGKELYDHLLSLHRISLLECGELF 138

Query: 136 RQIIIGISYCHSLGVVHRDLKPEXXXXXXXXXXXXADFGMAALESEDKLLETSCGSPHYA 195
            QI   + Y HS+  VHRDLK E             DFG          LET CG+  Y 
Sbjct: 139 AQISGAVYYAHSMHCVHRDLKLENILLDKNGNAKLTDFGFTRECMTKTTLETVCGTTVYM 198

Query: 196 APEIISGLPYEGFSSDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQKGEFE---MPD 252
           APE+I    Y+GF  D WS GVIL+ L+TG LPFD++D       +  ++ +++   +PD
Sbjct: 199 APELIGRKTYDGFKIDTWSLGVILYTLITGSLPFDDDDEAKTKWKIVNEEPKYDPKLIPD 258

Query: 253 DDEITKEAQDLLARLLTVDPSKRITIREILKHPLLQKYPSIKDSRSIRNLPREDTYLSPL 312
           D      A+DL++RLL  +P +R ++ ++L+HP LQ Y S+   ++ + L R+       
Sbjct: 259 D------AKDLISRLLAKNPGERPSLPQVLRHPFLQPYGSVVLDQTEKILCRQ------- 305

Query: 313 ADTNSKIDDAILQNLVILWHGKDAREIAAKLREPGANTEKTLYALLYRFKCD 364
                       ++  I +  K  R +  +L++ G +T+    ++L R KCD
Sbjct: 306 ------------RSGGIQFKSKLERRLLKRLKQSGIDTQAVKQSILKR-KCD 344

>NDAI0G05300 Chr7 (1289208..1290521) [1314 bp, 437 aa] {ON}
           Anc_1.374
          Length = 437

 Score =  153 bits (386), Expect = 5e-39,   Method: Compositional matrix adjust.
 Identities = 95/274 (34%), Positives = 147/274 (53%), Gaps = 17/274 (6%)

Query: 20  WKLGETLGSGSTGKVLLASNETTKQQAAVKVISKAVFEAMNNSESNGDATNALPYNIEQE 79
           +  G+TLG+G+ G V  A   TT +  AVK++ K   +  NN +        + Y+   E
Sbjct: 52  YIFGKTLGAGTFGVVRQARKLTTGEDVAVKILLKKALKG-NNVQLQ------MLYD---E 101

Query: 80  IIIMKLLNHPNVLRLFDVWETNSDLYLVLEYAEKGELFNMLVERGPLPENEAVRAFRQII 139
           + I++ L+HPN++   D +E+    Y+V + A  GELF+ ++++G   E +AV    Q+I
Sbjct: 102 LAILQKLHHPNIVAFKDWFESKDKFYIVTQLATGGELFDRIIKKGKFSEVDAVSIMVQLI 161

Query: 140 IGISYCHSLGVVHRDLKPEXXXX---XXXXXXXXADFGMAA-LESEDKLLETSCGSPHYA 195
             +SY HS  +VHRDLKPE               ADFG+A  L+S D L+    GS  Y 
Sbjct: 162 SAVSYIHSQNIVHRDLKPENVLYLDNSDNSQLVIADFGIAKELKSNDDLIFKGAGSLGYV 221

Query: 196 APEIISGLPYEGFSSDVWSCGVILFALLTGRLPFDEE--DGNIRNLLLKVQKGEFEMPDD 253
           APE+++   + G   D+WS GVI + LL+G   F  E  +G +          +F  P  
Sbjct: 222 APEVLTREGH-GKPCDIWSLGVITYTLLSGYSAFIAESVEGFLEECTRSTYPVKFHSPYW 280

Query: 254 DEITKEAQDLLARLLTVDPSKRITIREILKHPLL 287
           D I++EA+D + R LT+DP+ R T  E+L+ P +
Sbjct: 281 DNISQEAKDFILRALTIDPNDRPTAEELLQDPWI 314

>YPL150W Chr16 (268188..270893) [2706 bp, 901 aa] {ON} Protein
           kinase of unknown cellular role; binds
           phosphatidylinositols and cardiolipin in a large-scale
           study
          Length = 901

 Score =  157 bits (398), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 91/281 (32%), Positives = 145/281 (51%), Gaps = 27/281 (9%)

Query: 16  QIGPWKLGETLGSGSTGKVLLASNETTKQQAAVKVISKAVFEAMNNSESNGDATNALPYN 75
           ++G +K+ + +G GS GKV LA +  T ++  +K            S+ N         N
Sbjct: 37  EVGNYKILKQIGEGSFGKVYLALHRPTHRKVCLKT-----------SDKNDP-------N 78

Query: 76  IEQEIIIMKLLNHPNVLRLFDVWETNSDLYLVLEYAEKGELFNMLVERGPLPENEAVRAF 135
           I +E+   +  + P + +L++V  T S +++ LEY    EL++ L+    +   E    F
Sbjct: 79  IVREVFYHRQFDFPYITKLYEVIVTESKVWMALEYCPGKELYDHLLSLRRISLLECGELF 138

Query: 136 RQIIIGISYCHSLGVVHRDLKPEXXXXXXXXXXXXADFGMAALESEDKLLETSCGSPHYA 195
            QI   + Y HS+  VHRDLK E             DFG          LET CG+  Y 
Sbjct: 139 AQISGAVYYAHSMHCVHRDLKLENILLDKNGNAKLTDFGFTRECMTKTTLETVCGTTVYM 198

Query: 196 APEIISGLPYEGFSSDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQKGEFE---MPD 252
           APE+I    Y+GF  D+WS GVIL+ L+TG LPFD++D       +  ++ +++   +PD
Sbjct: 199 APELIERRTYDGFKIDIWSLGVILYTLITGYLPFDDDDEAKTKWKIVNEEPKYDAKVIPD 258

Query: 253 DDEITKEAQDLLARLLTVDPSKRITIREILKHPLLQKYPSI 293
           D      A+DL++RLL  +P +R ++ ++L+HP LQ Y S+
Sbjct: 259 D------ARDLISRLLAKNPGERPSLSQVLRHPFLQPYGSV 293

>CAGL0F04741g Chr6 (478256..479584) [1329 bp, 442 aa] {ON} similar
           to uniprot|P22517 Saccharomyces cerevisiae YOL016c CMK2
           Ca2+/calmodulin-dependent ser/thr protein kinase type II
          Length = 442

 Score =  150 bits (380), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 97/298 (32%), Positives = 148/298 (49%), Gaps = 25/298 (8%)

Query: 22  LGETLGSGSTGKVLLASNETTKQQAAVKVISKAVFEAMNNSESNGDATNALPYNIEQEII 81
            G+TLG+G+ G V  A    T +  AVK++ K   +         D    + Y+   E+ 
Sbjct: 47  FGKTLGAGTFGVVRQARYSPTNEDVAVKILLKKALKG-------NDVQLQMLYD---ELS 96

Query: 82  IMKLLNHPNVLRLFDVWETNSDLYLVLEYAEKGELFNMLVERGPLPENEAVRAFRQIIIG 141
           I+++L HPN++   D +E+    Y+V + A  GELF+ ++ +G   E +AV    QI+  
Sbjct: 97  ILQMLKHPNIVEFKDWFESKDKFYIVTQLAVGGELFDRILAKGKFTERDAVSITMQILSA 156

Query: 142 ISYCHSLGVVHRDLKPEXXXXXXX---XXXXXADFGMA-ALESEDKLLETSCGSPHYAAP 197
           + Y HS  VVHRDLKPE               ADFG+A  L+  D L+  + GS  Y AP
Sbjct: 157 VDYMHSKNVVHRDLKPENVLYIDKSDDSQLVIADFGIAKQLQDNDDLIFKAAGSLGYVAP 216

Query: 198 EIISGLPYEGFSSDVWSCGVILFALLTGRLPFDEE--DGNIRNLLLKVQKGEFEMPDDDE 255
           E+++   + G   D+WS GVI++ LL G   F  E  DG +           F  P  D 
Sbjct: 217 EVLTNNGH-GKPCDIWSIGVIVYTLLCGYSAFVAETVDGFLEECTQNKYPVTFHKPYWDN 275

Query: 256 ITKEAQDLLARLLTVDPSKRITIREILKHPLLQK--------YPSIKDSRSIRNLPRE 305
           I+ EA++ + R LT+DP++R T  E++K P +          YP I+    +R   R+
Sbjct: 276 ISDEAKNFILRALTLDPAERPTAAELMKDPWITNTRPETANIYPEIRKGFDLRKKLRD 333

>Ecym_1275 Chr1 complement(560481..561836) [1356 bp, 451 aa] {ON}
           similar to Ashbya gossypii AAR009W
          Length = 451

 Score =  150 bits (379), Expect = 4e-38,   Method: Compositional matrix adjust.
 Identities = 93/268 (34%), Positives = 146/268 (54%), Gaps = 19/268 (7%)

Query: 22  LGETLGSGSTGKVLLASNETTKQQAAVKVISKAVFEAMNNSESNGDATNALPYNIEQEII 81
            G+TLG+G+ G V  A N    +  AVK++ K   +        GD  N L Y+   E++
Sbjct: 56  FGKTLGAGAFGVVRQARNSNNDEDVAVKILLKRALK--------GDELNML-YD---ELM 103

Query: 82  IMKLLNHPNVLRLFDVWETNSDLYLVLEYAEKGELFNMLVERGPLPENEAVRAFRQIIIG 141
           I++ L+HP++++  D +E+    Y+V + A  GELF+ ++++G   E +AV+   Q++  
Sbjct: 104 ILQKLDHPHIVKFKDWFESKDKFYIVTQLATGGELFDRILKKGRFTETDAVKIVVQMLEA 163

Query: 142 ISYCHSLGVVHRDLKPEXXXX---XXXXXXXXADFGMA-ALESEDKLLETSCGSPHYAAP 197
           I Y HS  VVHRDLKPE               +DFG+A  L SED L+  + GS  Y AP
Sbjct: 164 IEYMHSKNVVHRDLKPENVLYLNPSDDSELVISDFGIAKQLSSEDHLIHRAAGSMGYVAP 223

Query: 198 EIISGLPYEGFSSDVWSCGVILFALLTGRLPFDEE--DGNIRNLLLKVQKGEFEMPDDDE 255
           E+++   + G   D+WS GVI + LL G  PF  E  +G +  +        F  P  + 
Sbjct: 224 EVLTTSGH-GKPCDIWSLGVITYTLLCGYSPFVAESSEGFLEEVTRSKYPVTFHKPYWNS 282

Query: 256 ITKEAQDLLARLLTVDPSKRITIREILK 283
           I+ EA++ + + LT+DPS+R T  E+L+
Sbjct: 283 ISVEAKEFILKALTLDPSERPTATELLQ 310

>Smik_6.347 Chr6 complement(553316..556069) [2754 bp, 917 aa] {ON}
           YPL150W (REAL)
          Length = 917

 Score =  156 bits (394), Expect = 4e-38,   Method: Compositional matrix adjust.
 Identities = 92/281 (32%), Positives = 145/281 (51%), Gaps = 27/281 (9%)

Query: 16  QIGPWKLGETLGSGSTGKVLLASNETTKQQAAVKVISKAVFEAMNNSESNGDATNALPYN 75
           ++G +K+ + +G GS GKV LA +  T ++  +K            S+ N         N
Sbjct: 37  EVGNYKILKQIGEGSFGKVYLALHRPTHRKVCLKT-----------SDKNDP-------N 78

Query: 76  IEQEIIIMKLLNHPNVLRLFDVWETNSDLYLVLEYAEKGELFNMLVERGPLPENEAVRAF 135
           I +E+   +  + P + +L++V  T S +++ LEY    EL++ L+    L   E    F
Sbjct: 79  IVREVFYHRQFDFPYITKLYEVIVTESKVWMALEYCPGKELYDHLLSLRRLSLLECGELF 138

Query: 136 RQIIIGISYCHSLGVVHRDLKPEXXXXXXXXXXXXADFGMAALESEDKLLETSCGSPHYA 195
            QI   + Y HS+  VHRDLK E             DFG          LET CG+  Y 
Sbjct: 139 AQISGAVYYAHSMHCVHRDLKLENILLDRNGNAKLTDFGFTRECMTKTTLETVCGTTVYM 198

Query: 196 APEIISGLPYEGFSSDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQKGEFE---MPD 252
           APE+I    Y+GF  D+WS GVIL+ L+TG LPFD++D       +  ++ +++   +PD
Sbjct: 199 APELIERKTYDGFKIDIWSLGVILYTLITGYLPFDDDDEVKTKWKIVNEEPKYDSKFIPD 258

Query: 253 DDEITKEAQDLLARLLTVDPSKRITIREILKHPLLQKYPSI 293
           D      A+DL++RLL  +P +R ++ ++L+HP LQ Y S+
Sbjct: 259 D------AKDLISRLLAKNPGERPSLPQVLRHPFLQPYGSV 293

>TDEL0B06320 Chr2 (1118534..1119868) [1335 bp, 444 aa] {ON}
           Anc_1.374 YFR014C
          Length = 444

 Score =  150 bits (378), Expect = 5e-38,   Method: Compositional matrix adjust.
 Identities = 94/284 (33%), Positives = 153/284 (53%), Gaps = 21/284 (7%)

Query: 20  WKLGETLGSGSTGKVLLASNETTKQQAAVKVISKAVFEAMNNSESNGDATNALPYNIEQE 79
           +  G+TLG+G+ G V  A   +T++  AVK++ K   +         D    L Y+   E
Sbjct: 40  YVFGKTLGAGTFGVVRQARKISTRENVAVKILLKKALKG-------NDVQLQLLYD---E 89

Query: 80  IIIMKLLNHPNVLRLFDVWETNSDLYLVLEYAEKGELFNMLVERGPLPENEAVRAFRQII 139
           + I++ L+HPN+++  D +E+    Y+V + A  GELF+ ++ +G   E +AV+   QI+
Sbjct: 90  LKILQKLDHPNIVKFKDWFESKDKFYIVTQLATGGELFDRILSKGKFTEIDAVKIVTQIL 149

Query: 140 IGISYCHSLGVVHRDLKPEXXXX---XXXXXXXXADFGMAA-LESEDKLLETSCGSPHYA 195
             + Y HS  +VHRDLKPE               ADFG+A  L+S D+L+  + GS  Y 
Sbjct: 150 SAVQYIHSKNIVHRDLKPENILYIDPSDDSPLVLADFGIAKELKSGDELIFKAAGSLGYV 209

Query: 196 APEIISGLPYEGFSSDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQKG----EFEMP 251
           APE+++   + G   D+WS GV+ + LL+G  PF  E  ++   L +  +G    +F  P
Sbjct: 210 APEVLTTSGH-GKPCDIWSLGVVTYTLLSGYSPFIAE--SVEGFLEECTEGSKPVKFHKP 266

Query: 252 DDDEITKEAQDLLARLLTVDPSKRITIREILKHPLLQKYPSIKD 295
             D I+ +A++ + R L + PSKR T  E+L+ P +    S K+
Sbjct: 267 YWDGISDDAKNFILRALVLSPSKRPTATELLEDPWITCCTSCKN 310

>Suva_16.160 Chr16 (277393..280149) [2757 bp, 918 aa] {ON} YPL150W
           (REAL)
          Length = 918

 Score =  154 bits (390), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 91/293 (31%), Positives = 148/293 (50%), Gaps = 27/293 (9%)

Query: 16  QIGPWKLGETLGSGSTGKVLLASNETTKQQAAVKVISKAVFEAMNNSESNGDATNALPYN 75
           ++G +K+ + +G GS GKV LA +  T ++  +K            S+ N         N
Sbjct: 37  EVGNYKILKQVGEGSFGKVYLALHRPTHRKVCLKT-----------SDKNDP-------N 78

Query: 76  IEQEIIIMKLLNHPNVLRLFDVWETNSDLYLVLEYAEKGELFNMLVERGPLPENEAVRAF 135
           I +E+   +  + P + +L++V  T + +++ LEY    EL++ L+    +   E    F
Sbjct: 79  IVREVFYHRQFDFPYITKLYEVIVTETKVWMALEYCPGKELYDHLLSLHRISLLECAELF 138

Query: 136 RQIIIGISYCHSLGVVHRDLKPEXXXXXXXXXXXXADFGMAALESEDKLLETSCGSPHYA 195
            QI   + Y HS+  VHRDLK E             DFG          LET CG+  Y 
Sbjct: 139 AQISGAVYYAHSMHCVHRDLKLENILLDKNGNAKLTDFGFTRECMTKTTLETVCGTTVYM 198

Query: 196 APEIISGLPYEGFSSDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQKGEFE---MPD 252
           APE+I    Y+GF  D+WS GVIL+ L+TG LPFD++D       +  ++  ++   +PD
Sbjct: 199 APELIERRTYDGFKIDIWSLGVILYTLITGSLPFDDDDEVKTKWKIVNEEPNYDSTLIPD 258

Query: 253 DDEITKEAQDLLARLLTVDPSKRITIREILKHPLLQKYPSIKDSRSIRNLPRE 305
           D      A+DL++RLL  +P +R ++ ++L H  LQ Y S+   ++ + L R+
Sbjct: 259 D------AKDLISRLLAKNPKERPSLPQVLHHQFLQPYGSVVLDQTEKTLSRQ 305

>YFR014C Chr6 complement(172537..173877) [1341 bp, 446 aa] {ON}
           CMK1Calmodulin-dependent protein kinase; may play a role
           in stress response, many Ca++/calmodulin dependent
           phosphorylation substrates demonstrated in vitro, amino
           acid sequence similar to Cmk2p and mammalian Cam Kinase
           II
          Length = 446

 Score =  148 bits (374), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 91/276 (32%), Positives = 151/276 (54%), Gaps = 21/276 (7%)

Query: 20  WKLGETLGSGSTGKVLLASNETTKQQAAVKVISKAVFEAMNNSESNGDATNALPYNIEQE 79
           +  G+TLG+G+ G V  A N  T +  AVK++ K   +A+  ++   +A       +  E
Sbjct: 37  YVFGKTLGAGTFGVVRQAKNTETGEDVAVKILIK---KALKGNKVQLEA-------LYDE 86

Query: 80  IIIMKLLNHPNVLRLFDVWETNSDLYLVLEYAEKGELFNMLVERGPLPENEAVRAFRQII 139
           + I++ L+HPN++   D +E+    Y++ + A+ GELF+ ++++G   E +AVR   +I+
Sbjct: 87  LDILQRLHHPNIVAFKDWFESKDKFYIITQLAKGGELFDRILKKGKFTEEDAVRILVEIL 146

Query: 140 IGISYCHSLGVVHRDLKPEXXXXXXXXXXX---XADFGMAA-LESEDKLLETSCGSPHYA 195
             + Y HS  +VHRDLKPE               ADFG+A  L+S+++LL    GS  Y 
Sbjct: 147 SAVKYMHSQNIVHRDLKPENLLYIDKSDESPLVVADFGIAKRLKSDEELLYKPAGSLGYV 206

Query: 196 APEIISGLPYEGFSSDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQKGE----FEMP 251
           APE+++   + G   D+WS GVI + LL G   F  E   +++ L +   GE    F  P
Sbjct: 207 APEVLTQDGH-GKPCDIWSIGVITYTLLCGYSAFRAE--RVQDFLDECTTGEYPVKFHRP 263

Query: 252 DDDEITKEAQDLLARLLTVDPSKRITIREILKHPLL 287
             D ++ +A+  + + L +DPSKR T  E+L+ P +
Sbjct: 264 YWDSVSNKAKQFILKALNLDPSKRPTAAELLEDPWI 299

>SAKL0D07656g Chr4 complement(627469..628767) [1299 bp, 432 aa] {ON}
           similar to uniprot|P22517 Saccharomyces cerevisiae
           YOL016C CMK2 Calmodulin-dependent protein kinase and
           uniprot|P27466 Saccharomyces cerevisiae YFR014C CMK1
          Length = 432

 Score =  147 bits (372), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 96/300 (32%), Positives = 152/300 (50%), Gaps = 29/300 (9%)

Query: 22  LGETLGSGSTGKVLLASNETTKQQAAVKVISKAVFEAMNNSESNGDATNALPYNIEQEII 81
            G+TLG+GS G V  A   +T    AVK++ K   +         D    + Y+   E++
Sbjct: 48  FGKTLGAGSFGVVRQARKISTGDNVAVKILLKKALKG-------NDVQLQMLYD---ELM 97

Query: 82  IMKLLNHPNVLRLFDVWETNSDLYLVLEYAEKGELFNMLVERGPLPENEAVRAFRQIIIG 141
           I++ LNHPN+++  D +E+    Y+V + A  GELF+ ++++G   E +AV+   QI+  
Sbjct: 98  ILQKLNHPNIVKFKDWFESKEKFYIVTQLATGGELFDRILQKGKFTEVDAVKIVVQILKA 157

Query: 142 ISYCHSLGVVHRDLKPEXXX---XXXXXXXXXADFGMAA-LESEDKLLETSCGSPHYAAP 197
           + Y HS  +VHRDLKPE                DFG+A  L+++  L+  + GS  Y AP
Sbjct: 158 VEYLHSRNIVHRDLKPENLLYLDKSDNSQLVLGDFGIAKELKNDGDLIHKAAGSMGYVAP 217

Query: 198 EIISGLPYEGFSSDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQKGE----FEMPDD 253
           E+++   + G   D+WS GVI + LL G  PF  E  ++   L +   G+    F  P  
Sbjct: 218 EVLTSNGH-GKPCDIWSIGVITYTLLCGYSPFIAE--SVDGFLEECTSGQYPVTFHKPYW 274

Query: 254 DEITKEAQDLLARLLTVDPSKRITIREILKHPLLQK--------YPSIKDSRSIRNLPRE 305
           + I+KEA+  + R+LT+ P KR T  ++L    +           P I+   + RN  RE
Sbjct: 275 NNISKEAKLFILRVLTISPKKRPTATDLLSDAWITSKTQQTNDLLPEIRKGFNARNKFRE 334

>NCAS0A08880 Chr1 (1756271..1757539) [1269 bp, 422 aa] {ON}
           Anc_1.374
          Length = 422

 Score =  147 bits (371), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 89/272 (32%), Positives = 144/272 (52%), Gaps = 17/272 (6%)

Query: 22  LGETLGSGSTGKVLLASNETTKQQAAVKVISKAVFEAMNNSESNGDATNALPYNIEQEII 81
            G+TLG+G+ G V  A   ++++  AVK++ K       N+    D    + Y+   E+ 
Sbjct: 40  FGKTLGAGTFGVVRQARQLSSQEDVAVKILLK-------NALKGNDVQLQMLYD---ELS 89

Query: 82  IMKLLNHPNVLRLFDVWETNSDLYLVLEYAEKGELFNMLVERGPLPENEAVRAFRQIIIG 141
           I++ L+HPN++   D +E+    Y+V + A  GELF+ ++++G   E +AV    Q++  
Sbjct: 90  ILQRLHHPNIVAFKDWFESRDKFYIVTQLATGGELFDRIIKKGKFTEVDAVNIMVQLLDA 149

Query: 142 ISYCHSLGVVHRDLKPEXXXX---XXXXXXXXADFGMAA-LESEDKLLETSCGSPHYAAP 197
           + Y HS  +VHRDLKPE               ADFG+A  L+S D L+    GS  Y AP
Sbjct: 150 VKYIHSQNIVHRDLKPENVLYLDPSDESQLVIADFGIAKELKSNDDLIFKGAGSLGYVAP 209

Query: 198 EIISGLPYEGFSSDVWSCGVILFALLTGRLPFDEE--DGNIRNLLLKVQKGEFEMPDDDE 255
           E+++   + G   D+WS GVI + LL+G  PF  E  +G +          +F  P  D 
Sbjct: 210 EVLTKEGH-GKPCDIWSLGVITYTLLSGYSPFIAESVEGFLEECTRSRYPVQFHKPYWDS 268

Query: 256 ITKEAQDLLARLLTVDPSKRITIREILKHPLL 287
           I+ EA+D + + LT+DP +R +  E++  P +
Sbjct: 269 ISDEAKDFILKALTIDPEERPSAEELMNDPWI 300

>Smik_6.350 Chr6 (559997..562465) [2469 bp, 822 aa] {ON} YPL153C
           (REAL)
          Length = 822

 Score =  153 bits (386), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 97/310 (31%), Positives = 161/310 (51%), Gaps = 37/310 (11%)

Query: 3   AISSNTVSVIKNNQIGPWK----LGETLGSGSTGKVLLASNETTKQQAAVKVISKAVFEA 58
            ++S+T S I  ++ G ++    + E +G G+   V  A   TT +  AVK+ISK   + 
Sbjct: 177 GLASSTASAIMTHKTGIFRDFSIIDEVVGQGAFATVKKAIERTTGKTFAVKIISKR--KV 234

Query: 59  MNNSESNGDATNALPYNIEQEIIIMKLLNHPNVLRLFDVWETNSDLYLVLEYAEKGELFN 118
           + N +            + +E+ +++ LNHP ++RL   +E     Y+V+E+   G+L +
Sbjct: 235 IGNMDG-----------VTRELEVLQKLNHPRIVRLKGFYEDADSYYMVMEFVSGGDLMD 283

Query: 119 MLVERGPLPENEAVRAFRQIIIGISYCHSLGVVHRDLKPEXXXXXXX--XXXXXADFGMA 176
            +   G + E+      RQI+  + Y HS+G+ HRDLKP+               DFG+A
Sbjct: 284 FVAAHGAVGEDAGREISRQILTAVKYIHSMGISHRDLKPDNILIEQDDPVLVKITDFGLA 343

Query: 177 ALESEDKLLETSCGSPHYAAPEIISGL-------PYE---GFSS--DVWSCGVILFALLT 224
            ++     ++T CG+  Y APE+I G         YE    +SS  D+WS G +++ +LT
Sbjct: 344 KVQGNGSFMKTFCGTLAYVAPEVIRGKDSSASPDEYEERNEYSSLVDMWSMGCLVYVILT 403

Query: 225 GRLPFDEEDGNIRNLLLK-VQKGEF-EMP-DDDEITKEAQDLLARLLTVDPSKRITIREI 281
           G LPF    G+ ++ L K + +G + E P  D  I++EA+D +  LL VDPS R+T  + 
Sbjct: 404 GHLPF---SGSTQDQLYKQIGRGSYHEGPLKDFRISEEARDFIDSLLQVDPSNRLTAAKA 460

Query: 282 LKHPLLQKYP 291
           L HP ++  P
Sbjct: 461 LDHPWIKMGP 470

>AAR009W Chr1 (358947..360308) [1362 bp, 453 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOL016C (CMK2) and
           YFR014C (CMK1)
          Length = 453

 Score =  148 bits (373), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 90/267 (33%), Positives = 143/267 (53%), Gaps = 19/267 (7%)

Query: 22  LGETLGSGSTGKVLLASNETTKQQAAVKVISKAVFEAMNNSESNGDATNALPYNIEQEII 81
            G+TLG+G+ G V  A N    Q  A+K++ K    A+  +E        + Y+   E+ 
Sbjct: 58  FGKTLGAGAFGVVRQARNSKQNQNVAIKILLK---RALKGNELQ------MLYD---ELS 105

Query: 82  IMKLLNHPNVLRLFDVWETNSDLYLVLEYAEKGELFNMLVERGPLPENEAVRAFRQIIIG 141
           I++ L+HPN+++  D +E+    Y+V + A  GELF+ ++++G   E +AV+   Q++  
Sbjct: 106 ILQKLDHPNIVKFKDWFESREKFYIVTQLATGGELFDRILKKGKFTETDAVKIVVQMLTA 165

Query: 142 ISYCHSLGVVHRDLKPEXXXX---XXXXXXXXADFGMA-ALESEDKLLETSCGSPHYAAP 197
           + Y HS  VVHRDLKPE               +DFG+A  L SE +L+  + GS  Y AP
Sbjct: 166 VEYMHSQNVVHRDLKPENVLYLDPSDESQLVISDFGIAKQLSSESQLIHRAAGSMGYVAP 225

Query: 198 EIISGLPYEGFSSDVWSCGVILFALLTGRLPFDEE--DGNIRNLLLKVQKGEFEMPDDDE 255
           E+++   + G   D+WS GVI + LL G  PF  E  +G +  +        F  P  + 
Sbjct: 226 EVLTTSGH-GKPCDIWSLGVITYTLLCGYSPFIAESTEGFLEEVFSGSDPVTFHSPYWNN 284

Query: 256 ITKEAQDLLARLLTVDPSKRITIREIL 282
           I+KEA+  + R LT+ P++R T  E+L
Sbjct: 285 ISKEAKQFILRALTLTPARRPTAAELL 311

>CAGL0L07326g Chr12 (810529..812049) [1521 bp, 506 aa] {ON} similar
           to uniprot|P39009 Saccharomyces cerevisiae YDL101c DUN1
           protein kinase
          Length = 506

 Score =  149 bits (375), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 99/311 (31%), Positives = 152/311 (48%), Gaps = 43/311 (13%)

Query: 20  WKLGETLGSGSTGKVLLASNETTKQQAAVKVISKAVFEAMNNSESNGDATNALPYNIEQE 79
           + LG+ LGSG    V  A N+TT +  AVK+          + + N D      +  E+ 
Sbjct: 193 YLLGKDLGSGHYAIVKEAKNKTTGETVAVKIF---------HPQQNDDQKKNKQFR-EET 242

Query: 80  IIIMKLLNHPNVLRLFD-----VWETNSDLYLVLEYAEKGELFNMLVERGPLPENEAVRA 134
            I+MK+ +HPN++ L D     + +T    YLVLE  + GELF+ +V++  LP+ E+   
Sbjct: 243 TILMKI-HHPNIVNLLDSFVEPISKTQIQKYLVLEKIDDGELFDRIVKKTSLPQEESKAI 301

Query: 135 FRQIIIGISYCHSLGVVHRDLKPEXX-------------------XXXXXXXXXXADFGM 175
           F+QI+ G+ Y HS  ++HRD+KPE                               ADFG+
Sbjct: 302 FKQILTGLKYLHSQNIIHRDIKPENILLNIRRRQSPDERQLGPWDEDEIDIQVKIADFGL 361

Query: 176 AALESEDKLLETSCGSPHYAAPEIISGLPYEGFSS--DVWSCGVILFALLTGRLPFDEED 233
           A    E +   T CG+P Y APE+   L  +G++S  D+WS GVIL+  L G  PF ++ 
Sbjct: 362 AKFTGEMQFTNTLCGTPSYVAPEV---LVKKGYTSKVDLWSAGVILYVCLCGFPPFSDQL 418

Query: 234 G--NIRNLLLKVQKGEFEMPDDDEITKEAQDLLARLLTVDPSKRITIREILKHPLLQKYP 291
           G  +++  ++   K  F  P  DEI   A  L++ LL +DP  R  +     HP L    
Sbjct: 419 GPPSLKEQIMSA-KYAFYSPYWDEIDDAALHLISNLLVLDPENRYDVDAAAAHPWLDSVS 477

Query: 292 SIKDSRSIRNL 302
            +  S +++ L
Sbjct: 478 HLDVSHNLKRL 488

>Kwal_0.96 s0 complement(46082..47365) [1284 bp, 427 aa] {ON}
           YOL016C (CMK2) - Calmodulin-dependent protein kinase
           [contig 76] FULL
          Length = 427

 Score =  147 bits (370), Expect = 4e-37,   Method: Compositional matrix adjust.
 Identities = 88/268 (32%), Positives = 142/268 (52%), Gaps = 17/268 (6%)

Query: 22  LGETLGSGSTGKVLLASNETTKQQAAVKVISKAVFEAMNNSESNGDATNALPYNIEQEII 81
            G+TLG+GS G V  A   ++ +  A+K++ K   +         D    + Y+   E+ 
Sbjct: 48  FGKTLGAGSFGVVRQARQVSSGENVAIKILLKKALKGK-------DVELQMLYD---ELS 97

Query: 82  IMKLLNHPNVLRLFDVWETNSDLYLVLEYAEKGELFNMLVERGPLPENEAVRAFRQIIIG 141
           I++ L+HPN+++  D +E+    Y+V + A  GELF+ ++++G   E +AVR   QI+  
Sbjct: 98  ILQKLDHPNIVKFKDWFESKDKFYIVTQLATGGELFDRILKQGKFTEEDAVRIVYQILKA 157

Query: 142 ISYCHSLGVVHRDLKPE---XXXXXXXXXXXXADFGMAA-LESEDKLLETSCGSPHYAAP 197
           + Y HS  +VHRDLKPE                DFG+A  L+++D+L+  + GS  Y AP
Sbjct: 158 VEYLHSRNIVHRDLKPENLLYLTEAADSQLVLGDFGIAKELKNDDELIHKAAGSMGYVAP 217

Query: 198 EIISGLPYEGFSSDVWSCGVILFALLTGRLPFDEE--DGNIRNLLLKVQKGEFEMPDDDE 255
           E+++   + G   D+WS GV+ + LL G  PF  E  +G +    +      F  P    
Sbjct: 218 EVVTTSGH-GKPCDIWSLGVVTYTLLCGYSPFVAESVEGFLEECTIGRTPVTFHKPYWSN 276

Query: 256 ITKEAQDLLARLLTVDPSKRITIREILK 283
           I+ EA+D + R LTV+P  R T  E+L+
Sbjct: 277 ISNEAKDFILRALTVNPHDRPTATELLQ 304

>TPHA0O01120 Chr15 complement(217462..218751) [1290 bp, 429 aa] {ON}
           Anc_1.374 YFR014C
          Length = 429

 Score =  145 bits (367), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 94/298 (31%), Positives = 153/298 (51%), Gaps = 25/298 (8%)

Query: 22  LGETLGSGSTGKVLLASNETTKQQAAVKVISKAVFEAMNNSESNGDATNALPYNIEQEII 81
            G+TLG+GS G V  A   +T +  AVK++ K   +A+  +E +          +  E+ 
Sbjct: 40  FGKTLGAGSFGVVRQARRISTGEDVAVKILLK---KALQGNEVHLQM-------LYDELS 89

Query: 82  IMKLLNHPNVLRLFDVWETNSDLYLVLEYAEKGELFNMLVERGPLPENEAVRAFRQIIIG 141
           I++ L+HP+++   D +E+    Y+V + A  GELF+ ++ RG   EN+AV+   Q++  
Sbjct: 90  ILQRLHHPHIVAFKDWFESKDKFYIVTQLATGGELFDRILARGKFTENDAVKIIYQLLDA 149

Query: 142 ISYCHSLGVVHRDLKPE---XXXXXXXXXXXXADFGMA-ALESEDKLLETSCGSPHYAAP 197
           + Y HS  VVHRDLKPE               ADFG+A  L++ D ++  + GS  Y AP
Sbjct: 150 VKYIHSQNVVHRDLKPENILYVNNSDNSDLVIADFGIAKQLKNNDDMIFKAAGSLGYVAP 209

Query: 198 EIISGLPYEGFSSDVWSCGVILFALLTGRLPFDEE--DGNIRNLLLKVQKGEFEMPDDDE 255
           E+++ +   G + D+WS GVI + LL+G   F  E  +G +           F  P  D+
Sbjct: 210 EVLT-VNGHGKACDIWSLGVITYTLLSGYSAFIAESVEGFLEECTSSTYPVTFHRPYWDK 268

Query: 256 ITKEAQDLLARLLTVDPSKRITIREILKHPLLQK--------YPSIKDSRSIRNLPRE 305
           I+ EA+  +   LT++P +R T  ++L HP +           PS+++    R   RE
Sbjct: 269 ISDEAKKFILSALTIEPEERPTAEQLLSHPWITSTMSHDADLLPSVREGFDARKKFRE 326

>Smik_7.319 Chr7 complement(534132..535472) [1341 bp, 446 aa] {ON}
           YFR014C (REAL)
          Length = 446

 Score =  145 bits (367), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 89/276 (32%), Positives = 151/276 (54%), Gaps = 21/276 (7%)

Query: 20  WKLGETLGSGSTGKVLLASNETTKQQAAVKVISKAVFEAMNNSESNGDATNALPYNIEQE 79
           +  G+TLG+G+ G V  A N  T +  AVK++ K   +A+  ++   +A       +  E
Sbjct: 37  YVFGKTLGAGTFGVVRQARNTETGEDVAVKILIK---KALKGNKIQLEA-------LYDE 86

Query: 80  IIIMKLLNHPNVLRLFDVWETNSDLYLVLEYAEKGELFNMLVERGPLPENEAVRAFRQII 139
           + I++ L+HPN++   D +E+    Y++ + A+ GELF+ ++++G   E +AVR   +I+
Sbjct: 87  LDILQRLHHPNIVAFKDWFESKDKFYIITQLAKGGELFDRILKKGKFTEVDAVRILVEIL 146

Query: 140 IGISYCHSLGVVHRDLKPEXXXXXXXXXXX---XADFGMAA-LESEDKLLETSCGSPHYA 195
             + Y HS  +VHRDLKPE               ADFG+A  L+S+++L+    GS  Y 
Sbjct: 147 SAVKYMHSQNIVHRDLKPENLLYIDKSDESPLVVADFGIAKRLKSDEELIYKPAGSLGYV 206

Query: 196 APEIISGLPYEGFSSDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQKGE----FEMP 251
           APE+++   + G   D+WS GVI + LL G   F  E   +++ L +   GE    F  P
Sbjct: 207 APEVLTQDGH-GKPCDIWSLGVITYTLLCGYSAFKAE--RVQDFLDECTTGEYPVRFHRP 263

Query: 252 DDDEITKEAQDLLARLLTVDPSKRITIREILKHPLL 287
             D ++ +A+  + + L +DPSKR T  ++L+ P +
Sbjct: 264 YWDSVSDKAKQFILKALNLDPSKRPTAAQLLEDPWI 299

>KLTH0H11396g Chr8 complement(973355..974668) [1314 bp, 437 aa] {ON}
           similar to uniprot|P22517 Saccharomyces cerevisiae
           YOL016C CMK2 Calmodulin-dependent protein kinase and to
           YFR014C uniprot|P27466 Saccharomyces cerevisiae YFR014C
           CMK1 Calmodulin-dependent protein kinase
          Length = 437

 Score =  145 bits (366), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 90/274 (32%), Positives = 141/274 (51%), Gaps = 21/274 (7%)

Query: 22  LGETLGSGSTGKVLLASNETTKQQAAVKVISKAVFEAMNNSESNGDATNALPYNIEQEII 81
            G TLG+GS G V  A   +T +  AVK++ K   +         D    + Y+   E+ 
Sbjct: 48  FGRTLGAGSFGVVRQARKLSTGENVAVKILLKKALKGK-------DVQLQMLYD---ELS 97

Query: 82  IMKLLNHPNVLRLFDVWETNSDLYLVLEYAEKGELFNMLVERGPLPENEAVRAFRQIIIG 141
           I++ L+HPN+++  D +E+    Y+V + A  GELF+ ++++G   E +AVR   QI+  
Sbjct: 98  ILQKLDHPNIVKFKDWFESKDKFYIVTQLAMGGELFDRILKKGKFTEKDAVRIVYQILKA 157

Query: 142 ISYCHSLGVVHRDLKPEXXXXXXXXXXX---XADFGMAA-LESEDKLLETSCGSPHYAAP 197
           + Y HS  +VHRDLKPE                DFG+A  L +ED+L+  + GS  Y AP
Sbjct: 158 VEYLHSRNIVHRDLKPENLLYLAEKDDSPLVLGDFGIAKELNNEDELIHKAAGSMGYVAP 217

Query: 198 EIISGLPYEGFSSDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQKGE----FEMPDD 253
           E+++   + G   D+WS GV+ + LL G  PF  E  ++   L +   G     F  P  
Sbjct: 218 EVLTTSGH-GKPCDIWSLGVVTYTLLCGYSPFVAE--SVEGFLEECTSGRYPVTFHKPYW 274

Query: 254 DEITKEAQDLLARLLTVDPSKRITIREILKHPLL 287
             I+ +A+D + + LTV P  R +  E+L H  +
Sbjct: 275 SSISDDAKDFILQALTVTPRYRPSATELLNHKWI 308

>YPL153C Chr16 complement(261727..264192) [2466 bp, 821 aa] {ON}
           RAD53Protein kinase, required for cell-cycle arrest in
           response to DNA damage; activated by trans
           autophosphorylation when interacting with
           hyperphosphorylated Rad9p; also interacts with ARS1 and
           plays a role in initiation of DNA replication
          Length = 821

 Score =  150 bits (380), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 98/310 (31%), Positives = 160/310 (51%), Gaps = 37/310 (11%)

Query: 3   AISSNTVSVIKNNQIGPWK----LGETLGSGSTGKVLLASNETTKQQAAVKVISKAVFEA 58
            ++S+T S +  N+ G +K    + E +G G+   V  A   TT +  AVK+ISK   + 
Sbjct: 177 GLTSSTASSMVANKTGIFKDFSIIDEVVGQGAFATVKKAIERTTGKTFAVKIISKR--KV 234

Query: 59  MNNSESNGDATNALPYNIEQEIIIMKLLNHPNVLRLFDVWETNSDLYLVLEYAEKGELFN 118
           + N +            + +E+ +++ LNHP ++RL   +E     Y+V+E+   G+L +
Sbjct: 235 IGNMDG-----------VTRELEVLQKLNHPRIVRLKGFYEDTESYYMVMEFVSGGDLMD 283

Query: 119 MLVERGPLPENEAVRAFRQIIIGISYCHSLGVVHRDLKPEXXXXXXX--XXXXXADFGMA 176
            +   G + E+      RQI+  I Y HS+G+ HRDLKP+               DFG+A
Sbjct: 284 FVAAHGAVGEDAGREISRQILTAIKYIHSMGISHRDLKPDNILIEQDDPVLVKITDFGLA 343

Query: 177 ALESEDKLLETSCGSPHYAAPEIISGL-------PYE---GFSS--DVWSCGVILFALLT 224
            ++     ++T CG+  Y APE+I G         YE    +SS  D+WS G +++ +LT
Sbjct: 344 KVQGNGSFMKTFCGTLAYVAPEVIRGKDTSVSPDEYEERNEYSSLVDMWSMGCLVYVILT 403

Query: 225 GRLPFDEEDGNIRNLLLK-VQKGEF-EMP-DDDEITKEAQDLLARLLTVDPSKRITIREI 281
           G LPF    G+ ++ L K + +G + E P  D  I++EA+D +  LL VDP+ R T  + 
Sbjct: 404 GHLPF---SGSTQDQLYKQIGRGSYHEGPLKDFRISEEARDFIDSLLQVDPNNRSTAAKA 460

Query: 282 LKHPLLQKYP 291
           L HP ++  P
Sbjct: 461 LNHPWIKMSP 470

>Kpol_1069.13 s1069 complement(27223..28506) [1284 bp, 427 aa] {ON}
           complement(27223..28506) [1284 nt, 428 aa]
          Length = 427

 Score =  145 bits (365), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 95/277 (34%), Positives = 146/277 (52%), Gaps = 23/277 (8%)

Query: 20  WKLGETLGSGSTGKVLLASNETTKQQAAVKVISKAVFEAMNNSESNGDATNA-LPYNIEQ 78
           +  G+TLG+GS G V  A   +T +  AVK++ K   +        G+     + Y+   
Sbjct: 38  YVFGKTLGAGSFGVVRQARRISTGENVAVKILLKKALK--------GNCVQIEMLYD--- 86

Query: 79  EIIIMKLLNHPNVLRLFDVWETNSDLYLVLEYAEKGELFNMLVERGPLPENEAVRAFRQI 138
           E+ I++ L+HPN++     +E+    Y+  + A  GELF+ ++ RG   E +AVR   Q+
Sbjct: 87  ELSILQKLHHPNIVDFKAWFESKDKFYIATQLATGGELFDRILARGKFTEVDAVRIIVQL 146

Query: 139 IIGISYCHSLGVVHRDLKPEXXXXXXXXX---XXXADFGMA-ALESEDKLLETSCGSPHY 194
           + GI Y HS  +VHRDLKPE               ADFG+A  L+S D L+  + GS  Y
Sbjct: 147 LQGIKYIHSKDIVHRDLKPENVLYIDKSDDSPLVIADFGIAKQLKSGDDLIFKAAGSLGY 206

Query: 195 AAPEIISGLPYEGFSSDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQKG----EFEM 250
            APE+++ +   G   D+WS GVI + LL G  PF  E  ++   L +   G    +F  
Sbjct: 207 VAPEVLT-VNGHGKPCDIWSLGVITYTLLCGYSPFIAE--SVEGFLDECTSGKYPVKFHR 263

Query: 251 PDDDEITKEAQDLLARLLTVDPSKRITIREILKHPLL 287
           P  D I+ EA++ + R L ++PSKR T  E+L+ P +
Sbjct: 264 PYWDTISDEAKEFILRALILEPSKRPTASELLEDPWI 300

>KAFR0C04480 Chr3 (894906..896213) [1308 bp, 435 aa] {ON} Anc_1.374
           YFR014C
          Length = 435

 Score =  145 bits (366), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 91/285 (31%), Positives = 150/285 (52%), Gaps = 23/285 (8%)

Query: 12  IKNNQIGPWKLGETLGSGSTGKVLLASNETTKQQAAVKVISKAVFEAMNNSESNGDATNA 71
           + +N    +  G+TLG+G+ G V  A   +T +  AVK++ K   E            N+
Sbjct: 24  VASNAKTDYIFGKTLGAGTFGVVRQARKLSTNEDVAVKILLKKALEG-----------NS 72

Query: 72  LPYN-IEQEIIIMKLLNHPNVLRLFDVWETNSDLYLVLEYAEKGELFNMLVERGPLPENE 130
           +    +  E+ I++ LNHPN++   D +ET    ++V + A  GELF+ +V++G   E +
Sbjct: 73  VQLQMLYDELSILQRLNHPNIVEFKDWFETKEKFFIVTQLATGGELFDRIVKKGKFTEED 132

Query: 131 AVRAFRQIIIGISYCHSLGVVHRDLKPEXXXXXXXXXXX---XADFGMAA-LESEDKLLE 186
           A++   QI+  + Y HS  +VHRDLKPE               ADFG+A  L+S D+L+ 
Sbjct: 133 AIKILVQILGAVEYIHSRNIVHRDLKPENLLYIDEADTSPLVLADFGIAKELKSGDELIF 192

Query: 187 TSCGSPHYAAPEIISGLPYEGFSSDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQKG 246
            + GS  Y APE+++   + G   D+WS GVI + LL G   F  E  ++   L +  + 
Sbjct: 193 KAAGSLGYVAPEVLTSDGH-GKPCDIWSIGVITYTLLCGYSAFAAE--SVEGFLDECTQN 249

Query: 247 E----FEMPDDDEITKEAQDLLARLLTVDPSKRITIREILKHPLL 287
           +    F  P  D ++++A+  + R LT+DP+KR T   +L+ P +
Sbjct: 250 DKPVVFHKPYWDNVSEDARKFILRALTLDPTKRPTATALLEDPWI 294

>Skud_16.129 Chr16 complement(233341..235824) [2484 bp, 827 aa] {ON}
           YPL153C (REAL)
          Length = 827

 Score =  150 bits (378), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 97/310 (31%), Positives = 160/310 (51%), Gaps = 37/310 (11%)

Query: 3   AISSNTVSVIKNNQIGPWK----LGETLGSGSTGKVLLASNETTKQQAAVKVISKAVFEA 58
            ++S+T S I   + G +K    + E +G G+   V  A   TT +  AVK+ISK   + 
Sbjct: 177 GLTSSTTSAIMARKTGIFKDFSIIDEVVGQGAFATVKKAIERTTGKTFAVKIISKR--KV 234

Query: 59  MNNSESNGDATNALPYNIEQEIIIMKLLNHPNVLRLFDVWETNSDLYLVLEYAEKGELFN 118
           + N +            + +E+ +++ LNHP ++RL   +E     Y+V+E+   G+L +
Sbjct: 235 IGNMDG-----------VTRELEVLQKLNHPRIVRLKGFYEDAESYYMVMEFVSGGDLMD 283

Query: 119 MLVERGPLPENEAVRAFRQIIIGISYCHSLGVVHRDLKPEXXXXXXX--XXXXXADFGMA 176
            +   G + E+      RQI+  + Y HS+G+ HRDLKP+               DFG+A
Sbjct: 284 FVAAHGAVGEDAGREISRQILAAVKYIHSMGISHRDLKPDNILIEQDDPVLVKITDFGLA 343

Query: 177 ALESEDKLLETSCGSPHYAAPEIISG-----LPYEG-----FSS--DVWSCGVILFALLT 224
            ++     ++T CG+  Y APE+I G      P E      +SS  D+WS G +++ +LT
Sbjct: 344 KVQGNGSFMKTFCGTLAYVAPEVIRGKDSSVSPDECEERNEYSSLVDMWSMGCLVYVILT 403

Query: 225 GRLPFDEEDGNIRNLLLK-VQKGEF-EMP-DDDEITKEAQDLLARLLTVDPSKRITIREI 281
           G LPF    G+ ++ L K + +G + E P  D  I++EA+D +  LL VDP+ R+T  + 
Sbjct: 404 GHLPF---SGSTQDQLYKQIGRGSYHEGPLKDFRISEEARDFIDLLLQVDPNNRLTAAKA 460

Query: 282 LKHPLLQKYP 291
           L HP ++  P
Sbjct: 461 LDHPWIKMNP 470

>CAGL0K10604g Chr11 complement(1030055..1031395) [1341 bp, 446 aa]
           {ON} similar to uniprot|P27466 Saccharomyces cerevisiae
           YFR014c CMK1 Ca2+/calmodulin-dependent ser/thr protein
           kinase type I
          Length = 446

 Score =  145 bits (365), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 93/276 (33%), Positives = 142/276 (51%), Gaps = 18/276 (6%)

Query: 25  TLGSGSTGKVLLASNETTKQQAAVKVISKAVFEAMNNSESNGDATNALPYNIEQEIIIMK 84
           TLG+GS G V  A    + +  AVK++ K   E     E   D  N           I++
Sbjct: 70  TLGAGSFGVVKRAKQLHSDEDVAVKILLKRALEKNGGLEPIYDELN-----------IIQ 118

Query: 85  LLNHPNVLRLFDVWETNSDLYLVLEYAEKGELFNMLVERGPLPENEAVRAFRQIIIGISY 144
            L+HPN+++  D +ET S  Y+V + A  GELF+ ++  G   E +AV    QI+  + Y
Sbjct: 119 HLDHPNIVKFKDWFETESKFYIVTQLASGGELFDRIMHDGKYTEEDAVNIVVQILKAVEY 178

Query: 145 CHSLGVVHRDLKPE---XXXXXXXXXXXXADFGMA-ALESEDKLLETSCGSPHYAAPEII 200
            HS  ++HRDLKPE               ADFG+A  LE++D ++    GS  Y APE+ 
Sbjct: 179 LHSQNIIHRDLKPENLLYLDKSKDSRIVLADFGIARQLENDDDVIYRPAGSLGYVAPEVF 238

Query: 201 SGLPYEGFSSDVWSCGVILFALLTGRLPFDEE--DGNIRNLLLKVQKGEFEMPDDDEITK 258
           +   + G  SD+WS GVI + LL G  PF  E  DG +  +       +F+ P  D I++
Sbjct: 239 TSDGH-GKPSDIWSVGVITYTLLCGYSPFKAESVDGFLDEVTSDENPVKFQRPYWDGISE 297

Query: 259 EAQDLLARLLTVDPSKRITIREILKHPLLQKYPSIK 294
            A++ + R+L +DP+ R +  E+L  P +Q   S++
Sbjct: 298 LAKNFILRILDLDPACRPSATELLNDPWIQSKCSLR 333

>NCAS0D00630 Chr4 complement(107310..108593) [1284 bp, 427 aa] {ON}
           Anc_1.374
          Length = 427

 Score =  144 bits (364), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 87/276 (31%), Positives = 149/276 (53%), Gaps = 21/276 (7%)

Query: 20  WKLGETLGSGSTGKVLLASNETTKQQAAVKVISKAVFEAMNNSESNGDATNALPYNIEQE 79
           ++ G+TLG+GS G V  A+ ++  ++ A+K++ K   E              + Y+   E
Sbjct: 27  YEFGKTLGAGSFGVVREATKKSNNEEVAIKILLKKALEG-------NQVQLQMLYD---E 76

Query: 80  IIIMKLLNHPNVLRLFDVWETNSDLYLVLEYAEKGELFNMLVERGPLPENEAVRAFRQII 139
           + I+K L+HPN++   + +ET+  +Y+V + A  GELF+ ++++G   E++AV+   QI+
Sbjct: 77  LTILKKLHHPNIVEFKNWFETDDKIYIVTQLATGGELFDRIIKKGRFSEDDAVKILIQIL 136

Query: 140 IGISYCHSLGVVHRDLKPE---XXXXXXXXXXXXADFGMAA-LESEDKLLETSCGSPHYA 195
             + Y HS  +VHRDLKPE               ADFG+A  L+  ++L+  + GS  Y 
Sbjct: 137 SAVEYIHSRDIVHRDLKPENLLYLTEKEDSELVIADFGIAKELKKGEQLIFKAAGSLGYV 196

Query: 196 APEIISGLPYEGFSSDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQKGE----FEMP 251
           APE+++ +   G   D+WS GVI + LL+G   F  E   +   L +   G+    F  P
Sbjct: 197 APEVLT-VDGHGKPCDIWSIGVITYTLLSGYAAFVAE--TVEGFLDECTSGDYPVKFHKP 253

Query: 252 DDDEITKEAQDLLARLLTVDPSKRITIREILKHPLL 287
             D I+ +A++ + + L ++P KR T  E+L  P +
Sbjct: 254 YWDNISDDAKNFILKALDLNPQKRPTATELLDDPWI 289

>Suva_16.157 Chr16 complement(270891..273389) [2499 bp, 832 aa] {ON}
           YPL153C (REAL)
          Length = 832

 Score =  150 bits (378), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 97/315 (30%), Positives = 164/315 (52%), Gaps = 37/315 (11%)

Query: 3   AISSNTVSVIKNNQIGPWK----LGETLGSGSTGKVLLASNETTKQQAAVKVISKAVFEA 58
            ++S+T SV+  ++ G +K    + E +G G+   V  A   TT +  AVK+ISK   + 
Sbjct: 177 GLTSSTPSVVAAHKTGIFKDFSIIDEVVGQGAFATVKKAIERTTGKTFAVKIISKR--KV 234

Query: 59  MNNSESNGDATNALPYNIEQEIIIMKLLNHPNVLRLFDVWETNSDLYLVLEYAEKGELFN 118
           + N +            + +E+ +++ L+HP ++RL   +E     Y+V+E+   G+L +
Sbjct: 235 IGNMDG-----------VTRELEVLQKLHHPRIVRLKGFYEDTESYYMVMEFVSGGDLMD 283

Query: 119 MLVERGPLPENEAVRAFRQIIIGISYCHSLGVVHRDLKPEXXXXXXX--XXXXXADFGMA 176
            +   G + E+      RQI+  + Y HS+G+ HRDLKP+               DFG+A
Sbjct: 284 FVAAHGAVGEDAGREISRQILEAVKYIHSMGISHRDLKPDNILIEQDDPVLVKITDFGLA 343

Query: 177 ALESEDKLLETSCGSPHYAAPEIISGL-------PYE---GFSS--DVWSCGVILFALLT 224
            ++     ++T CG+  Y APE+I G         YE    +SS  D+WS G +++ +LT
Sbjct: 344 KVQGNGSFMKTFCGTLAYVAPEVIRGKDSSVSPDEYEERNEYSSLVDMWSMGCLVYVILT 403

Query: 225 GRLPFDEEDGNIRNLLLK-VQKGEF-EMP-DDDEITKEAQDLLARLLTVDPSKRITIREI 281
           G LPF    G+ ++ L K + +G + E P  D  I++EA+D +  LL VDP+ R+T  + 
Sbjct: 404 GHLPF---SGSTQDQLYKQIGRGSYHEGPLKDFRISEEARDFIDSLLQVDPNNRLTAAKA 460

Query: 282 LKHPLLQKYPSIKDS 296
           L HP ++  P +  S
Sbjct: 461 LCHPWIKMNPLVSQS 475

>Suva_6.78 Chr6 (135988..137325) [1338 bp, 445 aa] {ON} YFR014C
           (REAL)
          Length = 445

 Score =  143 bits (361), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 88/276 (31%), Positives = 152/276 (55%), Gaps = 21/276 (7%)

Query: 20  WKLGETLGSGSTGKVLLASNETTKQQAAVKVISKAVFEAMNNSESNGDATNALPYNIEQE 79
           +  G+TLG+G+ G V  A N  T +  AVK++ K   +A+  ++   +A       +  E
Sbjct: 37  YVFGKTLGAGTFGVVRQARNSETGEDVAVKILIK---KALKGNKIQLEA-------LYDE 86

Query: 80  IIIMKLLNHPNVLRLFDVWETNSDLYLVLEYAEKGELFNMLVERGPLPENEAVRAFRQII 139
           + I++ L+HPN++   D +E+N   Y++ + A+ GELF+ ++++G   E +AVR   +I+
Sbjct: 87  LDILQRLHHPNIVAFKDWFESNDKFYIITQLAKGGELFDRILKKGKFTEVDAVRILVEIL 146

Query: 140 IGISYCHSLGVVHRDLKPEXXXXXXXXXXX---XADFGMAA-LESEDKLLETSCGSPHYA 195
             + Y HS  +VHRDLKPE               ADFG+A  L+S+++L+  + GS  Y 
Sbjct: 147 SAVKYMHSQNIVHRDLKPENLLYIDKSDESPLVIADFGIAKRLKSDEELIYKAAGSLGYV 206

Query: 196 APEIISGLPYEGFSSDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQKGE----FEMP 251
           APE+++   + G   D+WS GVI + LL G   F  E   + + L +   G+    F  P
Sbjct: 207 APEVLTQDGH-GKPCDIWSIGVITYTLLCGYSAFKAE--RVLDFLDECTTGKYPVTFHRP 263

Query: 252 DDDEITKEAQDLLARLLTVDPSKRITIREILKHPLL 287
             D ++ +A+  + + L ++P+KR T  E+L+ P +
Sbjct: 264 YWDSVSDKAKRFILKALDLNPAKRPTAAELLEDPWI 299

>TBLA0D05010 Chr4 complement(1234934..1236238) [1305 bp, 434 aa]
           {ON} Anc_1.374 YFR014C
          Length = 434

 Score =  142 bits (359), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 89/275 (32%), Positives = 146/275 (53%), Gaps = 17/275 (6%)

Query: 20  WKLGETLGSGSTGKVLLASNETTKQQAAVKVISKAVFEAMNNSESNGDATNALPYNIEQE 79
           +  G+TLG+GS G V  A   +T +  AVK+I K   +         D    + Y+   E
Sbjct: 47  YVFGKTLGAGSFGVVRQAKKLSTDENVAVKIILKKALKG-------NDVQLQMLYD---E 96

Query: 80  IIIMKLLNHPNVLRLFDVWETNSDLYLVLEYAEKGELFNMLVERGPLPENEAVRAFRQII 139
           + I++ L+HPN+++  D +E+    Y+V + A  GELF+ +++RG   E +AV+   Q++
Sbjct: 97  LSILQRLHHPNIVQFKDWFESKEKFYIVTQLATGGELFDRILKRGKFTEVDAVKIIIQML 156

Query: 140 IGISYCHSLGVVHRDLKPEXXXX---XXXXXXXXADFGMAA-LESEDKLLETSCGSPHYA 195
             I Y HS  +VHRDLKPE               ADFG+A  L+  D L+  + GS  Y 
Sbjct: 157 KAIEYIHSQNIVHRDLKPENVLYIDPSDDSQLVIADFGIAKELKDGDDLIFKAAGSLGYV 216

Query: 196 APEIISGLPYEGFSSDVWSCGVILFALLTGRLPFDEE--DGNIRNLLLKVQKGEFEMPDD 253
           APE+++   + G   D+WS GVI + LL G   F  E  +G +      +   +F  P  
Sbjct: 217 APEVLTTNGH-GKPCDIWSLGVITYTLLCGYSAFIAETVEGFLEECTSNIYPVKFHEPYW 275

Query: 254 DEITKEAQDLLARLLTVDPSKRITIREILKHPLLQ 288
           + +++EA++ + + LT++P +R T  E+L  P ++
Sbjct: 276 NNVSREAKEFILKALTLNPDERPTATELLNDPWIK 310

>TBLA0A02050 Chr1 (495735..497039) [1305 bp, 434 aa] {ON} 
          Length = 434

 Score =  142 bits (359), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 79/275 (28%), Positives = 142/275 (51%), Gaps = 17/275 (6%)

Query: 16  QIGPWKLGETLGSGSTGKVLLASNETTKQQAAVKVISKAVFEAMNNSESNGDATNALPYN 75
           Q   +++G  LG G  GKV    ++ +   +A+KV+ K    + N  +            
Sbjct: 171 QFSDFEIGRGLGKGKFGKVYCVKHKQSGFISALKVMKKKEIVSYNAEKQ----------- 219

Query: 76  IEQEIIIMKLLNHPNVLRLFDVWETNSDLYLVLEYAEKGELFNMLVER-GPLPENEAVRA 134
            ++E+ +   LNHPN++++F  ++    +YL++EY   GEL+  L    GP  +  A   
Sbjct: 220 FKREVEVQNSLNHPNIVKIFGFFQDEIFVYLIMEYLINGELYKSLKNNNGPFNDILASNY 279

Query: 135 FRQIIIGISYCHSLGVVHRDLKPEXXXXXXXXXXXXADFGMAALESEDKLLETSCGSPHY 194
             QI   + Y HS  ++HRD+KPE            ADFG +     +   +T CG+  Y
Sbjct: 280 IYQIADALKYMHSKHIIHRDIKPENIVLGFNNKIKLADFGWSICTPPNLRRKTICGTIDY 339

Query: 195 AAPEIISGLPYEGFSSDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQKGEFEMPDDD 254
            APE+++   Y+ ++ D+W+ G++ + L+ G  PF+EE  ++     ++   +   P   
Sbjct: 340 LAPELVTFKEYD-YNVDIWALGILTYELIVGNPPFEEETKDLT--YKRIINVDLNFP--Q 394

Query: 255 EITKEAQDLLARLLTVDPSKRITIREILKHPLLQK 289
            ++ +A+DL+ RLL  DPSKR+ + +++KHP + K
Sbjct: 395 TVSMDARDLITRLLRFDPSKRMPLVDVMKHPWITK 429

>Skud_6.89 Chr6 (166257..167594) [1338 bp, 446 aa] {ON} YFR014C
           (REAL)
          Length = 446

 Score =  142 bits (358), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 87/276 (31%), Positives = 150/276 (54%), Gaps = 21/276 (7%)

Query: 20  WKLGETLGSGSTGKVLLASNETTKQQAAVKVISKAVFEAMNNSESNGDATNALPYNIEQE 79
           +  G+TLG+G+ G V  A N  T +  AVK++ K   +A+  ++   +A       +  E
Sbjct: 37  YVFGKTLGAGTFGVVRQARNTETGEDVAVKILIK---KALKGNKIQLEA-------LYDE 86

Query: 80  IIIMKLLNHPNVLRLFDVWETNSDLYLVLEYAEKGELFNMLVERGPLPENEAVRAFRQII 139
           + I++ L+HPN++   D +E+    Y++ + A+ GELF+ ++++G   E +AVR   +I+
Sbjct: 87  LDILQRLHHPNIVAFKDWFESKDKFYIITQLAKGGELFDRILKKGKFTEVDAVRILVEIL 146

Query: 140 IGISYCHSLGVVHRDLKPEXXXXXXXXXXX---XADFGMAA-LESEDKLLETSCGSPHYA 195
             + Y HS  +VHRDLKPE               ADFG+A  L+S+++L+    GS  Y 
Sbjct: 147 SAVKYMHSQNIVHRDLKPENLLYVDKSDESPLVVADFGIAKRLKSDEELIYKPAGSLGYV 206

Query: 196 APEIISGLPYEGFSSDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQKGE----FEMP 251
           APE+++   + G   D+WS GVI + LL G   F  E   +++ L +   GE    F  P
Sbjct: 207 APEVLTQDGH-GKPCDIWSIGVITYTLLCGYSAFKAE--RVQDFLDECTTGEHPVRFHRP 263

Query: 252 DDDEITKEAQDLLARLLTVDPSKRITIREILKHPLL 287
             D ++ +A+  + + L +DP++R T  ++L  P +
Sbjct: 264 YWDSVSGKAKQFILKALNLDPAERPTAAQLLDDPWI 299

>KAFR0H02510 Chr8 complement(476574..479213) [2640 bp, 879 aa] {ON}
           Anc_8.668 YPL150W
          Length = 879

 Score =  147 bits (371), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 100/365 (27%), Positives = 165/365 (45%), Gaps = 71/365 (19%)

Query: 16  QIGPWKLGETLGSGSTGKVLLASNETTKQQAAVKVISKAVFEAMNNSESNGDATNALPYN 75
           ++G +++ + +G GS GKV LA +  T ++  +K            S+ N         N
Sbjct: 37  EVGNYRILKQIGEGSFGKVYLALHRPTHRKVVLKT-----------SDKNDP-------N 78

Query: 76  IEQEIIIMKLLNHPNVLRLFDVWETNSDLYLVLEYAEKGELFNMLVERGPLPENEAVRAF 135
           I +E+   +  ++P + +++++  T + +++ LEY    EL++ L+    +P  E    F
Sbjct: 79  IVREVFYHRQFDYPYITKVYEIIVTETKVWMALEYCPGKELYDHLLFSKRIPIAECTELF 138

Query: 136 RQIIIGISYCHSLGVVHRDLKPEXXXXXXXXXXXXADFGMAALESEDKLLETSCGSPHYA 195
            QI+  + Y HSL  VHRDLK E             DFG          LET CG+  Y 
Sbjct: 139 AQIVGAVYYAHSLNCVHRDLKLENILLDKHGRAKLTDFGFTRECMTRSTLETVCGTTVYM 198

Query: 196 APEIISGLPYEGFSSDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQKGEFEMPDDDE 255
           APE+I    Y+GF  D+W+ GVIL+ ++ G +PFDE+D               E+    +
Sbjct: 199 APELIERKSYDGFKIDIWALGVILYTMIYGAMPFDEDD---------------EVKTKWK 243

Query: 256 ITKEAQDLLARLLTVD------------PSKRITIREILKHPLLQKYPSIKDSRSIRNLP 303
           I  E  D    + + D            P++R TIREILKH  L+ Y             
Sbjct: 244 IVNEDPDFTNNISSNDVKDLIKKLLKKDPTERPTIREILKHDFLKPYG------------ 291

Query: 304 REDTYLSPLADTNSKIDDAILQ---NLVILWHGKDAREIAAKLREPGANTEKTLYALLYR 360
                 + L  T     D I+Q   N  I +H K  + +  +L+  G +T+   ++++ +
Sbjct: 292 -----FTILEKT-----DKIIQRQRNDSIHFHSKIEKRLLKRLKRSGFDTQSIKHSIMKK 341

Query: 361 FKCDT 365
            KCD+
Sbjct: 342 -KCDS 345

>Kpol_1065.3 s1065 complement(4445..5575) [1131 bp, 376 aa] {ON}
           complement(4445..5575) [1131 nt, 377 aa]
          Length = 376

 Score =  140 bits (353), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 78/274 (28%), Positives = 143/274 (52%), Gaps = 16/274 (5%)

Query: 16  QIGPWKLGETLGSGSTGKVLLASNETTKQQAAVKVISKAVFEAMNNSESNGDATNALPYN 75
           ++  +++G  LG G  GKV    ++ +    A+KV++K      N  +            
Sbjct: 114 KLNDFEIGRKLGKGKFGKVYCVRHKPSGLICALKVMNKMEIVNFNVQKQ----------- 162

Query: 76  IEQEIIIMKLLNHPNVLRLFDVWETNSDLYLVLEYAEKGELFNMLVERGPLPENEAVRAF 135
            ++EI I   LNH N+ +L+  +  + ++YLV+EY   GEL+ +L + GP+ +  A    
Sbjct: 163 FKREIDIQYHLNHKNLTKLYAFFHDSKNVYLVMEYLIGGELYKLLKKNGPMNDITASNYV 222

Query: 136 RQIIIGISYCHSLGVVHRDLKPEXXXXXXXXXXXXADFGMAALESEDKLLETSCGSPHYA 195
            Q+   ++Y H   ++HRDLKPE             DFG +     ++  +T CG+  Y 
Sbjct: 223 YQMTDALNYMHKRKIIHRDLKPENILIGFNNQIKLTDFGWSIYNPNNQKRKTLCGTIDYL 282

Query: 196 APEIISGLPYEGFSSDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQKGEFEMPDDDE 255
           +PE+IS   Y+  + DVW+ G++ + L+ G  PF+E+         ++ K + + P +  
Sbjct: 283 SPELISSREYDE-NVDVWALGILTYELVVGAPPFEEDTK--EQTYKRIAKSDLKFPPN-- 337

Query: 256 ITKEAQDLLARLLTVDPSKRITIREILKHPLLQK 289
           ++ EA+DL+  LL V PS+R  +++++ HP ++K
Sbjct: 338 VSSEARDLITNLLKVVPSERFNLQQVMNHPWIEK 371

>NDAI0H03520 Chr8 (860096..861472) [1377 bp, 458 aa] {ON} 
          Length = 458

 Score =  141 bits (356), Expect = 5e-35,   Method: Compositional matrix adjust.
 Identities = 89/271 (32%), Positives = 146/271 (53%), Gaps = 19/271 (7%)

Query: 20  WKLGETLGSGSTGKVLLASNETTKQQAAVKVISKAVFEAMNNSESNGDATNALPYN-IEQ 78
           ++ G+TLG+GS G V  A   ++ ++ AVK++ K                NA+    + Q
Sbjct: 31  YEFGKTLGAGSFGIVRQAKRISSNEEVAVKILLKQALRE-----------NAIQLRMLYQ 79

Query: 79  EIIIMKLLNHPNVLRLFDVWETNSDLYLVLEYAEKGELFNMLVERGPLPENEAVRAFRQI 138
           E+ I+K L+H N++   + +ET+  LY+V + A  GELF+ ++  G   E++AV+   QI
Sbjct: 80  ELSILKKLHHRNIVEFKNWFETDDKLYIVTQLATGGELFDRIIMEGKFTEDDAVKIIVQI 139

Query: 139 IIGISYCHSLGVVHRDLKPE---XXXXXXXXXXXXADFGMAA-LESEDKLLETSCGSPHY 194
           +  + Y HS  +VHRDLKPE               ADFG+A  L+S ++L+  + GS  Y
Sbjct: 140 LSAVEYIHSKNIVHRDLKPENLLYLTKEKDSQLVIADFGIAKELKSGEELIFKAAGSLGY 199

Query: 195 AAPEIISGLPYEGFSSDVWSCGVILFALLTGRLPFDEE--DGNIRNLLLKVQKGEFEMPD 252
            APE+++ +   G   D+WS GVI + LL G   F  E  +G +   +   Q  +F+ P 
Sbjct: 200 VAPEVLT-VNGHGKPCDIWSLGVITYTLLCGYSAFKAETVEGFLDECIANDQPVQFQKPY 258

Query: 253 DDEITKEAQDLLARLLTVDPSKRITIREILK 283
            D I++ A++ + + L + P +R T  E+LK
Sbjct: 259 WDNISQSAKNFILKCLDLTPEQRPTATELLK 289

>ZYRO0E05588g Chr5 (430271..431686) [1416 bp, 471 aa] {ON} similar
           to uniprot|P22517 Saccharomyces cerevisiae YOL016C CMK2
           Calmodulin-dependent protein kinase and to YFR014C
           uniprot|P27466 Saccharomyces cerevisiae YFR014C CMK1
           Calmodulin-dependent protein kinase
          Length = 471

 Score =  142 bits (357), Expect = 5e-35,   Method: Compositional matrix adjust.
 Identities = 90/276 (32%), Positives = 143/276 (51%), Gaps = 21/276 (7%)

Query: 20  WKLGETLGSGSTGKVLLASNETTKQQAAVKVISKAVFEAMNNSESNGDATNALPYNIEQE 79
           +  G TLG+G+ G V  A   +TKQ  AVK++ K   +         D    + Y+   E
Sbjct: 59  YVFGRTLGAGTFGIVRQARRYSTKQNVAVKILLKKALKG-------NDVQLQMLYD---E 108

Query: 80  IIIMKLLNHPNVLRLFDVWETNSDLYLVLEYAEKGELFNMLVERGPLPENEAVRAFRQII 139
           + I++ L HPN++R  D +E+    Y+V + A  GELF+ ++ +G   E +AV+   Q++
Sbjct: 109 LSILQKLRHPNIVRFEDWFESKDKFYIVTQLATGGELFDRIIAKGHFTEEDAVKIVVQML 168

Query: 140 IGISYCHSLGVVHRDLKPEXXXX---XXXXXXXXADFGMAA-LESEDKLLETSCGSPHYA 195
             + Y HS  +VHRDLKPE               ADFG+A  L + D+L+  + GS  Y 
Sbjct: 169 NAVEYMHSENIVHRDLKPENILYIDPSDDSPLVIADFGIAKELHNNDELIFKAAGSLGYV 228

Query: 196 APEIISGLPYEGFSSDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQKGEFEMPDDDE 255
           APE+++   + G   D+WS GVI + LL G  PF  E  ++   L +V K  + +   ++
Sbjct: 229 APEVLTTNGH-GKPCDIWSLGVITYTLLCGYSPFVAE--SVEGFLEEVAKDRYPVKFHEQ 285

Query: 256 ----ITKEAQDLLARLLTVDPSKRITIREILKHPLL 287
               I+ EA+  + R L ++P  R T  E+L  P +
Sbjct: 286 YWSKISTEARRFILRALEINPQYRPTASELLCDPWI 321

>Suva_4.145 Chr4 complement(268826..270370) [1545 bp, 514 aa] {ON}
           YDL101C (REAL)
          Length = 514

 Score =  142 bits (358), Expect = 6e-35,   Method: Compositional matrix adjust.
 Identities = 97/326 (29%), Positives = 159/326 (48%), Gaps = 49/326 (15%)

Query: 2   SAISSNTVSVIKNNQIG---PWKLGETLGSGSTGKVLLASNETTKQQAAVKVISKAVFEA 58
           + ISS +  +IK   +     + LG+ LG+G    V  A N+ T QQ AVK+     F A
Sbjct: 180 AMISSTSKKIIKTKPVSFFDKYLLGKELGAGHYALVKEAKNKKTGQQVAVKI-----FHA 234

Query: 59  MNNSESNGDATNALPYNIEQEIIIMKLLNHPNVLRLFD-----VWETNSDLYLVLEYAEK 113
             N +   +          +E  I+  ++HPN++ L D     + ++    YLVLE  + 
Sbjct: 235 QQNDDQKKNK------QFREETNILMRVHHPNIVNLLDSFVEPISKSQIQKYLVLEKIDD 288

Query: 114 GELFNMLVERGPLPENEAVRAFRQIIIGISYCHSLGVVHRDLKPEXXXXXXX-------- 165
           GELF  +V +  L ++E+   F+Q++ G+ Y H   ++HRD+KPE               
Sbjct: 289 GELFERIVRKTCLGQDESRALFKQLLTGLKYLHEQNIIHRDIKPENILLNITRRENSNQV 348

Query: 166 -----------XXXXXADFGMAALESEDKLLETSCGSPHYAAPEIISGLPYEGFSS--DV 212
                           ADFG+A    E +   T CG+P Y APE+++    +G++S  D+
Sbjct: 349 QLGPWDEDEIDIQVKIADFGLAKFTGEMQFTNTLCGTPSYVAPEVLTK---KGYTSKVDL 405

Query: 213 WSCGVILFALLTGRLPFDEEDG--NIRNLLLKVQKGEFEMPDDDEITKEAQDLLARLLTV 270
           WS GVIL+  L G  PF ++ G  +++  +++  K  F  P  D+I      L++ LL +
Sbjct: 406 WSAGVILYVCLCGFPPFSDQLGPPSLKEQIMQA-KYAFYSPYWDKIDDSVLHLISNLLVL 464

Query: 271 DPSKRITIREILKHPL---LQKYPSI 293
           +P +R  I E + HP    L+K+ S+
Sbjct: 465 NPDERYNIDEAMNHPWFKDLKKHNSV 490

>Skud_15.144 Chr15 complement(254620..255969) [1350 bp, 449 aa] {ON}
           YOL016C (REAL)
          Length = 449

 Score =  141 bits (355), Expect = 6e-35,   Method: Compositional matrix adjust.
 Identities = 89/274 (32%), Positives = 138/274 (50%), Gaps = 17/274 (6%)

Query: 20  WKLGETLGSGSTGKVLLASNETTKQQAAVKVISKAVFEAMNNSESNGDATNALPYNIEQE 79
           +  G TLG+GS G V  A   +T +  A+K++ K   +            N     + +E
Sbjct: 47  YIFGRTLGAGSFGVVRQARKLSTNEDVAIKILLKKALQG----------NNVQLQMLYEE 96

Query: 80  IIIMKLLNHPNVLRLFDVWETNSDLYLVLEYAEKGELFNMLVERGPLPENEAVRAFRQII 139
           + I++ L+HPN++   D +E+    Y+V + A  GELF+ ++ RG   E +AV    QI+
Sbjct: 97  LSILQKLSHPNIVAFKDWFESKDKFYIVTQLATGGELFDRILSRGKFTEVDAVEIVVQIL 156

Query: 140 IGISYCHSLGVVHRDLKPEXXXXXXXXXXX---XADFGMA-ALESEDKLLETSCGSPHYA 195
             + Y HS  VVHRDLKPE               ADFG+A  L+ ++ L+  + GS  Y 
Sbjct: 157 GAVEYMHSKNVVHRDLKPENVLYVDKSENSPLVIADFGIAKQLKGKEDLIYKAAGSLGYV 216

Query: 196 APEIISGLPYEGFSSDVWSCGVILFALLTGRLPFDEE--DGNIRNLLLKVQKGEFEMPDD 253
           APE+++   + G   D+WS GVI + LL G  PF  E  +G +           F MP  
Sbjct: 217 APEVLTQDGH-GKPCDIWSIGVITYTLLCGYSPFIAESVEGFMEECTAYRYPVTFHMPYW 275

Query: 254 DEITKEAQDLLARLLTVDPSKRITIREILKHPLL 287
           D I+ +A+  + + L +DP+ R T  E+L  P +
Sbjct: 276 DSISVDAKHFILKALRLDPADRPTATELLDDPWI 309

>YDL101C Chr4 complement(280307..281848) [1542 bp, 513 aa] {ON}
           DUN1Cell-cycle checkpoint serine-threonine kinase
           required for DNA damage-induced transcription of certain
           target genes, phosphorylation of Rad55p and Sml1p, and
           transient G2/M arrest after DNA damage; also regulates
           postreplicative DNA repair
          Length = 513

 Score =  142 bits (358), Expect = 7e-35,   Method: Compositional matrix adjust.
 Identities = 91/296 (30%), Positives = 143/296 (48%), Gaps = 43/296 (14%)

Query: 20  WKLGETLGSGSTGKVLLASNETTKQQAAVKVISKAVFEAMNNSESNGDATNALPYNIEQE 79
           + LG+ LG+G    V  A N+ T QQ AVK+     F A  N +   +          +E
Sbjct: 200 YLLGKELGAGHYALVKEAKNKKTGQQVAVKI-----FHAQQNDDQKKNK------QFREE 248

Query: 80  IIIMKLLNHPNVLRLFD-----VWETNSDLYLVLEYAEKGELFNMLVERGPLPENEAVRA 134
             I+  + HPN++ L D     + ++    YLVLE  + GELF  +V +  L ++E+   
Sbjct: 249 TNILMRVQHPNIVNLLDSFVEPISKSQIQKYLVLEKIDDGELFERIVRKTCLRQDESKAL 308

Query: 135 FRQIIIGISYCHSLGVVHRDLKPEXXXXXXX-------------------XXXXXADFGM 175
           F+Q++ G+ Y H   ++HRD+KPE                               ADFG+
Sbjct: 309 FKQLLTGLKYLHEQNIIHRDIKPENILLNITRRENPSQVQLGPWDEDEIDIQVKIADFGL 368

Query: 176 AALESEDKLLETSCGSPHYAAPEIISGLPYEGFSS--DVWSCGVILFALLTGRLPFDEED 233
           A    E +   T CG+P Y APE+++    +G++S  D+WS GVIL+  L G  PF ++ 
Sbjct: 369 AKFTGEMQFTNTLCGTPSYVAPEVLTK---KGYTSKVDLWSAGVILYVCLCGFPPFSDQL 425

Query: 234 G--NIRNLLLKVQKGEFEMPDDDEITKEAQDLLARLLTVDPSKRITIREILKHPLL 287
           G  +++  +L+  K  F  P  D+I      L++ LL ++P +R  I E L HP  
Sbjct: 426 GPPSLKEQILQA-KYAFYSPYWDKIDDSVLHLISNLLVLNPDERYNIDEALNHPWF 480

>KAFR0H02430 Chr8 complement(464446..466800) [2355 bp, 784 aa] {ON}
           Anc_8.676 YPL153C
          Length = 784

 Score =  144 bits (364), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 91/280 (32%), Positives = 144/280 (51%), Gaps = 31/280 (11%)

Query: 24  ETLGSGSTGKVLLASNETTKQQAAVKVISKAVFEAMNNSESNGDATNALPYNIEQEIIIM 83
           E +G G+   V  A   TT +  AVK+I+K   + M N +            + +E+ ++
Sbjct: 191 EVVGQGAFATVKKAVERTTGKTYAVKIINKR--KVMGNLDG-----------VTRELEVL 237

Query: 84  KLLNHPNVLRLFDVWETNSDLYLVLEYAEKGELFNMLVERGPLPENEAVRAFRQIIIGIS 143
           K LNHP ++ L   +E N   Y+V+E+   G+L + +   G + E+      RQI+  + 
Sbjct: 238 KRLNHPRIVSLKGFYEDNESYYMVMEFVSGGDLMDFVAAHGAVGEDAGKEISRQILEAVK 297

Query: 144 YCHSLGVVHRDLKPEXXXXXXX--XXXXXADFGMAALESEDKLLETSCGSPHYAAPEII- 200
           Y HS+G+ HRDLKP+               DFG+A ++     ++T CG+  Y APE+I 
Sbjct: 298 YIHSMGISHRDLKPDNILIEQDDPVLVKITDFGLAKVQGNGTFMKTFCGTLAYVAPEVIG 357

Query: 201 SGLPY-------EGFSS--DVWSCGVILFALLTGRLPFDEEDGNIRNLLLK-VQKGEF-E 249
           S   Y         +SS  D+WS G +++ +LTG LPF    G+ +  L K + +G + E
Sbjct: 358 SSSKYNEEDEERNEYSSLVDMWSMGCLVYVILTGHLPF---SGSTQEQLYKQISRGSYHE 414

Query: 250 MP-DDDEITKEAQDLLARLLTVDPSKRITIREILKHPLLQ 288
            P  D  I+ EA+D +  LL VDPS R+T    L+HP ++
Sbjct: 415 GPLKDYRISDEARDFIDSLLQVDPSNRLTAARALEHPWIK 454

>AFL188C Chr6 complement(88793..90211) [1419 bp, 472 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDL101C
           (DUN1)
          Length = 472

 Score =  140 bits (354), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 100/328 (30%), Positives = 156/328 (47%), Gaps = 45/328 (13%)

Query: 23  GETLGSGSTGKVLLASNETTKQQAAVKVISKAVFEAMNNSESNGDATNALPYNIEQEIII 82
           G+ LGSG    V  A N+ T Q  AVK+          + + N DA     +  E +I++
Sbjct: 158 GKELGSGHYAIVKEAINKITGQSVAVKIF---------HPQKNDDAKKTRQFREETKILM 208

Query: 83  MKLLNHPNVLRLFDVW-----ETNSDLYLVLEYAEKGELFNMLVERGPLPENEAVRAFRQ 137
              LNH N+++L + +     ++    YLVLE  + GELF+ +V +  L ++E    F+Q
Sbjct: 209 G--LNHENIVKLLERFVEPLSKSQVQTYLVLEKIQDGELFDKIVRKTKLHQDETRALFKQ 266

Query: 138 IIIGISYCHSLGVVHRDLKPEXXXXXXXX-------------------XXXXADFGMAAL 178
           I+ G+ Y H   ++HRD+KPE                               ADFG+A  
Sbjct: 267 ILAGLKYLHDRNIIHRDIKPENILLSIRRRTSPDQVQLGPWDEDELDITVKIADFGLAKF 326

Query: 179 ESEDKLLETSCGSPHYAAPEIISGLPYEGFSSDVWSCGVILFALLTGRLPFDEEDG--NI 236
             E +   T CG+P Y A E+++   Y     D+WS GV+L+  L G  PF ++    ++
Sbjct: 327 TGEMQFTTTLCGTPSYVAAEVLTKTGYTS-KVDLWSAGVLLYVCLCGFPPFSDQLAPPSM 385

Query: 237 RNLLLKVQKGEFEMPDDDEITKEAQDLLARLLTVDPSKRITIREILKHPLLQKYPSIKDS 296
           +  +L+  K  F  P  DEI      L++ LL VDP+KR ++R+ + H  L K    K S
Sbjct: 386 KEQILQ-GKFAFYSPYWDEIDDSVLHLISNLLVVDPAKRYSVRDAIGHEWLTKTDDSKTS 444

Query: 297 RSIR------NLPREDTYLSPLADTNSK 318
           +  R      N+P+  + LS +  T SK
Sbjct: 445 KVERPRLSETNVPKTYSELSSIQQTASK 472

>KLLA0F23155g Chr6 (2157146..2158429) [1284 bp, 427 aa] {ON} similar
           to uniprot|P22517 Saccharomyces cerevisiae YOL016C CMK2
           Calmodulin-dependent protein kinase and uniprot|P27466
           Saccharomyces cerevisiae YFR014C CMK1
          Length = 427

 Score =  139 bits (351), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 86/267 (32%), Positives = 139/267 (52%), Gaps = 17/267 (6%)

Query: 22  LGETLGSGSTGKVLLASNETTKQQAAVKVISKAVFEAMNNSESNGDATNALPYNIEQEII 81
            G+TLG+G+ G V  A   ++ +  AVK++ K   +  +           + Y+   E+ 
Sbjct: 48  FGKTLGAGTFGVVRQARCISSGENVAVKILLKKALKGQS-------VQLQMLYD---ELS 97

Query: 82  IMKLLNHPNVLRLFDVWETNSDLYLVLEYAEKGELFNMLVERGPLPENEAVRAFRQIIIG 141
           I++ LNHPN++R  D +E+    Y+V + A  GELF+ ++E+G   E +AV   +QI+ G
Sbjct: 98  ILQQLNHPNIVRFKDWFESKEKFYIVTQLATGGELFDRILEKGKFCEVDAVFIVKQILQG 157

Query: 142 ISYCHSLGVVHRDLKPEXXXXXXXXX---XXXADFGMAA-LESEDKLLETSCGSPHYAAP 197
           + Y H   +VHRDLKPE                DFG+A  L+ +++L+  + GS  Y AP
Sbjct: 158 VQYLHQRNIVHRDLKPENILYLNKSDDSPLVIGDFGIAKELKDDNELIHKAAGSMGYVAP 217

Query: 198 EIISGLPYEGFSSDVWSCGVILFALLTGRLPFDEE--DGNIRNLLLKVQKGEFEMPDDDE 255
           E+++   + G   D+WS GVI + LL G  PF  E  DG I           F  P  + 
Sbjct: 218 EVLTSSGH-GKPCDIWSIGVITYTLLCGYSPFLAESADGFIEECTSGQYPVVFHKPYWNN 276

Query: 256 ITKEAQDLLARLLTVDPSKRITIREIL 282
           ++K A++ +   LTV P +R T  +++
Sbjct: 277 VSKTAKEFILWALTVSPKRRPTATDLI 303

>CAGL0M02233g Chr13 complement(267332..269635) [2304 bp, 767 aa]
           {ON} highly similar to uniprot|P22216 Saccharomyces
           cerevisiae YPL153c SPK1 ser/thr/tyr protein kinase
          Length = 767

 Score =  144 bits (363), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 91/294 (30%), Positives = 151/294 (51%), Gaps = 34/294 (11%)

Query: 24  ETLGSGSTGKVLLASNETTKQQAAVKVISKAVFEAMNNSESNGDATNALPYNIEQEIIIM 83
           E +G+G+   V  A    T +  AVK+I+K   + + N +            + +E+ ++
Sbjct: 192 EVVGTGAFATVKKAVERNTGKTFAVKIINKR--KVVGNMDG-----------VSRELEVL 238

Query: 84  KLLNHPNVLRLFDVWETNSDLYLVLEYAEKGELFNMLVERGPLPENEAVRAFRQIIIGIS 143
           + LNHP ++ L   +E  ++ Y+V+E+   G+L + +   G + E       RQI+  I 
Sbjct: 239 QKLNHPRIVSLKAFYEDEANYYMVMEFISGGDLMDFVAAHGAVGEEAGREISRQILEAIQ 298

Query: 144 YCHSLGVVHRDLKPEXXXXXXX--XXXXXADFGMAALESEDKLLETSCGSPHYAAPEIIS 201
           Y HS G+ HRDLKP+               DFG+A ++    +++T CG+  Y APE+I 
Sbjct: 299 YIHSKGISHRDLKPDNILIEQDDPVLVKITDFGLAKVQGNGSIMKTFCGTLAYVAPEVIG 358

Query: 202 GLP-----------YEGFSS--DVWSCGVILFALLTGRLPFDEEDGNIRNLLL-KVQKGE 247
           G                +SS  D+WS G ++F +LTG LPF    G+ +  L  +++KG 
Sbjct: 359 GFTGATGEEETEEERIEYSSLVDMWSMGCLVFVILTGHLPF---SGSTQEQLYEQIRKGS 415

Query: 248 F-EMP-DDDEITKEAQDLLARLLTVDPSKRITIREILKHPLLQKYPSIKDSRSI 299
           + E P  D  I+ EA+D +  LL VD SKR+T+ + L HP +++  S  D+ S+
Sbjct: 416 YHEGPLKDFRISDEARDFIDGLLQVDQSKRMTVDDALNHPWIKQCSSQFDANSM 469

>Smik_4.135 Chr4 complement(256861..258402) [1542 bp, 513 aa] {ON}
           YDL101C (REAL)
          Length = 513

 Score =  141 bits (355), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 90/297 (30%), Positives = 144/297 (48%), Gaps = 43/297 (14%)

Query: 20  WKLGETLGSGSTGKVLLASNETTKQQAAVKVISKAVFEAMNNSESNGDATNALPYNIEQE 79
           + LG+ LGSG    V  A N+ T QQ AVK+     F A  N +   +          +E
Sbjct: 200 YLLGKELGSGHYALVKEAKNKKTGQQVAVKI-----FHAQQNDDQKKNK------QFREE 248

Query: 80  IIIMKLLNHPNVLRLFD-----VWETNSDLYLVLEYAEKGELFNMLVERGPLPENEAVRA 134
             I+  + HPN++ L D     + ++    YLVLE  + GELF  +V +  L ++E+   
Sbjct: 249 TNILMRVQHPNIVNLLDSFVEPISKSQIQKYLVLEKIDDGELFERIVRKTCLRQDESKAL 308

Query: 135 FRQIIIGISYCHSLGVVHRDLKPEXXXXXXXX-------------------XXXXADFGM 175
           F+Q++ G+ Y H   ++HRD+KPE                               ADFG+
Sbjct: 309 FKQLLTGLKYLHEQNIIHRDIKPENVLLNITRRKNSSQVQLGPWDEDEIDIQVKIADFGL 368

Query: 176 AALESEDKLLETSCGSPHYAAPEIISGLPYEGFSS--DVWSCGVILFALLTGRLPFDEED 233
           A    E +   T CG+P Y APE+++    +G++S  D+WS GVIL+  L G  PF ++ 
Sbjct: 369 AKFTGEMQFTNTLCGTPSYVAPEVLTK---KGYTSKVDLWSAGVILYVCLCGFPPFSDQL 425

Query: 234 G--NIRNLLLKVQKGEFEMPDDDEITKEAQDLLARLLTVDPSKRITIREILKHPLLQ 288
           G  +++  +L+  K  F  P  D+I      L++ LL ++P +R  I + + HP  +
Sbjct: 426 GPPSLKEQILQA-KYAFYSPYWDKIDDSVLHLISNLLVLNPDERYNIDDAMNHPWFK 481

>KAFR0I02010 Chr9 complement(411589..412887) [1299 bp, 432 aa] {ON}
           Anc_1.374 YFR014C
          Length = 432

 Score =  139 bits (350), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 92/278 (33%), Positives = 147/278 (52%), Gaps = 21/278 (7%)

Query: 18  GPWKLGETLGSGSTGKVLLASNETTKQQAAVKVISKAVFEAMNNSESNGDATNALPYNIE 77
           G +  G+TLG+G+ G V  A   +T +  AVK+I K   +         D    + Y+  
Sbjct: 37  GNYTFGKTLGAGTFGVVRQARKVSTDEDVAVKIILKKALKG-------NDIQLQMLYD-- 87

Query: 78  QEIIIMKLLNHPNVLRLFDVWETNSDLYLVLEYAEKGELFNMLVERGPLPENEAVRAFRQ 137
            E+ I++ L+HPN++   D +E+    Y+V + A  GELF+ ++ +G   E +AV+   Q
Sbjct: 88  -ELSILQHLSHPNIVEFKDWFESRDKFYIVTQLAIGGELFDRILSKGKFTELDAVKIVVQ 146

Query: 138 IIIGISYCHSLGVVHRDLKPEXXXXXXXXXXX---XADFGMA-ALESEDKLLETSCGSPH 193
           I+  I Y HS  VVHRDLKPE               ADFG+A  L++++ L+  + GS  
Sbjct: 147 ILGAIEYMHSQDVVHRDLKPENVLYVDNSDSSPIVIADFGIAKKLKNKNDLIFKAAGSLG 206

Query: 194 YAAPEIISGLPYEGFSSDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQKGEFEM--- 250
           Y APE+++   + G   D+WS GVI + LL G   F  E   +   L +  + +F +   
Sbjct: 207 YVAPEVLTEGGH-GKPCDIWSLGVITYTLLCGYSAFIAE--TVEGFLEECTRSKFPVKFH 263

Query: 251 -PDDDEITKEAQDLLARLLTVDPSKRITIREILKHPLL 287
            P  D I+ EA++ + R LT++P +R T  E+L+ P +
Sbjct: 264 KPYWDNISDEAKNFILRSLTLNPDERPTATELLEDPWI 301

>Suva_15.155 Chr15 complement(267680..269038) [1359 bp, 452 aa] {ON}
           YOL016C (REAL)
          Length = 452

 Score =  139 bits (351), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 94/300 (31%), Positives = 148/300 (49%), Gaps = 25/300 (8%)

Query: 20  WKLGETLGSGSTGKVLLASNETTKQQAAVKVISKAVFEAMNNSESNGDATNALPYNIEQE 79
           +  G TLG+GS G V  A   +T +  A+K++ K   +  NN +            + +E
Sbjct: 47  YIFGRTLGAGSFGVVRQARKLSTNEDVAIKILLKKALQG-NNIQLQ---------MLYEE 96

Query: 80  IIIMKLLNHPNVLRLFDVWETNSDLYLVLEYAEKGELFNMLVERGPLPENEAVRAFRQII 139
           + I++ L+HPN++   D +E+    Y+V + A  GELF+ ++ RG   E +AV    QI+
Sbjct: 97  LSILQKLSHPNIVSFKDWFESKDKFYIVTQLATGGELFDRILSRGKFTEIDAVEIIVQIL 156

Query: 140 IGISYCHSLGVVHRDLKPEXXXXXXXXXXX---XADFGMA-ALESEDKLLETSCGSPHYA 195
             + Y HS  VVHRDLKPE               ADFG+A  L+ ++ L+  + GS  Y 
Sbjct: 157 GAVEYIHSKNVVHRDLKPENVLYVDKSDNSPLVIADFGIAKQLKGKEDLIYKAAGSLGYV 216

Query: 196 APEIISGLPYEGFSSDVWSCGVILFALLTGRLPFDEE--DGNIRNLLLKVQKGEFEMPDD 253
           APE+++   + G   D+WS GVI + LL G  PF  E  +G +           F MP  
Sbjct: 217 APEVLTQDGH-GKPCDIWSVGVITYTLLCGYSPFIAESVEGFMEECTASRYPVTFHMPYW 275

Query: 254 DEITKEAQDLLARLLTVDPSKRITIREILKHPLLQK--------YPSIKDSRSIRNLPRE 305
           D I+ +A+  + + L ++P+ R T  E+L  P +           P +K   S+R   R+
Sbjct: 276 DNISVDAKRFILKALILNPADRPTATELLDDPWITSKRVETSNILPDVKKGFSLRKKLRD 335

>YOL016C Chr15 complement(294777..296120) [1344 bp, 447 aa] {ON}
           CMK2Calmodulin-dependent protein kinase; may play a role
           in stress response, many CA++/calmodulan dependent
           phosphorylation substrates demonstrated in vitro, amino
           acid sequence similar to Cmk1p and mammalian Cam Kinase
           II
          Length = 447

 Score =  139 bits (351), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 93/300 (31%), Positives = 145/300 (48%), Gaps = 25/300 (8%)

Query: 20  WKLGETLGSGSTGKVLLASNETTKQQAAVKVISKAVFEAMNNSESNGDATNALPYNIEQE 79
           +  G TLG+GS G V  A   +T +  A+K++ K   +            N     + +E
Sbjct: 47  YIFGRTLGAGSFGVVRQARKLSTNEDVAIKILLKKALQG----------NNVQLQMLYEE 96

Query: 80  IIIMKLLNHPNVLRLFDVWETNSDLYLVLEYAEKGELFNMLVERGPLPENEAVRAFRQII 139
           + I++ L+HPN++   D +E+    Y+V + A  GELF+ ++ RG   E +AV    QI+
Sbjct: 97  LSILQKLSHPNIVSFKDWFESKDKFYIVTQLATGGELFDRILSRGKFTEVDAVEIIVQIL 156

Query: 140 IGISYCHSLGVVHRDLKPEXXXXXXXXXXX---XADFGMA-ALESEDKLLETSCGSPHYA 195
             + Y HS  VVHRDLKPE               ADFG+A  L+ E+ L+  + GS  Y 
Sbjct: 157 GAVEYMHSKNVVHRDLKPENVLYVDKSENSPLVIADFGIAKQLKGEEDLIYKAAGSLGYV 216

Query: 196 APEIISGLPYEGFSSDVWSCGVILFALLTGRLPFDEE--DGNIRNLLLKVQKGEFEMPDD 253
           APE+++   + G   D+WS GVI + LL G  PF  E  +G +           F MP  
Sbjct: 217 APEVLTQDGH-GKPCDIWSIGVITYTLLCGYSPFIAESVEGFMEECTASRYPVTFHMPYW 275

Query: 254 DEITKEAQDLLARLLTVDPSKRITIREILKHPLLQK--------YPSIKDSRSIRNLPRE 305
           D I+ + +  + + L ++P+ R T  E+L  P +           P +K   S+R   R+
Sbjct: 276 DNISIDVKRFILKALRLNPADRPTATELLDDPWITSKRVETSNILPDVKKGFSLRKKLRD 335

>Kwal_56.23717 s56 complement(674222..676798) [2577 bp, 858 aa] {ON}
           YDR122W (KIN1) - Serine/threonine protein kinase [contig
           174] PARTIAL
          Length = 858

 Score =  144 bits (363), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 66/186 (35%), Positives = 110/186 (59%), Gaps = 4/186 (2%)

Query: 104 LYLVLEYAEKGELFNMLVERGPLPENEAVRAFRQIIIGISYCHSLGVVHRDLKPEXXXXX 163
            Y++ EY   G+L + +++ G L E  A +  R I   + Y H   +VHRDLK E     
Sbjct: 8   FYMLFEYVSGGQLLDYIIQHGSLRERSARKFARGIASALQYLHMNNIVHRDLKIENIMIS 67

Query: 164 XXXXXXXADFGMAALESEDKLLETSCGSPHYAAPEIISGLPYEGFSSDVWSCGVILFALL 223
                   DFG++ + +  K L T CGS ++AAPE++   PY G   DVWS GV+LF L+
Sbjct: 68  TSGEIKIIDFGLSNMYNPKKQLHTFCGSLYFAAPELLKACPYTGPEVDVWSFGVVLFVLV 127

Query: 224 TGRLPFDEEDGNIRNLLLKVQKGEFEMPDDDEITKEAQDLLARLLTVDPSKRITIREILK 283
            G++PFD+E+ ++  L  K+++G+ E P    ++ E   LL+++L VDP+KR ++++++ 
Sbjct: 128 CGKVPFDDENSSV--LHEKIKQGKVEYP--QHLSIEVISLLSKMLVVDPTKRASLKQVVN 183

Query: 284 HPLLQK 289
           H  +Q+
Sbjct: 184 HQWMQR 189

>KLLA0F11143g Chr6 complement(1026129..1028570) [2442 bp, 813 aa]
           {ON} similar to uniprot|P22216 Saccharomyces cerevisiae
           YPL153C RAD53 Protein kinase required for cell-cycle
           arrest in response to DNA damage activated by trans
           autophosphorylation when interacting with
           hyperphosphorylated Rad9p
          Length = 813

 Score =  143 bits (360), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 82/275 (29%), Positives = 147/275 (53%), Gaps = 27/275 (9%)

Query: 26  LGSGSTGKVLLASNETTKQQAAVKVISKAVFEAMNNSESNGDATNALPYNIEQEIIIMKL 85
           +G G+   V  A   +T +  AVK+I K   + M+  +            +++E+ +++ 
Sbjct: 198 VGQGAFATVKKAVERSTGKTFAVKIIHKR--KVMDKFDG-----------VKRELDVLQK 244

Query: 86  LNHPNVLRLFDVWETNSDLYLVLEYAEKGELFNMLVERGPLPENEAVRAFRQIIIGISYC 145
           LNHP +++L D +E N + Y+++E+   G+L + +   G + E+      RQ++  + Y 
Sbjct: 245 LNHPRIVKLKDFFEDNDNYYMLMEFVSGGDLMDFVAAHGTVGEDAGREITRQVLEAVKYM 304

Query: 146 HSLGVVHRDLKPEXXXXXXX--XXXXXADFGMAALESEDKLLETSCGSPHYAAPEIISGL 203
           H  G+ HRDLKP+               DFG+A +++++  L T CG+  Y APE+I G 
Sbjct: 305 HDQGISHRDLKPDNIMIEQDDPVLIKITDFGLAKVQNQNTFLNTFCGTLAYVAPEVIDGK 364

Query: 204 PYEG------FSS--DVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQKGEF-EMP-DD 253
             E       +SS  D+WS G +++ +LTG LPF  +  N   L  ++++G + E P  D
Sbjct: 365 NAEDKTNRDLYSSLVDMWSIGCLVYVILTGHLPFSGQSQN--ELFKQIKRGSYHEGPLKD 422

Query: 254 DEITKEAQDLLARLLTVDPSKRITIREILKHPLLQ 288
             I++EA++ +  LL VDP +R+   + L+HP ++
Sbjct: 423 YRISEEARNFIDCLLNVDPKERMNAGKALQHPWMK 457

>SAKL0E05984g Chr5 complement(485895..487391,487462..487482) [1518
           bp, 505 aa] {ON} similar to uniprot|P39009 Saccharomyces
           cerevisiae YDL101C DUN1 Cell-cycle checkpoint
           serine-threonine kinase required for DNA damage-induced
           transcription of certain target genes phosphorylation of
           Rad55p and Sml1p and transient G2/M arrest after DNA
           damage also regulates postreplicative DNA repair
          Length = 505

 Score =  139 bits (350), Expect = 6e-34,   Method: Compositional matrix adjust.
 Identities = 89/291 (30%), Positives = 141/291 (48%), Gaps = 39/291 (13%)

Query: 23  GETLGSGSTGKVLLASNETTKQQAAVKVISKAVFEAMNNSESNGDATNALPYNIEQEIII 82
           G+ LG+G    V  A N+ T Q AAVK+          + + N D      +  E +I++
Sbjct: 192 GKELGTGHYAVVKEAINKETGQIAAVKIF---------HPQQNDDQKKTKQFRDETKILM 242

Query: 83  MKLLNHPNVLRLFD-----VWETNSDLYLVLEYAEKGELFNMLVERGPLPENEAVRAFRQ 137
              + H N+++L D     V +++   YLVLE    GELF+ +V +  L ++E    F+Q
Sbjct: 243 R--IQHKNIVKLLDRFVEPVSKSHIQTYLVLEKINDGELFDRIVRKTKLEQDETRAIFKQ 300

Query: 138 IIIGISYCHSLGVVHRDLKPEXXXXXXXXXXXX-------------------ADFGMAAL 178
           ++ G+ Y HS  ++HRD+KPE                               ADFG+A  
Sbjct: 301 LLNGLKYLHSENIIHRDIKPENILLSIQKRKSSEEKCLGPWDRDEIDIKVKIADFGLAKF 360

Query: 179 ESEDKLLETSCGSPHYAAPEIISGLPYEGFSSDVWSCGVILFALLTGRLPFDEEDG--NI 236
             E K   T CG+P Y APE+++   Y     D+WS GV+L+  L G  PF E+    ++
Sbjct: 361 TGEMKFTNTLCGTPSYVAPEVLTKTGYTA-KVDMWSAGVLLYVCLCGFPPFSEQLSPPSM 419

Query: 237 RNLLLKVQKGEFEMPDDDEITKEAQDLLARLLTVDPSKRITIREILKHPLL 287
           +  +L+  K  F  P  DEI   A  L++ LL V+P++R ++ + + HP  
Sbjct: 420 KEQILQ-GKYAFYSPYWDEIDDSALHLISNLLVVNPAQRFSVNDTINHPWF 469

>Smik_15.153 Chr15 complement(261920..263248) [1329 bp, 442 aa] {ON}
           YOL016C (REAL)
          Length = 442

 Score =  138 bits (347), Expect = 6e-34,   Method: Compositional matrix adjust.
 Identities = 92/300 (30%), Positives = 147/300 (49%), Gaps = 25/300 (8%)

Query: 20  WKLGETLGSGSTGKVLLASNETTKQQAAVKVISKAVFEAMNNSESNGDATNALPYNIEQE 79
           +  G TLG+GS G V  A   +T +  A+K++ K   +            N     + +E
Sbjct: 47  YIFGRTLGAGSFGVVRQARKLSTNEDVAIKILLKKALQG----------NNVQLQMLYEE 96

Query: 80  IIIMKLLNHPNVLRLFDVWETNSDLYLVLEYAEKGELFNMLVERGPLPENEAVRAFRQII 139
           + I++ L+HPN++   D +E+    Y+V + A  GELF+ ++ RG   E +AV    QI+
Sbjct: 97  LSILQKLSHPNIVSFKDWFESKDKFYIVTQLATGGELFDRILSRGKFTEVDAVEIVVQIL 156

Query: 140 IGISYCHSLGVVHRDLKPEXXXXXXXXXXX---XADFGMA-ALESEDKLLETSCGSPHYA 195
             + Y HS  VVHRDLKPE               ADFG+A  L+ ++ L+  + GS  Y 
Sbjct: 157 GAVEYMHSKNVVHRDLKPENVLYVDKSENSPLVIADFGIAKQLKGKEDLIYKAAGSLGYV 216

Query: 196 APEIISGLPYEGFSSDVWSCGVILFALLTGRLPFDEE--DGNIRNLLLKVQKGEFEMPDD 253
           APE+++   + G   D+WS GVI + LL G  PF  E  +G +           F +P  
Sbjct: 217 APEVLTQDGH-GKPCDIWSIGVITYTLLCGYSPFIAESVEGFMEECTASRYPVTFHIPYW 275

Query: 254 DEITKEAQDLLARLLTVDPSKRITIREILKHPLLQK--------YPSIKDSRSIRNLPRE 305
           D I+ +A+  + + L ++P++R T  E+L  P +           P +K   S+R   R+
Sbjct: 276 DNISIDAKRFILKALRLNPTERPTATELLDDPWITSKRIGTSNILPDVKKGFSLRKKLRD 335

>NCAS0D02100 Chr4 (385878..388058) [2181 bp, 726 aa] {ON} Anc_6.31
          Length = 726

 Score =  141 bits (356), Expect = 8e-34,   Method: Compositional matrix adjust.
 Identities = 85/267 (31%), Positives = 141/267 (52%), Gaps = 20/267 (7%)

Query: 20  WKLGETLGSGSTGKVLLASNETTKQQAAVKVISKAVFEAMNNSESNGDATNALPYNIEQE 79
           ++ G  LG G   +     +E+ K  AA  V   ++       +               E
Sbjct: 92  YRRGHFLGEGGFARCFQIKDESGKIFAAKTVAKISIKTEKTKKKL------------LSE 139

Query: 80  IIIMKLLNHPNVLRLFDVWETNSDLYLVLEYAEKGELFNMLVERGPLPENEAVRAFRQII 139
           I I K + HPN++   D +E ++++Y++LE    G L +++ +R  L E E VR F   I
Sbjct: 140 IQIHKSMKHPNIVHFVDCFEDDTNVYILLEICSNGSLMDLMKKRKTLTEPE-VRFFTTQI 198

Query: 140 IG-ISYCHSLGVVHRDLKPEXXXXXXXXXXXXADFGMAALESEDKLLE-TSCGSPHYAAP 197
            G + Y HS  V+HRDLK               DFG+AA+ + ++  + T CG+P+Y AP
Sbjct: 199 CGAVKYMHSRRVIHRDLKLGNIFFDKDYNLKVGDFGLAAVLANNRERKYTVCGTPNYIAP 258

Query: 198 EIISGLPYEG--FSSDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQKGEFEMPDDDE 255
           E++ G  + G  F  D+WS GV+++ALL G+ PF  +D N+  +  +++  ++  P D  
Sbjct: 259 EVLMG-KHAGHSFEVDIWSIGVMIYALLVGKPPFQAKDVNV--IYDRIKACQYGYPKDKY 315

Query: 256 ITKEAQDLLARLLTVDPSKRITIREIL 282
           ++ EA+ L+A +L VDP +R +IREI+
Sbjct: 316 VSSEAKTLIADILCVDPVERPSIREII 342

>KAFR0K00280 Chr11 complement(64906..65988) [1083 bp, 360 aa] {ON}
           Anc_6.222 YPL209C
          Length = 360

 Score =  135 bits (340), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 72/232 (31%), Positives = 123/232 (53%), Gaps = 5/232 (2%)

Query: 58  AMNNSESNGDATNALPYNIEQEIIIMKLLNHPNVLRLFDVWETNSDLYLVLEYAEKGELF 117
           A+   E N      L   + +EI I  +LNHPN+ +L+  +     +Y+V+EY  +GEL+
Sbjct: 129 ALKAMEKNEIIQYNLQKQVRREIEIQTILNHPNLTKLYSFFHDEKRIYIVMEYLIQGELY 188

Query: 118 NMLVERGPLPENEAVRAFRQIIIGISYCHSLGVVHRDLKPEXXXXXXXXXXXXADFGMAA 177
            +L   GP  +  A     QI   + Y H   ++HRD+KPE             DFG + 
Sbjct: 189 KLLQSHGPFNDVLASNYVYQIADALDYLHQKHIIHRDIKPENILIGFNNTVKLTDFGWSI 248

Query: 178 LESEDKLLETSCGSPHYAAPEIISGLPYEGFSSDVWSCGVILFALLTGRLPFDEEDGNIR 237
           +  +    +T CG+  Y +PEII+   Y+  + D+W+ GV+ + L+ G   F+EE   + 
Sbjct: 249 INPKGIRRKTLCGTIDYLSPEIITSKEYD-HTVDIWALGVLAYELVVGSPAFEEETKEMT 307

Query: 238 NLLLKVQKGEFEMPDDDEITKEAQDLLARLLTVDPSKRITIREILKHPLLQK 289
               ++ KGE + P  + +    +DL+ R+L ++PSKR++++EI +HP + K
Sbjct: 308 --YKRIVKGELKFP--EHLPNIVRDLIQRILVIEPSKRMSLKEIKRHPWILK 355

>Skud_4.154 Chr4 complement(275783..277324) [1542 bp, 513 aa] {ON}
           YDL101C (REAL)
          Length = 513

 Score =  138 bits (348), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 90/297 (30%), Positives = 145/297 (48%), Gaps = 43/297 (14%)

Query: 20  WKLGETLGSGSTGKVLLASNETTKQQAAVKVISKAVFEAMNNSESNGDATNALPYNIEQE 79
           + LG+ LG+G    V  A N+ + QQ AVK+     F A  N +   +          +E
Sbjct: 200 YLLGKELGAGHYALVKEAKNKKSGQQVAVKI-----FHAQQNDDQKKNK------QFREE 248

Query: 80  IIIMKLLNHPNVLRLFD-----VWETNSDLYLVLEYAEKGELFNMLVERGPLPENEAVRA 134
             I+  ++HPN++ L D     + ++    YLVLE  + GELF  +V +  L ++E+   
Sbjct: 249 TNILMRVHHPNIVNLLDSFVEPISKSQIQKYLVLEKIDDGELFERIVRKTCLRQDESKAL 308

Query: 135 FRQIIIGISYCHSLGVVHRDLKPEXXXXXXX-------------------XXXXXADFGM 175
           F+Q++ G+ Y H   ++HRD+KPE                               ADFG+
Sbjct: 309 FKQLLTGLKYLHEQNIIHRDIKPENILLNITRRENSNQAQLGPWDEDEIDIQVKIADFGL 368

Query: 176 AALESEDKLLETSCGSPHYAAPEIISGLPYEGFSS--DVWSCGVILFALLTGRLPFDEED 233
           A    E +   T CG+P Y APE+++    +G+SS  D+WS GVIL+  L G  PF ++ 
Sbjct: 369 AKFTGEMQFTNTLCGTPSYVAPEVLTK---KGYSSKVDLWSAGVILYVCLCGFPPFSDQL 425

Query: 234 G--NIRNLLLKVQKGEFEMPDDDEITKEAQDLLARLLTVDPSKRITIREILKHPLLQ 288
           G  +++  +L+  K  F  P  D+I      L++ LL ++P +R  I E + HP  +
Sbjct: 426 GPPSLKEQILQA-KYAFYSPYWDKIDDLVLHLISNLLVLNPDERYNIDEAMDHPWFK 481

>SAKL0H06534g Chr8 complement(575439..577853) [2415 bp, 804 aa] {ON}
           similar to uniprot|P22216 Saccharomyces cerevisiae
           YPL153C RAD53 Protein kinase required for cell-cycle
           arrest in response to DNA damage activated by trans
           autophosphorylation when interacting with
           hyperphosphorylated Rad9p
          Length = 804

 Score =  140 bits (354), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 85/279 (30%), Positives = 144/279 (51%), Gaps = 30/279 (10%)

Query: 24  ETLGSGSTGKVLLASNETTKQQAAVKVISKAVFEAMNNSESNGDATNALPYNIEQEIIIM 83
           E +G G+   V  A    T +  AVK+ISK   + M N +            + +E+ ++
Sbjct: 192 EVVGQGAFAIVKKAVERKTGKTFAVKIISKR--KVMGNIDG-----------VTRELEVL 238

Query: 84  KLLNHPNVLRLFDVWETNSDLYLVLEYAEKGELFNMLVERGPLPENEAVRAFRQIIIGIS 143
           + LNHP ++RL   +E +   YL++E+   G+L + +   G + E+      +Q++  + 
Sbjct: 239 RRLNHPRIVRLKGFYEDDESYYLLMEFVSGGDLMDFVAAHGSVGEDAGREITKQVLEAVK 298

Query: 144 YCHSLGVVHRDLKPEXXXXXXX--XXXXXADFGMAALESEDKLLETSCGSPHYAAPEIIS 201
           Y H +G+ HRDLKP+               DFG+A ++     ++T CG+  Y APE+IS
Sbjct: 299 YIHGMGISHRDLKPDNILIEQDDPVMVKITDFGLAKIQGNGTFMKTFCGTLAYVAPEVIS 358

Query: 202 GLPYEG-------FSS--DVWSCGVILFALLTGRLPFDEEDGNIRNLLLK-VQKGEF-EM 250
           G   E        +SS  D+WS G +++ +LTG LPF    G+ ++ L K + +G + E 
Sbjct: 359 GKNSEDKSQNKNKYSSLVDMWSIGCLVYVILTGHLPF---SGSTQDQLYKQISRGSYHEG 415

Query: 251 P-DDDEITKEAQDLLARLLTVDPSKRITIREILKHPLLQ 288
           P  D  I+ EA++ +  LL V+P  R+T  + L HP ++
Sbjct: 416 PLKDFRISDEARNFIDSLLQVNPKDRLTAEKALDHPWIK 454

>Kwal_56.22476 s56 complement(145039..147132) [2094 bp, 697 aa] {ON}
           YMR001C (CDC5) - protein kinase which functions at the
           G(sub)2/M boundary [contig 185] FULL
          Length = 697

 Score =  140 bits (352), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 95/308 (30%), Positives = 162/308 (52%), Gaps = 22/308 (7%)

Query: 1   MSAISSNTVSVIKNNQIGPWKLGETLGSGSTGKVLLASNETTKQQAAVKVISKAVFEAMN 60
           +SA+     S+IK      +  G  LG G   +     ++  K  AA K ++K   ++  
Sbjct: 61  LSALCKTPPSLIKTRG-RDYHRGHFLGEGGFARCFQIKDDGGKIFAA-KTVAKISIKSEK 118

Query: 61  NSESNGDATNALPYNIEQEIIIMKLLNHPNVLRLFDVWETNSDLYLVLEYAEKGELFNML 120
             +            +  EI I K + H N+++  D +E ++++Y++LE    G L ++L
Sbjct: 119 TRK-----------KLLSEIQIHKSMRHTNIVQFVDCFEDDTNVYILLEICPNGSLMDLL 167

Query: 121 VERGPLPENEAVRAFRQIIIG-ISYCHSLGVVHRDLKPEXXXXXXXXXXXXADFGMAALE 179
             R  L E E VR F   I+G + Y HS  V+HRDLK               DFG+AA+ 
Sbjct: 168 KRRKMLTEPE-VRFFTTQIVGAVKYMHSRRVIHRDLKLGNIFFDKHYNLKVGDFGLAAVL 226

Query: 180 SEDKLLE-TSCGSPHYAAPEIISGLPYEGFSS--DVWSCGVILFALLTGRLPFDEEDGNI 236
           + D+  + T CG+P+Y APE+++G  + G S   D+WSCGV+++ALL G+ PF  ++ NI
Sbjct: 227 ANDRERKYTVCGTPNYIAPEVLTG-KHTGHSYEVDIWSCGVMIYALLIGKPPFQAKEVNI 285

Query: 237 RNLLLKVQKGEFEMPDDDEITKEAQDLLARLLTVDPSKRITIREILKHPLLQK-YPSIKD 295
             +  +++ G+F  P D  I+ EA  L+  +L++DP +R ++ EI+ +   +  +PS  D
Sbjct: 286 --IYERIKCGDFVFPKDKFISPEALVLIKDILSIDPLERPSLDEIIDYVWFRGLFPSRID 343

Query: 296 SRSIRNLP 303
           +  + + P
Sbjct: 344 ASVLTSAP 351

>NDAI0F01600 Chr6 complement(392424..393662) [1239 bp, 412 aa] {ON} 
          Length = 412

 Score =  135 bits (340), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 71/227 (31%), Positives = 125/227 (55%), Gaps = 9/227 (3%)

Query: 67  DATNALPYNIEQ----EIIIMKLLNHPNVLRLFDVWETNSDLYLVLEYAEKGELFNMLVE 122
           D +  + YN+++    E+ I   LNHPN+ +L+  +  +  +YL++EY   GEL+ +L  
Sbjct: 186 DKSEIIQYNLQRQFRREVEIQTSLNHPNLTKLYGHFYDDKRVYLIMEYLVYGELYKLLRS 245

Query: 123 RGPLPENEAVRAFRQIIIGISYCHSLGVVHRDLKPEXXXXXXXXXXXXADFGMAALESED 182
            GP  +  A R   QI   +++ H  G++HRDLKPE             DFG + +  + 
Sbjct: 246 HGPFNDIIASRFVYQIADALNHLHEKGIIHRDLKPENILIGFNNVLKLTDFGWSIINPKG 305

Query: 183 KLLETSCGSPHYAAPEIISGLPYEGFSSDVWSCGVILFALLTGRLPFDEEDGNIRNLLLK 242
              +T CG+  Y +PE+I    Y+  + DVW+ GV+ + L+ G  PF+E+   +     +
Sbjct: 306 VKRKTLCGTIDYLSPEMIRSREYDD-TVDVWALGVLTYELVAGDPPFEEDSKEL--TYKR 362

Query: 243 VQKGEFEMPDDDEITKEAQDLLARLLTVDPSKRITIREILKHPLLQK 289
           + KGE   P    ++++ +DL++RLL  DP +RI ++E++ HP + +
Sbjct: 363 ILKGEIRFP--GTVSQDVRDLISRLLKNDPKERILLKEVMVHPWIMR 407

>Kwal_26.8796 s26 (946406..948796) [2391 bp, 796 aa] {ON} YPL153C
           (RAD53) - protein kinase, Mec1p and Tel1p regulate
           rad53p phosphorylation [contig 68] FULL
          Length = 796

 Score =  140 bits (353), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 89/278 (32%), Positives = 142/278 (51%), Gaps = 30/278 (10%)

Query: 24  ETLGSGSTGKVLLASNETTKQQAAVKVISK-AVFEAMNNSESNGDATNALPYNIEQEIII 82
           E +G G+   V  A    T +  AVK+ISK  V   M+               + +E+ +
Sbjct: 192 EVVGQGAFATVKKAIERKTGKTHAVKIISKRKVVGVMDG--------------VARELEV 237

Query: 83  MKLLNHPNVLRLFDVWETNSDLYLVLEYAEKGELFNMLVERGPLPENEAVRAFRQIIIGI 142
           ++ L+HP ++ L   +E     YLV+E+   G+L + +   G + E+      RQI+  +
Sbjct: 238 LQRLDHPRIVSLKGFYEDKDSHYLVMEFVSGGDLMDFVAAHGSVGEDAGREITRQILEAV 297

Query: 143 SYCHSLGVVHRDLKPEXXXXXXX--XXXXXADFGMAALESEDKLLETSCGSPHYAAPEII 200
            Y HS+G+ HRDLKP+               DFG+A ++     ++T CG+  Y APE+I
Sbjct: 298 KYIHSMGISHRDLKPDNILIERDDPVLVKITDFGLAKIQGNGTFMKTFCGTLAYVAPEVI 357

Query: 201 SGL---PYEG--FSS--DVWSCGVILFALLTGRLPFDEEDGNIRNLLLK-VQKGEF-EMP 251
           SG      EG  +SS  D+WS G +++ +LTG LPF    G+ +N L K +  G + E P
Sbjct: 358 SGKNSGEKEGNTYSSLVDMWSIGCLVYVILTGHLPF---SGSTQNDLYKQITAGSYHEGP 414

Query: 252 -DDDEITKEAQDLLARLLTVDPSKRITIREILKHPLLQ 288
             D  I+ +A+D +   L VDP  R+T  + L+HP ++
Sbjct: 415 LKDYRISDDARDFIESFLQVDPRNRMTAEQALRHPWIK 452

>KLLA0E01585g Chr5 (149305..149370,149488..150960) [1539 bp, 512 aa]
           {ON} similar to uniprot|P39009 Saccharomyces cerevisiae
           YDL101C DUN1 Cell-cycle checkpoint serine-threonine
           kinase required for DNA damage-induced transcription of
           certain target genes phosphorylation of Rad55p and Sml1p
           and transient G2/M arrest after DNA damage also
           regulates postreplicative DNA repair
          Length = 512

 Score =  137 bits (345), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 92/293 (31%), Positives = 138/293 (47%), Gaps = 43/293 (14%)

Query: 23  GETLGSGSTGKVLLASNETTKQQAAVKVISKAVFEAMNNSESNGDATNALPYNIEQEIII 82
           G+ LG+G    V  A N+ T +  AVK+          + + N D      +  E +I++
Sbjct: 201 GKELGTGHYAIVKEARNKETGETVAVKIF---------HPQQNDDDKRTKKFTEETKILL 251

Query: 83  MKLLNHPNVLRLFD-----VWETNSDLYLVLEYAEKGELFNMLVERGPLPENEAVRAFRQ 137
              + HPN+++L D     V +T    YLVLE    GELF  +V +  L E+E    FRQ
Sbjct: 252 S--IQHPNIVKLIDRFVEPVSKTQIQTYLVLEKINDGELFERIVRKNNLREDETKALFRQ 309

Query: 138 IIIGISYCHSLGVVHRDLKPEXXXXXXXX-------------------XXXXADFGMAAL 178
           ++ G+ Y HS  ++HRD+KPE                               ADFG+A  
Sbjct: 310 LLNGLKYLHSRNIIHRDIKPENILLSISKRRSPEEIALGPWDDDELDIQVKIADFGLAKF 369

Query: 179 ESEDKLLETSCGSPHYAAPEIISGLPYEGFSS--DVWSCGVILFALLTGRLPFDEEDG-- 234
             E K   T CG+P Y APE+   L   G++S  D+WS GV+L+  L G  PF E+    
Sbjct: 370 TGEMKFTNTLCGTPSYVAPEV---LVKTGYTSRVDMWSAGVLLYVCLCGFPPFSEQLAPP 426

Query: 235 NIRNLLLKVQKGEFEMPDDDEITKEAQDLLARLLTVDPSKRITIREILKHPLL 287
           +++  +L+  K  F  P  D I      L++ LL V+P+ R ++ + L HP  
Sbjct: 427 SMKEQILQ-GKFAFYSPYWDNIDDSVLHLISNLLVVNPASRFSVNDALTHPWF 478

>TBLA0B00490 Chr2 complement(94755..97118) [2364 bp, 787 aa] {ON}
           Anc_6.31 YMR001C
          Length = 787

 Score =  140 bits (352), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 97/318 (30%), Positives = 161/318 (50%), Gaps = 26/318 (8%)

Query: 20  WKLGETLGSGSTGKVLLASNETTKQQAAVKVISKAVFEAMNNSESNGDATNALPYNIEQE 79
           ++ G+ LG G   +     +E+ K  AA  V   ++             T      +  E
Sbjct: 142 YRRGQFLGEGGFARCFQIKDESGKIFAAKTVAKISI------------KTEKTRRKLLSE 189

Query: 80  IIIMKLLNHPNVLRLFDVWETNSDLYLVLEYAEKGELFNMLVERGPLPENEAVRAFR-QI 138
           I I K + H N+++  D +E + ++Y++L     G L  +L +R  L E E VR F  QI
Sbjct: 190 IQIHKSMKHQNIVQFVDCFEDHINVYILLGMCPNGSLMELLKKRKILTEPE-VRFFTVQI 248

Query: 139 IIGISYCHSLGVVHRDLKPEXXXXXXXXXXXXADFGMAALESEDKLLE-TSCGSPHYAAP 197
              I Y HS  V+HRDLK               DFG+AA+ + D+  + T CG+P+Y AP
Sbjct: 249 CGAIKYMHSRRVIHRDLKLGNIFFDENYNLKIGDFGLAAVLANDRERKYTVCGTPNYIAP 308

Query: 198 EII----SGLPYEGFSSDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQKGEFEMPDD 253
           E++    SG  YE    D+WS GV++FALL G+ PF  +D N   +  +++  E+  P +
Sbjct: 309 EVLLGKHSGHSYE---VDIWSIGVMIFALLIGKPPFQAKDVN--TIYSRIKNSEYTFPIN 363

Query: 254 DEITKEAQDLLARLLTVDPSKRITIREILKHPLLQ-KYPSIKDSRSIRNLPREDTYLSPL 312
             I++EA+ L+  +L  DP  R +I EI+++   +  +PS+  +     +P  D +L+P 
Sbjct: 364 KSISQEAKTLIQDILINDPIARPSINEIMEYVWFRGTFPSMTSNTVFTEIPEYDQFLTPN 423

Query: 313 ADTNSKIDDAILQNLVIL 330
              N+   + ++Q+ +IL
Sbjct: 424 ESLNN-FRNCMIQSGLIL 440

>KLTH0C10912g Chr3 (898372..900465) [2094 bp, 697 aa] {ON} highly
           similar to uniprot|P32562 Saccharomyces cerevisiae
           YMR001C
          Length = 697

 Score =  139 bits (350), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 90/288 (31%), Positives = 155/288 (53%), Gaps = 21/288 (7%)

Query: 1   MSAISSNTVSVIKNNQIGPWKLGETLGSGSTGKVLLASNETTKQQAAVKVISKAVFEAMN 60
           +SA+     S+IK      +  G  LG G   +     +++ K  AA K ++K   ++  
Sbjct: 61  LSALCKTPPSLIKTRG-RDYHRGHFLGEGGFARCFQIKDDSGKIFAA-KTVAKISIKSEK 118

Query: 61  NSESNGDATNALPYNIEQEIIIMKLLNHPNVLRLFDVWETNSDLYLVLEYAEKGELFNML 120
             +            +  EI I K + H N+++  D +E ++++Y++LE    G L ++L
Sbjct: 119 TRK-----------KLLSEIQIHKSMRHFNIVQFIDCFEDDTNVYILLEICPNGSLMDLL 167

Query: 121 VERGPLPENEAVRAFRQIIIG-ISYCHSLGVVHRDLKPEXXXXXXXXXXXXADFGMAALE 179
             R  L E E VR F   I+G + Y HS  V+HRDLK               DFG+AA+ 
Sbjct: 168 KRRKVLTEPE-VRFFTTQIVGAVKYMHSRRVIHRDLKLGNIFFDKHYNLKIGDFGLAAVL 226

Query: 180 SEDKLLE-TSCGSPHYAAPEIISGLPYEGFSS--DVWSCGVILFALLTGRLPFDEEDGNI 236
           + D+  + T CG+P+Y APE+++G  + G S   D+WSCGV+++ALL G+ PF  ++ NI
Sbjct: 227 ANDRERKYTVCGTPNYIAPEVLTG-KHTGHSYEVDIWSCGVMIYALLIGKPPFQAKEVNI 285

Query: 237 RNLLLKVQKGEFEMPDDDEITKEAQDLLARLLTVDPSKRITIREILKH 284
             +  +++ G++  P D  I++EA  L+  +L++DP +R ++ EI+ +
Sbjct: 286 --IYERIKCGDYVFPRDKCISQEALTLIRDILSIDPLERPSLDEIIDY 331

>NDAI0E02110 Chr5 complement(430989..433700) [2712 bp, 903 aa] {ON} 
          Length = 903

 Score =  140 bits (353), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 91/286 (31%), Positives = 149/286 (52%), Gaps = 37/286 (12%)

Query: 24  ETLGSGSTGKVLLASNETTKQQAAVKVISKAVFEAMNNSESNGDATNALPYNIEQEIIIM 83
           E +G G+   V  A   +T +  AVK+ISK   + M    SN D        + +E+ ++
Sbjct: 206 EVVGQGAFATVKKAVERSTGKTFAVKIISKR--KVMG---SNMDG-------VSRELEVL 253

Query: 84  KLLNHPNVLRLFDVWETNSDLYLVLEYAEKGELFNMLVERGPLPENEAVRAFRQIIIGIS 143
           + L+HP ++RL   +E + + Y+++E+   G+L + +   G + E+      RQI+  I 
Sbjct: 254 QRLDHPRIVRLKGFYEDHENYYMLMEFVSGGDLMDFVAAHGAVGEDAGREISRQILEAIK 313

Query: 144 YCHSLGVVHRDLKPEXXXXXXX--XXXXXADFGMAALESEDKLLETSCGSPHYAAPEIIS 201
           Y HS+G+ HRDLKP+               DFG+A ++     ++T CG+  Y APEIIS
Sbjct: 314 YIHSMGISHRDLKPDNILIEQDDPVLVKITDFGLAKVQDNGTFMKTFCGTLAYVAPEIIS 373

Query: 202 GLPYEG--------------FSS--DVWSCGVILFALLTGRLPFDEEDGNIRNLLLK-VQ 244
           G   +G              +SS  D+WS G +++ +LTG LPF    G+ +  L K + 
Sbjct: 374 G-KNDGELRENADANSERNEYSSLVDMWSMGCLVYVILTGHLPF---SGSTQKQLYKQIS 429

Query: 245 KGEF-EMP-DDDEITKEAQDLLARLLTVDPSKRITIREILKHPLLQ 288
           +G + E P  D  I+ EA+D +  LL V P+ R+T  + L+HP ++
Sbjct: 430 RGSYHEGPLKDFRISDEARDFIDSLLQVKPNDRLTAEKALEHPWIK 475

>TDEL0A06220 Chr1 (1088622..1091006) [2385 bp, 794 aa] {ON}
           Anc_8.676 YPL153C
          Length = 794

 Score =  140 bits (352), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 86/279 (30%), Positives = 145/279 (51%), Gaps = 30/279 (10%)

Query: 24  ETLGSGSTGKVLLASNETTKQQAAVKVISKAVFEAMNNSESNGDATNALPYNIEQEIIIM 83
           E +G G+   V  A   +T +  A K+ISK   + M N +            + +E+ ++
Sbjct: 197 EVVGQGAFATVKKAVERSTGKTFAAKIISKR--KVMGNMDG-----------VTRELEVL 243

Query: 84  KLLNHPNVLRLFDVWETNSDLYLVLEYAEKGELFNMLVERGPLPENEAVRAFRQIIIGIS 143
           + LNHP ++RL   +E +   YL++E+   G+L + +   G + E+      RQ++ G+ 
Sbjct: 244 RKLNHPKIVRLKGFYEDDEFYYLLMEFVSGGDLMDFVAAHGSVGEDAGREITRQVLEGVK 303

Query: 144 YCHSLGVVHRDLKPEXXXXXXX--XXXXXADFGMAALESEDKLLETSCGSPHYAAPEIIS 201
           Y HS G+ HRDLKP+               DFG+A ++     ++T CG+  Y APE+I+
Sbjct: 304 YIHSQGISHRDLKPDNILIEQDDPVLVKITDFGLAKVQGNGTFMKTFCGTLAYVAPEVIA 363

Query: 202 GLP-------YEGFSS--DVWSCGVILFALLTGRLPFDEEDGNIRNLLLK-VQKGEF-EM 250
           G            +SS  D+WS G +++ +LTG LPF    G+ +  L K ++ G + E 
Sbjct: 364 GKANAEENEKRNEYSSLVDMWSMGCLVYVILTGHLPF---SGSTQEQLYKQIKNGSYHEG 420

Query: 251 P-DDDEITKEAQDLLARLLTVDPSKRITIREILKHPLLQ 288
           P  D  I+ EA+D +  LL V+P+ R T ++ L+HP ++
Sbjct: 421 PLKDFRISDEARDFIDSLLQVNPNARPTAKKALEHPWIK 459

>KLTH0D11242g Chr4 (918232..920619) [2388 bp, 795 aa] {ON} similar
           to uniprot|P22216 Saccharomyces cerevisiae YPL153C RAD53
           Protein kinase required for cell-cycle arrest in
           response to DNA damage activated by trans
           autophosphorylation when interacting with
           hyperphosphorylated Rad9p
          Length = 795

 Score =  140 bits (352), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 85/277 (30%), Positives = 141/277 (50%), Gaps = 28/277 (10%)

Query: 24  ETLGSGSTGKVLLASNETTKQQAAVKVISKAVFEAMNNSESNGDATNALPYNIEQEIIIM 83
           E +G G+   V  A    T +  AVK+I+K   + M N +            + +E+ ++
Sbjct: 192 EVVGQGAFATVKKAIERRTGKTHAVKIINKR--KVMGNMDG-----------VTRELEVL 238

Query: 84  KLLNHPNVLRLFDVWETNSDLYLVLEYAEKGELFNMLVERGPLPENEAVRAFRQIIIGIS 143
           + LNHP ++ L   +E     YLV+E+   G+L + +   G + E+      RQ++  + 
Sbjct: 239 RRLNHPRIVSLKGFYEDKESYYLVMEFVSGGDLMDFVAAHGSVGEDAGREITRQVLEAVK 298

Query: 144 YCHSLGVVHRDLKPEXXXXXXX--XXXXXADFGMAALESEDKLLETSCGSPHYAAPEIIS 201
           Y H++G+ HRDLKP+               DFG+A ++     ++T CG+  Y APE+IS
Sbjct: 299 YIHAMGISHRDLKPDNILIERDDPVLVKITDFGLAKIQDNGTFMKTFCGTLAYVAPEVIS 358

Query: 202 GLPYE-----GFSS--DVWSCGVILFALLTGRLPFDEEDGNIRNLLLK-VQKGEF-EMP- 251
           G   E      +SS  D+WS G +++ +LTG LPF    G+ +  L K +  G + E P 
Sbjct: 359 GKNSEEKEGNKYSSLVDMWSIGCLVYVILTGHLPF---SGSTQQELYKQISAGSYHEGPL 415

Query: 252 DDDEITKEAQDLLARLLTVDPSKRITIREILKHPLLQ 288
            D  I+ +A+D +   L V+P  R+T  + LKHP ++
Sbjct: 416 KDYRISDDARDFIESFLQVNPRDRMTAEQALKHPWIR 452

>TPHA0E02820 Chr5 complement(589816..590970) [1155 bp, 384 aa] {ON}
           Anc_6.222 YPL209C
          Length = 384

 Score =  134 bits (337), Expect = 5e-33,   Method: Compositional matrix adjust.
 Identities = 71/227 (31%), Positives = 123/227 (54%), Gaps = 9/227 (3%)

Query: 67  DATNALPYNIEQ----EIIIMKLLNHPNVLRLFDVWETNSDLYLVLEYAEKGELFNMLVE 122
           D +  L YN+ +    EI I   LNH N+ +L+  +  +  +YL++EY   GEL+++L +
Sbjct: 158 DKSEILTYNVTKQFRNEIEIQSNLNHENLTKLYGFFHDSKRVYLIMEYIYNGELYSILKK 217

Query: 123 RGPLPENEAVRAFRQIIIGISYCHSLGVVHRDLKPEXXXXXXXXXXXXADFGMAALESED 182
            GP  +  A     Q+   I Y H   ++HRDLKPE             DFG +      
Sbjct: 218 NGPFNDIVASNFVFQLTNAIRYLHKKRIIHRDLKPENILIDFNNVIKITDFGWSVYNEAG 277

Query: 183 KLLETSCGSPHYAAPEIISGLPYEGFSSDVWSCGVILFALLTGRLPFDEEDGNIRNLLLK 242
              +T CG+  Y +PE+I+   Y+G   DVW+ G+I + L+ G  PF+E+   +     +
Sbjct: 278 NKRKTLCGTIDYLSPELINSKEYDGL-IDVWALGIIAYELIVGTPPFEEDTKELT--YKR 334

Query: 243 VQKGEFEMPDDDEITKEAQDLLARLLTVDPSKRITIREILKHPLLQK 289
           ++  +   P    ++++A++L++ LL ++PS+RIT+ ++LKHP + K
Sbjct: 335 IKNCDLNFP--AHVSQDAKNLISSLLKLNPSERITLTDVLKHPWINK 379

>Ecym_5624 Chr5 (1256658..1258022) [1365 bp, 454 aa] {ON} similar to
           Ashbya gossypii AFL188C
          Length = 454

 Score =  135 bits (340), Expect = 5e-33,   Method: Compositional matrix adjust.
 Identities = 89/295 (30%), Positives = 140/295 (47%), Gaps = 39/295 (13%)

Query: 23  GETLGSGSTGKVLLASNETTKQQAAVKVISKAVFEAMNNSESNGDATNALPYNIEQEIII 82
           G+ LGSG    V  A N++T +  AVK+          + + N D   A  +  E EI++
Sbjct: 149 GKELGSGHYATVKEAVNKSTGEVVAVKIF---------HPQKNDDIKKARQFREETEILM 199

Query: 83  MKLLNHPNVLRLFD-----VWETNSDLYLVLEYAEKGELFNMLVERGPLPENEAVRAFRQ 137
              ++H N+++L +     V +T    YLVLE    GELF  +V +  L ++E    F+Q
Sbjct: 200 S--IDHVNIVKLLERFVEPVSKTKVQTYLVLEKINDGELFERIVRKTKLRQDETRALFKQ 257

Query: 138 IIIGISYCHSLGVVHRDLKPEXXXXXXXX-------------------XXXXADFGMAAL 178
           I+ G+ Y H   ++HRD+KPE                               ADFG+A  
Sbjct: 258 ILGGLKYLHDKNIIHRDIKPENILLSIRQRKFTDELQLGPWDKNEIDIIVKIADFGLAKF 317

Query: 179 ESEDKLLETSCGSPHYAAPEIISGLPYEGFSSDVWSCGVILFALLTGRLPFDEEDG--NI 236
             E +   T CG+P Y A E++S   Y     D+WS GV+L+  L G  PF ++    ++
Sbjct: 318 TGEMQFTNTLCGTPSYVAAEVLSKAGYTS-KVDLWSAGVLLYVCLCGFPPFSDQLAPPSM 376

Query: 237 RNLLLKVQKGEFEMPDDDEITKEAQDLLARLLTVDPSKRITIREILKHPLLQKYP 291
           +  +L+  K  F  P  D+I     DL++ LL V+P +R ++R+ + HP     P
Sbjct: 377 KEQILR-GKFAFYSPYWDDIDDSVLDLISNLLVVNPDQRFSVRDAIAHPWFDGLP 430

>KAFR0K02450 Chr11 (504087..504131,504190..505680) [1536 bp, 511 aa]
           {ON} 
          Length = 511

 Score =  136 bits (343), Expect = 6e-33,   Method: Compositional matrix adjust.
 Identities = 90/296 (30%), Positives = 140/296 (47%), Gaps = 43/296 (14%)

Query: 20  WKLGETLGSGSTGKVLLASNETTKQQAAVKVISKAVFEAMNNSESNGDATNALPYNIEQE 79
           + LG  LGSG    V    N+ T Q  AVK+          + + N D   +  +  E  
Sbjct: 197 YTLGRELGSGHYAIVKEGKNKQTGQTVAVKIF---------HPQQNDDQKKSKQFREETN 247

Query: 80  IIIMKLLNHPNVLRLFD-----VWETNSDLYLVLEYAEKGELFNMLVERGPLPENEAVRA 134
           I++   ++HPN++ L D     + +  +  YLVLE  + GELF+ +V++  L ++E    
Sbjct: 248 ILMR--IHHPNIVNLLDSFVEPISKQQTQKYLVLEKIDNGELFDRIVKKTCLRQDETKAI 305

Query: 135 FRQIIIGISYCHSLGVVHRDLKPEXXXXXXX-------------------XXXXXADFGM 175
           F QI+ G+ Y H   ++HRD+KPE                               ADFG+
Sbjct: 306 FTQILHGLKYLHGQNIIHRDIKPENILLNITKRTSPDQKQLGPWDDDEIDVQVKIADFGL 365

Query: 176 AALESEDKLLETSCGSPHYAAPEIISGLPYEGFSS--DVWSCGVILFALLTGRLPFDEED 233
           A    E +   T CG+P Y APE+   L  +G++S  D+WS GVIL+  L G  PF ++ 
Sbjct: 366 AKFTGEMQFTNTLCGTPSYVAPEV---LIKKGYTSKVDMWSSGVILYVCLCGFPPFSDQL 422

Query: 234 G--NIRNLLLKVQKGEFEMPDDDEITKEAQDLLARLLTVDPSKRITIREILKHPLL 287
           G   ++  +L+  K  F  P  D I      L++ LL +DP +R ++ +   HP L
Sbjct: 423 GPPALKEQILQA-KFAFYTPYWDNIDDSILHLISHLLVLDPEQRYSVSDAFNHPWL 477

>Kpol_1004.19 s1004 (36090..36101,36217..37689) [1485 bp, 494 aa]
           {ON} (36090..36101,36217..37689) [1485 nt, 495 aa]
          Length = 494

 Score =  136 bits (342), Expect = 6e-33,   Method: Compositional matrix adjust.
 Identities = 86/291 (29%), Positives = 138/291 (47%), Gaps = 39/291 (13%)

Query: 20  WKLGETLGSGSTGKVLLASNETTKQQAAVKVISKAVFEAMNNSESNGDATNALPYNIEQE 79
           + +G+ LGSG    V    N+ T Q  A+K+     F    N +   +      +   +E
Sbjct: 182 YIIGKELGSGHYAIVKEGRNKKTGQSVAIKI-----FHPQLNDDQKKN------HQFREE 230

Query: 80  IIIMKLLNHPNVLRLFDVW-----ETNSDLYLVLEYAEKGELFNMLVERGPLPENEAVRA 134
             I+  ++HPN++ L D +     ++    YLVL+  + GELF+ +V +  L +NE    
Sbjct: 231 TDILMRVHHPNIVNLLDSYVEPLSKSQIQKYLVLDKIDDGELFDRIVRKTSLSQNETKAL 290

Query: 135 FRQIIIGISYCHSLGVVHRDLKPEXXXXXXX-------------------XXXXXADFGM 175
           F+QI+ GI Y H   ++HRD+KPE                               ADFG+
Sbjct: 291 FKQILSGIQYLHGQNIIHRDIKPENILLNITRRTSNDQIKTGPWDEDEIDIQVKIADFGL 350

Query: 176 AALESEDKLLETSCGSPHYAAPEIISGLPYEGFSSDVWSCGVILFALLTGRLPFDEEDG- 234
           A    E +   T CG+P Y APE++    Y     D+WS GV+L+  L G  PF ++ G 
Sbjct: 351 AKFTGELQFTNTLCGTPSYVAPEVLRKTGYTS-KVDIWSTGVLLYVCLCGFPPFSDQLGP 409

Query: 235 -NIRNLLLKVQKGEFEMPDDDEITKEAQDLLARLLTVDPSKRITIREILKH 284
             ++  +L+  K  F  P  DEI      L++ LL V+P++R +I +++ H
Sbjct: 410 PTLKEQILQ-GKFAFFSPYWDEINDSVLHLISNLLVVNPAQRYSIEDMINH 459

>KNAG0J01700 Chr10 (309962..312424) [2463 bp, 820 aa] {ON} 
          Length = 820

 Score =  139 bits (350), Expect = 7e-33,   Method: Compositional matrix adjust.
 Identities = 83/282 (29%), Positives = 144/282 (51%), Gaps = 32/282 (11%)

Query: 24  ETLGSGSTGKVLLASNETTKQQAAVKVISKAVFEAMNNSESNGDATNALPYNIEQEIIIM 83
           E +G G+   V  A    T +  AVK+I+K   + M N +            + +E+ ++
Sbjct: 206 EVVGQGAFATVKKAIETATGRTYAVKIINKR--KVMGNLDG-----------VTRELTVL 252

Query: 84  KLLNHPNVLRLFDVWETNSDLYLVLEYAEKGELFNMLVERGPLPENEAVRAFRQIIIGIS 143
           + L+HP+++ L   +E   + Y+V+E+   G+L + +   GP+ E+      RQI+  + 
Sbjct: 253 QKLDHPSIVTLKGFYEDKDNYYMVMEFVSGGDLMDFVAAHGPVGEDAGREITRQILEAVK 312

Query: 144 YCHSLGVVHRDLKPEXXXXXXX--XXXXXADFGMAALESEDKLLETSCGSPHYAAPEIIS 201
           Y HS+G+ HRDLKP+               DFG+A ++     + T CG+  Y APE+++
Sbjct: 313 YIHSVGISHRDLKPDNILIKQDDPVLVKITDFGLAKMQEHGAFMNTFCGTLAYVAPEVVN 372

Query: 202 G--------LP---YEGFSS--DVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQKGEF 248
           G        +P      +SS  D+WS G +++ +LTG LPF       + L  ++ K  +
Sbjct: 373 GRQQTSEPAVPKGERSHYSSLVDMWSMGCLVYVILTGHLPF--SGSTPQQLYEQIGKASY 430

Query: 249 -EMP-DDDEITKEAQDLLARLLTVDPSKRITIREILKHPLLQ 288
            E+P  D  I+ +A+D +  LL VDP+ R++    L+HP +Q
Sbjct: 431 HEVPLKDCRISDQARDFIDCLLQVDPNNRLSAARALEHPWIQ 472

>ACR142W Chr3 (597519..600032) [2514 bp, 837 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPL153C (RAD53)
          Length = 837

 Score =  138 bits (348), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 88/284 (30%), Positives = 141/284 (49%), Gaps = 30/284 (10%)

Query: 24  ETLGSGSTGKVLLASNETTKQQAAVKVISKAVFEAMNNSESNGDATNALPYNIEQEIIIM 83
           E +G G+   V  A    T +  AVK+I+K   + M N +            + +E+ ++
Sbjct: 221 EVVGQGAFATVKKAVERNTGKTFAVKIINKR--KVMGNVDG-----------VTRELEVL 267

Query: 84  KLLNHPNVLRLFDVWETNSDLYLVLEYAEKGELFNMLVERGPLPENEAVRAFRQIIIGIS 143
           + LNHP ++ L   +E +   YL++E+   G+L + +   G + E+      RQI+  + 
Sbjct: 268 RRLNHPRIVSLKGFYEDDESYYLLMEFVSGGDLMDFVAAHGSVGEDAGREITRQILEAVR 327

Query: 144 YCHSLGVVHRDLKPEXXXXXXX--XXXXXADFGMAALESEDKLLETSCGSPHYAAPEIIS 201
           Y H  G+ HRDLKP+               DFG+A ++     ++T CG+  Y APE+I 
Sbjct: 328 YIHEQGISHRDLKPDNILIEQDDPVLVKITDFGLAKIQDNTTFMKTFCGTLAYVAPEVIG 387

Query: 202 GLPYEG-------FSS--DVWSCGVILFALLTGRLPFDEEDGNIRNLLLK-VQKGEF-EM 250
           G   EG       +SS  D+WS G +++ +LTG LPF    G+ +  L K +  G + E 
Sbjct: 388 GKNPEGNGANGNLYSSLVDMWSIGCLVYVILTGHLPF---SGSTQEQLYKQIANGSYHEG 444

Query: 251 P-DDDEITKEAQDLLARLLTVDPSKRITIREILKHPLLQKYPSI 293
           P  D  I+ EA+D +  LL ++P  R+T    L+HP L    SI
Sbjct: 445 PLKDYWISDEARDFIDSLLQINPVDRLTAERALQHPWLHPCTSI 488

>Kpol_1033.50 s1033 complement(126043..127197) [1155 bp, 384 aa]
           {ON} complement(126043..127197) [1155 nt, 385 aa]
          Length = 384

 Score =  132 bits (333), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 80/257 (31%), Positives = 131/257 (50%), Gaps = 18/257 (7%)

Query: 20  WKLGETLGSGSTGKVLLASNETTKQQAAVKVISKAVFEAMNNSESNGDATNALPYNIEQE 79
           +++  TLG+GS G+V L  +   K+  A+KV+ K     M   E   D           E
Sbjct: 74  FQIMRTLGTGSFGRVHLVRSVHNKRYYAIKVLKKQQIFKMKQIEHTND-----------E 122

Query: 80  IIIMKLLNHPNVLRLFDVWETNSDLYLVLEYAEKGELFNMLVERGPLPENEAVRAFRQII 139
             I+K++ HP ++R++  ++ + +L++V++Y E GELF++L +    P   A     ++I
Sbjct: 123 RKILKIVEHPFLIRMWGTFQDSRNLFMVMDYIEGGELFSLLRKSQRFPNPVAKFYAAEVI 182

Query: 140 IGISYCHSLGVVHRDLKPEXXXXXXXXXXXXADFGMAALESEDKLLETSCGSPHYAAPEI 199
           + + Y HS  +++RDLKPE             DFG A  +    +  T CG+P Y APE+
Sbjct: 183 LALDYLHSHNIIYRDLKPENILLDRNGHIKITDFGFA--KEVSTVTWTLCGTPDYIAPEV 240

Query: 200 ISGLPYEGFSSDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQKGEFEMPDDDEITKE 259
           I+  PY   S D WS G++++ +L G  PF   D        K+  G+   P       +
Sbjct: 241 IATKPYNK-SVDWWSLGILIYEMLAGYTPF--YDTTPMKTYEKILHGKVNYP--SFFHPD 295

Query: 260 AQDLLARLLTVDPSKRI 276
             DLLARL+T D ++R+
Sbjct: 296 VIDLLARLITADLTRRL 312

>Kwal_56.24091 s56 (845680..846825) [1146 bp, 381 aa] {ON} YPL209C
           (IPL1) - Protein kinase [contig 166] FULL
          Length = 381

 Score =  132 bits (332), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 69/220 (31%), Positives = 116/220 (52%), Gaps = 9/220 (4%)

Query: 74  YNIEQ----EIIIMKLLNHPNVLRLFDVWETNSDLYLVLEYAEKGELFNMLVERGPLPEN 129
           YN+++    E+ I   L HPN+ RL+  +     +YL++EY   GEL+  L   GP  + 
Sbjct: 162 YNVQKQFRREVEIQSSLKHPNLTRLYGYFHDEKRVYLLMEYLVNGELYKHLRSHGPFNDI 221

Query: 130 EAVRAFRQIIIGISYCHSLGVVHRDLKPEXXXXXXXXXXXXADFGMAALESEDKLLETSC 189
            A     Q+   ++Y HS  ++HRD+KPE             DFG +     +   +T C
Sbjct: 222 TASHFVHQMADALNYMHSKNILHRDIKPENILLGFQNTLKLTDFGWSVSNVGNSKRKTLC 281

Query: 190 GSPHYAAPEIISGLPYEGFSSDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQKGEFE 249
           G+  Y +PE+I    Y+    DVW+ GV+ + LL G  PF+E+   +     ++ K +  
Sbjct: 282 GTMDYLSPELIKSREYDN-KVDVWALGVLTYELLVGSPPFEEDTKEL--TYKRIIKRDLR 338

Query: 250 MPDDDEITKEAQDLLARLLTVDPSKRITIREILKHPLLQK 289
            P  D+++  A+DL++RLL  DP  RI ++++ +HP ++K
Sbjct: 339 FP--DQVSPHARDLISRLLEYDPQNRIPLKDVKRHPWIKK 376

>Skud_13.154 Chr13 complement(255263..257380) [2118 bp, 705 aa] {ON}
           YMR001C (REAL)
          Length = 705

 Score =  137 bits (345), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 95/290 (32%), Positives = 150/290 (51%), Gaps = 25/290 (8%)

Query: 1   MSAISSNTVSVIKNNQIGPWKLGETLGSGSTGKVLLASNETTKQQAAVKVISKAVFEAMN 60
           +SA+     S+IK      +  G  LG G   +     +++ +  AA K ++KA  ++  
Sbjct: 64  LSALCKTPPSLIKTRG-KDYHRGHFLGEGGFARCFQIKDDSGEIFAA-KTVAKASIKSEK 121

Query: 61  NSESNGDATNALPYNIEQEIIIMKLLNHPNVLRLFDVWETNSDLYLVLEYAEKGELFNML 120
             +            +  EI I K ++HPN+++  D +E +S++Y++LE    G L  +L
Sbjct: 122 TRK-----------KLLSEIQIHKSMSHPNIVQFIDCFEDDSNVYILLEICPNGSLMELL 170

Query: 121 VERGPLPENEAVRAFRQIIIG-ISYCHSLGVVHRDLKPEXXXXXXXXXXXXADFGMAAL- 178
             R  L E E VR F   I G I Y HS  V+HRDLK               DFG+AA+ 
Sbjct: 171 KRRKVLTEPE-VRFFTTQICGAIKYMHSRRVIHRDLKLGNIFFDSNYNLKIGDFGLAAVL 229

Query: 179 --ESEDKLLETSCGSPHYAAPEIISGLPYEG--FSSDVWSCGVILFALLTGRLPFDEEDG 234
             ESE K   T CG+P+Y APE++ G  + G  F  D+WS GV+L+ALL G+ PF   D 
Sbjct: 230 ANESERKY--TICGTPNYIAPEVLMG-KHSGHSFEVDIWSLGVMLYALLIGKPPFQARDV 286

Query: 235 NIRNLLLKVQKGEFEMPDDDEITKEAQDLLARLLTVDPSKRITIREILKH 284
           N   +  +++  +F  P D  I+ E + L+  +L++DP +R ++ EI+ +
Sbjct: 287 N--TIYERIKCRDFSFPKDKPISDEGKILIRDILSLDPIERPSLTEIMDY 334

>NCAS0C01370 Chr3 complement(250693..253092) [2400 bp, 799 aa] {ON}
           Anc_8.676
          Length = 799

 Score =  137 bits (346), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 86/277 (31%), Positives = 139/277 (50%), Gaps = 28/277 (10%)

Query: 24  ETLGSGSTGKVLLASNETTKQQAAVKVISKAVFEAMNNSESNGDATNALPYNIEQEIIIM 83
           E +G G+   V  A   +T +  AVK+ISK   + M N E            + +E+ ++
Sbjct: 199 EVVGQGAFATVKKAVERSTGKTFAVKIISKR--KVMGNMEG-----------VSRELEVL 245

Query: 84  KLLNHPNVLRLFDVWETNSDLYLVLEYAEKGELFNMLVERGPLPENEAVRAFRQIIIGIS 143
           + L+HP ++RL   +E     Y+V+E+   G+L + +   G + E       RQI+  + 
Sbjct: 246 QQLDHPRIVRLKGFYEDKDSYYMVMEFVSGGDLMDFVAAHGAVGEEAGKEISRQILEAVK 305

Query: 144 YCHSLGVVHRDLKPEXXXXXXX--XXXXXADFGMAALESEDKLLETSCGSPHYAAPEIIS 201
           Y HS G+ HRDLKP+               DFG+A ++     ++T CG+  Y APE+I 
Sbjct: 306 YIHSKGISHRDLKPDNILIEQDDPVLVKITDFGLAKVQGNGSFMKTFCGTLAYVAPEVIG 365

Query: 202 GLPYEG-----FSS--DVWSCGVILFALLTGRLPFDEEDGNIRNLLLK-VQKGEF-EMP- 251
           G          +SS  D+WS G +++ +LTG LPF    G+ +  L K + +G + E P 
Sbjct: 366 GKGETNEERNEYSSLVDMWSMGCLVYVILTGHLPF---SGSTQEQLYKQISRGSYHEGPL 422

Query: 252 DDDEITKEAQDLLARLLTVDPSKRITIREILKHPLLQ 288
            D  I+ EA+  +  LL V+P  R+T    L+HP ++
Sbjct: 423 KDFRISDEARSFIDSLLQVNPGNRLTAARALEHPWIK 459

>YMR001C Chr13 complement(269019..271136) [2118 bp, 705 aa] {ON}
           CDC5Polo-like kinase with multiple functions in mitosis
           and cytokinesis through substrate phosphorylation, also
           functions in adaptation to DNA damage during meiosis;
           has similarity to Xenopus Plx1 and S. pombe Plo1p;
           possible Cdc28p substrate
          Length = 705

 Score =  137 bits (344), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 95/290 (32%), Positives = 150/290 (51%), Gaps = 25/290 (8%)

Query: 1   MSAISSNTVSVIKNNQIGPWKLGETLGSGSTGKVLLASNETTKQQAAVKVISKAVFEAMN 60
           +SA+     S+IK      +  G  LG G   +     +++ +  AA K ++KA  ++  
Sbjct: 64  LSALCKTPPSLIKTRG-KDYHRGHFLGEGGFARCFQIKDDSGEIFAA-KTVAKASIKSEK 121

Query: 61  NSESNGDATNALPYNIEQEIIIMKLLNHPNVLRLFDVWETNSDLYLVLEYAEKGELFNML 120
             +            +  EI I K ++HPN+++  D +E +S++Y++LE    G L  +L
Sbjct: 122 TRK-----------KLLSEIQIHKSMSHPNIVQFIDCFEDDSNVYILLEICPNGSLMELL 170

Query: 121 VERGPLPENEAVRAFRQIIIG-ISYCHSLGVVHRDLKPEXXXXXXXXXXXXADFGMAAL- 178
             R  L E E VR F   I G I Y HS  V+HRDLK               DFG+AA+ 
Sbjct: 171 KRRKVLTEPE-VRFFTTQICGAIKYMHSRRVIHRDLKLGNIFFDSNYNLKIGDFGLAAVL 229

Query: 179 --ESEDKLLETSCGSPHYAAPEIISGLPYEG--FSSDVWSCGVILFALLTGRLPFDEEDG 234
             ESE K   T CG+P+Y APE++ G  + G  F  D+WS GV+L+ALL G+ PF   D 
Sbjct: 230 ANESERKY--TICGTPNYIAPEVLMG-KHSGHSFEVDIWSLGVMLYALLIGKPPFQARDV 286

Query: 235 NIRNLLLKVQKGEFEMPDDDEITKEAQDLLARLLTVDPSKRITIREILKH 284
           N   +  +++  +F  P D  I+ E + L+  +L++DP +R ++ EI+ +
Sbjct: 287 N--TIYERIKCRDFSFPRDKPISDEGKILIRDILSLDPIERPSLTEIMDY 334

>TBLA0A02030 Chr1 complement(491365..492576) [1212 bp, 403 aa] {ON}
           Anc_6.214 YPL203W
          Length = 403

 Score =  132 bits (333), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 84/273 (30%), Positives = 136/273 (49%), Gaps = 23/273 (8%)

Query: 20  WKLGETLGSGSTGKVLLASNETTKQQAAVKVISKAVFEAMNNSESNGDATNALPYNIEQE 79
           +++  TLG+GS G+V L  +    +  A+KV+ K     M   E   D           E
Sbjct: 93  FQIMRTLGTGSFGRVHLVRSVHNGRYYAIKVLKKQQIIKMKQIEHTND-----------E 141

Query: 80  IIIMKLLNHPNVLRLFDVWETNSDLYLVLEYAEKGELFNMLVERGPLPENEAVRAFRQII 139
             ++KL+ HP ++RL+  ++ + +L++V++Y E GELF++L +    P   A     +++
Sbjct: 142 RRMLKLVEHPFIIRLWGTFQDSRNLFMVMDYIEGGELFSLLRKSQRFPNPVAKFYAAEVV 201

Query: 140 IGISYCHSLGVVHRDLKPEXXXXXXXXXXXXADFGMAALESEDKLLETSCGSPHYAAPEI 199
           + + Y H+  +++RDLKPE            ADFG A   S   +  T CG+P Y APE+
Sbjct: 202 LALEYLHANNIIYRDLKPENILLDRNGHIKVADFGFAKEVSS--VTWTLCGTPDYIAPEV 259

Query: 200 ISGLPYEGFSSDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQKGEFEMPDDDEITKE 259
           I+  PY   S D WS GV+++ +L G  PF   D        K+ +G+   P       +
Sbjct: 260 IATKPYNK-SVDWWSLGVLIYEMLAGYTPF--YDVTPMKTYEKILQGKINFPQG--FHPD 314

Query: 260 AQDLLARLLTVDPSKRI-----TIREILKHPLL 287
             DLL RL+T D +KR+       R++  HP  
Sbjct: 315 VIDLLTRLITSDLTKRLGNLQNGSRDVKNHPWF 347

>Suva_13.163 Chr13 complement(259136..261253) [2118 bp, 705 aa] {ON}
           YMR001C (REAL)
          Length = 705

 Score =  136 bits (343), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 101/323 (31%), Positives = 163/323 (50%), Gaps = 32/323 (9%)

Query: 1   MSAISSNTVSVIKNNQIGPWKLGETLGSGSTGKVLLASNETTKQQAAVKVISKAVFEAMN 60
           +SA+     S+IK      +  G  LG G   +     +++ +  AA K ++KA  ++  
Sbjct: 64  LSALCKTPPSLIKTRG-KDYHRGHFLGEGGFARCFQIKDDSGEIFAA-KTVAKASIKSEK 121

Query: 61  NSESNGDATNALPYNIEQEIIIMKLLNHPNVLRLFDVWETNSDLYLVLEYAEKGELFNML 120
             +            +  EI I K + HPN+++  D +E +S++Y++LE    G L  +L
Sbjct: 122 TRK-----------KLLSEIQIHKSMAHPNIVQFVDCFEDDSNVYILLEICPNGSLMELL 170

Query: 121 VERGPLPENEAVRAFRQIIIG-ISYCHSLGVVHRDLKPEXXXXXXXXXXXXADFGMAAL- 178
             R  L E E VR F   I G I Y HS  V+HRDLK               DFG+AA+ 
Sbjct: 171 KRRKVLTEPE-VRFFTTQICGAIKYMHSRRVIHRDLKLGNIFFDSNYNLKIGDFGLAAVL 229

Query: 179 --ESEDKLLETSCGSPHYAAPEIISGLPYEG--FSSDVWSCGVILFALLTGRLPFDEEDG 234
             ESE K   T CG+P+Y APE++ G  + G  F  D+WS GV+L+ALL G+ PF   D 
Sbjct: 230 ANESERKY--TICGTPNYIAPEVLMG-KHSGHSFEVDIWSLGVMLYALLIGKPPFQARDV 286

Query: 235 NIRNLLLKVQKGEFEMPDDDEITKEAQDLLARLLTVDPSKRITIREILKHPLLQKY--PS 292
           N   +  +++  +F  P D  I+ E + L+  +L++DP +R ++ EI+ +   +    PS
Sbjct: 287 N--TIYERIKCRDFSFPKDKPISDEGKILIRDILSLDPIERPSLTEIMDYVWFRGTFPPS 344

Query: 293 I-----KDSRSIRNLPREDTYLS 310
           I      ++ +  N+P E + ++
Sbjct: 345 IPSTVMSEASNFDNIPEEQSLIN 367

>NCAS0B05910 Chr2 (1120092..1121645) [1554 bp, 517 aa] {ON}
           Anc_2.352
          Length = 517

 Score =  134 bits (337), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 86/296 (29%), Positives = 141/296 (47%), Gaps = 43/296 (14%)

Query: 20  WKLGETLGSGSTGKVLLASNETTKQQAAVKVISKAVFEAMNNSESNGDATNALPYNIEQE 79
           + LG+ LGSG    V    N+ T Q  AVK+          + + N D   +  +  E  
Sbjct: 204 YVLGKDLGSGHYATVKEGINKVTGQTVAVKIF---------HPQQNDDEKKSKQFREETN 254

Query: 80  IIIMKLLNHPNVLRLFDVW-----ETNSDLYLVLEYAEKGELFNMLVERGPLPENEAVRA 134
           I++   ++HPN++ L D +     ++    YLVL+  + GELF  +V++  L ++E    
Sbjct: 255 ILMR--IHHPNIVNLLDFFIEPVSKSQIQKYLVLDKIDDGELFERIVKKTCLRQDETKAI 312

Query: 135 FRQIIIGISYCHSLGVVHRDLKPEXXXXXXX-------------------XXXXXADFGM 175
           F QI++G+ + H   ++HRD+KPE                               ADFG+
Sbjct: 313 FNQILMGLKHLHQQNIIHRDIKPENILLNITRRTNPEQKQLGPWDEDEIDIQVKIADFGL 372

Query: 176 AALESEDKLLETSCGSPHYAAPEIISGLPYEGFSS--DVWSCGVILFALLTGRLPFDEED 233
           A    E +   T CG+P Y APE+++    +G++S  D+WS GVIL+  L G  PF E+ 
Sbjct: 373 AKFTGEMQFTNTLCGTPSYVAPEVLTK---KGYTSKVDMWSAGVILYVCLCGFPPFSEQL 429

Query: 234 G--NIRNLLLKVQKGEFEMPDDDEITKEAQDLLARLLTVDPSKRITIREILKHPLL 287
           G  +++  +L+  K  F  P  D I      L++ LL +D   R ++ + + HP  
Sbjct: 430 GPPSLKEQILQA-KFAFYTPYWDNIDDNVLHLISHLLVLDADARYSVEDTINHPWF 484

>Kpol_1037.20 s1037 (41658..43772) [2115 bp, 704 aa] {ON}
           (41658..43772) [2115 nt, 705 aa]
          Length = 704

 Score =  136 bits (342), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 93/293 (31%), Positives = 153/293 (52%), Gaps = 21/293 (7%)

Query: 23  GETLGSGSTGKVLLASNETTKQQAAVKVISKAVFEAMNNSESNGDATNALPYNIEQEIII 82
           G  LG G   +     +++ K  AA K ++K   ++    +            +  EI I
Sbjct: 85  GHFLGEGGFARCFQIKDDSGKIFAA-KTVAKLSIKSEKTRK-----------KLLSEIQI 132

Query: 83  MKLLNHPNVLRLFDVWETNSDLYLVLEYAEKGELFNMLVERGPLPENEAVRAFRQIIIG- 141
            K + H NV++  D +E ++++Y++LE    G L ++L +R  L E E VR F   I G 
Sbjct: 133 HKSMKHQNVVQFIDCFEDDTNVYILLEICPNGSLMDLLKKRKLLTEPE-VRFFTTQICGA 191

Query: 142 ISYCHSLGVVHRDLKPEXXXXXXXXXXXXADFGMAALESEDKLLE-TSCGSPHYAAPEII 200
           I Y HS  V+HRDLK               DFG+AA+ + D+  + T CG+P+Y APE++
Sbjct: 192 IKYMHSRRVIHRDLKLGNIFFDRNYNLKIGDFGLAAVLANDRERKYTVCGTPNYIAPEVL 251

Query: 201 SGLPYEGFSS--DVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQKGEFEMPDDDEITK 258
            G  + G S   D+WS GV+L+ALL G+ PF  +D N   +  +++  +F  P +  I+ 
Sbjct: 252 MG-KHSGHSYEVDIWSIGVMLYALLIGKPPFQSKDVN--TIYERIKCCDFSFPKEKHISN 308

Query: 259 EAQDLLARLLTVDPSKRITIREILKHPLLQK-YPSIKDSRSIRNLPREDTYLS 310
           EA+ L+  LL++DP +R +I EI+ +   +  +P   +S  +  +P  D  L+
Sbjct: 309 EAKVLIQDLLSLDPLERPSISEIMDYVWFRGIFPPYIESTVMTEVPNYDKTLT 361

>Kpol_1072.16 s1072 complement(37585..39972) [2388 bp, 795 aa] {ON}
           complement(37585..39972) [2388 nt, 796 aa]
          Length = 795

 Score =  136 bits (343), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 84/280 (30%), Positives = 141/280 (50%), Gaps = 32/280 (11%)

Query: 24  ETLGSGSTGKVLLASNETTKQQAAVKVISKAVFEAMNNSESNGDATNALPYNIEQEIIIM 83
           E +G G+   V  A   +T +  AVK+I+K   + M N +            + +E+ ++
Sbjct: 197 EVVGQGAFAIVKKAVERSTGKTFAVKIINKR--KVMGNMDG-----------VTRELDVL 243

Query: 84  KLLNHPNVLRLFDVWETNSDLYLVLEYAEKGELFNMLVERGPLPENEAVRAFRQIIIGIS 143
           + L+HP ++RL   +E     YL++E+   G+L + +   G + E+      RQI+  + 
Sbjct: 244 RKLDHPRIVRLKGFYEDEDSYYLLMEFVSGGDLMDFVAAHGSVGEDAGREITRQILEAVK 303

Query: 144 YCHSLGVVHRDLKPEXXXXXXX--XXXXXADFGMAALESEDKLLETSCGSPHYAAPEIIS 201
           Y H  G+ HRDLKP+               DFG+A ++     ++T CG+  Y APE+I 
Sbjct: 304 YIHLQGISHRDLKPDNILIEQDDPVLVKITDFGLAKVQGNGTFMKTFCGTLAYVAPEVIG 363

Query: 202 G----------LPYEGFSSDVWSCGVILFALLTGRLPFDEEDGNIRNLLLK-VQKGEF-E 249
           G          + Y     D+WS G +++ +LTG LPF    G+ ++ L K + +G + E
Sbjct: 364 GKNSAEENEDRIEYSSL-VDMWSIGCLVYVILTGHLPF---SGSTQDQLYKQICRGSYHE 419

Query: 250 MP-DDDEITKEAQDLLARLLTVDPSKRITIREILKHPLLQ 288
            P  D  I+ EA+D +  LL V P+KR+T  + L HP ++
Sbjct: 420 GPLKDFRISDEARDFIDSLLQVSPNKRLTAIKALNHPWIK 459

>Smik_13.159 Chr13 complement(260249..262366) [2118 bp, 705 aa] {ON}
           YMR001C (REAL)
          Length = 705

 Score =  136 bits (342), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 95/290 (32%), Positives = 148/290 (51%), Gaps = 25/290 (8%)

Query: 1   MSAISSNTVSVIKNNQIGPWKLGETLGSGSTGKVLLASNETTKQQAAVKVISKAVFEAMN 60
           +SA+     S+IK      +  G  LG G   +     +++    AA K ++KA  ++  
Sbjct: 64  LSALCKTPPSLIKTRG-KDYHRGHFLGEGGFARCFQIKDDSGDIFAA-KTVAKASIKSEK 121

Query: 61  NSESNGDATNALPYNIEQEIIIMKLLNHPNVLRLFDVWETNSDLYLVLEYAEKGELFNML 120
             +            +  EI I K + HPN+++  D +E +S++Y++LE    G L  +L
Sbjct: 122 TRK-----------KLLSEIQIHKSMAHPNIVQFIDCFEDDSNVYILLEICPNGSLMELL 170

Query: 121 VERGPLPENEAVRAFRQIIIG-ISYCHSLGVVHRDLKPEXXXXXXXXXXXXADFGMAAL- 178
             R  L E E VR F   I G I Y HS  V+HRDLK               DFG+AA+ 
Sbjct: 171 KRRKVLSEPE-VRFFTTQICGAIKYMHSRRVIHRDLKLGNIFFDSNYNLKIGDFGLAAVL 229

Query: 179 --ESEDKLLETSCGSPHYAAPEIISGLPYEG--FSSDVWSCGVILFALLTGRLPFDEEDG 234
             ESE K   T CG+P+Y APE++ G  + G  F  D+WS GV+L+ALL G+ PF   D 
Sbjct: 230 ANESERKY--TICGTPNYIAPEVLMG-KHSGHSFEVDIWSLGVMLYALLIGKPPFQARDV 286

Query: 235 NIRNLLLKVQKGEFEMPDDDEITKEAQDLLARLLTVDPSKRITIREILKH 284
           N   +  +++  +F  P D  I+ E + L+  +L++DP +R ++ EI+ +
Sbjct: 287 N--TIYERIKCRDFSFPKDKPISDEGKILIRDILSLDPIERPSLTEIMDY 334

>ACL006W Chr3 (344395..346521) [2127 bp, 708 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR001C (CDC5)
          Length = 708

 Score =  136 bits (342), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 89/288 (30%), Positives = 155/288 (53%), Gaps = 21/288 (7%)

Query: 1   MSAISSNTVSVIKNNQIGPWKLGETLGSGSTGKVLLASNETTKQQAAVKVISKAVFEAMN 60
           +SA+     S+IK      +  G  LG G   +     +++ K  AA K ++K   ++  
Sbjct: 55  LSALCKTPPSLIKTKG-RDYHRGMFLGEGGFARCFQMKDDSGKVFAA-KTVAKISIKSEK 112

Query: 61  NSESNGDATNALPYNIEQEIIIMKLLNHPNVLRLFDVWETNSDLYLVLEYAEKGELFNML 120
             +            +  EI I K + HPN+++  D +E ++++Y++LE    G L ++L
Sbjct: 113 TRKK-----------LLSEIQIHKSMKHPNIVQFTDCFEDDTNVYILLEICPNGSLMDLL 161

Query: 121 VERGPLPENEAVRAFRQIIIG-ISYCHSLGVVHRDLKPEXXXXXXXXXXXXADFGMAALE 179
            +R  L E E VR F   I+G I Y HS  ++HRDLK               DFG+AA+ 
Sbjct: 162 KQRKQLTEPE-VRFFTTQIVGAIKYMHSRRIIHRDLKLGNIFFDKHFNLKIGDFGLAAVL 220

Query: 180 SEDKLLE-TSCGSPHYAAPEIISGLPYEG--FSSDVWSCGVILFALLTGRLPFDEEDGNI 236
           + D+  + T CG+P+Y APE+++G  + G  F  D+WS GV+++ALL G+ PF  ++ N 
Sbjct: 221 ANDRERKYTICGTPNYIAPEVLTG-KHTGHSFEVDIWSIGVMIYALLIGKPPFQAKEVN- 278

Query: 237 RNLLLKVQKGEFEMPDDDEITKEAQDLLARLLTVDPSKRITIREILKH 284
             +  +++  +F  P D  I+ EA+ L+  +L++DP +R ++ EI+++
Sbjct: 279 -TIYERIKVCDFSFPKDKPISSEAKVLIKDILSLDPLERPSLAEIMEY 325

>KAFR0B05410 Chr2 complement(1111152..1112771) [1620 bp, 539 aa]
           {ON} Anc_8.279 YLR096W
          Length = 539

 Score =  134 bits (337), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 84/283 (29%), Positives = 145/283 (51%), Gaps = 19/283 (6%)

Query: 16  QIGPWKLGETLGSGSTGKVLLASNETTKQQAAVKV--------ISKAVFEAMNNSESNGD 67
           Q+G W    TLG G+ G V LA +  + Q  AVK+        ++K   + + + + + +
Sbjct: 51  QLGEWIFSRTLGKGAKGTVKLAKHRASGQICAVKITIRYQSVILNKCNTQNIEDVKCSKE 110

Query: 68  ATNALPYN--IEQEIIIMKLLNHPNVLRLFDVWETNSDLYLVLEYAEKGELFNMLVERGP 125
              A+ ++    QE  + ++L HP++ + + + E     Y+ LEY +   L   +  +  
Sbjct: 111 FKTAIQHDRRTMQEFQLSRVLRHPHICKFYKMEEMRYHYYMFLEYIQGCTLLEYVSSQNA 170

Query: 126 LPENEAV-RAFR-QIIIGISYCHSLGVVHRDLKPEXXXXXXX-XXXXXADFGMAALESED 182
              NE + R F  QI+  ++Y HS  +VHRDLK E              DFG+     ++
Sbjct: 171 KKLNEEIARDFAGQILNALAYLHSNNIVHRDLKMENIMVTNEDKTIKLIDFGLGCFYDQN 230

Query: 183 KLLETSCGSPHYAAPEIISGLPYEGFSSDVWSCGVILFALLTGRLPFDEEDGNIRNLLLK 242
             L   CGS +YAAPE++    Y G   D+WS GV+L+ ++TG+LPF    G  +  L+K
Sbjct: 231 STLNDYCGSLYYAAPEVLKRDYYIGPEVDIWSFGVVLYIMVTGKLPF---KGRSKGRLMK 287

Query: 243 -VQKGEFEMPDDDEITKEAQDLLARLLTVDPSKRITIREILKH 284
            +  G+ + P  + ++ +   LL+R+L +D S R ++ +I+KH
Sbjct: 288 HILSGQVKFP--NFLSMDVISLLSRILEIDLSFRFSLSDIIKH 328

>AFL101C Chr6 complement(249144..250247) [1104 bp, 367 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPL209C
           (IPL1)
          Length = 367

 Score =  130 bits (328), Expect = 5e-32,   Method: Compositional matrix adjust.
 Identities = 82/285 (28%), Positives = 137/285 (48%), Gaps = 24/285 (8%)

Query: 9   VSVIKNNQIGPWKLGETLGSGSTGKVLLASNETTKQQAAVKVISKAVFEAMNNSESNGDA 68
           +S ++N ++  +++G+ LG G  G+V    +  +    A+K + K               
Sbjct: 98  LSKLQNLKLADFEIGKVLGKGKFGRVYCVRHIESGFVCALKAMEKK-------------- 143

Query: 69  TNALPYNIEQ----EIIIMKLLNHPNVLRLFDVWETNSDLYLVLEYAEKGELFNMLVERG 124
            + + YNIE+    E+ I   L HPN+ +L+  +     +YL++EY   GEL+  L  R 
Sbjct: 144 -DIIQYNIEKQFRREVEIQSSLRHPNLTQLYGYFHDEKRVYLLMEYLVNGELYKHLKGRS 202

Query: 125 PLPENEAVRAFRQIIIGISYCHSLGVVHRDLKPEXXXXXXXXXXXXADFGMAALESEDKL 184
              +  A     Q+   + Y H   ++HRD+KPE             DFG + +  +   
Sbjct: 203 HFNDVVASYYVYQMADALDYMHERNILHRDIKPENIIIGFNNTIKLTDFGWSVITPKGSK 262

Query: 185 LETSCGSPHYAAPEIISGLPYEGFSSDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQ 244
            +T CG+  Y +PE+I    Y     DVW+ GV+ + LL G  PF+EE   +     ++ 
Sbjct: 263 RKTLCGTVDYLSPELIRSREYNE-KVDVWALGVLTYELLVGSPPFEEESKEL--TYKRIL 319

Query: 245 KGEFEMPDDDEITKEAQDLLARLLTVDPSKRITIREILKHPLLQK 289
           K     P  D +  EA+ L++RLL  DP  RI ++E+ KHP ++K
Sbjct: 320 KRNLIFP--DHVDTEARHLISRLLEYDPGDRIPLKEVKKHPWIEK 362

>Suva_7.106 Chr7 (202969..204540) [1572 bp, 523 aa] {ON} YGL158W
           (REAL)
          Length = 523

 Score =  134 bits (336), Expect = 5e-32,   Method: Compositional matrix adjust.
 Identities = 92/313 (29%), Positives = 150/313 (47%), Gaps = 38/313 (12%)

Query: 16  QIGPWKLGETLGSGSTGKVLLASNETTKQQ--AAVKVISK----AVFEAMNNSESNGDAT 69
           ++  +K+   +G G+  +V  A N  +  Q   A+KVI K      +E   +   NGD  
Sbjct: 119 ELCNYKILSQIGDGAFSRVFKAVNVASIDQIPVAIKVIKKKSILCEYEKHEHDAENGDRI 178

Query: 70  NALPY-NIEQEIIIMKLL--NHPNVLRLFDVWETNSDLYLVLEYAEKGELFNMLVERGPL 126
                 NI  EI I +L+  N+P +++     E+ +  Y++ E    GE+F+ +++    
Sbjct: 179 KPCSRENILNEIFIHRLVSENNPYLVKFLGFQESVTYFYIISELVSGGEIFDKIIQMSSF 238

Query: 127 PENEAVRAFRQIIIGISYCHSLGVVHRDLKPE-------------------XXXXXXXXX 167
            E+ A     Q+ + + + H +GVVHRD+KPE                            
Sbjct: 239 SEDLARHVITQVAMAVKHMHYMGVVHRDIKPENLLFEPIPFYGVDGDEFKLGVGGGGIGF 298

Query: 168 XXXADFGMAALESEDKLLETSCGSPHYAAPEIISGLPYEGFSS--DVWSCGVILFALLTG 225
               DFG+A   S +   +T CG+  Y APEI +   +EG+S   D+W  G +L+ LL G
Sbjct: 299 VKLTDFGLAKRISHNAA-KTPCGTIEYTAPEIFN---FEGYSMKVDMWGIGCVLYTLLCG 354

Query: 226 RLPFDEEDGNIRNLLLKVQKGEFEM--PDDDEITKEAQDLLARLLTVDPSKRITIREILK 283
             PF E+  N   L+ K+ +G++E   P  D ++ EA++ ++ LL VDP+KR  I E L 
Sbjct: 355 YPPFYEK--NPSKLVKKISEGDYEFSAPWWDGVSSEAKNAISHLLEVDPNKRYDIDEFLN 412

Query: 284 HPLLQKYPSIKDS 296
            P L  Y  ++ S
Sbjct: 413 DPWLNTYDCLRPS 425

>Ecym_3035 Chr3 complement(70391..72613) [2223 bp, 740 aa] {ON}
           similar to Ashbya gossypii ACL006W
          Length = 740

 Score =  135 bits (341), Expect = 6e-32,   Method: Compositional matrix adjust.
 Identities = 76/210 (36%), Positives = 127/210 (60%), Gaps = 8/210 (3%)

Query: 79  EIIIMKLLNHPNVLRLFDVWETNSDLYLVLEYAEKGELFNMLVERGPLPENEAVRAFRQI 138
           EI I K + HPN+++  D +E ++++Y++LE    G L ++L +R  L E E VR F   
Sbjct: 120 EIQIHKSMRHPNIVQFTDCFEDDTNVYILLEICPNGSLMDLLKQRKQLTEPE-VRFFTTQ 178

Query: 139 IIG-ISYCHSLGVVHRDLKPEXXXXXXXXXXXXADFGMAALESEDKLLE-TSCGSPHYAA 196
           I+G I Y HS  ++HRDLK               DFG+AA+ + D+  + T CG+P+Y A
Sbjct: 179 IVGAIKYMHSRRIIHRDLKLGNIFFDKHFNLKIGDFGLAAVLANDRERKYTICGTPNYIA 238

Query: 197 PEIISGLPYEG--FSSDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQKGEFEMPDDD 254
           PE+++G  + G  F  DVWS GV+++ALL G+ PF  ++ N   +  +++  +F  P D 
Sbjct: 239 PEVLTG-KHTGHSFEVDVWSIGVMIYALLIGKPPFQAKEVN--TIYERIKVCDFNFPRDK 295

Query: 255 EITKEAQDLLARLLTVDPSKRITIREILKH 284
            I+ EA+ L+  +L++DP +R ++ EI+++
Sbjct: 296 PISSEAKVLIKDILSLDPLERPSLTEIMEY 325

>TBLA0B07330 Chr2 complement(1745229..1746821,1746990..1747013)
           [1617 bp, 538 aa] {ON} Anc_2.352 YDL101C
          Length = 538

 Score =  134 bits (336), Expect = 6e-32,   Method: Compositional matrix adjust.
 Identities = 91/305 (29%), Positives = 139/305 (45%), Gaps = 39/305 (12%)

Query: 20  WKLGETLGSGSTGKVLLASNETTKQQAAVKVISKAVFEAMNNSESNGDATNALPYNIEQE 79
           + +G+ LGSG    V    N+ T +  A+K+          + + N D   +  +  E  
Sbjct: 224 YVIGKELGSGHYAVVKEGINKKTGKAVAIKIF---------HPQQNDDQKKSRQFREETN 274

Query: 80  IIIMKLLNHPNVLRLFD-----VWETNSDLYLVLEYAEKGELFNMLVERGPLPENEAVRA 134
           I++   + HPN++ L D     V +     YLVL+  + GELF+ +V++  L ++E    
Sbjct: 275 ILMS--VQHPNIVNLLDSFIEPVSKMQIQKYLVLDKVDDGELFDRIVKKTCLRQDETKAL 332

Query: 135 FRQIIIGISYCHSLGVVHRDLKPEXXXXXXX-------------------XXXXXADFGM 175
           F QI+ G+ Y HS  V+HRD+KPE                               ADFG+
Sbjct: 333 FLQILSGLKYLHSRNVIHRDIKPENILLKITRRTSPDQIQTGPWDEDEVDIQVKIADFGL 392

Query: 176 AALESEDKLLETSCGSPHYAAPEIISGLPYEGFSSDVWSCGVILFALLTGRLPFDEEDG- 234
           A    E +   T CG+P Y APE++    Y     D+WS GV+L+  L G  PF ++   
Sbjct: 393 AKFTGELQFTNTLCGTPSYVAPEVLVKNGYTA-KVDIWSSGVLLYVCLCGFPPFSDQLAP 451

Query: 235 -NIRNLLLKVQKGEFEMPDDDEITKEAQDLLARLLTVDPSKRITIREILKHPLLQKYPSI 293
             ++  +L+  K  F  P  DEI      L++ LL VDP+ R  +   L HP  Q     
Sbjct: 452 PTLKEQILQ-GKFAFYSPYWDEIDDTVLHLISNLLVVDPTTRFDVNATLNHPWFQSMLQD 510

Query: 294 KDSRS 298
           +DS S
Sbjct: 511 QDSFS 515

>NCAS0B04490 Chr2 (814474..815523) [1050 bp, 349 aa] {ON} Anc_8.141
          Length = 349

 Score =  129 bits (325), Expect = 7e-32,   Method: Compositional matrix adjust.
 Identities = 69/225 (30%), Positives = 122/225 (54%), Gaps = 9/225 (4%)

Query: 67  DATNALPYNIEQ----EIIIMKLLNHPNVLRLFDVWETNSDLYLVLEYAEKGELFNMLVE 122
           D    + YN+++    E+ I   LNHPN+ +L+  +     +YL++EY   GEL+ +L  
Sbjct: 123 DKAEIVQYNLQKQFRREVEIQTSLNHPNLTKLYGHFHDEKRVYLLMEYLVYGELYKLLRS 182

Query: 123 RGPLPENEAVRAFRQIIIGISYCHSLGVVHRDLKPEXXXXXXXXXXXXADFGMAALESED 182
            GP  +  A R   QI   ++Y H   ++HRDLKPE             DFG + +    
Sbjct: 183 HGPFNDVIASRFVFQIADALNYLHDKQIIHRDLKPENILIGFNNVIKLTDFGWSIINPRG 242

Query: 183 KLLETSCGSPHYAAPEIISGLPYEGFSSDVWSCGVILFALLTGRLPFDEEDGNIRNLLLK 242
              +T CG+  Y +PE+I    Y+    DVW+ GV+ + L+ G  PF+E+   +     +
Sbjct: 243 VKRKTLCGTIDYLSPEMIRSREYDD-KVDVWALGVLTYELIVGSPPFEEDTKEL--TYKR 299

Query: 243 VQKGEFEMPDDDEITKEAQDLLARLLTVDPSKRITIREILKHPLL 287
           + K + + P  + ++ + +DL+++LL  +PS+RI++R+++KHP +
Sbjct: 300 ILKNDIKFP--ETVSHDVKDLISKLLKYNPSERISMRDVMKHPWI 342

>Skud_10.50 Chr10 complement(84697..85890) [1194 bp, 397 aa] {ON}
           YJL164C (REAL)
          Length = 397

 Score =  130 bits (328), Expect = 7e-32,   Method: Compositional matrix adjust.
 Identities = 76/270 (28%), Positives = 134/270 (49%), Gaps = 23/270 (8%)

Query: 25  TLGSGSTGKVLLASNETTKQQAAVKVISKAVFEAMNNSESNGDATNALPYNIEQEIIIMK 84
           TLG+GS G+V L  +    +  A+KV+ K +   +   E   D           E +++ 
Sbjct: 92  TLGTGSFGRVHLIRSRHNGRYYAMKVLKKEIVVRLKQVEHTND-----------ERLMLS 140

Query: 85  LLNHPNVLRLFDVWETNSDLYLVLEYAEKGELFNMLVERGPLPENEAVRAFRQIIIGISY 144
           ++ HP ++R++  ++ +  ++++++Y E GELF++L +    P   A     ++ + + Y
Sbjct: 141 IVTHPFIIRMWGTFQDSQQIFMIMDYIEGGELFSLLRKSQRFPNPVAKFYAAEVCLALEY 200

Query: 145 CHSLGVVHRDLKPEXXXXXXXXXXXXADFGMAALESEDKLLETSCGSPHYAAPEIISGLP 204
            HS  +++RDLKPE             DFG A    +  +  T CG+P Y APE++S  P
Sbjct: 201 LHSKDIIYRDLKPENILLDKNGHIKITDFGFAKYVPD--VTYTLCGTPDYIAPEVVSTKP 258

Query: 205 YEGFSSDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQKGEFEMPDDDEITKEAQDLL 264
           Y   S D WS G++++ +L G  PF   D N      K+   E   P      ++ +DLL
Sbjct: 259 YNK-SIDWWSFGILIYEMLAGYTPF--YDSNTMKTYEKILNAELRFP--PFFNEDVKDLL 313

Query: 265 ARLLTVDPSKRI-----TIREILKHPLLQK 289
           +RL+T D S+R+        ++  HP  ++
Sbjct: 314 SRLITRDLSQRLGNLQNGTEDVKNHPWFKE 343

>Kwal_56.24059 s56 complement(829673..830734) [1062 bp, 353 aa] {ON}
           YPL203W (TPK2) - cAMP-dependent protein kinase catalytic
           subunit [contig 166] FULL
          Length = 353

 Score =  129 bits (325), Expect = 8e-32,   Method: Compositional matrix adjust.
 Identities = 79/252 (31%), Positives = 129/252 (51%), Gaps = 18/252 (7%)

Query: 25  TLGSGSTGKVLLASNETTKQQAAVKVISKAVFEAMNNSESNGDATNALPYNIEQEIIIMK 84
           TLG+GS G+V L  +    +  A+KV+ K     M   E   D           E  ++K
Sbjct: 48  TLGTGSFGRVHLVRSVHNGRYYAIKVLKKEQVIRMKQIEHTND-----------ERRMLK 96

Query: 85  LLNHPNVLRLFDVWETNSDLYLVLEYAEKGELFNMLVERGPLPENEAVRAFRQIIIGISY 144
           L++HP ++R++  ++ + +L++V++Y E GELF++L +    P   A     ++I+ + Y
Sbjct: 97  LVDHPFLIRMWGTFQDSRNLFMVMDYIEGGELFSLLRKSQRFPNPVAKFYAAEVILALEY 156

Query: 145 CHSLGVVHRDLKPEXXXXXXXXXXXXADFGMAALESEDKLLETSCGSPHYAAPEIISGLP 204
            HS  +++RDLKPE             DFG A  +  D +  T CG+P Y APE+I+  P
Sbjct: 157 LHSHDIIYRDLKPENILLDRNGHIKITDFGFA--KEVDTVTWTLCGTPDYIAPEVIATKP 214

Query: 205 YEGFSSDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQKGEFEMPDDDEITKEAQDLL 264
           Y   S D WS G+++F +L G  PF   D        K+ +G+   P       +  DLL
Sbjct: 215 YNK-SVDWWSLGILIFEMLAGYTPF--YDATPMKTYEKILQGKVAYP--PFFHPDVVDLL 269

Query: 265 ARLLTVDPSKRI 276
            +L+T D ++R+
Sbjct: 270 CKLITSDLTRRL 281

>KNAG0E00850 Chr5 complement(158992..161127) [2136 bp, 711 aa] {ON}
           Anc_6.31 YMR001C
          Length = 711

 Score =  135 bits (340), Expect = 8e-32,   Method: Compositional matrix adjust.
 Identities = 91/297 (30%), Positives = 151/297 (50%), Gaps = 20/297 (6%)

Query: 1   MSAISSNTVSVIKNNQIGPWKLGETLGSGSTGKVLLASNETTKQQAAVKVISKAVFEAMN 60
           +SA+     S+IK      +  G  LG G   +     +E+ K  AA K ++K   ++  
Sbjct: 73  LSALCKTPPSLIKTRG-RDYHRGHFLGEGGFARCFQIKDESGKIFAA-KTVAKISIKSEK 130

Query: 61  NSESNGDATNALPYNIEQEIIIMKLLNHPNVLRLFDVWETNSDLYLVLEYAEKGELFNML 120
             +            +  EI I K + H NV++  D +E ++++Y++LE    G L  +L
Sbjct: 131 TRK-----------KLLSEIQIHKSMRHFNVVQFIDCFEDDTNVYILLEICPNGSLMELL 179

Query: 121 VERGPLPENEAVRAFRQIIIGISYCHSLGVVHRDLKPEXXXXXXXXXXXXADFGMAALES 180
            +R  + E E      QI   I Y HS  V+HRDLK               DFG+AA+ +
Sbjct: 180 KKRRTVTEPEVRYFMTQICGAIKYMHSRRVIHRDLKLGNIFFDKNYNLKIGDFGLAAVLA 239

Query: 181 EDKLLE-TSCGSPHYAAPEIISGLPYEGFSS--DVWSCGVILFALLTGRLPFDEEDGNIR 237
            D+  + T CG+P+Y APE++ G  + G S   D+WS GV+++ALL G+ PF  +D N+ 
Sbjct: 240 NDRERKYTVCGTPNYIAPEVLMG-KHSGHSYEVDIWSIGVMIYALLIGKPPFQSKDVNM- 297

Query: 238 NLLLKVQKGEFEMPDDDEITKEAQDLLARLLTVDPSKRITIREILKHPLLQK-YPSI 293
            +  +++  +F  P D  I+ EA+ L+  +L+ DP +R +I EI+ +   +  +PS 
Sbjct: 298 -IYERIKNRDFAFPKDKYISNEAKTLIHDILSTDPLERPSIEEIIDYVWFRGIFPSC 353

>TBLA0B03840 Chr2 complement(881914..884490) [2577 bp, 858 aa] {ON}
           Anc_8.676 YPL153C
          Length = 858

 Score =  135 bits (341), Expect = 9e-32,   Method: Compositional matrix adjust.
 Identities = 81/279 (29%), Positives = 140/279 (50%), Gaps = 30/279 (10%)

Query: 24  ETLGSGSTGKVLLASNETTKQQAAVKVISKAVFEAMNNSESNGDATNALPYNIEQEIIIM 83
           E +G G+   V  A   +T +  AVK+I+K   + M N              + +E+ I+
Sbjct: 201 EVVGQGAFATVKKAVERSTGRTFAVKIINKR--KVMGNLSG-----------VTRELEIL 247

Query: 84  KLLNHPNVLRLFDVWETNSDLYLVLEYAEKGELFNMLVERGPLPENEAVRAFRQIIIGIS 143
           + L+HP ++RL   +E     YLV+E+   G+L + +   G + E+      RQI+  ++
Sbjct: 248 RKLDHPRIVRLKGFYEDEESYYLVMEFVSGGDLMDFVAAHGSVGEDAGREITRQILEAVA 307

Query: 144 YCHSLGVVHRDLKPEXXXXXXX--XXXXXADFGMAALESEDKLLETSCGSPHYAAPEIIS 201
           Y H  G+ HRD+KP+               DFG+A ++     ++T CG+  Y APE+IS
Sbjct: 308 YMHEKGISHRDIKPDNILIEQDDPVLVKITDFGLAKVQGNGTFMKTFCGTLAYVAPEVIS 367

Query: 202 G----------LPYEGFSSDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQKGEF-EM 250
           G          + Y     D+WS G +++ +LT  LPF       + L  ++ +G + E 
Sbjct: 368 GKNAATENDDRIEYSSL-VDMWSIGCLVYVILTAHLPF--SGSTQQELYEQINRGSYHEG 424

Query: 251 P-DDDEITKEAQDLLARLLTVDPSKRITIREILKHPLLQ 288
           P  D  +++EA+D +  L+ VDP+ R+T ++ LKH  ++
Sbjct: 425 PLKDYRVSEEARDFIESLIQVDPNNRLTAKDALKHEWIK 463

>SAKL0E01584g Chr5 complement(121830..123917) [2088 bp, 695 aa] {ON}
           highly similar to uniprot|P32562 Saccharomyces
           cerevisiae YMR001C
          Length = 695

 Score =  134 bits (338), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 91/311 (29%), Positives = 164/311 (52%), Gaps = 22/311 (7%)

Query: 1   MSAISSNTVSVIKNNQIGPWKLGETLGSGSTGKVLLASNETTKQQAAVKVISKAVFEAMN 60
           +SA+     S+IK      +  G  LG G   +     +++ K  AA K ++K   ++  
Sbjct: 59  LSALCKTPPSLIKTRG-RDYHRGHFLGEGGFARCFQMKDDSGKIFAA-KTVAKISIKSEK 116

Query: 61  NSESNGDATNALPYNIEQEIIIMKLLNHPNVLRLFDVWETNSDLYLVLEYAEKGELFNML 120
             +            +  EI I K + HPN+++  D +E ++++Y++LE    G L ++L
Sbjct: 117 TRKK-----------LLSEIQIHKSMKHPNIVQFIDCFEDDTNVYILLEICPNGSLMDLL 165

Query: 121 VERGPLPENEAVRAFRQIIIG-ISYCHSLGVVHRDLKPEXXXXXXXXXXXXADFGMAALE 179
            +R  L E E VR F   I+G I Y H+  V+HRDLK               DFG+AA+ 
Sbjct: 166 KKRKVLTEPE-VRYFTTQIVGAIKYMHNRRVIHRDLKLGNIFFDSNYNLKIGDFGLAAVL 224

Query: 180 SEDKLLE-TSCGSPHYAAPEIISGLPYEGFSS--DVWSCGVILFALLTGRLPFDEEDGNI 236
           + D+  + T CG+P+Y APE+++G  + G S   D+WS GV+++ALL G+ PF  ++ NI
Sbjct: 225 ANDRERKYTVCGTPNYIAPEVLAG-KHSGHSYEVDIWSIGVMIYALLIGKPPFQAKEVNI 283

Query: 237 RNLLLKVQKGEFEMPDDDEITKEAQDLLARLLTVDPSKRITIREILKHPLLQK-YPSIKD 295
             +  +++ G++  P +   +KE   L+  +L++DP +R ++ EI+ +   +  +P+  +
Sbjct: 284 --IYERIKSGDYIFPREKPTSKEVMVLIQDILSIDPIERPSLDEIMDYVWFRGIFPARIN 341

Query: 296 SRSIRNLPRED 306
              + ++P  D
Sbjct: 342 GDVLTSVPVYD 352

>KLTH0H04180g Chr8 (381111..382172) [1062 bp, 353 aa] {ON} highly
           similar to uniprot|P06245 Saccharomyces cerevisiae
           YPL203W TPK2 Involved in nutrient control of cell growth
           and division cAMP-dependent protein kinase catalytic
           subunit
          Length = 353

 Score =  129 bits (324), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 78/252 (30%), Positives = 130/252 (51%), Gaps = 18/252 (7%)

Query: 25  TLGSGSTGKVLLASNETTKQQAAVKVISKAVFEAMNNSESNGDATNALPYNIEQEIIIMK 84
           TLG+GS G+V L  +    +  A+KV+ K     M   E   D           E  ++K
Sbjct: 48  TLGTGSFGRVHLVRSVHNGRYYAIKVLKKEQVIRMKQIEHTND-----------ERRMLK 96

Query: 85  LLNHPNVLRLFDVWETNSDLYLVLEYAEKGELFNMLVERGPLPENEAVRAFRQIIIGISY 144
           L++HP ++R++  ++ + +L++V++Y E GELF++L +    P   A     ++I+ + Y
Sbjct: 97  LVDHPFLIRMWGTFQDSRNLFMVMDYIEGGELFSLLRKSQRFPNPVAKFYAAEVILALEY 156

Query: 145 CHSLGVVHRDLKPEXXXXXXXXXXXXADFGMAALESEDKLLETSCGSPHYAAPEIISGLP 204
            H+  +++RDLKPE             DFG A  +  D +  T CG+P Y APE+I+  P
Sbjct: 157 LHAHDIIYRDLKPENILLDRNGHIKITDFGFA--KEVDTVTWTLCGTPDYIAPEVIATKP 214

Query: 205 YEGFSSDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQKGEFEMPDDDEITKEAQDLL 264
           Y   S D WS G+++F +L G  PF   D        K+ +G+   P       +  DLL
Sbjct: 215 YNK-SVDWWSLGILIFEMLAGYTPF--YDATPMKTYEKILQGKVAYP--PFFHPDVVDLL 269

Query: 265 ARLLTVDPSKRI 276
           ++L+T D ++R+
Sbjct: 270 SKLITADLTRRL 281

>CAGL0E05720g Chr5 (569265..570341) [1077 bp, 358 aa] {ON} similar
           to uniprot|P38991 Saccharomyces cerevisiae YPL209c IPL1
           ser/thr protein kinase
          Length = 358

 Score =  129 bits (324), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 80/271 (29%), Positives = 138/271 (50%), Gaps = 18/271 (6%)

Query: 20  WKLGETLGSGSTGKVLLASNETTKQQAAVKVISKAVFEAMNNSESNGDATNALPYNIEQE 79
           +++G  LG G  GKV    ++ +    A+K I K      N           L   +++E
Sbjct: 100 FEVGRKLGKGKFGKVYCVRHKKSGFICALKAIEKNEILQFN-----------LLKQLKRE 148

Query: 80  IIIMKLLNHPNVLRLFDVWETNSDLYLVLEYAEKGELFNMLVERGPLPENEAVRAFRQII 139
           + I   ++HPN+++L+  +     +YL++E++  GEL+  L   GP  +  A     QI 
Sbjct: 149 VDIQLGMDHPNIIKLYAHFHDEKRVYLLMEHSINGELYKSLKNNGPFNDVLASHYIYQIA 208

Query: 140 IGISYCHSLGVVHRDLKPEXXXXXXXXXXXXADFGMAALESEDKLLETSCGSPHYAAPEI 199
             + Y H   ++HRD+KPE            ADFG + L  E    +T CG+  Y +PE+
Sbjct: 209 DALHYMHKKRIIHRDVKPENVLIGFDNVVKLADFGWSILNPEGSKRKTLCGTIDYLSPEM 268

Query: 200 ISGLPYEGFSSDVWSCGVILFALLTGRLPFDEEDGNIRNLLLK-VQKGEFEMPDDDEITK 258
           I+   Y+    DVW+ GV+ + L+ G  PF+E   N + L  K + K +   P  + I+K
Sbjct: 269 ITPREYDE-QVDVWALGVLAYELVVGVPPFEE---NSKELTYKRILKCDLNFP--ESISK 322

Query: 259 EAQDLLARLLTVDPSKRITIREILKHPLLQK 289
           +A+DL+++LL  D ++R+++  +  HP + K
Sbjct: 323 DAKDLISKLLVTDTTQRLSLTGVKTHPWILK 353

>YJL164C Chr10 complement(109966..111159) [1194 bp, 397 aa] {ON}
           TPK1cAMP-dependent protein kinase catalytic subunit;
           promotes vegetative growth in response to nutrients via
           the Ras-cAMP signaling pathway; inhibited by regulatory
           subunit Bcy1p in the absence of cAMP; partially
           redundant with Tpk2p and Tpk3p
          Length = 397

 Score =  130 bits (326), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 76/270 (28%), Positives = 133/270 (49%), Gaps = 23/270 (8%)

Query: 25  TLGSGSTGKVLLASNETTKQQAAVKVISKAVFEAMNNSESNGDATNALPYNIEQEIIIMK 84
           TLG+GS G+V L  +    +  A+KV+ K +   +   E   D           E +++ 
Sbjct: 92  TLGTGSFGRVHLIRSRHNGRYYAMKVLKKEIVVRLKQVEHTND-----------ERLMLS 140

Query: 85  LLNHPNVLRLFDVWETNSDLYLVLEYAEKGELFNMLVERGPLPENEAVRAFRQIIIGISY 144
           ++ HP ++R++  ++    ++++++Y E GELF++L +    P   A     ++ + + Y
Sbjct: 141 IVTHPFIIRMWGTFQDAQQIFMIMDYIEGGELFSLLRKSQRFPNPVAKFYAAEVCLALEY 200

Query: 145 CHSLGVVHRDLKPEXXXXXXXXXXXXADFGMAALESEDKLLETSCGSPHYAAPEIISGLP 204
            HS  +++RDLKPE             DFG A    +  +  T CG+P Y APE++S  P
Sbjct: 201 LHSKDIIYRDLKPENILLDKNGHIKITDFGFAKYVPD--VTYTLCGTPDYIAPEVVSTKP 258

Query: 205 YEGFSSDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQKGEFEMPDDDEITKEAQDLL 264
           Y   S D WS G++++ +L G  PF   D N      K+   E   P      ++ +DLL
Sbjct: 259 YNK-SIDWWSFGILIYEMLAGYTPF--YDSNTMKTYEKILNAELRFP--PFFNEDVKDLL 313

Query: 265 ARLLTVDPSKRI-----TIREILKHPLLQK 289
           +RL+T D S+R+        ++  HP  ++
Sbjct: 314 SRLITRDLSQRLGNLQNGTEDVKNHPWFKE 343

>TPHA0J00420 Chr10 complement(96445..98568) [2124 bp, 707 aa] {ON}
           Anc_6.31 YMR001C
          Length = 707

 Score =  134 bits (337), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 92/296 (31%), Positives = 155/296 (52%), Gaps = 21/296 (7%)

Query: 20  WKLGETLGSGSTGKVLLASNETTKQQAAVKVISKAVFEAMNNSESNGDATNALPYNIEQE 79
           +  G  LG G   +    ++++ K  AA K ++K   ++                 +  E
Sbjct: 83  YHRGHFLGEGGFARCFQFNDDSGKIFAA-KTVAKLSIKSEKTRRK-----------LLSE 130

Query: 80  IIIMKLLNHPNVLRLFDVWETNSDLYLVLEYAEKGELFNMLVERGPLPENEAVRAFRQII 139
           I I K + + N+++  D +E ++++Y++LE    G L ++L +R  L E E VR F   I
Sbjct: 131 IQIHKSMKNVNIVQFIDCFEDDTNVYILLEICPNGSLMDLLKKRKSLTEPE-VRFFTTQI 189

Query: 140 IG-ISYCHSLGVVHRDLKPEXXXXXXXXXXXXADFGMAALESEDKLLE-TSCGSPHYAAP 197
            G I Y HS  V+HRDLK               DFG+AA+ + D+  + T CG+P+Y AP
Sbjct: 190 CGAIKYMHSRRVIHRDLKLGNIFFDKDYNLKIGDFGLAAVLANDRERKYTVCGTPNYIAP 249

Query: 198 EIISGLPYEGFSS--DVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQKGEFEMPDDDE 255
           E++ G  + G S   D+WS GV+L+ALL G+ PF  +D N   +  +++  +F  P D  
Sbjct: 250 EVLMG-KHTGHSYEVDIWSIGVMLYALLIGKPPFQSKDVN--TIYERIKCCDFTFPKDKY 306

Query: 256 ITKEAQDLLARLLTVDPSKRITIREILKHPLLQK-YPSIKDSRSIRNLPREDTYLS 310
           I+ EA+ L+  LL++DP +R ++ EI+ +   +  +P   +S  + N+P  D  L+
Sbjct: 307 ISPEAKILIQDLLSLDPLERPSVDEIIDYVWFRGLFPPQIESDVMTNIPNYDNQLT 362

>TPHA0G01600 Chr7 complement(329313..331850) [2538 bp, 845 aa] {ON}
           Anc_8.676 YPL153C
          Length = 845

 Score =  135 bits (339), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 86/279 (30%), Positives = 142/279 (50%), Gaps = 30/279 (10%)

Query: 24  ETLGSGSTGKVLLASNETTKQQAAVKVISKAVFEAMNNSESNGDATNALPYNIEQEIIIM 83
           E +G G+   V  A   +T +  AVK+ISK   + M N +            + +E+ ++
Sbjct: 201 EVVGQGAFAIVKKAVERSTGKTFAVKIISKR--KVMGNMDG-----------VTRELEVL 247

Query: 84  KLLNHPNVLRLFDVWETNSDLYLVLEYAEKGELFNMLVERGPLPENEAVRAFRQIIIGIS 143
           + L+HP ++RL   +E     YL++E+   G+L + +   G + E+      RQI+  + 
Sbjct: 248 RKLDHPRIVRLKGFYEDEESYYLLMEFVSGGDLMDFVAAHGSVGEDAGREITRQILEAVK 307

Query: 144 YCHSLGVVHRDLKPEXXXXXXX--XXXXXADFGMAALESEDKLLETSCGSPHYAAPEIIS 201
           Y HS  + HRDLKP+               DFG+A ++     ++T CG+  Y APEIIS
Sbjct: 308 YIHSKCISHRDLKPDNILIEQDDPVLVKITDFGLAKVQGNGTFMKTFCGTLAYVAPEIIS 367

Query: 202 G-------LPYEGFSS--DVWSCGVILFALLTGRLPFDEEDGNIRNLLLK-VQKGEF-EM 250
           G            +SS  D+WS G +++ +LTG LPF    G+ +  L K V+ G + E 
Sbjct: 368 GSNNLEENEERNEYSSLVDMWSIGCLVYVILTGHLPF---SGSTQEQLYKQVRNGSYHEG 424

Query: 251 P-DDDEITKEAQDLLARLLTVDPSKRITIREILKHPLLQ 288
           P  D  I+ EA++ +  LL V+P+ R++    L+HP ++
Sbjct: 425 PLKDFRISDEARNFIDSLLQVNPNDRLSAERALQHPWIK 463

>Ecym_2397 Chr2 complement(771343..773961) [2619 bp, 872 aa] {ON}
           similar to Ashbya gossypii ACR142W
          Length = 872

 Score =  135 bits (339), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 87/279 (31%), Positives = 139/279 (49%), Gaps = 30/279 (10%)

Query: 24  ETLGSGSTGKVLLASNETTKQQAAVKVISKAVFEAMNNSESNGDATNALPYNIEQEIIIM 83
           E +G G+   V  A    T +  AVK+ISK   + M N E            + +E+ ++
Sbjct: 194 EVVGQGAFATVKKAVERKTGKTFAVKIISKR--KVMGNVEG-----------VTRELEVL 240

Query: 84  KLLNHPNVLRLFDVWETNSDLYLVLEYAEKGELFNMLVERGPLPENEAVRAFRQIIIGIS 143
             LNHP ++ L   +E     YL++E+   G+L + +   G + E+      RQI+  + 
Sbjct: 241 HRLNHPRIVSLKGFYEDEESYYLLMEFVSGGDLMDFVAAHGSVGEDAGREITRQILEAVK 300

Query: 144 YCHSLGVVHRDLKPEXXXXXXX--XXXXXADFGMAALESEDKLLETSCGSPHYAAPEIIS 201
           Y H   + HRDLKP+               DFG+A ++     ++T CG+  Y APE+I 
Sbjct: 301 YIHQQEISHRDLKPDNILIEQDDPVLVKITDFGLAKIQDNGTFMKTFCGTLAYVAPEVID 360

Query: 202 GLPYEG-------FSS--DVWSCGVILFALLTGRLPFDEEDGNIRNLLL-KVQKGEF-EM 250
           G   E        +SS  D+WS G +++ +LTG LPF    G+ +  L  ++ +G + E 
Sbjct: 361 GKSLEEKSVNKNLYSSLVDMWSIGCLVYVILTGHLPF---SGSTQEQLYEQISRGSYHEG 417

Query: 251 P-DDDEITKEAQDLLARLLTVDPSKRITIREILKHPLLQ 288
           P  D +I+ EA+D +  LL V+P  R+T  + LKHP +Q
Sbjct: 418 PLKDFKISDEARDFIDALLQVNPRDRLTAAKALKHPWIQ 456

>KLTH0H03982g Chr8 complement(363432..364628) [1197 bp, 398 aa] {ON}
           similar to uniprot|P38991 Saccharomyces cerevisiae
           YPL209C IPL1 Aurora kinase involved in regulating
           kinetochore-microtubule attachments associates with
           Sli5p which stimulates Ipl1p kinase activity and
           promotes its association with the mitotic spindle
           potential Cdc28p substrate
          Length = 398

 Score =  129 bits (325), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 69/222 (31%), Positives = 116/222 (52%), Gaps = 9/222 (4%)

Query: 72  LPYNIEQ----EIIIMKLLNHPNVLRLFDVWETNSDLYLVLEYAEKGELFNMLVERGPLP 127
           + YN+E+    E+ I   L HPN+ RL+  +     +YL++EY   GEL+  L   GP  
Sbjct: 177 IQYNVEKQFRREVEIQSSLKHPNLTRLYGYFHDEKRVYLLMEYLVNGELYKHLRSHGPFN 236

Query: 128 ENEAVRAFRQIIIGISYCHSLGVVHRDLKPEXXXXXXXXXXXXADFGMAALESEDKLLET 187
           +  A     Q+   + Y HS  ++HRD+KPE             DFG +     +    T
Sbjct: 237 DIVASHFVYQMADALDYMHSKHIIHRDIKPENILLGFQNTLKLTDFGWSVTNLNNSRRRT 296

Query: 188 SCGSPHYAAPEIISGLPYEGFSSDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQKGE 247
            CG+  Y +PE+I    Y+    DVW+ GV+ + LL G  PF E+   +     ++++ +
Sbjct: 297 LCGTMDYLSPELIKSREYDN-KVDVWALGVLTYELLVGTPPFLEDSKEM--TYKRIKRRD 353

Query: 248 FEMPDDDEITKEAQDLLARLLTVDPSKRITIREILKHPLLQK 289
            + P  D I+ +A+D++++LL  +P+ RI +R++ KHP + K
Sbjct: 354 LKFP--DHISSQARDIISKLLEYEPNARIALRDVKKHPWILK 393

>SAKL0C05368g Chr3 complement(510576..511832) [1257 bp, 418 aa] {ON}
           similar to uniprot|P05986 Saccharomyces cerevisiae
           YKL166C TPK3 Involved in nutrient control of cell growth
           and division cAMP-dependent protein kinase catalytic
           subunit
          Length = 418

 Score =  130 bits (326), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 85/293 (29%), Positives = 140/293 (47%), Gaps = 27/293 (9%)

Query: 25  TLGSGSTGKVLLASNETTKQQAAVKVISKAVFEAMNNSESNGDATNALPYNIEQEIIIMK 84
           TLG+GS G+V L  +    +  A+KV+ K     +   E   D           E  ++ 
Sbjct: 113 TLGTGSFGRVHLVRSNHNGRFYAMKVLKKRTIVKLKQVEHTND-----------ERRMLS 161

Query: 85  LLNHPNVLRLFDVWETNSDLYLVLEYAEKGELFNMLVERGPLPENEAVRAFRQIIIGISY 144
           +++HP  +R++  ++    ++++++Y E GELF++L +    P   A     ++ + + Y
Sbjct: 162 VVSHPFTIRMWGTFQDAQQVFMIMDYIEGGELFSLLRKSQRFPNPVAKFYAAEVCLALEY 221

Query: 145 CHSLGVVHRDLKPEXXXXXXXXXXXXADFGMAALESEDKLLETSCGSPHYAAPEIISGLP 204
            HS+ +++RDLKPE             DFG A    +  +  T CG+P Y APE++S  P
Sbjct: 222 LHSMDIIYRDLKPENILLDKNGHIKLTDFGFAKYVPD--VTYTLCGTPDYIAPEVVSTKP 279

Query: 205 YEGFSSDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQKGEFEMPDDDEITKEAQDLL 264
           Y   S D WS G+++F +L G  PF   D N       +   E + P       +AQDLL
Sbjct: 280 YNK-SVDWWSFGILIFEMLAGYTPF--YDSNTMKTYENILNAELQFP--SIFHPDAQDLL 334

Query: 265 ARLLTVDPSKRI-----TIREILKHPLLQKYPSIKDSRSIRNLPREDTYLSPL 312
            RL+T D SKR+        ++ +HP   +   + D    RN+  E  Y  P+
Sbjct: 335 CRLITRDLSKRLGNLQNGSEDVKRHPWFSE--VVWDKLLCRNI--ETPYEPPI 383

>CAGL0J11638g Chr10 complement(1130744..1132984) [2241 bp, 746 aa]
           {ON} highly similar to uniprot|P32562 Saccharomyces
           cerevisiae YMR001c CDC5 involved in regulation of DNA
           replication
          Length = 746

 Score =  134 bits (337), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 82/268 (30%), Positives = 144/268 (53%), Gaps = 18/268 (6%)

Query: 20  WKLGETLGSGSTGKVLLASNETTKQQAAVKVISKAVFEAMNNSESNGDATNALPYNIEQE 79
           +  G+ LG G   +     +++ K  AA K ++K   ++    +            +  E
Sbjct: 81  YHRGQFLGEGGFARCFQIKDDSGKIFAA-KTVAKISIKSEKTRKK-----------LLSE 128

Query: 80  IIIMKLLNHPNVLRLFDVWETNSDLYLVLEYAEKGELFNMLVERGPLPENEAVRAFRQII 139
           I I K ++H N+++  D +E N ++Y++LE    G L  ++ +R  + E E      QI 
Sbjct: 129 IQIHKSMSHTNIVQFIDCFEDNVNVYILLEICPNGSLMELIKKRKTITEPEVRFFMTQIC 188

Query: 140 IGISYCHSLGVVHRDLKPEXXXXXXXXXXXXADFGMAALESEDKLLE-TSCGSPHYAAPE 198
            GI Y HS  V+HRDLK               DFG+AA+ + D+  + T CG+P+Y APE
Sbjct: 189 GGIQYMHSNRVIHRDLKLGNIFFDEHYNLKIGDFGLAAVLANDRERKFTICGTPNYIAPE 248

Query: 199 IISGLPYEGFSS--DVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQKGEFEMPDDDEI 256
           ++ G  + G S   D+WS GV+L+ALL G+ PF  +D N   +  ++++  F  P D +I
Sbjct: 249 VLMG-KHSGHSYEVDIWSIGVMLYALLIGKPPFQAKDVN--TIYERIKQRNFAYPKDKKI 305

Query: 257 TKEAQDLLARLLTVDPSKRITIREILKH 284
           +++A+ L+  +L+++P +R +I+EI+ +
Sbjct: 306 SQDAKYLIDDILSLNPMERPSIQEIMDY 333

>ZYRO0A07546g Chr1 complement(619278..620747,620833..620847) [1485
           bp, 494 aa] {ON} highly similar to uniprot|P39009
           Saccharomyces cerevisiae YDL101C DUN1 Cell-cycle
           checkpoint serine- threonine kinase required for DNA
           damage-induced transcription of certain target genes
           phosphorylation of Rad55p and Sml1p and transient G2/M
           arrest after DNA damage also regulates postreplicative
           DNA repair
          Length = 494

 Score =  131 bits (330), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 89/295 (30%), Positives = 139/295 (47%), Gaps = 39/295 (13%)

Query: 20  WKLGETLGSGSTGKVLLASNETTKQQAAVKVISKAVFEAMNNSESNGDATNALPYNIEQE 79
           + L   LGSG    V    N+ T +  AVK+          + + N D   +  +  E  
Sbjct: 182 YLLERELGSGHYATVKEGINKKTGEVVAVKIF---------HPQQNDDQKKSNQFREETN 232

Query: 80  IIIMKLLNHPNVLRLFD-----VWETNSDLYLVLEYAEKGELFNMLVERGPLPENEAVRA 134
           I++   ++HPN++++ D     V ++    YLVLE    GELF+ +V++  L +NE    
Sbjct: 233 ILMR--VHHPNIVKMLDSFVEPVSKSQIQKYLVLEKINDGELFDRIVKKVCLRQNETQAL 290

Query: 135 FRQIIIGISYCHSLGVVHRDLKPEXXXXXXX-------------------XXXXXADFGM 175
           F+QI+ GI + HS  ++HRD+KPE                               ADFG+
Sbjct: 291 FKQILEGIKHLHSQNIIHRDIKPENILLNITRRQSPNEMQLGPWDQDEIDVQVKIADFGL 350

Query: 176 AALESEDKLLETSCGSPHYAAPEIISGLPYEGFSSDVWSCGVILFALLTGRLPFDEEDG- 234
           A    E +   T CG+P Y APE++    Y     D+WS GV+L+  L G  PF +  G 
Sbjct: 351 AKFTGEIQFTNTLCGTPSYVAPEVLLKSDYSS-KVDMWSAGVLLYVCLCGFPPFSDSLGP 409

Query: 235 -NIRNLLLKVQKGEFEMPDDDEITKEAQDLLARLLTVDPSKRITIREILKHPLLQ 288
            ++R  +L+  K  F  P  DEI      L++ LL V+ S+R ++ E + HP  +
Sbjct: 410 PSMREQILQ-GKFAFYSPYWDEIDDSVLHLISNLLVVNASERFSVVETMNHPWFR 463

>Smik_10.66 Chr10 complement(108043..109236) [1194 bp, 397 aa] {ON}
           YJL164C (REAL)
          Length = 397

 Score =  129 bits (324), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 76/270 (28%), Positives = 133/270 (49%), Gaps = 23/270 (8%)

Query: 25  TLGSGSTGKVLLASNETTKQQAAVKVISKAVFEAMNNSESNGDATNALPYNIEQEIIIMK 84
           TLG+GS G+V L  +    +  A+KV+ K +   +   E   D           E +++ 
Sbjct: 92  TLGTGSFGRVHLIRSRHNGRYYAMKVLKKEIVVRLKQVEHTND-----------ERLMLS 140

Query: 85  LLNHPNVLRLFDVWETNSDLYLVLEYAEKGELFNMLVERGPLPENEAVRAFRQIIIGISY 144
           ++ HP ++R++  ++    ++++++Y E GELF++L +    P   A     ++ + + Y
Sbjct: 141 IVTHPFIIRMWGTFQDAQQIFMIMDYIEGGELFSLLRKSQRFPNPVAKFYAAEVCLALEY 200

Query: 145 CHSLGVVHRDLKPEXXXXXXXXXXXXADFGMAALESEDKLLETSCGSPHYAAPEIISGLP 204
            HS  +++RDLKPE             DFG A    +  +  T CG+P Y APE++S  P
Sbjct: 201 LHSKDIIYRDLKPENILLDKNGHIKITDFGFAKYVPD--VTYTLCGTPDYIAPEVVSTKP 258

Query: 205 YEGFSSDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQKGEFEMPDDDEITKEAQDLL 264
           Y   S D WS G++++ +L G  PF   D N      K+   E   P      ++ +DLL
Sbjct: 259 YNK-SIDWWSFGILIYEMLAGYTPF--YDSNTMKTYEKILNAELRFP--PFFNEDVKDLL 313

Query: 265 ARLLTVDPSKRI-----TIREILKHPLLQK 289
           +RL+T D S+R+        ++  HP  ++
Sbjct: 314 SRLITRDLSQRLGNLQNGTEDVKNHPWFKE 343

>KNAG0A05670 Chr1 complement(847460..849016) [1557 bp, 518 aa] {ON}
           Anc_2.352 YDL101C
          Length = 518

 Score =  131 bits (330), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 85/295 (28%), Positives = 134/295 (45%), Gaps = 39/295 (13%)

Query: 20  WKLGETLGSGSTGKVLLASNETTKQQAAVKVISKAVFEAMNNSESNGDATNALPYNIEQE 79
           + LG+ LG+G    V   +N+ T    AVK+     F+   N +              +E
Sbjct: 205 YLLGKELGAGHYAIVKEGTNKATGDTVAVKI-----FQPQQNDDEKKSK------QFREE 253

Query: 80  IIIMKLLNHPNVLRLFDVW-----ETNSDLYLVLEYAEKGELFNMLVERGPLPENEAVRA 134
             I+  ++HPN++ + D +     +     YLVLE  + GELF  +V++  L ++E    
Sbjct: 254 TSILMSIHHPNIVNMLDSFVEPLNKAQIQKYLVLEKVDDGELFERIVKKTSLRQDETKAI 313

Query: 135 FRQIIIGISYCHSLGVVHRDLKPEXXXXXXXXXXX-------------------XADFGM 175
           F+QI+ G+ Y H   ++HRD+KPE                               ADFG+
Sbjct: 314 FQQIMTGLKYLHGQNIIHRDIKPENILLNITRRTSPVQIQSGPWDEDEIDIKVKIADFGL 373

Query: 176 AALESEDKLLETSCGSPHYAAPEIISGLPYEGFSSDVWSCGVILFALLTGRLPFDEEDG- 234
           A    E +   T CG+P Y APE++    Y+    D+WS GVIL+  L G  PF ++ G 
Sbjct: 374 AKFTGEMQFANTLCGTPSYVAPEVLMKTEYDA-KVDMWSAGVILYVCLCGFPPFSDQLGP 432

Query: 235 -NIRNLLLKVQKGEFEMPDDDEITKEAQDLLARLLTVDPSKRITIREILKHPLLQ 288
            +++  +L+  K  F  P  D I      L++ LL  DP KR  +  +  H  +Q
Sbjct: 433 PSLKEQILQA-KYAFYTPYWDNIDDSILHLISNLLVRDPKKRYDVDAVFAHQWMQ 486

>KAFR0K00330 Chr11 (74162..75283) [1122 bp, 373 aa] {ON} Anc_6.214
           YPL203W
          Length = 373

 Score =  128 bits (322), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 93/324 (28%), Positives = 152/324 (46%), Gaps = 24/324 (7%)

Query: 20  WKLGETLGSGSTGKVLLASNETTKQQAAVKVISKAVFEAMNNSESNGDATNALPYNIEQE 79
           +++  TLG+GS G+V L  +    +  A+KV+ K     M   E   D           E
Sbjct: 63  FQIMRTLGTGSFGRVHLVRSVHNGRYYAIKVLKKQQIVKMKQIEHTND-----------E 111

Query: 80  IIIMKLLNHPNVLRLFDVWETNSDLYLVLEYAEKGELFNMLVERGPLPENEAVRAFRQII 139
             ++KL+ HP ++R++  ++ +++L++V++Y E GELF++L +    P   A     +++
Sbjct: 112 RRMLKLVEHPFLIRMWGTFQDSNNLFMVMDYIEGGELFSLLRKSQRFPNPVAKFYAAEVV 171

Query: 140 IGISYCHSLGVVHRDLKPEXXXXXXXXXXXXADFGMAALESEDKLLETSCGSPHYAAPEI 199
           + + Y H   +++RDLKPE             DFG A  +    +  T CG+P Y APE+
Sbjct: 172 LALEYLHFNNIIYRDLKPENILLDRNGHIKITDFGFA--KEVTTVTWTLCGTPDYIAPEV 229

Query: 200 ISGLPYEGFSSDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQKGEFEMPDDDEITKE 259
           I+  PY   S D WS G++++ +L G  PF   D        K+  G    P       +
Sbjct: 230 IATKPYNK-SVDWWSLGILIYEMLAGYTPF--YDTTPMKTYEKILHGRVTYP--SFFNSD 284

Query: 260 AQDLLARLLTVDPSKRI-----TIREILKHPLLQKYPSIKDSRSIRNLPREDTYLSPLAD 314
             DLL++L+T D ++RI       +EI  HP   +    K        P E   +S + D
Sbjct: 285 VVDLLSKLITADLTRRIGNLQNGTQEIKSHPWFSEVVWEKLLSKDIETPYEPPIVSGVGD 344

Query: 315 TNSKIDDAILQNLVILWHGKDARE 338
           T S  D    + L    HG+D  E
Sbjct: 345 T-SLFDQYPEERLNYGIHGEDPYE 367

>NDAI0A00960 Chr1 complement(197205..198431) [1227 bp, 408 aa] {ON}
           Anc_1.182
          Length = 408

 Score =  129 bits (323), Expect = 4e-31,   Method: Compositional matrix adjust.
 Identities = 77/257 (29%), Positives = 130/257 (50%), Gaps = 18/257 (7%)

Query: 20  WKLGETLGSGSTGKVLLASNETTKQQAAVKVISKAVFEAMNNSESNGDATNALPYNIEQE 79
           +++  TLG+GS G+V L  +    +  A+KVI K     +   E   D           E
Sbjct: 98  FQIMRTLGTGSFGRVHLVRSIHNGRFYALKVIKKNTVVRLKQIEHTND-----------E 146

Query: 80  IIIMKLLNHPNVLRLFDVWETNSDLYLVLEYAEKGELFNMLVERGPLPENEAVRAFRQII 139
             ++ ++NHP ++R++  ++ +  ++++++Y E GELF++L      P   A     ++ 
Sbjct: 147 RRMLSVVNHPFLVRMWGTFQDSEQIFMIMDYIEGGELFSLLRRSQKFPNPVAKFYAAEVC 206

Query: 140 IGISYCHSLGVVHRDLKPEXXXXXXXXXXXXADFGMAALESEDKLLETSCGSPHYAAPEI 199
           + + Y HSL +++RDLKPE             DFG A    +  +  T CG+P Y APE+
Sbjct: 207 LALEYLHSLDIIYRDLKPENILLDKNGHIKITDFGFAKYVPD--VTYTLCGTPDYIAPEV 264

Query: 200 ISGLPYEGFSSDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQKGEFEMPDDDEITKE 259
           +S  PY   S D WS G++++ +L+GR PF   D +       +       P    + ++
Sbjct: 265 VSSKPYNK-SVDWWSFGILIYEMLSGRTPF--YDRSTIKTYENILSAPLTFP--SYLHED 319

Query: 260 AQDLLARLLTVDPSKRI 276
            QDLL RL+T D SKR+
Sbjct: 320 VQDLLNRLITRDLSKRL 336

>Suva_6.245 Chr6 (438131..439315) [1185 bp, 394 aa] {ON} YJL164C
           (REAL)
          Length = 394

 Score =  129 bits (323), Expect = 4e-31,   Method: Compositional matrix adjust.
 Identities = 78/273 (28%), Positives = 134/273 (49%), Gaps = 29/273 (10%)

Query: 25  TLGSGSTGKVLLASNETTKQQAAVKVISKAVFEAMNNSESNGDATNALPYNIEQEIIIMK 84
           TLG+GS G+V L  +    +  A+KV+ K +   +   E   D           E +++ 
Sbjct: 89  TLGTGSFGRVHLIRSRHNGRYYAMKVLKKEIVVRLKQVEHTND-----------ERLMLS 137

Query: 85  LLNHPNVLRLFDVWETNSDLYLVLEYAEKGELFNMLVERGPLPENEAVRAFRQIIIGISY 144
           ++ HP ++R++  ++    ++++++Y E GELF++L +    P   A     ++ + + Y
Sbjct: 138 IVTHPFIIRMWGTFQDAQQIFMIMDYIEGGELFSLLRKSQRFPNPVAKFYAAEVCLALEY 197

Query: 145 CHSLGVVHRDLKPEXXXXXXXXXXXXADFGMAALESEDKLLETSCGSPHYAAPEIISGLP 204
            HS  +++RDLKPE             DFG A    +  +  T CG+P Y APE++S  P
Sbjct: 198 LHSKDIIYRDLKPENILLDKNGHVKITDFGFAKYVPD--VTYTLCGTPDYIAPEVVSTKP 255

Query: 205 YEGFSSDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQKGEFEMP---DDDEITKEAQ 261
           Y   S D WS G++++ +L G  PF   D N      K+   E   P   +DD      +
Sbjct: 256 YNK-SIDWWSFGILIYEMLAGYTPF--YDSNTMKTYEKILNAELRFPPFFNDD-----VK 307

Query: 262 DLLARLLTVDPSKRI-----TIREILKHPLLQK 289
           DLL+RL+T D S+R+        ++  HP  ++
Sbjct: 308 DLLSRLITRDLSQRLGNLQNGTEDVKNHPWFKE 340

>KLLA0C06138g Chr3 (540409..542535) [2127 bp, 708 aa] {ON} similar
           to uniprot|P32562 Saccharomyces cerevisiae YMR001C
          Length = 708

 Score =  133 bits (334), Expect = 4e-31,   Method: Compositional matrix adjust.
 Identities = 77/232 (33%), Positives = 131/232 (56%), Gaps = 7/232 (3%)

Query: 79  EIIIMKLLNHPNVLRLFDVWETNSDLYLVLEYAEKGELFNMLVERGPLPENEAVRAFRQI 138
           EI I K + HPN+++  D +E ++++Y++LE    G +  +L +R  L E E      QI
Sbjct: 137 EIQIHKSMKHPNIVQFTDCFEDDTNVYILLEICPNGSVMELLRQRKHLTEPEVRFCMIQI 196

Query: 139 IIGISYCHSLGVVHRDLKPEXXXXXXXXXXXXADFGMAALESEDKLLE-TSCGSPHYAAP 197
           I  I Y HS  V+HRDLK               DFG+AA+ + DK  + T CG+P+Y AP
Sbjct: 197 IGAIRYMHSRRVIHRDLKLGNIFFDKEYNLKIGDFGLAAVLANDKERKYTICGTPNYIAP 256

Query: 198 EIISGLPYEGFSS--DVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQKGEFEMPDDDE 255
           E+++G  + G S   D+WS GV+L+ALL G+ PF  ++  +  +  +++  +F  P D  
Sbjct: 257 EVLTG-KHTGHSYEVDIWSIGVMLYALLFGKPPFQAKE--VETIYERIKCRDFIFPADKP 313

Query: 256 ITKEAQDLLARLLTVDPSKRITIREILKHPLLQK-YPSIKDSRSIRNLPRED 306
           ++ +A++L++ LL ++P+ R ++ EI  +   +  +PS   S   + +P  D
Sbjct: 314 VSSDAKNLISHLLQLNPAARPSLYEITDNVWFRNTFPSRLPSTITKEIPNFD 365

>TDEL0G02820 Chr7 complement(543911..545377,545450..545476) [1494
           bp, 497 aa] {ON} Anc_2.352 YDL101C
          Length = 497

 Score =  130 bits (327), Expect = 5e-31,   Method: Compositional matrix adjust.
 Identities = 85/294 (28%), Positives = 138/294 (46%), Gaps = 39/294 (13%)

Query: 20  WKLGETLGSGSTGKVLLASNETTKQQAAVKVISKAVFEAMNNSESNGDATNALPYNIEQE 79
           + +G+ LG G    V    N+ T+Q  A+K+     F    N +   +         ++E
Sbjct: 181 YVVGKELGVGHYATVKEGINKKTEQIVAIKI-----FHPQLNDDQKKNK------QFKEE 229

Query: 80  IIIMKLLNHPNVLRLFDVW-ETNS----DLYLVLEYAEKGELFNMLVERGPLPENEAVRA 134
             I+  + H N+++L D + ET S      YLVLE  + GELF+ ++ +  L ++E    
Sbjct: 230 TDILMRVKHSNIVKLLDSYVETVSKSQIQKYLVLEKIDDGELFDRILRKTSLRQDETKAL 289

Query: 135 FRQIIIGISYCHSLGVVHRDLKPEXXXXXXXX-------------------XXXXADFGM 175
           F+QI+ G+ Y H + ++HRD+KPE                               ADFG+
Sbjct: 290 FKQILTGLQYLHGMNIIHRDIKPENILLNITKRSDPKELQKGPWDADEIDIQVKIADFGL 349

Query: 176 AALESEDKLLETSCGSPHYAAPEIISGLPYEGFSSDVWSCGVILFALLTGRLPFDEEDGN 235
           A    E +   T CG+P Y APE++    Y     D+WS GV+L+  L G  PF +  G 
Sbjct: 350 AKFTGEMQFTNTLCGTPSYVAPEVLRKTDYSS-KVDMWSAGVLLYVCLCGFPPFSDTLGP 408

Query: 236 IRNLLLKVQKGEFEM--PDDDEITKEAQDLLARLLTVDPSKRITIREILKHPLL 287
             +L  ++ +G F    P  DEI      L++ LL V+P+ R ++ + ++HP  
Sbjct: 409 -PSLKEQIAQGIFAFYSPYWDEIDDSVLHLISHLLVVNPTNRYSVEDTIRHPWF 461

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.311    0.128    0.346 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 101,948,815
Number of extensions: 4308720
Number of successful extensions: 25606
Number of sequences better than 10.0: 2400
Number of HSP's gapped: 22220
Number of HSP's successfully gapped: 2839
Length of query: 1103
Length of database: 53,481,399
Length adjustment: 120
Effective length of query: 983
Effective length of database: 39,721,479
Effective search space: 39046213857
Effective search space used: 39046213857
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.8 bits)
S2: 71 (32.0 bits)